BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21068_g1_i1 len=911 path=[954:0-369 1324:370-570 1525:571-572
1527:573-752 1707:753-774 1729:775-910]

Length=911
                                                                      Score     E

ref|XP_002284391.1|  PREDICTED: protein Mpv17 isoform X1                279   4e-90   Vitis vinifera
emb|CDP03325.1|  unnamed protein product                                278   2e-89   
ref|XP_011081831.1|  PREDICTED: protein Mpv17-like                      273   7e-88   
ref|XP_007012047.1|  Peroxisomal membrane 22 kDa (Mpv17/PMP22) fa...    273   9e-88   
ref|XP_009374024.1|  PREDICTED: PXMP2/4 family protein 2                273   2e-87   
gb|KHG18961.1|  PXMP2/4 family protein 2                                272   3e-87   
ref|XP_008337377.1|  PREDICTED: PXMP2/4 family protein 2                271   4e-87   
ref|XP_007202554.1|  hypothetical protein PRUPE_ppa011241mg             271   6e-87   
ref|XP_009355419.1|  PREDICTED: PXMP2/4 family protein 2-like           271   1e-86   
gb|KDO48887.1|  hypothetical protein CISIN_1g027783mg                   270   2e-86   
ref|XP_006418722.1|  hypothetical protein EUTSA_v10002655mg             270   3e-86   
ref|XP_008242659.1|  PREDICTED: PXMP2/4 family protein 2 isoform X1     270   3e-86   
ref|XP_009371457.1|  PREDICTED: PXMP2/4 family protein 2-like           270   3e-86   
gb|KFK39778.1|  hypothetical protein AALP_AA3G286400                    269   4e-86   
gb|KDO48888.1|  hypothetical protein CISIN_1g027783mg                   268   8e-86   
ref|XP_006451173.1|  hypothetical protein CICLE_v10009440mg             268   9e-86   
ref|XP_004251193.1|  PREDICTED: protein Mpv17                           268   1e-85   
ref|XP_006340270.1|  PREDICTED: protein Mpv17-like                      267   2e-85   
ref|XP_010103049.1|  PXMP2/4 family protein 2                           268   2e-85   
ref|XP_011088955.1|  PREDICTED: protein Mpv17-like                      267   3e-85   
gb|EYU29265.1|  hypothetical protein MIMGU_mgv1a013630mg                266   3e-85   
gb|KDP34215.1|  hypothetical protein JCGZ_07786                         267   3e-85   
ref|XP_006475631.1|  PREDICTED: PXMP2/4 family protein 2-like iso...    266   4e-85   
emb|CDX93025.1|  BnaA03g37470D                                          267   4e-85   
ref|XP_009627762.1|  PREDICTED: protein Mpv17                           266   6e-85   
ref|XP_010249717.1|  PREDICTED: protein Mpv17                           266   8e-85   
ref|XP_010488566.1|  PREDICTED: PXMP2/4 family protein 2-like           266   8e-85   
ref|XP_008220028.1|  PREDICTED: protein Mpv17-like isoform X1           266   8e-85   
ref|XP_007013158.1|  Peroxisomal membrane 22 kDa (Mpv17/PMP22) fa...    266   9e-85   
ref|XP_010513603.1|  PREDICTED: PXMP2/4 family protein 2-like           266   9e-85   
ref|XP_006298493.1|  hypothetical protein CARUB_v10014569mg             266   1e-84   
ref|XP_009783726.1|  PREDICTED: protein Mpv17                           265   1e-84   
ref|XP_002885656.1|  hypothetical protein ARALYDRAFT_479971             265   1e-84   
ref|XP_003544665.1|  PREDICTED: PXMP2/4 family protein 2 isoform 1      264   3e-84   
ref|XP_009136077.1|  PREDICTED: PXMP2/4 family protein 2-like           264   5e-84   
ref|XP_010093531.1|  PXMP2/4 family protein 2                           263   9e-84   
ref|XP_010466872.1|  PREDICTED: PXMP2/4 family protein 2-like           263   1e-83   
ref|XP_010527210.1|  PREDICTED: PXMP2/4 family protein 2-like iso...    263   1e-83   
ref|XP_010527208.1|  PREDICTED: PXMP2/4 family protein 2-like iso...    263   2e-83   
ref|NP_189100.1|  Peroxisomal membrane 22 kDa (Mpv17/PMP22) famil...    263   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010667863.1|  PREDICTED: protein sym-1                           262   2e-83   
dbj|BAF00872.1|  hypothetical protein                                   263   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550867.1|  PREDICTED: protein Mpv17-like                      262   2e-83   
gb|AAR20751.1|  At3g24570                                               263   3e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043474.1|  PREDICTED: protein Mpv17 isoform X2                261   4e-83   
ref|XP_002284227.1|  PREDICTED: protein Mpv17                           261   4e-83   Vitis vinifera
ref|XP_007226753.1|  hypothetical protein PRUPE_ppa018859mg             261   5e-83   
ref|XP_011043473.1|  PREDICTED: protein Mpv17 isoform X1                261   7e-83   
emb|CAN61516.1|  hypothetical protein VITISV_033965                     261   9e-83   Vitis vinifera
emb|CDX77411.1|  BnaA07g05490D                                          261   1e-82   
ref|XP_009102493.1|  PREDICTED: PXMP2/4 family protein 2 isoform X1     260   1e-82   
ref|XP_008393897.1|  PREDICTED: protein SYM1-like                       259   3e-82   
ref|XP_004287433.1|  PREDICTED: PXMP2/4 family protein 2-like           259   3e-82   
ref|XP_010049080.1|  PREDICTED: protein Mpv17-like                      258   6e-82   
ref|XP_002516574.1|  mpv17, putative                                    258   1e-81   Ricinus communis
ref|XP_004498538.1|  PREDICTED: PXMP2/4 family protein 2-like           257   1e-81   
gb|KHG09812.1|  PXMP2/4 family protein 2                                257   3e-81   
ref|XP_009367921.1|  PREDICTED: protein SYM1-like                       256   8e-81   
ref|XP_007135879.1|  hypothetical protein PHAVU_010G165700g             255   9e-81   
ref|XP_010254106.1|  PREDICTED: protein Mpv17-like                      258   1e-80   
ref|XP_002324248.2|  hypothetical protein POPTR_0018s00810g             255   2e-80   Populus trichocarpa [western balsam poplar]
gb|KDP33682.1|  hypothetical protein JCGZ_07253                         254   2e-80   
ref|XP_002324994.1|  peroxisomal membrane 22 kDa family protein         255   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_004503440.1|  PREDICTED: protein SYM1-like                       254   3e-80   
ref|XP_010049672.1|  PREDICTED: protein sym-1                           254   3e-80   
ref|XP_008795056.1|  PREDICTED: protein Mpv17 isoform X1                253   6e-80   
ref|XP_011026578.1|  PREDICTED: protein Mpv17-like                      253   1e-79   
ref|XP_003588541.1|  Protein Mpv17                                      250   8e-79   
ref|XP_010915812.1|  PREDICTED: protein Mpv17 isoform X1                249   2e-78   
ref|XP_010915813.1|  PREDICTED: protein Mpv17 isoform X2                249   2e-78   
ref|XP_004139343.1|  PREDICTED: PXMP2/4 family protein 2-like           249   2e-78   
ref|XP_008458377.1|  PREDICTED: protein Mpv17                           249   2e-78   
ref|XP_002514294.1|  mpv17, putative                                    249   3e-78   Ricinus communis
gb|KHN43686.1|  Protein sym-1                                           248   5e-78   
gb|AFK43334.1|  unknown                                                 248   6e-78   
ref|XP_006450623.1|  hypothetical protein CICLE_v10009403mg             248   6e-78   
gb|KHG20325.1|  PXMP2/4 family protein 2                                248   8e-78   
gb|ACJ83986.1|  unknown                                                 247   1e-77   Medicago truncatula
ref|XP_004291212.1|  PREDICTED: PXMP2/4 family protein 2-like           247   2e-77   
gb|KDO79717.1|  hypothetical protein CISIN_1g041783mg                   246   4e-77   
ref|XP_003543277.1|  PREDICTED: protein Mpv17-like                      245   1e-76   
emb|CDY50613.1|  BnaC03g44040D                                          245   1e-76   
ref|XP_003630794.1|  Protein SYM1                                       243   5e-76   
ref|XP_009413818.1|  PREDICTED: protein Mpv17                           243   7e-76   
gb|AFK36378.1|  unknown                                                 242   2e-75   
gb|ABK27083.1|  unknown                                                 241   3e-75   Picea sitchensis
ref|XP_007013157.1|  Peroxisomal membrane 22 kDa family protein i...    241   2e-74   
ref|XP_002457081.1|  hypothetical protein SORBIDRAFT_03g000970          234   3e-72   Sorghum bicolor [broomcorn]
ref|NP_001151871.1|  mpv17 protein                                      234   4e-72   Zea mays [maize]
ref|XP_002986637.1|  hypothetical protein SELMODRAFT_124507             232   1e-71   
ref|NP_001189964.1|  Peroxisomal membrane 22 kDa (Mpv17/PMP22) fa...    231   2e-71   
ref|XP_002990770.1|  hypothetical protein SELMODRAFT_132224             231   6e-71   
gb|ACG28641.1|  mpv17 protein                                           230   1e-70   Zea mays [maize]
ref|XP_006643936.1|  PREDICTED: protein Mpv17-like                      227   1e-69   
ref|XP_003565929.1|  PREDICTED: protein Mpv17                           225   5e-69   
gb|EEC70229.1|  hypothetical protein OsI_00998                          222   1e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001042476.1|  Os01g0228300                                       222   1e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010656323.1|  PREDICTED: PXMP2/4 family protein 4 isoform X2     221   2e-67   
ref|XP_008220029.1|  PREDICTED: PXMP2/4 family protein 4-like iso...    217   3e-66   
ref|XP_008230052.1|  PREDICTED: PXMP2/4 family protein 4-like           211   6e-64   
ref|XP_008795057.1|  PREDICTED: protein Mpv17 isoform X2                209   3e-63   
gb|KDO48890.1|  hypothetical protein CISIN_1g027783mg                   209   3e-63   
ref|XP_009102494.1|  PREDICTED: PXMP2/4 family protein 2 isoform X2     209   5e-63   
gb|KDO48889.1|  hypothetical protein CISIN_1g027783mg                   207   1e-62   
ref|XP_006451172.1|  hypothetical protein CICLE_v10009440mg             207   2e-62   
emb|CDY39538.1|  BnaC07g07060D                                          209   6e-62   
ref|XP_001756423.1|  predicted protein                                  206   2e-61   
ref|XP_007012049.1|  Peroxisomal membrane 22 kDa (Mpv17/PMP22) fa...    191   1e-56   
gb|ACH73030.1|  hypothetical protein                                    189   2e-55   Ziziphus jujuba [Chinese jujube]
ref|XP_008798737.1|  PREDICTED: PXMP2/4 family protein 4-like iso...    185   6e-54   
ref|XP_008798664.1|  PREDICTED: PXMP2/4 family protein 4-like iso...    185   7e-54   
ref|XP_002986651.1|  hypothetical protein SELMODRAFT_446690             182   6e-52   
ref|XP_002990761.1|  hypothetical protein SELMODRAFT_448158             181   1e-51   
dbj|BAJ90837.1|  predicted protein                                      179   2e-51   
ref|XP_006382060.1|  hypothetical protein POPTR_0006s25930g             177   7e-51   
ref|XP_010497744.1|  PREDICTED: protein SYM1-like                       171   3e-49   
ref|XP_006833304.1|  hypothetical protein AMTR_s00109p00044680          171   6e-49   
ref|XP_010541768.1|  PREDICTED: PXMP2/4 family protein 2-like           168   8e-48   
ref|XP_008798511.1|  PREDICTED: PXMP2/4 family protein 4-like iso...    170   8e-48   
ref|XP_008798587.1|  PREDICTED: PXMP2/4 family protein 4-like iso...    169   9e-48   
gb|EPS72405.1|  hypothetical protein M569_02354                         167   1e-47   
ref|XP_005650792.1|  hypothetical protein COCSUDRAFT_21583              159   3e-43   
gb|EMT29019.1|  Protein SYM1                                            153   8e-41   
ref|XP_005847416.1|  hypothetical protein CHLNCDRAFT_134283             151   2e-40   
gb|KDD76330.1|  hypothetical protein H632_c266p1                        146   1e-37   
ref|XP_010490117.1|  PREDICTED: protein SYM1-like                       138   1e-36   
gb|KHN41635.1|  Hypothetical protein glysoja_036379                     134   3e-35   
ref|XP_007161548.1|  hypothetical protein PHAVU_001G078700g             140   6e-35   
ref|XP_001695053.1|  predicted protein                                  132   3e-33   Chlamydomonas reinhardtii
ref|XP_002956332.1|  hypothetical protein VOLCADRAFT_107170             130   4e-32   
ref|XP_001695054.1|  predicted protein                                  126   3e-30   Chlamydomonas reinhardtii
ref|XP_001594898.1|  hypothetical protein SS1G_04706                    108   9e-25   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_002956281.1|  hypothetical protein VOLCADRAFT_121508             110   2e-24   
ref|XP_001560976.1|  hypothetical protein BC1G_00061                    105   9e-24   Botrytis cinerea B05.10
emb|CEG67381.1|  hypothetical protein RMATCC62417_03819                 105   3e-23   
emb|CEJ01706.1|  hypothetical protein RMCBS344292_15728                 105   5e-23   
ref|XP_006673361.1|  integral membrane protein, Mpv17/PMP22 famil...    103   6e-23   
emb|CEG84574.1|  hypothetical protein RMATCC62417_18355                 104   6e-23   
ref|XP_009216843.1|  hypothetical protein GGTG_00828                    103   7e-23   
ref|XP_380906.1|  hypothetical protein FG00730.1                        102   1e-22   Fusarium graminearum PH-1
ref|XP_001220940.1|  hypothetical protein CHGG_01719                    103   1e-22   Chaetomium globosum CBS 148.51
ref|XP_006814766.1|  PREDICTED: protein Mpv17-like                      102   2e-22   
gb|KFM27615.1|  Protein SYM1                                            102   2e-22   
ref|XP_009252794.1|  hypothetical protein FPSE_01399                    102   2e-22   
gb|KFH70427.1|  hypothetical protein MVEG_03277                         101   4e-22   
emb|CCE35176.1|  probable glomerulosclerosis protein Mpv17              101   4e-22   
gb|ESZ98317.1|  hypothetical protein SBOR_1310                          101   4e-22   
ref|XP_009523526.1|  hypothetical protein PHYSODRAFT_359986             101   6e-22   
ref|XP_003002638.1|  SYM1                                               100   7e-22   
ref|XP_007594041.1|  sym-1                                              100   7e-22   
ref|XP_003656540.1|  hypothetical protein THITE_2121301                 100   7e-22   
ref|XP_002908286.1|  conserved hypothetical protein                     101   8e-22   
emb|CCF32955.1|  sym-1                                                  100   1e-21   
gb|EWG94415.1|  Sym1p                                                 99.8    2e-21   
ref|XP_002838969.1|  hypothetical protein                             99.8    2e-21   Tuber melanosporum Mel28
gb|EPE06672.1|  integral membrane mpv17 pmp22                         99.0    3e-21   
ref|XP_009657846.1|  SYM1 protein                                     98.6    4e-21   
ref|XP_003678385.1|  hypothetical protein NCAS_0J00670                99.4    4e-21   
gb|EDZ70530.1|  YLR251Wp-like protein                                 99.0    4e-21   Saccharomyces cerevisiae AWRI1631
ref|XP_007833748.1|  Protein sym-1                                    98.2    4e-21   
ref|NP_013352.1|  Sym1p                                               99.0    4e-21   Saccharomyces cerevisiae S288C
ref|XP_005535986.1|  similar to peroxisomal membrane protein PMP22      100   5e-21   
gb|EFQ30791.1|  Mpv17/PMP22 family protein                            97.8    5e-21   
ref|XP_007753564.1|  protein sym1                                     97.8    5e-21   
ref|XP_008601247.1|  Mpv17/PMP22 family protein                       97.8    6e-21   
gb|EGU89103.1|  hypothetical protein FOXB_00376                       97.8    7e-21   
ref|XP_004337490.1|  peroxisomal membrane 22 kDa family protein       99.0    8e-21   
ref|XP_008890629.1|  hypothetical protein PPTG_00827                  98.2    9e-21   
gb|EXM30510.1|  protein SYM1                                          97.4    9e-21   
ref|XP_963854.2|  hypothetical protein NCU02117                       97.4    9e-21   Neurospora crassa OR74A
gb|ETI56561.1|  hypothetical protein F443_00970                       98.2    9e-21   
gb|KFY20731.1|  hypothetical protein V491_03473                       97.1    9e-21   
gb|KHN96844.1|  Mpv17/PMP22                                           97.1    1e-20   
ref|XP_007811254.1|  integral membrane protein, Mpv17/PMP22 famil...  97.1    1e-20   
ref|XP_008080883.1|  hypothetical protein GLAREA_11910                97.1    1e-20   
gb|KFY02708.1|  hypothetical protein O988_01958                         102   1e-20   
gb|KFX86855.1|  hypothetical protein V490_08777                         102   1e-20   
gb|KFY09174.1|  hypothetical protein V491_08356                       96.7    1e-20   
emb|CCT62895.1|  probable glomerulosclerosis protein Mpv17            96.7    1e-20   
gb|KFY88078.1|  hypothetical protein V500_06576                       96.7    1e-20   
gb|EMT61325.1|  Protein SYM1                                          96.7    2e-20   
ref|NP_001090480.1|  uncharacterized protein LOC779393                97.4    2e-20   Xenopus laevis [clawed frog]
ref|XP_007739255.1|  protein sym1                                     96.7    2e-20   
gb|KFY48054.1|  hypothetical protein V495_01651                       96.3    2e-20   
ref|XP_011127820.1|  hypothetical protein AOL_s00215g316              96.3    2e-20   
gb|EGA57584.1|  Sym1p                                                 96.7    2e-20   
ref|XP_005538717.1|  similar to peroxisomal membrane protein PMP22    96.3    2e-20   
ref|XP_001801590.1|  hypothetical protein SNOG_11347                  96.3    3e-20   Parastagonospora nodorum SN15
gb|EYE94996.1|  hypothetical protein EURHEDRAFT_412854                95.9    3e-20   
ref|XP_004346946.1|  Mpv17 protein                                    96.3    3e-20   
ref|XP_007816811.1|  integral membrane protein, Mpv17/PMP22 famil...  95.5    4e-20   
gb|ESA19537.1|  hypothetical protein GLOINDRAFT_134941                95.9    4e-20   
ref|XP_007588885.1|  putative mpv17 pmp22 family protein              95.9    4e-20   
ref|XP_006966661.1|  predicted protein                                95.9    4e-20   
emb|CBN79011.1|  peroxisomal membrane protein-related                 96.3    4e-20   
gb|KDB18115.1|  putative integral membrane protein, Mpv17/PMP22 f...  95.5    4e-20   
gb|ELR03552.1|  hypothetical protein GMDG_01303                       95.1    4e-20   
ref|XP_007297121.1|  Mpv17/PMP22 family protein                       95.5    5e-20   
gb|EWG36396.1|  protein SYM1                                          95.1    5e-20   
gb|KFY69245.1|  hypothetical protein V496_00405                       95.1    5e-20   
ref|XP_007792574.1|  putative integral membrane mpv17 pmp22 protein   95.1    5e-20   
ref|XP_008723026.1|  hypothetical protein G647_01404                  95.1    6e-20   
gb|EWY92751.1|  protein SYM1                                          94.7    7e-20   
gb|KIH89476.1|  protein Mpv17                                         94.7    8e-20   
emb|CDW91795.1|  mpv17 pmp22 family protein                           96.3    9e-20   
dbj|GAM22026.1|  hypothetical protein SAMD00019534_052010             95.1    9e-20   
gb|EWM26132.1|  mpv17-like protein                                    94.7    9e-20   
emb|CEJ88834.1|  Putative Protein SYM1                                94.4    1e-19   
gb|ERS96861.1|  hypothetical protein HMPREF1624_07070                 94.4    1e-19   
gb|EXM30511.1|  protein SYM1                                          94.4    1e-19   
gb|ENH82799.1|  integral membrane mpv17 pmp22                         95.5    1e-19   
gb|KDN69708.1|  putative Mpv17/PMP22 family protein                   94.4    1e-19   
ref|XP_001827254.1|  protein sym1                                     94.0    1e-19   Aspergillus oryzae RIB40
ref|XP_001276424.1|  integral membrane protein, Mpv17/PMP22 famil...  94.4    1e-19   Aspergillus clavatus NRRL 1
gb|EFA78150.1|  pmp22 family protein                                  98.6    2e-19   Heterostelium album PN500
gb|EWM28134.1|  mpv17-like protein                                    95.5    2e-19   
ref|XP_005703050.1|  peroxisomal membrane MPV17/PMP22-like protein    94.4    2e-19   
ref|XP_008020534.1|  hypothetical protein SETTUDRAFT_162002           94.0    2e-19   
gb|EXL93873.1|  protein SYM1                                          93.2    2e-19   
gb|KFH45512.1|  hypothetical protein ACRE_036540                      93.2    2e-19   
ref|XP_002180247.1|  predicted protein                                93.2    3e-19   Phaeodactylum tricornutum CCAP 1055/1
gb|EHN01156.1|  Sym1p                                                 93.6    3e-19   
ref|XP_007277456.1|  integral membrane mpv17 pmp22                    92.8    3e-19   
gb|ELT87101.1|  hypothetical protein CAPTEDRAFT_150250                93.6    4e-19   
ref|XP_003718248.1|  hypothetical protein MGG_00752                   93.2    4e-19   
ref|XP_002384507.1|  integral membrane protein, Mpv17/PMP22 famil...  92.8    5e-19   Aspergillus flavus NRRL3357
gb|EEH40591.2|  hypothetical protein PAAG_09044                       92.4    5e-19   Paracoccidioides lutzii Pb01
ref|XP_004359177.1|  pmp22 family protein                             92.8    6e-19   
gb|EHK25202.1|  hypothetical protein TRIVIDRAFT_81939                 92.4    6e-19   
ref|XP_007687660.1|  hypothetical protein COCMIDRAFT_26058            92.4    6e-19   
gb|EME48377.1|  hypothetical protein DOTSEDRAFT_161874                92.4    6e-19   
ref|XP_005707818.1|  peroxisomal membrane MPV17/PMP22-like protei...  92.0    7e-19   
ref|XP_001395222.2|  protein sym1                                     91.7    8e-19   Aspergillus niger CBS 513.88
ref|XP_003352903.1|  hypothetical protein SMAC_05017                  91.7    8e-19   
ref|XP_001027141.1|  Mpv17 / PMP22 family protein                     92.8    8e-19   Tetrahymena thermophila
emb|CCX33601.1|  Similar to Protein SYM1; acc. no. Q4IPX8             93.2    8e-19   
ref|XP_002542852.1|  conserved hypothetical protein                   91.7    9e-19   Uncinocarpus reesii 1704
emb|CDM38143.1|  Protein sym1                                         91.7    1e-18   
gb|EHK40338.1|  hypothetical protein TRIATDRAFT_302717                91.7    1e-18   
ref|XP_003053748.1|  predicted protein                                91.3    1e-18   
ref|XP_011104570.1|  sym1p                                            91.7    1e-18   
gb|ESX01924.1|  Protein required for ethanol metabolism               91.7    1e-18   
ref|XP_002789043.1|  conserved hypothetical protein                   91.3    1e-18   Paracoccidioides lutzii Pb01
gb|KFA55001.1|  hypothetical protein S40293_02290                     90.9    2e-18   
ref|XP_007714977.1|  hypothetical protein COCCADRAFT_28442            91.3    2e-18   
ref|XP_003841062.1|  similar to integral membrane protein             90.9    2e-18   
ref|XP_009603125.1|  PREDICTED: PXMP2/4 family protein 4-like         92.0    2e-18   
emb|CBJ27540.1|  conserved unknown protein                            92.8    2e-18   
ref|XP_007758902.1|  hypothetical protein A1O7_06711                  92.0    2e-18   
ref|XP_007704473.1|  hypothetical protein COCSADRAFT_40738            90.9    2e-18   
gb|EWM28728.1|  Mpv17/PMP22                                           92.0    3e-18   
dbj|GAA91203.1|  integral membrane protein, Mpv17/PMP22 family        90.1    3e-18   
ref|XP_010763915.1|  hypothetical protein PADG_08603                  90.1    3e-18   
ref|XP_007920307.1|  hypothetical protein MYCFIDRAFT_71100            90.5    3e-18   
ref|XP_006659719.1|  PREDICTED: peroxisomal membrane protein PMP2...  90.5    3e-18   
gb|EEH18599.2|  hypothetical protein PABG_07659                       90.1    3e-18   Paracoccidioides brasiliensis Pb03
ref|XP_007784749.1|  hypothetical protein W97_08692                   89.7    3e-18   
emb|CDP22545.1|  Putative protein sym-1                               90.1    4e-18   
emb|CCK70010.1|  hypothetical protein KNAG_0D02610                    90.9    4e-18   
emb|CEG03149.1|  unnamed protein product                              89.7    4e-18   
ref|XP_003304859.1|  hypothetical protein PTT_17568                   90.1    4e-18   
gb|EMD85555.1|  hypothetical protein COCHEDRAFT_1024467               90.1    5e-18   
gb|KEQ61379.1|  putative integral membrane protein, Mpv17/PMP22 f...  89.7    5e-18   
ref|XP_008728379.1|  hypothetical protein G647_05831                  91.3    5e-18   
gb|KGO69836.1|  Mpv17/PMP22                                           89.4    6e-18   
gb|EPS65987.1|  hypothetical protein M569_08790                       87.0    6e-18   
ref|XP_005707552.1|  peroxisomal membrane MPV17/PMP22-like protein    90.9    7e-18   
gb|KGO70211.1|  Mpv17/PMP22                                           89.0    8e-18   
gb|EMF16791.1|  Mpv17_PMP22-domain-containing protein                 89.0    9e-18   
gb|KGO48259.1|  Mpv17/PMP22                                           88.6    1e-17   
ref|XP_006681871.1|  hypothetical protein BATDEDRAFT_14086            88.6    1e-17   
ref|XP_001272400.1|  integral membrane protein, Mpv17/PMP22 famil...  87.8    2e-17   Aspergillus clavatus NRRL 1
gb|EPS31028.1|  hypothetical protein PDE_05982                        87.8    2e-17   
ref|XP_007912038.1|  putative integral membrane mpv17 pmp22 protein   87.8    2e-17   
ref|XP_001240930.1|  hypothetical protein CIMG_08093                  87.8    2e-17   Coccidioides immitis RS
emb|CDR36304.1|  CYFA0S01e00364g1_1                                   88.2    2e-17   
ref|XP_001262783.1|  integral membrane protein, Mpv17/PMP22 famil...  87.4    3e-17   Aspergillus fischeri NRRL 181
ref|NP_001062544.1|  Os08g0566900                                     87.8    3e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EFX03442.1|  integral membrane protein mpv17 pmp22 family          87.4    3e-17   
gb|KEQ93996.1|  hypothetical protein AUEXF2481DRAFT_30553             87.4    3e-17   
ref|XP_003193315.1|  hypothetical protein CGB_D1270W                  89.0    3e-17   
ref|XP_004332855.1|  protein sym1, putative                           87.4    3e-17   
gb|EGE08821.1|  sym1                                                  87.4    3e-17   
ref|XP_003955604.1|  hypothetical protein KAFR_0B01700                88.2    3e-17   
gb|ACG27544.1|  peroxisomal membrane protein PMP22                    87.4    3e-17   
ref|XP_003170267.1|  hypothetical protein MGYG_07512                  87.0    3e-17   
ref|XP_773496.1|  hypothetical protein CNBI1100                       88.6    4e-17   
ref|XP_001637570.1|  predicted protein                                87.0    4e-17   
gb|EWM25529.1|  Mpv17/PMP22                                           88.2    4e-17   
ref|XP_008454382.1|  PREDICTED: PXMP2/4 family protein 4              88.6    4e-17   
ref|XP_007720588.1|  hypothetical protein A1O1_01485                  85.5    4e-17   
ref|XP_005102214.1|  PREDICTED: mpv17-like protein 2-like isoform X2  87.0    4e-17   
ref|NP_001096523.1|  uncharacterized protein LOC100125162             86.7    5e-17   
ref|XP_001239295.1|  hypothetical protein CIMG_10317                  88.2    5e-17   
emb|CCG80652.1|  Protein sym-1                                        86.3    5e-17   
gb|EPB88885.1|  hypothetical protein HMPREF1544_04275                 87.8    5e-17   
ref|XP_008468802.1|  PREDICTED: PXMP2/4 family protein 4-like         87.4    5e-17   
gb|KHN16605.1|  hypothetical protein glysoja_002702                   83.6    6e-17   
gb|KEQ74361.1|  putative integral membrane protein, Mpv17/PMP22 f...  86.7    6e-17   
ref|XP_003072224.1|  Mpv17/PMP22 family protein                       87.8    6e-17   
gb|KEQ87254.1|  putative integral membrane protein, Mpv17/PMP22 f...  86.7    6e-17   
ref|XP_008469234.1|  PREDICTED: PXMP2/4 family protein 4-like         87.4    6e-17   
gb|EJB11847.1|  integral membrane protein                             87.8    6e-17   
ref|XP_003233996.1|  hypothetical protein TERG_05865                  86.3    6e-17   
ref|XP_007678290.1|  hypothetical protein BAUCODRAFT_124035           86.7    7e-17   
ref|XP_002611065.1|  hypothetical protein BRAFLDRAFT_206123           86.7    7e-17   
ref|XP_003065228.1|  Mpv17/PMP22 family protein                       86.3    7e-17   
ref|XP_008486156.1|  PREDICTED: PXMP2/4 family protein 4-like         86.7    7e-17   
gb|EQB51326.1|  hypothetical protein CGLO_09141                       87.8    8e-17   
ref|XP_003669525.1|  hypothetical protein NDAI_0C06230                86.7    9e-17   
gb|KEF52738.1|  hypothetical protein A1O9_11155                       87.4    9e-17   
ref|XP_973172.1|  PREDICTED: protein Mpv17                            85.9    9e-17   
gb|EHA25898.1|  hypothetical protein ASPNIDRAFT_127917                85.9    9e-17   
ref|XP_002491920.1|  Protein required for ethanol metabolism          86.3    1e-16   
gb|EZF28656.1|  protein sym1                                          85.5    1e-16   
gb|KGB78800.1|  hypothetical protein CNBG_4638                        87.4    1e-16   
ref|XP_004974279.1|  PREDICTED: peroxisomal membrane protein PMP2...  85.9    1e-16   
ref|XP_003534581.1|  PREDICTED: peroxisomal membrane protein PMP2...  85.9    1e-16   
ref|XP_002956366.1|  hypothetical protein VOLCADRAFT_107206           86.3    1e-16   
ref|XP_002620843.1|  protein sym1                                     85.1    1e-16   
gb|EEH07953.1|  Mvp17/PMP22 family protein                            87.0    1e-16   
ref|XP_001541287.1|  conserved hypothetical protein                   87.0    1e-16   
gb|EGC42991.1|  Mvp17/PMP22 family protein                            86.7    1e-16   
ref|XP_007743829.1|  hypothetical protein A1O5_05036                  86.7    2e-16   
gb|EPS95831.1|  hypothetical protein FOMPIDRAFT_1131728               85.5    2e-16   
ref|XP_002143230.1|  integral membrane protein, Mpv17/PMP22 famil...  85.1    2e-16   
gb|KFA67165.1|  hypothetical protein S40285_05242                     89.4    2e-16   
ref|NP_001146502.1|  uncharacterized protein LOC100280092             85.5    2e-16   
ref|XP_001416602.1|  predicted protein                                86.3    2e-16   
emb|CDY52414.1|  BnaCnng22350D                                        86.3    2e-16   
ref|XP_008833272.1|  PREDICTED: protein Mpv17 isoform X3              85.1    2e-16   
gb|EGV95875.1|  Protein Mpv17                                         85.1    2e-16   
ref|XP_011088050.1|  PREDICTED: PXMP2/4 family protein 4-like         86.7    2e-16   
ref|XP_006696182.1|  hypothetical protein CTHT_0058620                85.1    2e-16   
emb|CCU81800.1|  sym1 protein                                         84.7    2e-16   
gb|KHJ30247.1|  putative mpv17 pmp22 family protein                   86.3    2e-16   
ref|XP_007319942.1|  hypothetical protein SERLADRAFT_393206           85.1    2e-16   
emb|CDH49613.1|  protein sym1                                         85.1    2e-16   
ref|XP_001393565.1|  protein sym1                                     84.7    3e-16   
ref|XP_006409624.1|  hypothetical protein EUTSA_v10022819mg           85.9    3e-16   
ref|XP_001624885.1|  predicted protein                                85.1    3e-16   
ref|XP_006383889.1|  hypothetical protein POPTR_0004s00950g           84.3    3e-16   
ref|XP_003497098.2|  PREDICTED: protein Mpv17                         85.1    3e-16   
ref|XP_006640259.1|  PREDICTED: peroxisomal membrane protein 2-like   84.7    3e-16   
ref|XP_007181381.1|  PREDICTED: peroxisomal membrane protein 2        84.7    3e-16   
ref|XP_009171338.1|  hypothetical protein T265_07529                  85.9    3e-16   
gb|EEH04669.1|  conserved hypothetical protein                        84.3    3e-16   
ref|XP_005102213.1|  PREDICTED: mpv17-like protein 2-like isoform X1  84.7    3e-16   
ref|XP_002623809.1|  integral membrane protein                        85.9    3e-16   
emb|CBN79193.1|  conserved unknown protein                            85.9    4e-16   
dbj|GAA88805.1|  integral membrane protein, Mpv17/PMP22 family        84.3    4e-16   
gb|EDP50963.1|  integral membrane protein, Mpv17/PMP22 family, pu...  84.7    4e-16   
gb|EZF24176.1|  hypothetical protein H100_03260                       84.7    4e-16   
ref|XP_010539236.1|  PREDICTED: peroxisomal membrane protein PMP2...  84.3    4e-16   
gb|EJY73831.1|  Protein Mpv17, putative                               84.0    4e-16   
ref|XP_001217280.1|  conserved hypothetical protein                   84.0    4e-16   
ref|XP_445122.1|  hypothetical protein                                84.7    4e-16   
gb|AFR94310.1|  hypothetical protein CNAG_05045                       85.5    4e-16   
ref|XP_007736875.1|  hypothetical protein A1O3_08588                  82.4    4e-16   
emb|CDY54475.1|  BnaA09g52780D                                        85.1    5e-16   
ref|XP_005073600.1|  PREDICTED: protein Mpv17                         84.0    5e-16   
ref|XP_003190956.1|  protein sym1                                     84.0    5e-16   
ref|XP_001483270.1|  hypothetical protein PGUG_03999                  84.7    5e-16   
ref|XP_002568378.1|  Pc21g13610                                       83.6    5e-16   
ref|XP_002409071.1|  conserved hypothetical protein                   84.3    6e-16   
ref|XP_003078057.1|  Peroxisomal membrane protein MPV17 and relat...  84.7    6e-16   
ref|NP_192356.1|  peroxisomal membrane protein PMP22                  84.0    6e-16   
ref|XP_010099189.1|  Peroxisomal membrane protein                     83.6    6e-16   
emb|CEF97050.1|  Mpv17/PMP22                                          85.1    6e-16   
gb|KFK39987.1|  hypothetical protein AALP_AA3G315400                  85.1    6e-16   
ref|XP_006351928.1|  PREDICTED: PXMP2/4 family protein 4-like         84.3    6e-16   
ref|XP_003695695.1|  PREDICTED: protein Mpv17-like                    83.6    7e-16   
emb|CDS04063.1|  hypothetical protein LRAMOSA07018                    84.0    7e-16   
ref|XP_748225.1|  integral membrane protein, Mpv17/PMP22 family       84.0    7e-16   
ref|XP_002151570.1|  integral membrane protein, Mpv17/PMP22 famil...  84.7    7e-16   
ref|XP_746785.1|  integral membrane protein, Mpv17/PMP22 family       83.2    8e-16   
gb|EPQ66145.1|  hypothetical protein BGT96224_3433                    82.8    8e-16   
emb|CDY52415.1|  BnaCnng22360D                                        84.7    9e-16   
ref|XP_005778735.1|  hypothetical protein EMIHUDRAFT_443435           84.7    9e-16   
ref|XP_001694125.1|  predicted protein                                83.6    9e-16   
ref|XP_009123221.1|  PREDICTED: protein SYM1-like                     84.3    1e-15   
gb|EPS32197.1|  hypothetical protein PDE_07157                        84.3    1e-15   
ref|XP_007360051.1|  hypothetical protein DICSQDRAFT_94930            83.6    1e-15   
ref|XP_007233539.1|  PREDICTED: peroxisomal membrane protein 2-like   83.2    1e-15   
emb|CDW84001.1|  peroxisomal membrane protein 2                       83.2    1e-15   
ref|XP_002385009.1|  integral membrane protein, Mpv17/PMP22 famil...  82.8    1e-15   
ref|XP_008330350.1|  PREDICTED: mpv17-like protein 2                  83.2    1e-15   
gb|EFX70972.1|  hypothetical protein DAPPUDRAFT_309248                83.2    1e-15   
ref|XP_010686813.1|  PREDICTED: peroxisomal membrane protein PMP22    82.8    1e-15   
ref|XP_003688465.1|  hypothetical protein TPHA_0O00610                83.6    1e-15   
emb|CDX71197.1|  BnaC07g04760D                                        83.6    1e-15   
gb|ADE76561.1|  unknown                                               84.3    1e-15   
gb|EJK54998.1|  hypothetical protein THAOC_25323                      83.6    2e-15   
ref|NP_001091710.1|  protein Mpv17                                    82.4    2e-15   
ref|XP_007897040.1|  PREDICTED: mpv17-like protein 2                  82.8    2e-15   
ref|XP_006562124.1|  PREDICTED: protein Mpv17-like                    82.4    2e-15   
ref|XP_002341466.1|  integral membrane protein, Mpv17/PMP22 famil...  83.6    2e-15   
ref|XP_002171905.1|  Mvp17/PMP22 family protein 2                     82.8    2e-15   
ref|XP_002874798.1|  hypothetical protein ARALYDRAFT_911705           82.4    2e-15   
ref|XP_007233216.1|  PREDICTED: mpv17-like protein 2-like             82.8    2e-15   
ref|XP_004489899.1|  PREDICTED: PXMP2/4 family protein 4-like         82.8    2e-15   
ref|NP_001039473.1|  peroxisomal membrane protein 2                   82.4    2e-15   
ref|XP_004686100.1|  PREDICTED: protein Mpv17                         82.0    2e-15   
emb|CDM30326.1|  Mpv17/PMP22                                          83.2    2e-15   
ref|XP_008469246.1|  PREDICTED: uncharacterized protein LOC103506628  85.5    2e-15   
ref|XP_002183376.1|  predicted protein                                82.0    2e-15   
ref|NP_001237804.1|  uncharacterized protein LOC100499909             82.0    2e-15   
ref|XP_009123223.1|  PREDICTED: PXMP2/4 family protein 4-like         83.2    2e-15   
ref|XP_011092520.1|  PREDICTED: PXMP2/4 family protein 4              83.6    2e-15   
gb|EMD41716.1|  hypothetical protein CERSUDRAFT_90289                 82.4    2e-15   
gb|ACU19135.1|  unknown                                               82.0    3e-15   
ref|XP_010272158.1|  PREDICTED: PXMP2/4 family protein 3-like         83.2    3e-15   
gb|EER40101.1|  integral membrane protein                             81.6    3e-15   
ref|XP_005371420.1|  PREDICTED: protein Mpv17 isoform X1              81.6    3e-15   
ref|XP_008718885.1|  hypothetical protein HMPREF1541_06327            81.6    3e-15   
gb|AEE62437.1|  unknown                                               82.4    3e-15   
gb|KHN32813.1|  PXMP2/4 family protein 4                              82.4    3e-15   
gb|AAH82223.1|  Mpv17 protein                                         81.6    3e-15   
ref|XP_006409625.1|  hypothetical protein EUTSA_v10022822mg           82.8    3e-15   
ref|XP_006299560.1|  hypothetical protein CARUB_v10015735mg           82.8    3e-15   
ref|XP_635703.1|  pmp22 family protein                                81.6    3e-15   
ref|XP_004336503.1|  Hypothetical protein ACA1_192610                 80.5    3e-15   
ref|NP_032648.1|  protein Mpv17 isoform 1                             81.3    3e-15   
ref|XP_004250325.2|  PREDICTED: protein SYM1-like                     82.4    3e-15   
ref|XP_642423.1|  pmp22 family protein                                81.6    3e-15   
sp|Q66GV0.2|MPV17_XENLA  RecName: Full=Protein Mpv17                  81.3    3e-15   
ref|XP_007489288.1|  PREDICTED: mpv17-like protein 2                  82.0    4e-15   
ref|XP_008979231.1|  PREDICTED: protein Mpv17                         81.3    4e-15   
ref|XP_003941604.1|  PREDICTED: protein Mpv17 isoform X2              81.3    4e-15   
ref|XP_006612128.1|  PREDICTED: protein Mpv17-like                    81.6    4e-15   
ref|XP_006396691.1|  hypothetical protein EUTSA_v10028993mg           81.6    4e-15   
ref|XP_005710823.1|  unnamed protein product                          83.2    4e-15   
ref|XP_007143101.1|  hypothetical protein PHAVU_007G043600g           82.8    4e-15   
emb|CCH42690.1|  hypothetical protein BN7_2234                        81.6    4e-15   
ref|XP_004611169.1|  PREDICTED: peroxisomal membrane protein 2        81.6    4e-15   
gb|KIA75714.1|  hypothetical protein HK57_00497                       82.0    4e-15   
ref|XP_010369534.1|  PREDICTED: protein Mpv17 isoform X3              81.3    4e-15   
ref|XP_001210309.1|  conserved hypothetical protein                   82.4    4e-15   
gb|EGC48674.1|  integral membrane protein                             81.3    4e-15   
gb|EME50373.1|  hypothetical protein DOTSEDRAFT_69032                 82.8    4e-15   
gb|ADG35815.1|  PXMP2/4 family protein 2                              81.6    4e-15   
ref|XP_006995587.1|  PREDICTED: protein Mpv17                         81.3    4e-15   
ref|XP_010455725.1|  PREDICTED: peroxisomal membrane protein PMP22    81.3    5e-15   
ref|XP_004525164.1|  PREDICTED: mpv17-like protein 2-like             82.0    5e-15   
gb|EJY69714.1|  Peroxisomal membrane protein MPV17 (ISS)              82.0    5e-15   
gb|EKC21719.1|  Mpv17-like protein 2                                  85.1    5e-15   
ref|XP_006880652.1|  PREDICTED: protein Mpv17                         80.9    5e-15   
ref|XP_010517857.1|  PREDICTED: protein SYM1-like                     82.4    5e-15   
gb|EYU42710.1|  hypothetical protein MIMGU_mgv1a011811mg              82.4    5e-15   
emb|CDO97259.1|  unnamed protein product                              82.4    5e-15   
ref|XP_010467271.1|  PREDICTED: protein SYM1-like                     82.0    5e-15   
ref|XP_010488928.1|  PREDICTED: protein SYM1-like                     82.4    5e-15   
gb|KFX42496.1|  Protein sym1                                          81.3    5e-15   
ref|XP_010432817.1|  PREDICTED: peroxisomal membrane protein PMP2...  81.3    5e-15   
ref|XP_001264738.1|  integral membrane protein, Mpv17/PMP22 famil...  81.6    5e-15   
ref|XP_005322586.1|  PREDICTED: protein Mpv17                         80.9    6e-15   
ref|XP_003175898.1|  vacuolar membrane protein                        82.0    6e-15   
ref|XP_007532632.1|  PREDICTED: protein Mpv17                         80.9    6e-15   
emb|CDF90112.1|  ZYBA0S06-00826g1_1                                   80.9    6e-15   
emb|CDH16666.1|  related to Protein SYM1                              80.9    6e-15   
gb|AFK37482.1|  unknown                                               81.6    7e-15   
gb|KDR14760.1|  Protein Mpv17                                         80.9    7e-15   
gb|ENN72913.1|  hypothetical protein YQE_10481                        80.5    7e-15   
ref|XP_004618992.1|  PREDICTED: protein Mpv17                         80.5    7e-15   
ref|XP_006078314.1|  PREDICTED: peroxisomal membrane protein 2        80.9    7e-15   
ref|XP_006389584.1|  hypothetical protein POPTR_0021s00350g           80.5    7e-15   
emb|CDH51447.1|  integral membrane mpv17 pmp22                        81.3    7e-15   
dbj|GAM41415.1|  hypothetical protein TCE0_042f14517                  82.0    8e-15   
ref|XP_003234664.1|  integral membrane protein                        81.6    8e-15   
gb|EJK66898.1|  hypothetical protein THAOC_12131                      80.5    8e-15   
ref|XP_003573232.1|  PREDICTED: peroxisomal membrane protein PMP22    80.5    8e-15   
ref|XP_006346324.1|  PREDICTED: PXMP2/4 family protein 4-like         81.6    8e-15   
ref|XP_003398381.1|  PREDICTED: protein Mpv17-like                    80.5    8e-15   
emb|CDY49382.1|  BnaA03g50710D                                        82.0    8e-15   
ref|XP_003737363.1|  PREDICTED: protein Mpv17-like                    80.9    8e-15   
dbj|BAJ92860.1|  predicted protein                                    80.5    8e-15   
ref|XP_008252832.1|  PREDICTED: protein Mpv17 isoform X6              80.5    8e-15   
ref|XP_010946653.1|  PREDICTED: peroxisomal membrane protein 2        80.9    8e-15   
ref|XP_006209527.1|  PREDICTED: peroxisomal membrane protein 2        80.5    9e-15   
ref|XP_006175085.1|  PREDICTED: peroxisomal membrane protein 2        80.1    9e-15   
ref|XP_004177439.1|  hypothetical protein TBLA_0A01200                80.5    9e-15   
ref|XP_002411403.1|  conserved hypothetical protein                   80.1    1e-14   
ref|XP_011096042.1|  PREDICTED: peroxisomal membrane protein PMP2...  80.1    1e-14   
ref|XP_004208761.1|  PREDICTED: mpv17-like protein 2-like             80.9    1e-14   
ref|NP_001247906.1|  protein Mpv17                                    80.1    1e-14   
ref|XP_009156685.1|  hypothetical protein HMPREF1120_04314            81.3    1e-14   
ref|XP_010530711.1|  PREDICTED: PXMP2/4 family protein 3-like         81.3    1e-14   
ref|XP_006835259.1|  PREDICTED: protein Mpv17                         80.1    1e-14   
ref|XP_003488373.1|  PREDICTED: protein Mpv17-like                    80.1    1e-14   
ref|XP_011008026.1|  PREDICTED: peroxisomal membrane protein PMP2...  80.1    1e-14   
dbj|BAJ86876.1|  predicted protein                                    80.1    1e-14   
ref|XP_004350783.1|  pmp22 family protein                             80.5    1e-14   
ref|XP_002527492.1|  Protein SYM1, putative                           81.3    1e-14   
ref|XP_011108175.1|  hypothetical protein H072_2187                   83.6    1e-14   
ref|XP_004289787.1|  PREDICTED: PXMP2/4 family protein 4-like iso...  81.3    1e-14   
ref|XP_010551679.1|  PREDICTED: peroxisomal membrane protein PMP22    80.1    1e-14   
ref|XP_002412714.1|  peroxisomal membrane protein 2, pxmp2, putative  80.1    1e-14   
ref|XP_005706645.1|  peroxisomal membrane MPV17/PMP22-like protein    79.7    1e-14   
ref|XP_003787520.1|  PREDICTED: protein Mpv17                         79.7    1e-14   
ref|NP_001004607.1|  peroxisomal membrane protein 2                   80.1    1e-14   



>ref|XP_002284391.1| PREDICTED: protein Mpv17 isoform X1 [Vitis vinifera]
 ref|XP_010656322.1| PREDICTED: protein Mpv17 isoform X1 [Vitis vinifera]
 emb|CBI28065.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML  W WYQ  +++ P++TQVISSG+LW +GD+ AQSIT S+++K RL ISD+G  +D  
Sbjct  1    MLNAWKWYQRCMSLHPVKTQVISSGILWGVGDITAQSITHSSARK-RLQISDAG--QDFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ID KR  IT M+G GF GP GHFWYEGLD+FI+L+  LQP S++F+A+KVA+D L+FGP 
Sbjct  58   IDWKRTAITSMFGFGFVGPVGHFWYEGLDRFIRLRLLLQPASVRFVASKVAMDSLIFGPF  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             L +FF++MGFSTGK+ +QVKE +KRDFLPAL++ES AWP  Q VNFRYVPV+YQLLYVN
Sbjct  118  ELFVFFSHMGFSTGKNAAQVKEDLKRDFLPALIVESGAWPFVQVVNFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNE  853
            +F +LDS FLSW+E QQK+AS KQ F+S P S E
Sbjct  178  LFCLLDSIFLSWME-QQKDASWKQWFSSSPSSKE  210



>emb|CDP03325.1| unnamed protein product [Coffea canephora]
Length=217

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 173/220 (79%), Gaps = 3/220 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQ+ISSG LW +GD+VAQSIT ST+K + L +SD+  +K+  
Sbjct  1    MLKLWRWYQNCLAVHPVKTQIISSGFLWGVGDIVAQSITHSTAKNRPLHLSDA--DKEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT M+G GF GP GHFWYE LD+FI+ + ++QP S++F+ATKVA+D ++FGP 
Sbjct  59   VNWKRVAITSMFGFGFVGPVGHFWYEYLDRFIRFRLKMQPKSVRFVATKVAMDGIIFGPF  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L++FF+YMGFS GKS SQVKE +KRDF+PAL+LE  AWP  Q +NFRYVPV+YQLLYVN
Sbjct  119  DLVVFFSYMGFSAGKSASQVKEDLKRDFIPALVLEGGAWPFMQVINFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDECK  871
             F +LDSAFLSWLEQQ+ +AS KQ F S     + + E +
Sbjct  179  AFCLLDSAFLSWLEQQE-DASWKQWFTSFTTLKKEEREGR  217



>ref|XP_011081831.1| PREDICTED: protein Mpv17-like [Sesamum indicum]
Length=218

 Score =   273 bits (699),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 162/208 (78%), Gaps = 2/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LA  P++TQVISSG++W IGD+ AQ++T  T+K+  L   D   NK   
Sbjct  1    MLKLWKWYQNCLATHPVKTQVISSGLIWGIGDIAAQAVTHYTAKRHHLQTHDENENK-AK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ +RV  T  +G GF GP GHFWYEGLD FI+L+ +LQPNS +F+ TKVAVD ++FGPL
Sbjct  60   LNWRRVATTSFFGLGFVGPVGHFWYEGLDHFIRLQLKLQPNSFRFVGTKVAVDSIIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GK+ SQVKE +KRDFLPAL++E   WP+ Q VNFR+VPV+YQLLYVN
Sbjct  120  DLLVFFTYMGFSLGKTASQVKEDVKRDFLPALVVEGGVWPILQVVNFRFVPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDS FLSWLEQQ+ +AS KQ F S
Sbjct  180  IFCLLDSCFLSWLEQQE-DASWKQWFRS  206



>ref|XP_007012047.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
1 [Theobroma cacao]
 ref|XP_007012048.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
1 [Theobroma cacao]
 gb|EOY29666.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
1 [Theobroma cacao]
 gb|EOY29667.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
1 [Theobroma cacao]
Length=216

 Score =   273 bits (699),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LA+ P++TQVISSG++W  GD+ AQ+IT ST+KK R L  +   +K+L 
Sbjct  1    MLRLWKWYQNCLAIHPVKTQVISSGLIWGFGDIAAQTITHSTAKKHRHLQEE---DKELK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G GF GP GH+WYEGLD++I+L+  LQPNS +F+ATKVA+D  +FGPL
Sbjct  58   INWKRVATTSLFGFGFVGPVGHYWYEGLDRYIRLRLCLQPNSFRFVATKVAIDGFIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  QVKE +KRDF+PALMLE   WP+ Q  NFRY+PV+YQLLYVN
Sbjct  118  DLLVFFTYMGFSAGKSFPQVKENVKRDFVPALMLEGGVWPIVQVANFRYIPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             F +LDS FLSW+EQQ+ +A  KQ   S+  S E + +
Sbjct  178  FFCLLDSCFLSWIEQQE-DAPWKQWLNSLLPSKEKRGQ  214



>ref|XP_009374024.1| PREDICTED: PXMP2/4 family protein 2 [Pyrus x bretschneideri]
Length=218

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LA  PL+TQVISSGVLW +GD+ AQ +T S ++K RL +SD   + D  
Sbjct  2    MLKLWKWYQNCLAFHPLKTQVISSGVLWGVGDIAAQYVTHSNARK-RLQLSDR--DADFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S++F+A KVA+D L+FGPL
Sbjct  59   VNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPKSVRFVAAKVAMDGLIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ +  NFRYVPV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVEIANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            MF +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  179  MFCLLDSAFLSWVE-QQKDAAWKQWFTS  205



>gb|KHG18961.1| PXMP2/4 family protein 2 [Gossypium arboreum]
Length=215

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 166/218 (76%), Gaps = 4/218 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LA+ P++TQV+SSG++WA GD+ AQ+IT ST+KK   L      +K+L 
Sbjct  1    MLKLWKWYQNCLAIHPVKTQVLSSGLIWAFGDIAAQTITHSTAKKHHHL---QEKDKELK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV  T ++G GF GP GH+WYEGLD+ I+ + RL+P S +F+ATKVAVD  +FGPL
Sbjct  58   VNWKRVATTSLFGLGFVGPVGHYWYEGLDRCIRFRLRLRPYSFRFVATKVAVDGFIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  Q+KE +KRDF+PAL+LE   WP+ Q  NFRY+PV+YQLLYVN
Sbjct  118  DLLVFFTYMGFSAGKSVPQIKEDVKRDFVPALILEGGLWPIVQVANFRYIPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            MF +LDS FLSW+EQQ+ +A  KQ   S+  S E KDE
Sbjct  178  MFCLLDSCFLSWIEQQE-DAPWKQWLNSLIHSKEKKDE  214



>ref|XP_008337377.1| PREDICTED: PXMP2/4 family protein 2 [Malus domestica]
Length=218

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 162/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN L+  PL+TQVISSGVLW +GDV AQ +T S ++K RL +SD   + D  
Sbjct  2    MLKLWKWYQNCLSFHPLKTQVISSGVLWGVGDVAAQYVTHSNARK-RLQLSDR--DADFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S +F+A KVA+D L+FGPL
Sbjct  59   VNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPXSXRFVAAKVAMDGLIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVQIANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            MF +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  179  MFCLLDSAFLSWVE-QQKDAAWKQWFTS  205



>ref|XP_007202554.1| hypothetical protein PRUPE_ppa011241mg [Prunus persica]
 ref|XP_008242660.1| PREDICTED: PXMP2/4 family protein 2 isoform X2 [Prunus mume]
 gb|EMJ03753.1| hypothetical protein PRUPE_ppa011241mg [Prunus persica]
Length=218

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN L+  PL+TQVISSGVLW +GD+ AQ IT S ++K RL +SD+  + D  
Sbjct  2    MLKLWKWYQNCLSFHPLKTQVISSGVLWGVGDIAAQYITHSNARK-RLQLSDT--DADFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S +F+A KVA+D L+FGPL
Sbjct  59   VNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPKSARFVAAKVAMDGLIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVQIANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  179  VFCLLDSAFLSWVE-QQKDAAWKQWFTS  205



>ref|XP_009355419.1| PREDICTED: PXMP2/4 family protein 2-like [Pyrus x bretschneideri]
Length=218

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M+++W WYQN L+  PL+TQVISSGVLW IGD+ AQ +T S ++K RL +SD+  + D  
Sbjct  2    MMKLWKWYQNCLSFHPLKTQVISSGVLWGIGDIAAQYVTHSNARK-RLQLSDT--DADFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S +F+A KVA+D L+FGPL
Sbjct  59   VNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPKSARFVAAKVAMDGLIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVQIANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  179  IFCLLDSAFLSWVE-QQKDAAWKQWFTS  205



>gb|KDO48887.1| hypothetical protein CISIN_1g027783mg [Citrus sinensis]
Length=219

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 2/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV PL+TQVISSG LW +GD+ AQ IT +T+K  RL +S + +++   
Sbjct  1    MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATAK-SRLQLSVTDADEKFK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+ATKVA+D ++FGPL
Sbjct  60   VNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  120  DLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  180  IFCLLDSAFLSWVE-QQKDAAWKQWFTS  206



>ref|XP_006418722.1| hypothetical protein EUTSA_v10002655mg [Eutrema salsugineum]
 gb|ESQ37158.1| hypothetical protein EUTSA_v10002655mg [Eutrema salsugineum]
Length=226

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V PL+TQVISSG LW  GDV AQ IT ST+K + L ++D+  ++D  
Sbjct  2    MLKLWRWYQRCLTVHPLKTQVISSGFLWGFGDVTAQYITHSTAKPRLLRLTDTKKDRDSD  61

Query  386  --LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
                ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P + +F+A KVA+D ++
Sbjct  62   AEFKVNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYAPKTTRFVAAKVAMDGII  121

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMGF+TGK+ S+VKE IKRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  122  FGPIDLLVFFTYMGFATGKNTSEVKEGIKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  181

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F +
Sbjct  182  LYVNIFCLIDSAFLSWVE-QQKDAAWKQWFTT  212



>ref|XP_008242659.1| PREDICTED: PXMP2/4 family protein 2 isoform X1 [Prunus mume]
Length=219

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 161/208 (77%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN L+  PL+TQVISSGVLW +GD+ AQ IT S ++K+  L  D+  + D  
Sbjct  2    MLKLWKWYQNCLSFHPLKTQVISSGVLWGVGDIAAQYITHSNARKRLQLSQDT--DADFK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S +F+A KVA+D L+FGPL
Sbjct  60   VNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPKSARFVAAKVAMDGLIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  120  DLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVQIANFRYVPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  180  VFCLLDSAFLSWVE-QQKDAAWKQWFTS  206



>ref|XP_009371457.1| PREDICTED: PXMP2/4 family protein 2-like [Pyrus x bretschneideri]
Length=218

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M+++W WYQN L+  PL+TQVISSGVLW +GD+ AQ +T S +++ RL +SD+  + D  
Sbjct  2    MMKLWKWYQNCLSFHPLKTQVISSGVLWGVGDIAAQYVTHSNARR-RLHLSDT--DADFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S +F+A KVA+D L+FGPL
Sbjct  59   VNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPKSARFVAAKVAMDGLIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVQIANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  179  IFCLLDSAFLSWVE-QQKDAAWKQWFTS  205



>gb|KFK39778.1| hypothetical protein AALP_AA3G286400 [Arabis alpina]
Length=226

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K + L ++D+  +KD  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPRLLRLTDTNKDKDAD  60

Query  386  --LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
                ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   AEFKVNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYTPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F +
Sbjct  181  LYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTA  211



>gb|KDO48888.1| hypothetical protein CISIN_1g027783mg [Citrus sinensis]
Length=217

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 166/208 (80%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV PL+TQVISSG LW +GD+ AQ IT +T+K  RL +SD+  ++   
Sbjct  1    MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATAK-SRLQLSDA--DEKFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+ATKVA+D ++FGPL
Sbjct  58   VNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  118  DLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  178  IFCLLDSAFLSWVE-QQKDAAWKQWFTS  204



>ref|XP_006451173.1| hypothetical protein CICLE_v10009440mg [Citrus clementina]
 ref|XP_006475630.1| PREDICTED: PXMP2/4 family protein 2-like isoform X1 [Citrus sinensis]
 gb|ESR64413.1| hypothetical protein CICLE_v10009440mg [Citrus clementina]
Length=219

 Score =   268 bits (686),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 165/208 (79%), Gaps = 2/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV PL+TQVISSG LW +GD+ AQ IT +T+K  RL +S + +++   
Sbjct  1    MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATAK-SRLQLSVTDADEKFK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+ATKVA+D ++FGPL
Sbjct  60   VNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFS GK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  120  DLFVFFTYMGFSAGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  180  IFCLLDSAFLSWVE-QQKDAAWKQWFTS  206



>ref|XP_004251193.1| PREDICTED: protein Mpv17 [Solanum lycopersicum]
 ref|XP_010313456.1| PREDICTED: protein Mpv17 [Solanum lycopersicum]
Length=214

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LA+ P++TQVISSG++W +GDV AQ++T  T+KK   L   S  NK+  
Sbjct  1    MLRLWKWYQNCLALHPVKTQVISSGLIWGLGDVSAQAVTHYTAKKHHHL--HSNENKEFA  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G  F GP GHFWYEGLD+ I+L+F++QP SL+F+ATKVA+D ++FGPL
Sbjct  59   INWRRVATTSLFGFAFVGPVGHFWYEGLDRVIRLRFQMQPKSLRFVATKVALDGIIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMG+STGK+ +QV E +KRDFLPAL+LE   WP+ Q  NFRY+PV+YQLLYVN
Sbjct  119  DLLVFFTYMGYSTGKNTAQVIEGVKRDFLPALILEGGIWPIVQVANFRYIPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKD  862
             F +LDS+FLSW+EQQ+ +A+ KQ   ++    E K+
Sbjct  179  FFCLLDSSFLSWIEQQE-DAAWKQWLKNIVRLKEQKE  214



>ref|XP_006340270.1| PREDICTED: protein Mpv17-like [Solanum tuberosum]
Length=217

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 170/220 (77%), Gaps = 3/220 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LA+ P++TQVISSG++W +GDV AQ++T  T+KK   L  D   +K+  
Sbjct  1    MLRLWKWYQNCLALHPVKTQVISSGLIWGLGDVSAQAVTHYTAKKHHHLHPDE--DKEFA  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G  F GP GHFWYEGLD+ I+L+F++QP SL+F+ATKVA+D ++FGPL
Sbjct  59   INWRRVATTSLFGFAFVGPVGHFWYEGLDRVIRLRFQMQPKSLRFVATKVALDGIIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMG+STGK+ +QV E +KRDFLPAL+LE   WP+ Q  NFRY+PV+YQLLYVN
Sbjct  119  DLLVFFTYMGYSTGKNTAQVVEGVKRDFLPALILEGGIWPIVQVANFRYIPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDECK  871
             F +LDS+FLSW+EQQ+ +A+ KQ   ++    E K+E +
Sbjct  179  FFCLLDSSFLSWIEQQE-DAAWKQWLKNIVRLKEQKEEGR  217



>ref|XP_010103049.1| PXMP2/4 family protein 2 [Morus notabilis]
 gb|EXB94672.1| PXMP2/4 family protein 2 [Morus notabilis]
Length=233

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 161/221 (73%), Gaps = 17/221 (8%)
 Frame = +2

Query  215  LRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKK--------------QR  352
            LR+W WYQN LA  P++TQVISSG LW +GDV AQ IT S   +              QR
Sbjct  3    LRLWKWYQNCLAYHPVKTQVISSGFLWGVGDVAAQYITHSAKSRLQISSVSLQKLDHNQR  62

Query  353  LLISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLA  532
            L+  D+  + D  I+ KRV IT  +G GF GP GHFWYEGLD+FI+LK   QP SLQF+A
Sbjct  63   LMYQDA--DADFRINWKRVAITSTFGFGFVGPVGHFWYEGLDRFIRLKLHQQPKSLQFVA  120

Query  533  TKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNF  712
            TKVA D ++FGPL+LL+FFTYMGFS GK+  QVKE +KRDFLPAL+LE   WP+ Q VNF
Sbjct  121  TKVAADGIIFGPLDLLVFFTYMGFSMGKNVQQVKEDVKRDFLPALILEGGVWPIVQVVNF  180

Query  713  RYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            RYVPV+YQLLYVN+F +LDSAFLSWLE QQK+A+ KQ F S
Sbjct  181  RYVPVRYQLLYVNIFCLLDSAFLSWLE-QQKDAAWKQWFTS  220



>ref|XP_011088955.1| PREDICTED: protein Mpv17-like [Sesamum indicum]
Length=217

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 166/215 (77%), Gaps = 4/215 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LA  P++TQVISSG++W +GD+ AQ++T ST+K   L   D    K+L 
Sbjct  1    MLRLWKWYQNCLATHPVKTQVISSGIIWGVGDIAAQAVTNSTAKHYHLQTHDE--VKELK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G GF GP GHFWYEGLD+ I+++ +LQPNS +F+A+KVA D ++FGPL
Sbjct  59   INWRRVATTTIFGLGFVGPVGHFWYEGLDRIIRVRLKLQPNSFRFVASKVAADGIIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS+GK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFR+VPV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSSGKTSAQVKEDVKRDFLPALILEGGVWPIVQVANFRFVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS-VPISNE  853
             F +LDS FLSW+EQQ+ +A  KQ F S +P+  +
Sbjct  179  FFCLLDSCFLSWIEQQE-DAPWKQWFKSFLPLKEQ  212



>gb|EYU29265.1| hypothetical protein MIMGU_mgv1a013630mg [Erythranthe guttata]
Length=215

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 164/211 (78%), Gaps = 3/211 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            MLR+W WYQN L+  P++TQVISSG +W  GD+ AQ++T  T+K   L I+D   +KD  
Sbjct  1    MLRLWKWYQNCLSTHPVKTQVISSGFIWGFGDIAAQTVTHYTAKPLHLQITDKNKDKDEE  60

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
            L I+ +RVG T ++G GF GP GHFWY+GLD+ IK++ +LQ NS +F+A+KVA D ++FG
Sbjct  61   LKINWRRVGCTALFGLGFVGPVGHFWYQGLDRIIKVRLKLQQNSFRFVASKVAADGIIFG  120

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            PL+LL+FFTYMGF++GK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFR+VPVQYQLLY
Sbjct  121  PLDLLVFFTYMGFASGKTSAQVKEDVKRDFLPALILEGGIWPIVQVANFRFVPVQYQLLY  180

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCFASV  838
            VN+F +LDS FLSW+EQQ+ +A  KQ F ++
Sbjct  181  VNLFCLLDSCFLSWIEQQE-DAPWKQWFKTI  210



>gb|KDP34215.1| hypothetical protein JCGZ_07786 [Jatropha curcas]
Length=220

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 159/208 (76%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WY+N LAV P++TQVISSG++W  GD+ AQSIT  T K+Q     +   N  L 
Sbjct  1    MLRLWKWYRNCLAVHPVKTQVISSGLIWGFGDIAAQSITNCTKKQQ---CQEDTENGRLK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G GF GP GHFWYEGLD+FI+L+  ++PNSLQF+A KVA+D  VFGPL
Sbjct  58   INWKRVATTSLFGFGFVGPIGHFWYEGLDKFIRLRLVMRPNSLQFVAAKVAIDGFVFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  Q+KE +KRDFLPAL++E   WPV Q VNFR+VPV+YQLLYVN
Sbjct  118  DLLVFFTYMGFSAGKSVPQIKEDLKRDFLPALIVEGGIWPVVQGVNFRFVPVKYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
             F +LDS FLSW+EQQQ +A  KQ F S
Sbjct  178  FFCLLDSCFLSWIEQQQ-DAPWKQWFKS  204



>ref|XP_006475631.1| PREDICTED: PXMP2/4 family protein 2-like isoform X2 [Citrus sinensis]
Length=217

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 165/208 (79%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV PL+TQVISSG LW +GD+ AQ IT +T+K  RL +SD+  ++   
Sbjct  1    MLKLWKWYQNCLAVHPLKTQVISSGFLWGVGDIAAQYITHATAK-SRLQLSDA--DEKFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+ATKVA+D ++FGPL
Sbjct  58   VNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDSIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFS GK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  118  DLFVFFTYMGFSAGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  178  IFCLLDSAFLSWVE-QQKDAAWKQWFTS  204



>emb|CDX93025.1| BnaA03g37470D [Brassica napus]
Length=225

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML+VW WYQ  L+V P++TQVISSG LW  GDV AQ IT ST+K   L ++D+  + D  
Sbjct  1    MLKVWRWYQRCLSVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPPLLRLTDTNKDADAD  60

Query  386  --LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
                ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   SEFKLNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMG++TGK+ SQVKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGYATGKNTSQVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  181  LYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  211



>ref|XP_009627762.1| PREDICTED: protein Mpv17 [Nicotiana tomentosiformis]
Length=217

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 166/218 (76%), Gaps = 3/218 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LAV P++TQVISSG++W  GDV AQ++T  T+KK   L SD    K+  
Sbjct  1    MLRLWKWYQNCLAVHPVKTQVISSGLIWGFGDVAAQAVTHYTAKKHLHLRSDK--EKEFA  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G  F GP GHFWYEGLD+FI+L+ ++QP S++F+ATKVA+D ++FGPL
Sbjct  59   INWRRVATTSLFGFAFVGPVGHFWYEGLDRFIRLRLQMQPKSIRFVATKVALDGVIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMG+STGK+ +QV E +KRDFLPAL+LE   WP  Q  NFRY+PV+YQLLYVN
Sbjct  119  DLLVFFTYMGYSTGKNTAQVIEGVKRDFLPALILEGGIWPAVQVANFRYIPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             F +LDS FLSW+EQQ+ +A+ KQ   S+    E K++
Sbjct  179  FFCLLDSCFLSWIEQQE-DAAWKQWLKSIVRLKEQKEK  215



>ref|XP_010249717.1| PREDICTED: protein Mpv17 [Nelumbo nucifera]
Length=216

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 164/209 (78%), Gaps = 4/209 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSIT-ISTSKKQRLLISDSGSNKDL  388
            M R+W WYQ  LAV P++TQ++SSG LW +GDV AQ++T  ST KK RL  +D+  +++ 
Sbjct  2    MFRLWKWYQKCLAVHPVKTQIVSSGFLWGVGDVAAQTVTHYSTRKKNRLNYTDT--DEEF  59

Query  389  TIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGP  568
             I+ +RV IT M+G GF GP GHFWYEGLD+FI+++  LQP S +F+ATKVA+D L+FGP
Sbjct  60   KINWRRVAITSMFGFGFVGPVGHFWYEGLDRFIRMQLHLQPRSPRFVATKVAMDSLIFGP  119

Query  569  LNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYV  748
            L+L +FFTY+GFSTGKS +QVKE +KRDFLPAL+LE   WPV Q  NFR+VPV+YQLLYV
Sbjct  120  LDLFIFFTYIGFSTGKSVAQVKEDVKRDFLPALILEGGIWPVLQVANFRFVPVRYQLLYV  179

Query  749  NMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            N+F +LDS FLSW+EQQ+ +A  KQ F S
Sbjct  180  NVFCLLDSTFLSWIEQQE-DAPWKQWFTS  207



>ref|XP_010488566.1| PREDICTED: PXMP2/4 family protein 2-like [Camelina sativa]
Length=224

 Score =   266 bits (680),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLIS----DSGSN  379
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K + L ++    D  +N
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKTRLLRLTETNKDGDTN  60

Query  380  KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
             +  ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   AEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMG++TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGYATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  LYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  211



>ref|XP_008220028.1| PREDICTED: protein Mpv17-like isoform X1 [Prunus mume]
Length=220

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 166/220 (75%), Gaps = 4/220 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            M R+W WYQN LAV P++TQVISSG++W  GD+ AQ+IT ST+K QR  I   G ++D  
Sbjct  1    MFRLWKWYQNSLAVHPIKTQVISSGLIWGFGDIAAQTITHSTAKAQRQ-IQTQGEDEDEE  59

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
            L I+ +RV  T ++G GF GP GH WYEGLD++I+ +  LQPNS +F+A+KVA+D  +FG
Sbjct  60   LKINWRRVCTTSLFGFGFVGPVGHLWYEGLDRYIRSRLLLQPNSFRFVASKVAIDGFLFG  119

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            PL+LL+FFTYMGFS GKS  Q+KE +KRDFLPA +LE   WP+ Q VNFR++PV+YQLLY
Sbjct  120  PLDLLVFFTYMGFSAGKSVPQIKEDVKRDFLPAFVLEGGIWPIVQVVNFRFIPVRYQLLY  179

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            VN F +LDS+FLSWLEQQ+ +A  KQ   S+   NE KDE
Sbjct  180  VNFFCLLDSSFLSWLEQQE-DAPWKQWLKSLVYFNEQKDE  218



>ref|XP_007013158.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
2 [Theobroma cacao]
 gb|EOY30777.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
2 [Theobroma cacao]
Length=217

 Score =   266 bits (679),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 162/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQ+ L++ P++TQVISSG LW  GD+ AQ IT ST+KK RL   D    ++  
Sbjct  1    MLRMWKWYQSCLSLHPVKTQVISSGFLWGFGDIAAQYITHSTAKK-RLQYKDE--EQEFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT M+G GF GP GHFWYEGLD+FIK++  L+P S +F+ATKVA+D L+FGP 
Sbjct  58   VNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKMRLHLRPKSARFVATKVAMDGLIFGPF  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGKS +QVKE + RDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  118  DLFVFFTYMGFSTGKSVAQVKEDVMRDFLPALILEGGVWPIVQVANFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A  KQ F+S
Sbjct  178  IFCLLDSAFLSWIE-QQKDAPWKQRFSS  204



>ref|XP_010513603.1| PREDICTED: PXMP2/4 family protein 2-like [Camelina sativa]
Length=224

 Score =   266 bits (679),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K + L ++D+  + D  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKTRLLRLTDTNKDGDAH  60

Query  386  --LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
                ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   AEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMG++TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGYATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  LYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  211



>ref|XP_006298493.1| hypothetical protein CARUB_v10014569mg [Capsella rubella]
 gb|EOA31391.1| hypothetical protein CARUB_v10014569mg [Capsella rubella]
Length=224

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K + L I+++  + D+ 
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPRLLRITETNKDGDVD  60

Query  392  IDRK----RVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
             D K    RV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   ADFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMGF+TGK+ ++VKE +KRDF+PAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGFATGKNTAEVKEGLKRDFIPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  LYVNVFCLIDSAFLSWVE-QQKDAAWKQWFTS  211



>ref|XP_009783726.1| PREDICTED: protein Mpv17 [Nicotiana sylvestris]
Length=217

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 168/218 (77%), Gaps = 3/218 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LAV P++TQVISSG++W  GDV AQ++T  T+KK   L SD   +K+ +
Sbjct  1    MLRLWKWYQNCLAVHPVKTQVISSGLIWGFGDVAAQAVTHYTAKKHLHLRSDK--DKEFS  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G  F GP GHFWYEGLD+FI+L+ ++QP S++F+ATKVA+D ++FGPL
Sbjct  59   INWRRVATTSLFGFAFVGPVGHFWYEGLDRFIRLQLQMQPKSMRFVATKVALDGVIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMG+STGK+ +QV E +KRDFLPAL+LE   WP  Q  NFRY+PV+YQLLYVN
Sbjct  119  DLLVFFTYMGYSTGKNTAQVVEGVKRDFLPALILEGGIWPAVQVANFRYIPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             F +LDS FLSW+EQQ+ +A+ KQ   ++    E K++
Sbjct  179  FFCLLDSCFLSWIEQQE-DAAWKQWLKNIVRLKEQKEK  215



>ref|XP_002885656.1| hypothetical protein ARALYDRAFT_479971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61915.1| hypothetical protein ARALYDRAFT_479971 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLIS----DSGSN  379
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K + L ++    D+ ++
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPRLLRLTETNKDADAD  60

Query  380  KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
             +  ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   AEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  LYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  211



>ref|XP_003544665.1| PREDICTED: PXMP2/4 family protein 2 isoform 1 [Glycine max]
 gb|KHN42587.1| PXMP2/4 family protein 2 [Glycine soja]
Length=210

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 159/208 (76%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LAV P++TQVISSG++W  GD+ AQ++T  T+KK+  +  D+   K+  
Sbjct  1    MLRLWKWYQNCLAVHPVKTQVISSGLIWGAGDIAAQAVTHYTAKKR--VTFDADDTKEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G GF GP GHFWYEGLD+FI+LK  L+PNS +F+ATKVAVD  +FGPL
Sbjct  59   INWRRVSTTSLFGLGFVGPVGHFWYEGLDRFIRLKLMLKPNSFRFVATKVAVDGFIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  QVKE +KRDFLPA +LE   WP+ Q  NFR++PV+YQLLYVN
Sbjct  119  DLLVFFTYMGFSAGKSVPQVKEDVKRDFLPAFVLEGGIWPIVQVANFRFIPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
             F +LDS FLSW+EQQQ +A  KQ   S
Sbjct  179  FFCLLDSCFLSWVEQQQ-DAPWKQWLKS  205



>ref|XP_009136077.1| PREDICTED: PXMP2/4 family protein 2-like [Brassica rapa]
Length=225

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 162/212 (76%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML+VW WYQ  L+V P++TQVISSG LW  GDV AQ IT ST+K   L ++D+  + D  
Sbjct  1    MLKVWRWYQRCLSVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPPLLRLTDTNKDADAD  60

Query  386  --LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
                ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   SEFKLNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            F P++LL+FFTYMG++TGK+ SQVKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FCPIDLLVFFTYMGYATGKNTSQVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  181  LYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  211



>ref|XP_010093531.1| PXMP2/4 family protein 2 [Morus notabilis]
 gb|EXB54205.1| PXMP2/4 family protein 2 [Morus notabilis]
Length=217

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN LA  P++TQ+ISS ++W  GD+ AQ+IT +T+ +QR +      N++  
Sbjct  1    MLRLWKWYQNSLATHPVKTQMISSALIWGFGDIAAQTITHTTAIRQRRI---QDENEEFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G GF GP GHFWYEGLD+FI+++ RLQ NS  F+A KVA+D ++FGPL
Sbjct  58   INWKRVATTSLFGFGFVGPVGHFWYEGLDRFIRVRRRLQANSFWFVANKVAIDGIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  Q+KE +KRDFLPAL+LE   WPV Q VNFRY+PV+YQLLYVN
Sbjct  118  DLLVFFTYMGFSAGKSVPQIKEDVKRDFLPALILEGGVWPVVQIVNFRYIPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKD  862
             F +LDS FLSWLEQQQ +A  KQ   S+    E K+
Sbjct  178  FFCLLDSCFLSWLEQQQ-DAPWKQWVKSILHLKEEKE  213



>ref|XP_010466872.1| PREDICTED: PXMP2/4 family protein 2-like [Camelina sativa]
Length=225

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K + L ++++  + D  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKTRLLRLTETNKDGDAD  60

Query  386  --LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
                ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D L+
Sbjct  61   AKFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP++LL+FFTYMG++TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQYQL
Sbjct  121  FGPIDLLVFFTYMGYATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F ++DSAFLSW+E QQK+A+ KQ F +
Sbjct  181  LYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTT  211



>ref|XP_010527210.1| PREDICTED: PXMP2/4 family protein 2-like isoform X2 [Tarenaya 
hassleriana]
Length=225

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 165/212 (78%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLI----SDSGSN  379
            ML++W WYQ  LAV P++TQVISSG LW IGD+ AQ IT ST++++   I     D+ ++
Sbjct  1    MLKLWRWYQRCLAVHPVKTQVISSGFLWGIGDITAQYITHSTAQRRLHRIPNADKDTDAD  60

Query  380  KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
             +  ++ KRV IT M+G GF GP GHFWYEGLD+FIKL+   +P + +F+A KVA+D L+
Sbjct  61   AEFKVNWKRVAITSMFGFGFVGPIGHFWYEGLDRFIKLRLLYEPKTARFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP +LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL+LE  AWP+ Q  NFRYVPV+YQL
Sbjct  121  FGPFDLLVFFTYMGFATGKNPTEVKEGLKRDFLPALVLEGGAWPLLQIANFRYVPVRYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  181  LYVNIFCLLDSAFLSWVE-QQKDAAWKQWFTS  211



>ref|XP_010527208.1| PREDICTED: PXMP2/4 family protein 2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527209.1| PREDICTED: PXMP2/4 family protein 2-like isoform X1 [Tarenaya 
hassleriana]
Length=226

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 165/212 (78%), Gaps = 5/212 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLI----SDSGSN  379
            ML++W WYQ  LAV P++TQVISSG LW IGD+ AQ IT ST++++   I     D+ ++
Sbjct  1    MLKLWRWYQRCLAVHPVKTQVISSGFLWGIGDITAQYITHSTAQRRLHRIPNADKDTDAD  60

Query  380  KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
             +  ++ KRV IT M+G GF GP GHFWYEGLD+FIKL+   +P + +F+A KVA+D L+
Sbjct  61   AEFKVNWKRVAITSMFGFGFVGPIGHFWYEGLDRFIKLRLLYEPKTARFVAAKVAMDGLI  120

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGP +LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL+LE  AWP+ Q  NFRYVPV+YQL
Sbjct  121  FGPFDLLVFFTYMGFATGKNPTEVKEGLKRDFLPALVLEGGAWPLLQIANFRYVPVRYQL  180

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  181  LYVNIFCLLDSAFLSWVE-QQKDAAWKQWFTS  211



>ref|NP_189100.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 dbj|BAB02009.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76924.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=235

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 164/222 (74%), Gaps = 15/222 (7%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K++ L ++++  + D  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADAD  60

Query  386  ------------LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL  529
                          ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+
Sbjct  61   AEIKVKWKQDAEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFV  120

Query  530  ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVN  709
            A KVA+D L+FGP++LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  N
Sbjct  121  AAKVAMDGLIFGPVDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIAN  180

Query  710  FRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            FRYVPVQYQLLYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  FRYVPVQYQLLYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  221



>ref|XP_010667863.1| PREDICTED: protein sym-1 [Beta vulgaris subsp. vulgaris]
Length=216

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 157/200 (79%), Gaps = 3/200 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR+W WYQN L+V P++TQ+ISSGVLW +GD+ AQ+IT S +KK  L ISD    K L 
Sbjct  1    MLRLWRWYQNCLSVHPVKTQMISSGVLWGVGDIAAQTITFSMAKKS-LQISDK--EKKLE  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G GF GP GHFWYEGLD+F+K++ ++Q NS +F+ +KVA+D ++FGPL
Sbjct  58   INWKRVAATSLFGFGFIGPAGHFWYEGLDRFLKVRLKMQQNSFRFVGSKVALDGIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  Q+KE +KRDF+PAL LE   WP+ Q  NFRY+PV+YQLLYVN
Sbjct  118  DLLVFFTYMGFSNGKSVPQIKEDVKRDFIPALALEGGIWPILQVANFRYIPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEA  811
            +F +LDS FLSW+EQQQ  A
Sbjct  178  VFCLLDSCFLSWIEQQQDAA  197



>dbj|BAF00872.1| hypothetical protein [Arabidopsis thaliana]
Length=235

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 164/222 (74%), Gaps = 15/222 (7%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K++ L ++++  + D  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADAD  60

Query  386  ------------LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL  529
                          ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+
Sbjct  61   AEIKVKWKQDAEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDRFIKLKLRYVPKSTRFV  120

Query  530  ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVN  709
            A KVA+D L+FGP++LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  N
Sbjct  121  AAKVAMDGLIFGPVDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIAN  180

Query  710  FRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            FRYVPVQYQLLYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  FRYVPVQYQLLYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  221



>ref|XP_010550867.1| PREDICTED: protein Mpv17-like [Tarenaya hassleriana]
Length=213

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 165/208 (79%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKK--QRLLISDSGSNKD  385
            ML++W WYQ  L+V P++TQVISSG LW IGDV AQ IT ST+++   R+  +D  ++ +
Sbjct  1    MLKLWRWYQRCLSVHPVKTQVISSGFLWGIGDVTAQYITHSTAQRRLHRIPNADGEADAE  60

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
              ++ KRV IT M+G GF GP GHFWYEGLD+FIKL+   +P +++F+A KVA+D L+FG
Sbjct  61   FNVNWKRVAITSMFGFGFVGPIGHFWYEGLDRFIKLRLLYEPKTVRFVAAKVAMDGLIFG  120

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            P++LL FF+YMGF+TGK+ +QVKE +KRDFLPAL+LE  AWP+ Q  NFRYVPV+YQLLY
Sbjct  121  PVDLLAFFSYMGFATGKNPTQVKEDLKRDFLPALVLEGGAWPLLQIANFRYVPVRYQLLY  180

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCF  829
            VN+F ++DSAFLSW+E QQK+A+ KQ F
Sbjct  181  VNIFCLVDSAFLSWVE-QQKDAAWKQWF  207



>gb|AAR20751.1| At3g24570 [Arabidopsis thaliana]
 gb|AAS00345.1| At3g24570 [Arabidopsis thaliana]
Length=235

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 164/222 (74%), Gaps = 15/222 (7%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K++ L ++++  + D  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADAD  60

Query  386  ------------LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL  529
                          ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+
Sbjct  61   TEIKVKWKQDAEFKVNWKRVAITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFV  120

Query  530  ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVN  709
            A KVA+D L+FGP++LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  N
Sbjct  121  AAKVAMDGLIFGPVDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIAN  180

Query  710  FRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            FRYVPVQYQLLYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  181  FRYVPVQYQLLYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  221



>ref|XP_011043474.1| PREDICTED: protein Mpv17 isoform X2 [Populus euphratica]
Length=215

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 158/208 (76%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML+ W WYQ+ L+  P++TQ++SSG LW IGD+ AQ IT ST+     L+  S    +  
Sbjct  1    MLKAWKWYQHCLSSHPVKTQIVSSGTLWGIGDIGAQYITHSTATS---LLPKSNEGAEFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV IT M+G GF GP GHFWYEGLD+FI+L+F LQP S +F+ATKVA D ++FGP 
Sbjct  58   INWKRVAITSMFGFGFVGPVGHFWYEGLDKFIRLRFLLQPKSPRFVATKVAADGIIFGPF  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q VNFRYVPV+YQLLYVN
Sbjct  118  DLFVFFTYMGFSTGKNVAQVKEDVKRDFLPALILEGGVWPIFQVVNFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F ++DSAFLSW+E QQK A  KQ F S
Sbjct  178  VFCLIDSAFLSWIE-QQKNAPWKQWFTS  204



>ref|XP_002284227.1| PREDICTED: protein Mpv17 [Vitis vinifera]
 emb|CBI20895.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            +LR+W WYQ+ LAV P++TQ+ISSG++W  GD+ AQ+IT +T+K+   +      +K+L 
Sbjct  3    LLRLWKWYQDCLAVHPVKTQIISSGLIWGFGDICAQTITHTTAKRHHQI---GDEDKELK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G GF GP GHFWYEGLD+ I+ + +LQP S +F+A KVA+D ++FGPL
Sbjct  60   INWRRVATTSLFGFGFVGPVGHFWYEGLDRLIRHRLQLQPKSFRFVAAKVAIDGIIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGFSTGKS +QVKE +KRDFLPAL+LE   WP+ Q VNFR++PV+YQLLYVN
Sbjct  120  DLLVFFSYMGFSTGKSVAQVKEDVKRDFLPALILEGGIWPIVQVVNFRFIPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
             F +LDS+FLSW+EQQQ +A  KQ F S
Sbjct  180  FFCLLDSSFLSWVEQQQ-DAPWKQWFTS  206



>ref|XP_007226753.1| hypothetical protein PRUPE_ppa018859mg [Prunus persica]
 gb|EMJ27952.1| hypothetical protein PRUPE_ppa018859mg [Prunus persica]
Length=220

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 165/220 (75%), Gaps = 4/220 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            M R+W WYQN LAV P++TQVISSG++W  GD+ AQ+IT ST+K QR  I   G ++D  
Sbjct  1    MFRLWKWYQNSLAVHPIKTQVISSGLIWGFGDIAAQTITHSTAKAQRQ-IQAQGEDEDEE  59

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
            L I+ +RV  T ++G GF GP GH WYEGLD++I+ +  LQP S +F+A+KVA+D  +FG
Sbjct  60   LKINWRRVCTTSLFGFGFVGPVGHLWYEGLDRYIRSRLLLQPKSFRFVASKVAIDGFLFG  119

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            PL+LL+FFTYMGFS GKS  Q+KE +KRDFLPA +LE   WP+ Q VNFR++PV+YQLLY
Sbjct  120  PLDLLVFFTYMGFSAGKSVPQIKEDVKRDFLPAFVLEGGIWPIVQVVNFRFIPVRYQLLY  179

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            VN F +LDS+FLSWLEQQ+ +A  KQ   S+   N+ KDE
Sbjct  180  VNFFCLLDSSFLSWLEQQE-DAPWKQWLKSLVHFNKQKDE  218



>ref|XP_011043473.1| PREDICTED: protein Mpv17 isoform X1 [Populus euphratica]
Length=216

 Score =   261 bits (666),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 157/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML+ W WYQ+ L+  P++TQ++SSG LW IGD+ AQ IT ST+    LL        +  
Sbjct  1    MLKAWKWYQHCLSSHPVKTQIVSSGTLWGIGDIGAQYITHSTATS--LLPKSQNEGAEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV IT M+G GF GP GHFWYEGLD+FI+L+F LQP S +F+ATKVA D ++FGP 
Sbjct  59   INWKRVAITSMFGFGFVGPVGHFWYEGLDKFIRLRFLLQPKSPRFVATKVAADGIIFGPF  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q VNFRYVPV+YQLLYVN
Sbjct  119  DLFVFFTYMGFSTGKNVAQVKEDVKRDFLPALILEGGVWPIFQVVNFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F ++DSAFLSW+E QQK A  KQ F S
Sbjct  179  VFCLIDSAFLSWIE-QQKNAPWKQWFTS  205



>emb|CAN61516.1| hypothetical protein VITISV_033965 [Vitis vinifera]
Length=218

 Score =   261 bits (666),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 163/208 (78%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            +LR+W WYQ+ LAV P++TQ+ISSG++W  GD+ AQ+IT +T+K+   +      +K+L 
Sbjct  3    LLRLWKWYQDCLAVHPVKTQIISSGLIWGFGDICAQTITHTTAKRXHQI---GDEDKELK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G GF GP GHFWYEGLD+ I+ + +LQP S +F+A KVA+D ++FGPL
Sbjct  60   INWRRVATTSLFGFGFVGPVGHFWYEGLDRLIRHRLQLQPKSFRFVAAKVAIDGIIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGFSTGKS +QVKE +KRDFLPAL+LE   WP+ Q VNFR++PV+YQLLYVN
Sbjct  120  DLLVFFSYMGFSTGKSVAQVKEDVKRDFLPALILEGGIWPIVQVVNFRFIPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
             F +LDS+FLSW+EQQQ +A  KQ F S
Sbjct  180  FFCLLDSSFLSWVEQQQ-DAPWKQWFTS  206



>emb|CDX77411.1| BnaA07g05490D [Brassica napus]
Length=228

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 162/215 (75%), Gaps = 8/215 (4%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ-----RLLISDSGS  376
            M+++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K       RL   D  +
Sbjct  1    MIKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPPPPPLLRLSDKDKEA  60

Query  377  NKD--LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVD  550
            +KD    ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D
Sbjct  61   DKDAEFKVNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMD  120

Query  551  VLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQ  730
             L+FGP++LL+FFTYMG++TGK+ S+VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQ
Sbjct  121  GLIFGPIDLLVFFTYMGYATGKNTSEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQ  180

Query  731  YQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            YQLLYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  181  YQLLYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  214



>ref|XP_009102493.1| PREDICTED: PXMP2/4 family protein 2 isoform X1 [Brassica rapa]
Length=227

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 162/214 (76%), Gaps = 7/214 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ----RLLISDSGSN  379
            M+++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K      RL   D  ++
Sbjct  1    MIKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPPPPLLRLSDKDKEAD  60

Query  380  KD--LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
            KD    ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+D 
Sbjct  61   KDAEFKVNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDG  120

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
            L+FGP++LL+FFTYMG++TGK+ S+VKE +KRDFLPAL LE  AWP+ Q  NFRYVPVQY
Sbjct  121  LIFGPIDLLVFFTYMGYATGKNTSEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQY  180

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            QLLYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  181  QLLYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  213



>ref|XP_008393897.1| PREDICTED: protein SYM1-like [Malus domestica]
Length=218

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 165/219 (75%), Gaps = 3/219 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQN L+V P++TQVISSG++W  GD+ AQ+IT ST+++    I   G ++ L 
Sbjct  1    MFRLWKWYQNSLSVHPIKTQVISSGLIWGFGDITAQTITHSTAQESER-IQAQGEDEKLK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RVG T ++G GF GP GH WYEGLD++I+ +  LQPNS +F+A+KVA+D  +FGPL
Sbjct  60   INWRRVGTTSLFGFGFVGPVGHLWYEGLDRYIRSRLLLQPNSFRFVASKVAIDGFLFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  Q+K+ +KRDFLPA +LE   WP+ Q VNFR++PV+YQLLYVN
Sbjct  120  DLLVFFTYMGFSAGKSFPQIKQDVKRDFLPAFVLEGGVWPIVQVVNFRFIPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS-VPISNEPKDE  865
             F +LDS+FLSWLEQQQ +A  KQ   S V +S +  DE
Sbjct  180  FFCLLDSSFLSWLEQQQ-DAPWKQWLKSLVHVSKQNGDE  217



>ref|XP_004287433.1| PREDICTED: PXMP2/4 family protein 2-like [Fragaria vesca subsp. 
vesca]
Length=213

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 157/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M++VW WYQ  L+  PL+TQVISSG+LW +GD+ AQ IT ST++ +  L  D    +D  
Sbjct  2    MMKVWKWYQGCLSHHPLKTQVISSGLLWGVGDIAAQYITHSTTRNRLQLSHDKA--EDFK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KRV IT  +G  F GP GHFWYE LD+FIKLK  L  NS +F+A KVA+D L+FGPL
Sbjct  60   VNWKRVAITSTFGFAFVGPVGHFWYENLDKFIKLKLLLPTNSARFVAAKVAMDGLIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGK+  QVKE +KRDF+PAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  120  DLLVFFTYMGFSTGKNAEQVKEDLKRDFIPALILEGGVWPIVQVANFRYVPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDSAFLSW+E QQK+A+ KQ   S
Sbjct  180  IFCLLDSAFLSWVE-QQKDAAWKQWLTS  206



>ref|XP_010049080.1| PREDICTED: protein Mpv17-like [Eucalyptus grandis]
 gb|KCW81531.1| hypothetical protein EUGRSUZ_C02890 [Eucalyptus grandis]
Length=217

 Score =   258 bits (660),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 164/215 (76%), Gaps = 4/215 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQN L   P++TQ+ISSG++W  GDV AQ+IT ST+KK+   + D    K+L 
Sbjct  1    MSRLWKWYQNCLRDHPVKTQIISSGLIWGFGDVAAQAITHSTAKKRHHHLQDE--EKELK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV  T ++G GF GP GHFWYEGLD+FI+L+ ++QPNSL+F++ KVA+D  +FGPL
Sbjct  59   INWRRVATTSLFGFGFVGPVGHFWYEGLDRFIRLRLQMQPNSLRFVSAKVAIDGFLFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMG S GKS  QVKE +KRDFLPAL+LE + WP+ Q  NFR++PV+YQLLYVN
Sbjct  119  DLLVFFSYMGLSAGKSVPQVKEDVKRDFLPALILEGAFWPIIQVANFRFIPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS-VPISNE  853
             F +LDS FLSW+EQQ+ +A  K+   S +P++ E
Sbjct  179  FFCLLDSCFLSWMEQQE-DAPWKEWLKSLIPLTKE  212



>ref|XP_002516574.1| mpv17, putative [Ricinus communis]
 gb|EEF45915.1| mpv17, putative [Ricinus communis]
Length=213

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 161/217 (74%), Gaps = 4/217 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M+++W WY+N L + P++TQVISSG++W  GDV AQSIT  T+ KQ+     S   K + 
Sbjct  1    MMKLWKWYRNCLTLHPVKTQVISSGLIWGFGDVAAQSITNYTTNKQQ---CQSDKEKGVK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            +D KR   T ++G GF GP GHFWYEGLD F++L+  L PNSL+F+A+KVA+D ++FGPL
Sbjct  58   VDWKRAATTSLFGFGFVGPVGHFWYEGLDHFMRLRLVLHPNSLRFVASKVAIDSILFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFS GKS  Q+KE +KRD+LPAL+LE   WPV Q +NFR+VPV+YQLLYVN
Sbjct  118  DLFVFFTYMGFSNGKSVPQIKEDLKRDYLPALILEGGIWPVVQVLNFRFVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKD  862
             F +LDS FLSW+EQQQ +A+ K+ F  +   N P +
Sbjct  178  FFCLLDSCFLSWVEQQQ-DAAWKKWFQPLKDQNGPGE  213



>ref|XP_004498538.1| PREDICTED: PXMP2/4 family protein 2-like [Cicer arietinum]
Length=209

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQ  LAV P++TQVISSG++W  GD+ AQ +T  T+K +     D   NK+  
Sbjct  1    MLKLWRWYQKCLAVHPVKTQVISSGIIWGAGDIAAQCVTHYTAKTRTTTEDD---NKEFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G GF GP GH+WYEGLD+FI+LK  L+PNS  F+A KV  D  +FGPL
Sbjct  58   INWKRVSTTSLFGLGFVGPVGHYWYEGLDRFIRLKLMLKPNSFPFVAAKVGADGFLFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGKS  Q+KE +KRDFLPAL+LE   WPV Q  NFRYVPV+YQLLYVN
Sbjct  118  DLLVFFTYMGFSTGKSVPQIKEDVKRDFLPALILEGGIWPVVQVANFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQ  802
             F +LDS FLSW+EQQQ
Sbjct  178  FFCLLDSCFLSWVEQQQ  194



>gb|KHG09812.1| PXMP2/4 family protein 2 [Gossypium arboreum]
Length=233

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 161/221 (73%), Gaps = 14/221 (6%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ-------RLLISDS  370
            MLR+W WYQ+ L++ P++TQ+ISSG LW IGDV AQ IT ST+KK+        ++   +
Sbjct  1    MLRIWKWYQSCLSLHPVKTQIISSGFLWGIGDVAAQYITHSTAKKRLQYHKCIPMVYGQN  60

Query  371  GSNKDLTIDR------KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLA  532
            G N  +  D       KRV +T M+G GF GP GHFWYE LD+FIK++  L+P S +F+A
Sbjct  61   GFNDAMDDDNEFKVNWKRVAVTSMFGFGFVGPVGHFWYEELDKFIKMRLLLRPKSARFVA  120

Query  533  TKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNF  712
             KVA+D L+FGP +L +FFTYMGFS GKS +QVKE +KRDFLPAL+LE   WP+ Q  NF
Sbjct  121  AKVAMDGLIFGPFDLFVFFTYMGFSAGKSTAQVKEDVKRDFLPALILEGGVWPIVQVANF  180

Query  713  RYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            RYVPV+YQLLYVN+F +LDSAFLSW+E QQK+A  KQ F S
Sbjct  181  RYVPVRYQLLYVNIFCLLDSAFLSWIE-QQKDAPWKQRFTS  220



>ref|XP_009367921.1| PREDICTED: protein SYM1-like [Pyrus x bretschneideri]
Length=218

 Score =   256 bits (653),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 163/219 (74%), Gaps = 3/219 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQN L+V P++TQVISSG++W  GDV AQ+IT  T+++    I   G ++ L 
Sbjct  1    MFRLWKWYQNSLSVHPIKTQVISSGLIWGFGDVTAQTITHYTAQESEQ-IQAQGEDEKLK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RVG T ++G GF GP GH WYEGLD++I+ +  LQP S +F+A+KVA+D  +FGPL
Sbjct  60   INWRRVGTTSLFGFGFVGPVGHLWYEGLDRYIRSRLLLQPKSFRFVASKVAIDGFLFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFS GKS  QVKE +KRDFLPA +LE   WP+ Q VNFR++PV+YQLLYVN
Sbjct  120  DLLVFFTYMGFSAGKSFPQVKEDVKRDFLPAFVLEGGVWPIVQVVNFRFIPVRYQLLYVN  179

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS-VPISNEPKDE  865
             F +LDS+FLSWLEQQQ +A  KQ   S V +S +  +E
Sbjct  180  FFCLLDSSFLSWLEQQQ-DAPWKQWLKSLVHVSKQNGEE  217



>ref|XP_007135879.1| hypothetical protein PHAVU_010G165700g [Phaseolus vulgaris]
 gb|ESW07873.1| hypothetical protein PHAVU_010G165700g [Phaseolus vulgaris]
Length=215

 Score =   255 bits (652),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 163/219 (74%), Gaps = 4/219 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML+VW WYQN L+V P++TQV+SS +LW +GD+ AQ IT S +KK RL +SDS  +    
Sbjct  1    MLKVWNWYQNCLSVHPVKTQVVSSTILWGVGDLTAQFITHSATKK-RLQLSDS--DAKFM  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KR+ +T M+G GF GP GHFWYEGLD+FI+ K +L P S++F+ATKVA+D ++FGP 
Sbjct  58   VNWKRLAVTSMFGFGFVGPVGHFWYEGLDKFIRFKLQLMPKSVRFVATKVAMDSMIFGPF  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FF+YMG   GK+  +VKE +KR+++PAL+LE   W V Q  NF Y+PV+YQLLYVN
Sbjct  118  HLFVFFSYMGLCAGKNLPKVKEDLKRNYVPALVLEGGVWSVVQVFNFWYLPVKYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDEC  868
            +F +LDSAFLSWLE QQK+AS K+CF      NE   +C
Sbjct  178  LFCLLDSAFLSWLE-QQKDASWKKCFQVFHSKNEKGGQC  215



>ref|XP_010254106.1| PREDICTED: protein Mpv17-like [Nelumbo nucifera]
Length=305

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 160/208 (77%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQ  LAV P++TQ++SSG LW +GDV A ++T ST +K R    +S ++++  
Sbjct  93   MSRLWKWYQKCLAVHPVKTQIVSSGFLWGVGDVAATTVTHSTKEKYR---QNSDADEEFK  149

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV IT M+G GF GP GHFWYEGLD+FI+++  LQ  S + +ATKVA+D ++FGPL
Sbjct  150  INWRRVAITSMFGFGFVGPIGHFWYEGLDRFIRMRLHLQSKSGRSVATKVALDAIIFGPL  209

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGKS ++VKE +KRDFLPAL+LE   WP+ Q  NFR+VPV+YQLLYVN
Sbjct  210  DLFVFFTYMGFSTGKSVAEVKEDVKRDFLPALVLEGGVWPLLQVANFRFVPVRYQLLYVN  269

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDS FLSW+EQQ+ +A  KQ F S
Sbjct  270  VFCLLDSTFLSWIEQQE-DAPWKQWFTS  296



>ref|XP_002324248.2| hypothetical protein POPTR_0018s00810g [Populus trichocarpa]
 gb|EEF02813.2| hypothetical protein POPTR_0018s00810g [Populus trichocarpa]
Length=221

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQ+ISSGV+W  GD+ AQSIT  T+KK R +  +    K+L 
Sbjct  1    MLKLWKWYQNCLAVHPVKTQMISSGVIWGFGDIAAQSITHYTAKKYRQIKVE---EKELK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G  F GP GHFWYE LD+FI+ +  L+PNSL+F+  KVA+D ++FGPL
Sbjct  58   INWKRVTTTSLFGFAFVGPVGHFWYESLDRFIRSRLLLRPNSLRFVGAKVALDGIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF++GKS  Q+KE +KRDF+PAL+LE   WP+ Q  NFR+VPV+YQLLYVN
Sbjct  118  DLLVFFSYMGFASGKSVPQIKEDLKRDFVPALILEGGIWPIVQVGNFRFVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             F +LDS FLSWLEQQ+ +A  KQ   S+    E KD+
Sbjct  178  FFCLLDSCFLSWLEQQE-DAPWKQRLISLLSGKEKKDK  214



>gb|KDP33682.1| hypothetical protein JCGZ_07253 [Jatropha curcas]
Length=218

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 157/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQ+ L+  P++TQ+ISSG+LW IGD+ AQ IT ST+  +  L        +  
Sbjct  1    MLKLWKWYQHCLSSHPVKTQIISSGILWGIGDIGAQYITHSTAVNR--LKKSKDVEAEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ +RV IT M+G GF GP GHFWYEGLD+ I+L+ +L P S++F+ATKVA D ++FGP 
Sbjct  59   INWRRVAITSMFGFGFVGPVGHFWYEGLDKLIRLRLQLPPKSVRFVATKVAADGIIFGPF  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALILEGGVWPIVQIANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            MF +LDSAFLSW+EQQ  +A  KQ F S
Sbjct  179  MFCLLDSAFLSWIEQQN-DAPWKQWFTS  205



>ref|XP_002324994.1| peroxisomal membrane 22 kDa family protein [Populus trichocarpa]
 gb|EEF03559.1| peroxisomal membrane 22 kDa family protein [Populus trichocarpa]
Length=232

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 160/222 (72%), Gaps = 15/222 (7%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKK------QRLLISD--  367
            ML+ W WYQ+ L+  P++TQ++SSG LW IGD+ AQ IT ST+          L I D  
Sbjct  1    MLKAWKWYQHCLSSHPVKTQIVSSGTLWGIGDIGAQYITHSTATSLLPKSVTSLRIGDLL  60

Query  368  ------SGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL  529
                  +    +  I+ KRV IT M+G GF GP GHFWYEGLD+FI+L+F LQP S +F+
Sbjct  61   LVIYFKNNEGAEFKINWKRVAITSMFGFGFVGPVGHFWYEGLDRFIRLRFLLQPKSPRFV  120

Query  530  ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVN  709
            ATKVA D ++FGP +L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q VN
Sbjct  121  ATKVAADGIIFGPFDLFVFFTYMGFSTGKNVAQVKEDVKRDFLPALILEGGVWPIFQVVN  180

Query  710  FRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            FRYVPV+YQLLYVN+F ++DSAFLSW+E QQK+A  KQ F S
Sbjct  181  FRYVPVRYQLLYVNVFCLIDSAFLSWIE-QQKDAPWKQWFTS  221



>ref|XP_004503440.1| PREDICTED: protein SYM1-like [Cicer arietinum]
Length=220

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 3/219 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGS-NKDL  388
            ML+VW WY+N L++ P++TQVI+SGVLWA+GDV AQ IT S +  +RL +S S   +   
Sbjct  4    MLKVWNWYENRLSIHPVKTQVITSGVLWAVGDVTAQYITHSAAANKRLRLSVSDEVDAKF  63

Query  389  TIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGP  568
             ID +RV +T M+G GF GP GHFWYEGLD+FI LK +L   S++ +ATKVA+D L+FGP
Sbjct  64   VIDWRRVAVTSMFGFGFVGPVGHFWYEGLDKFITLKLQLMSKSMRSIATKVAMDGLIFGP  123

Query  569  LNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYV  748
            ++LL+FFTYMG S GK+  QVKE +KR+++PAL+LE   WP+ Q  NF YVPV+YQLLYV
Sbjct  124  VHLLVFFTYMGLSAGKNIPQVKEDLKRNYVPALILEGGVWPILQVFNFCYVPVKYQLLYV  183

Query  749  NMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            N F +LDSAFLSWLE Q+K+A  KQ F ++  SN  +D+
Sbjct  184  NFFCLLDSAFLSWLE-QKKDAPWKQWF-TLHSSNGKRDK  220



>ref|XP_010049672.1| PREDICTED: protein sym-1 [Eucalyptus grandis]
 gb|KCW82415.1| hypothetical protein EUGRSUZ_C03819 [Eucalyptus grandis]
Length=216

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 160/208 (77%), Gaps = 4/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML+VW WYQ+ L++ P++TQVISSGVLW +GDV AQ IT ST++  RL IS++  +    
Sbjct  1    MLKVWKWYQSCLSLHPVKTQVISSGVLWGVGDVAAQFITHSTAR-NRLQISEA--DAKFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ KR  IT ++G GF GP GH WY+GLD+FI+L+  L P S +F+A KVA+D ++FGP 
Sbjct  58   VNWKRTAITSLFGFGFVGPLGHLWYDGLDKFIRLRLLLPPKSAKFVAAKVAMDGIIFGPF  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FF+YMGF+ GK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  118  DLFVFFSYMGFAAGKNVAQVKEDVKRDFLPALILEGGVWPLVQIANFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            MF +LDSAFLSWLE QQK+A  KQ F S
Sbjct  178  MFCLLDSAFLSWLE-QQKDAPWKQWFTS  204



>ref|XP_008795056.1| PREDICTED: protein Mpv17 isoform X1 [Phoenix dactylifera]
Length=216

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQVISSG+LW +GDV AQ++T  T +K   L      +K+  
Sbjct  1    MLKLWRWYQNCLAVHPVKTQVISSGILWGLGDVGAQAVTHRTQRKHPQLTHQE--DKEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV IT M+G  F GP GH+WYE LD++I+++ +LQP SL+F+A KVA D L+FGPL
Sbjct  59   INWKRVAITSMFGFAFVGPVGHYWYEYLDRYIRVRLQLQPKSLKFVAAKVAADGLLFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF++G+S  QVKE +KRDFLPAL++    WP  Q  NFR+VPV+YQLLYVN
Sbjct  119  DLLIFFSYMGFASGRSADQVKEDVKRDFLPALIVGGGVWPFVQVANFRFVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDEC  868
             F +LDS+FLSW+E QQ +A  KQ F+S+    + K + 
Sbjct  179  FFCLLDSSFLSWIE-QQGDAPWKQWFSSIGTLEKQKGQA  216



>ref|XP_011026578.1| PREDICTED: protein Mpv17-like [Populus euphratica]
Length=216

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 161/217 (74%), Gaps = 4/217 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQ+ISSGV+W  GD+ AQSI+  T++K R +  +    K+L 
Sbjct  1    MLKLWKWYQNCLAVHPVKTQMISSGVIWGFGDIAAQSISHYTAEKYRQIKEE---KKELK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G  F GP GHFWYE LDQFI+ +  L PNSL+F+  KVA+D ++FGPL
Sbjct  58   INWKRVTTTSLFGFAFVGPVGHFWYESLDQFIRSRVLLHPNSLRFVGAKVALDGIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF++GKS  Q+KE +KRDF+PAL+LE   WP+ Q  NFR+VPV+YQLLYVN
Sbjct  118  DLLVFFSYMGFASGKSVPQIKEDLKRDFVPALILEGGIWPIVQVGNFRFVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKD  862
             F +LDS FLSWLEQQ+ +A  KQ   S+    E KD
Sbjct  178  FFCLLDSCFLSWLEQQE-DAPWKQWLISLLSGMEKKD  213



>ref|XP_003588541.1| Protein Mpv17 [Medicago truncatula]
 gb|AES58792.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
 gb|AFK44194.1| unknown [Medicago truncatula]
Length=214

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 150/200 (75%), Gaps = 4/200 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGS---NK  382
            ML++W WYQN LAV P++TQVISSG +W  GDV AQ +T  T+K  R + ++S S    K
Sbjct  1    MLKLWRWYQNCLAVHPVKTQVISSGFIWGAGDVAAQYVTHYTAK-TRGVTNESHSQDDKK  59

Query  383  DLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVF  562
            +  I+ KRV  T ++G  F GP GH+WYEGLD+FI+ +  L+PNS +F+A KV  D  +F
Sbjct  60   EFKINWKRVSTTSLFGLAFVGPVGHYWYEGLDKFIRHRLLLKPNSFRFVAAKVGADGFLF  119

Query  563  GPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLL  742
            GPL+LL+FFTYMGFSTGKS  Q+KE +KRDFLPAL+LE   WPV Q  NFRYVPV+YQLL
Sbjct  120  GPLDLLVFFTYMGFSTGKSVPQIKEDVKRDFLPALILEGGIWPVVQVANFRYVPVRYQLL  179

Query  743  YVNMFSMLDSAFLSWLEQQQ  802
            YVN F +LDS FLSW+EQQQ
Sbjct  180  YVNFFCLLDSCFLSWVEQQQ  199



>ref|XP_010915812.1| PREDICTED: protein Mpv17 isoform X1 [Elaeis guineensis]
Length=216

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 159/218 (73%), Gaps = 3/218 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQVISSG+LW +GD+ AQ++T S   K   L      +K+  
Sbjct  1    MLKLWRWYQNCLAVHPVKTQVISSGILWGLGDIGAQAVTHSIQTKHPQLTQQK--DKEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV IT M+G  F GP GH+WYE LD +I+++ +LQP SL+F+A KVA D L+FGPL
Sbjct  59   INWKRVAITSMFGFAFVGPVGHYWYEYLDHYIRVRLQLQPKSLKFVAAKVAADGLLFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF++G+S  QVKE +KRDFLPAL++    WP  Q  NFR+VPV+YQLLYVN
Sbjct  119  DLLIFFSYMGFASGRSVEQVKEDVKRDFLPALIVGGGVWPFVQVANFRFVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             F +LDS FLSW+E QQ +A  KQ F+S+    + K +
Sbjct  179  FFCLLDSCFLSWIE-QQGDAPWKQWFSSIGTLEKQKGQ  215



>ref|XP_010915813.1| PREDICTED: protein Mpv17 isoform X2 [Elaeis guineensis]
Length=215

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 160/218 (73%), Gaps = 4/218 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQVISSG+LW +GD+ AQ++T S   K   L   +  +K+  
Sbjct  1    MLKLWRWYQNCLAVHPVKTQVISSGILWGLGDIGAQAVTHSIQTKHPQL---TQKDKEFK  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV IT M+G  F GP GH+WYE LD +I+++ +LQP SL+F+A KVA D L+FGPL
Sbjct  58   INWKRVAITSMFGFAFVGPVGHYWYEYLDHYIRVRLQLQPKSLKFVAAKVAADGLLFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF++G+S  QVKE +KRDFLPAL++    WP  Q  NFR+VPV+YQLLYVN
Sbjct  118  DLLIFFSYMGFASGRSVEQVKEDVKRDFLPALIVGGGVWPFVQVANFRFVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             F +LDS FLSW+E QQ +A  KQ F+S+    + K +
Sbjct  178  FFCLLDSCFLSWIE-QQGDAPWKQWFSSIGTLEKQKGQ  214



>ref|XP_004139343.1| PREDICTED: PXMP2/4 family protein 2-like [Cucumis sativus]
 ref|XP_004165183.1| PREDICTED: PXMP2/4 family protein 2-like [Cucumis sativus]
 gb|KGN60615.1| hypothetical protein Csa_2G004160 [Cucumis sativus]
Length=212

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQN L   P++TQVISSG LW  GD+ AQ IT S +K    L + S + ++  
Sbjct  1    MFRLWKWYQNCLTFHPVKTQVISSGFLWGTGDIAAQYITHSATKTH--LPTSSDAVEEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRVGIT M+G GF GP GH WYEGLD+FI+LK +LQP S +F+  K+A+D L+FGP+
Sbjct  59   INWKRVGITSMFGFGFVGPVGHMWYEGLDRFIRLKLQLQPKSAKFVGAKLAMDGLIFGPI  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L+ FF+YMGF+ GK  ++VKE +KRD LPA +L  + WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLVFFFSYMGFANGKDVAEVKEDLKRDVLPAFILSGTVWPIIQVANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            MF +LDSAFLSW EQQ  +A  KQ F S
Sbjct  179  MFCLLDSAFLSWFEQQN-DAPWKQWFTS  205



>ref|XP_008458377.1| PREDICTED: protein Mpv17 [Cucumis melo]
Length=212

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQN L   P++TQVISSG LW  GD+ AQ IT S +K    L + S + ++  
Sbjct  1    MFRLWKWYQNCLTFHPVKTQVISSGFLWGTGDIAAQYITHSAAKTH--LPTSSDAVEEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRVGIT M+G GF GP GH WYEGLD+FI+LK +LQP S +F+  K+A+D L+FGP+
Sbjct  59   INWKRVGITSMFGFGFVGPVGHMWYEGLDRFIRLKLQLQPKSAKFVGAKLAMDGLIFGPI  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L+ FF+YMGF+ GK  ++VKE +KRD LPA +L  + WP+ Q  NFRYVPV+YQLLYVN
Sbjct  119  DLVFFFSYMGFANGKDVAEVKEDLKRDVLPAFILSGTVWPIIQVANFRYVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            MF +LDSAFLSW EQQ  +A  KQ F S
Sbjct  179  MFCLLDSAFLSWFEQQN-DAPWKQWFTS  205



>ref|XP_002514294.1| mpv17, putative [Ricinus communis]
 gb|EEF48248.1| mpv17, putative [Ricinus communis]
Length=224

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLL--ISDSGSNKD  385
            ML++W WYQ  L+  P++TQ++SSG LW+IGD+ AQ IT ST+    L   + +  +  +
Sbjct  1    MLKLWKWYQQCLSTHPVKTQIVSSGFLWSIGDIGAQYITHSTAVSLILFSNVLEQDAEAE  60

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
              I+ KRV ITG++G GF GP GH+WYEGLD+ ++L+F+L P SL+F+A KVA D L+F 
Sbjct  61   FKINWKRVAITGLFGFGFIGPLGHYWYEGLDKIMRLRFQLPPKSLRFVAAKVAADTLIFA  120

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            P +L +FFTYMG ++GKS +QVKE ++RDFLPA+++E S WP+ Q  NFRYVPV++QLLY
Sbjct  121  PFDLFVFFTYMGLASGKSVAQVKEDVRRDFLPAMIMEGSIWPIVQVANFRYVPVRHQLLY  180

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDECK*R  877
            VN F +LDSAFLSW E QQ +A  KQ F SV    E + + + R
Sbjct  181  VNTFCLLDSAFLSWFE-QQNDAPWKQWFTSVKPLKEREGQGQGR  223



>gb|KHN43686.1| Protein sym-1 [Glycine soja]
Length=215

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 162/219 (74%), Gaps = 4/219 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M++VW WYQN L+V P++TQ ISS +LW +GD+ AQ IT S +KK  L +SDS  +   T
Sbjct  1    MMKVWNWYQNCLSVHPVKTQAISSAILWGVGDLSAQYITHSAAKKP-LQLSDS--DAKFT  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+  R+ +T M+G GF GP GHFWYEGLD+FI+ K +L+P S++ +ATKVA+D ++FGPL
Sbjct  58   INWNRLVVTSMFGFGFVGPVGHFWYEGLDKFIRFKLQLKPKSVRSVATKVAMDGIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMG   GK+ +QVK+ +KR+++PAL+LE   WPV Q  NF Y+PV+YQLLYVN
Sbjct  118  HLFVFFTYMGLCAGKNVAQVKDDLKRNYVPALILEGGVWPVVQVFNFWYLPVKYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDEC  868
            +F +LDS FLSWLE QQK+   K+ FAS   +NE    C
Sbjct  178  LFCLLDSVFLSWLE-QQKDTPWKKWFASFHSTNEKGGRC  215



>gb|AFK43334.1| unknown [Lotus japonicus]
Length=209

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQVISSG++W  GD+ AQ++T  T+K +     D   N++  
Sbjct  1    MLKLWRWYQNCLAVHPVKTQVISSGLIWGAGDIAAQAVTNYTAKTRSATEDD---NREFR  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV  T ++G  F GP GH+WYEGLD+FI+L+  L+PNS +F+A KV  D  +FGPL
Sbjct  58   INWKRVSTTSLFGLAFVGPVGHYWYEGLDRFIRLRLMLKPNSFRFVAAKVGADGFLFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FFTYMGFSTGKS  Q+KE +KRDF PAL+LE   WPV Q  NFRY+PV+YQ LYVN
Sbjct  118  DLLVFFTYMGFSTGKSVPQIKEDVKRDFFPALILEGGIWPVVQVANFRYIPVRYQPLYVN  177

Query  752  MFSMLDSAFLSWLEQQQ  802
             F +L S FLSW+EQQQ
Sbjct  178  FFCLLGSCFLSWVEQQQ  194



>ref|XP_006450623.1| hypothetical protein CICLE_v10009403mg [Citrus clementina]
 ref|XP_006476141.1| PREDICTED: protein sym-1-like [Citrus sinensis]
 gb|ESR63863.1| hypothetical protein CICLE_v10009403mg [Citrus clementina]
Length=225

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 161/222 (73%), Gaps = 7/222 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ-----RLLISDSGS  376
            MLR+W WYQN LAV P++TQV+SSG++W  GDV AQSIT  T++ +          D+G+
Sbjct  1    MLRLWKWYQNCLAVHPVKTQVVSSGLIWGFGDVAAQSITHLTAQNRLHNQNEKSTEDTGN  60

Query  377  -NKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
             N +L ++  RV  T  +G  F GP GHFWYEGLD+FI+ +F +QPNS +F+ATKVA+D 
Sbjct  61   GNNELKLNWNRVAKTSFFGFAFVGPVGHFWYEGLDRFIRNRFLMQPNSPRFVATKVAIDG  120

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
             +FGPL+LL+FF+YMGF+ GKS  QVKE +KRDFLPAL+LE   WP+ Q  NFR+VPV Y
Sbjct  121  GLFGPLDLLVFFSYMGFAAGKSFPQVKEDVKRDFLPALILEGGLWPLLQVANFRFVPVPY  180

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPK  859
            QLLYVN+F +LDS FLSW+EQQ+ +A  KQ   S   S E K
Sbjct  181  QLLYVNIFCLLDSCFLSWIEQQE-DAPWKQWIKSFLPSKEKK  221



>gb|KHG20325.1| PXMP2/4 family protein 2 [Gossypium arboreum]
Length=207

 Score =   248 bits (632),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 157/209 (75%), Gaps = 4/209 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WY++ L++ P++TQV+SSG LW IGDV AQ IT  T+   RL   DS   ++  
Sbjct  1    MSRIWKWYKSCLSLHPVKTQVVSSGFLWGIGDVGAQYITHFTTN-TRLQYKDS--EQEFI  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D KRV IT M+G GF GP GH+WYEGLD+FIKL+ +L+P S++F+A KVA+D  +FGP 
Sbjct  58   TDWKRVAITSMFGFGFVGPAGHYWYEGLDRFIKLRLQLRPKSVKFVAAKVAMDGFIFGPF  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FF+YMG STGKS  +VK  +KRDF+PAL+LE   WP+ Q  NFRYVPV+YQLLYVN
Sbjct  118  DLFVFFSYMGLSTGKSVPEVKADVKRDFIPALILEGGIWPIVQIANFRYVPVRYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASV  838
            +F +LDSAFLSW+E QQK+A  K+ F SV
Sbjct  178  IFCLLDSAFLSWIE-QQKDAPWKRRFTSV  205



>gb|ACJ83986.1| unknown [Medicago truncatula]
Length=214

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 148/200 (74%), Gaps = 4/200 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGS---NK  382
            ML++W WYQN LAV P++TQVISSG +W  GDV AQ +T  T+K  R + ++S S    K
Sbjct  1    MLKLWRWYQNCLAVHPVKTQVISSGFIWGAGDVAAQYVTHYTAK-TRGVTNESHSQDDKK  59

Query  383  DLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVF  562
            +  I+ KRV  T ++G  F GP GH+WYEGLD+FI+ +  L+PNS +F+A KV  D  +F
Sbjct  60   EFKINWKRVSTTSLFGLAFVGPVGHYWYEGLDKFIRHRLLLKPNSFRFVAAKVGADGFLF  119

Query  563  GPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLL  742
            GPL+LL+FFTYMGFS GKS  Q+KE +KRDFLPAL+LE   WPV Q  NFRYVPV+YQLL
Sbjct  120  GPLDLLVFFTYMGFSAGKSVPQIKEDVKRDFLPALILEGGIWPVGQVANFRYVPVRYQLL  179

Query  743  YVNMFSMLDSAFLSWLEQQQ  802
            Y N F +LDS FLSW+EQQQ
Sbjct  180  YANFFCLLDSCFLSWVEQQQ  199



>ref|XP_004291212.1| PREDICTED: PXMP2/4 family protein 2-like [Fragaria vesca subsp. 
vesca]
Length=221

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 160/211 (76%), Gaps = 3/211 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDS--GSNKD  385
            M ++W WYQN L   P++TQVISSG++W +GD+ AQ+IT ST+ K   + + +  G +++
Sbjct  1    MFKLWKWYQNCLVSHPVKTQVISSGLIWGVGDIAAQTITHSTANKDNQIQTQTHQGEDEE  60

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
            L I+ +RV  T ++G GF GP GH WY+GLD++IK +  L+ NS +F+A+KVA+D  +FG
Sbjct  61   LKINWRRVIKTSLFGFGFVGPVGHLWYQGLDRYIKSRLLLKQNSFRFVASKVAIDGFLFG  120

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            PL+LL+FFTYMGF+ GKS  Q+KE +KRDFLPA +LE   WP+ Q VNFR+VPV+YQLLY
Sbjct  121  PLDLLVFFTYMGFAAGKSVPQIKEDVKRDFLPAFVLEGGIWPIVQVVNFRFVPVRYQLLY  180

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCFASV  838
            VN+F +LDS+FLSWLEQQ+ +AS KQ   S 
Sbjct  181  VNVFCLLDSSFLSWLEQQE-DASWKQWLKSC  210



>gb|KDO79717.1| hypothetical protein CISIN_1g041783mg [Citrus sinensis]
Length=225

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 158/214 (74%), Gaps = 7/214 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ-----RLLISDSGS  376
            MLR+W WYQN LAV P++TQV+SSG++W  GDV AQSIT  T++ +          D+G+
Sbjct  1    MLRLWKWYQNCLAVHPVKTQVVSSGLIWGFGDVAAQSITHLTAQNRLHNQNEKSTEDTGN  60

Query  377  -NKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
             N +L ++  RV  T  +G  F GP GHFWYEGLD+FI+ +F +QPNS +F+ATKVA+D 
Sbjct  61   GNNELKLNWNRVAKTSFFGFAFVGPVGHFWYEGLDRFIRNRFLMQPNSPRFVATKVAIDG  120

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
             +FGPL+LL+FF+YMGF+ GKS  QVKE +KRDFLPAL+LE   WP+ Q  NFR+VPV Y
Sbjct  121  GLFGPLDLLVFFSYMGFAAGKSFPQVKEDVKRDFLPALILEGGLWPLLQVANFRFVPVPY  180

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            QLLYVN+F +LDS FLSW+EQQ+ +A  KQ   S
Sbjct  181  QLLYVNIFCLLDSCFLSWIEQQE-DAPWKQWIKS  213



>ref|XP_003543277.1| PREDICTED: protein Mpv17-like [Glycine max]
Length=215

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M++VW WYQN L+V P++TQ ISS +LW +G + AQ IT S +KK  L +SDS  +   T
Sbjct  1    MMKVWNWYQNCLSVHPVKTQAISSAILWGVGYLSAQYITHSAAKKP-LQLSDS--DAKFT  57

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+  R+ +T M+G GF GP GHFWYEGLD+FI+ K +L+P S++ +ATKVA+D ++FGPL
Sbjct  58   INWNRLVVTSMFGFGFVGPVGHFWYEGLDKFIRFKLQLKPKSVRSVATKVAMDGIIFGPL  117

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +FFTYMG   GK+ +QVK+ +KR+++PAL+LE   WPV Q  NF Y+PV+YQLLYVN
Sbjct  118  HLFVFFTYMGLCAGKNVAQVKDDLKRNYVPALILEGGVWPVVQVFNFWYLPVKYQLLYVN  177

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDEC  868
            +F +LDS FLSWLE QQK+   K+ FAS   +NE    C
Sbjct  178  LFCLLDSVFLSWLE-QQKDTPWKKWFASFHSTNEKGGRC  215



>emb|CDY50613.1| BnaC03g44040D [Brassica napus]
Length=234

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 162/221 (73%), Gaps = 14/221 (6%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML+VW WYQ  L+V P++TQVISSG+LW  GDV AQ IT ST+K    L+  + +NKD  
Sbjct  1    MLKVWRWYQRCLSVHPVKTQVISSGLLWGFGDVTAQYITHSTAKPPPPLLRVTDTNKDKD  60

Query  392  IDR--------KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAV  547
             D         KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KVA+
Sbjct  61   ADADSEFKLNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAM  120

Query  548  DVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPV  727
            D L+FGP++LL+FFTYMG++TGK+ SQVKE +KRDFLPAL LE  AWP+ Q  NFRYVPV
Sbjct  121  DGLIFGPIDLLVFFTYMGYATGKNTSQVKEGLKRDFLPALALEGGAWPLLQIANFRYVPV  180

Query  728  -----QYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
                  YQLLYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  181  QYQLLYYQLLYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  220



>ref|XP_003630794.1| Protein SYM1 [Medicago truncatula]
 gb|AET05270.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=226

 Score =   243 bits (621),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 160/218 (73%), Gaps = 6/218 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSIT----ISTSKKQRLLISDSGSN  379
            +LR W WYQN L+V P+ TQV +SGVLWA+GDV AQ IT     S+S K+RL +S + + 
Sbjct  4    ILRAWNWYQNSLSVHPVRTQVATSGVLWAVGDVTAQYITHSAAASSSSKKRLQLSATKAA  63

Query  380  KD-LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVL  556
             D   ID +RV +T M+G GF GP GHFWYEGL++FI  K +L P + + +ATKVA+D L
Sbjct  64   DDKFVIDWRRVAVTSMFGVGFVGPVGHFWYEGLEKFISHKLQLMPQTARSVATKVAMDGL  123

Query  557  VFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQ  736
            +FGP++L +FF+YMG S GK+  +VKE +KR++ PAL+LE   WP+ Q  NFRYVPV+YQ
Sbjct  124  IFGPVHLFVFFSYMGLSAGKTIPEVKEDLKRNYFPALVLEGGVWPIVQVFNFRYVPVKYQ  183

Query  737  LLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISN  850
            LLYVN+F +LDSAFLSWLE QQK+A+ K+ F     +N
Sbjct  184  LLYVNLFCLLDSAFLSWLE-QQKDAAWKKWFQPFHSAN  220



>ref|XP_009413818.1| PREDICTED: protein Mpv17 [Musa acuminata subsp. malaccensis]
Length=216

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQ  LAV P++TQ++SSG LW +GD+ AQ++T  T + Q         NK++ 
Sbjct  1    MLKLWRWYQKCLAVHPVKTQIVSSGFLWGLGDIGAQAVTQRTLRHQSQ--DRKEENKEIN  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ID +RV  T M+G  F GP GH+WYE LD+ I+++ +LQP S++F+ TKV  D L+FGPL
Sbjct  59   IDWRRVATTSMFGFAFVGPVGHYWYEYLDRIIRVRLQLQPKSMKFVTTKVVADGLIFGPL  118

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMG ++G+S SQVKE +KRDFLPAL++  + WP+ Q  NFR+VPV+YQLLYVN
Sbjct  119  DLLIFFSYMGLASGRSISQVKEDVKRDFLPALIVGGTVWPIVQVANFRFVPVRYQLLYVN  178

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDS+FLSW+E QQ +A  KQ F S
Sbjct  179  LFCLLDSSFLSWIE-QQGDAPWKQWFTS  205



>gb|AFK36378.1| unknown [Medicago truncatula]
Length=226

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 159/218 (73%), Gaps = 6/218 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSIT----ISTSKKQRLLISDSGSN  379
            +LR W WYQN L+V P+ TQV +SGVLWA+GDV AQ IT     S+S K+RL +S + + 
Sbjct  4    ILRAWNWYQNSLSVHPVRTQVATSGVLWAVGDVTAQYITHSAAASSSSKKRLQLSATKAA  63

Query  380  KD-LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVL  556
             D    D +RV +T M+G GF GP GHFWYEGL++FI  K +L P + + +ATKVA+D L
Sbjct  64   DDKFVTDWRRVAVTSMFGVGFVGPVGHFWYEGLEKFISHKLQLMPQTARSVATKVAMDGL  123

Query  557  VFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQ  736
            +FGP++L +FF+YMG S GK+  +VKE +KR++ PAL+LE   WP+ Q  NFRYVPV+YQ
Sbjct  124  IFGPVHLFVFFSYMGLSAGKTIPEVKEDLKRNYFPALVLEGGVWPIVQVFNFRYVPVKYQ  183

Query  737  LLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISN  850
            LLYVN+F +LDSAFLSWLE QQK+A+ K+ F     +N
Sbjct  184  LLYVNLFCLLDSAFLSWLE-QQKDAAWKKWFQPFHSAN  220



>gb|ABK27083.1| unknown [Picea sitchensis]
Length=213

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ++R W WYQ  LA  P+ TQVISSG+LW  GD+ AQ ++ ST +KQR L S     K   
Sbjct  2    LMRAWKWYQTQLATNPVSTQVISSGLLWGTGDIGAQYVSFST-RKQRQLHSHDKEGKSFK  60

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ID KRV  T M+G  F GP GHFWYEGL+   +   RL+P+S QF+  K+A D L+FGP+
Sbjct  61   IDWKRVATTSMFGFAFVGPVGHFWYEGLEHVTRHSLRLRPSSWQFVTAKLAADSLLFGPV  120

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL FFTYMG ++GK+  +VK  +KRDFLPA M E   WP+ QAVNFR+VPV+YQLLYVN
Sbjct  121  HLLTFFTYMGLASGKTFDEVKRDVKRDFLPAFMTEGCVWPIVQAVNFRFVPVRYQLLYVN  180

Query  752  MFSMLDSAFLSWLEQQ  799
             F +LDSAFLSW EQQ
Sbjct  181  FFCLLDSAFLSWFEQQ  196



>ref|XP_007013157.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY30776.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
Length=274

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 165/262 (63%), Gaps = 55/262 (21%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ-RLLISDSGS----  376
            MLR+W WYQ+ L++ P++TQVISSG LW  GD+ AQ IT ST+KK+ +  +S  G+    
Sbjct  1    MLRMWKWYQSCLSLHPVKTQVISSGFLWGFGDIAAQYITHSTAKKRLQYKVSPKGNRTTQ  60

Query  377  ------------------NKDLTIDRKRVGITGMYGAGFFGPFGHFW-------------  463
                               ++  ++ KRV IT M+G GF GP GHFW             
Sbjct  61   CIAYSIFFSQFELNSFDEEQEFKVNWKRVAITSMFGFGFVGPVGHFWYILLPCSFPVVLG  120

Query  464  ------------------YEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                              YEGLD+FIK++  L+P S +F+ATKVA+D L+FGP +L +FF
Sbjct  121  VGRAFDRYSRFLLRLKNRYEGLDKFIKMRLHLRPKSARFVATKVAMDGLIFGPFDLFVFF  180

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            TYMGFSTGKS +QVKE + RDFLPAL+LE   WP+ Q  NFRYVPV+YQLLYVN+F +LD
Sbjct  181  TYMGFSTGKSVAQVKEDVMRDFLPALILEGGVWPIVQVANFRYVPVRYQLLYVNIFCLLD  240

Query  770  SAFLSWLEQQQKEASGKQCFAS  835
            SAFLSW+E QQK+A  KQ F+S
Sbjct  241  SAFLSWIE-QQKDAPWKQRFSS  261



>ref|XP_002457081.1| hypothetical protein SORBIDRAFT_03g000970 [Sorghum bicolor]
 gb|EES02201.1| hypothetical protein SORBIDRAFT_03g000970 [Sorghum bicolor]
Length=220

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 152/212 (72%), Gaps = 7/212 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRL----LISDSGSN  379
            M ++W WYQ  LA  P+ TQV+SSG+LW +GD+ AQ++T  +++  R        D+  N
Sbjct  1    MRQLWRWYQQCLATHPVRTQVVSSGILWGLGDIGAQAVTHYSARPDRRSSPPEDKDNKDN  60

Query  380  KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLV  559
            K+  +D KRVG+T  +G  F GP GH+WYE LD+FI+ +F  QPN+ +F+A+KVA D  +
Sbjct  61   KEFKVDWKRVGVTSSFGFAFVGPVGHYWYEYLDRFIRRRF--QPNTFKFVASKVAADGFL  118

Query  560  FGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            FGPL+LLLFF+Y+G   G+S  QVKE +KRDF+PAL+L  + WP  Q  NFR++PV+YQL
Sbjct  119  FGPLDLLLFFSYVGLGQGRSVEQVKEDVKRDFIPALVLGGTIWPAVQIANFRFIPVRYQL  178

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            LYVN+F +LDS FLSW+E QQ +AS KQ F S
Sbjct  179  LYVNLFCLLDSCFLSWIE-QQGDASWKQWFTS  209



>ref|NP_001151871.1| mpv17 protein [Zea mays]
 gb|ACG44705.1| mpv17 protein [Zea mays]
Length=225

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 153/217 (71%), Gaps = 12/217 (6%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITI-STSKKQRLLIS--------  364
            M R+W WYQ  LA  P+ TQV+SSG+LW +GD+ AQ++T  S S  +R   S        
Sbjct  1    MRRLWRWYQQCLAAHPVRTQVVSSGILWGLGDIGAQTVTYYSASPDRRGHDSSPPDPEDK  60

Query  365  DSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVA  544
            D+  NK+  +D KRVGIT  +G  F GP GH+WYE LD+ I+ +F  QPN+ +F+A+KVA
Sbjct  61   DNKDNKEFKVDWKRVGITSSFGFAFVGPVGHYWYEYLDRIIRRRF--QPNTFKFVASKVA  118

Query  545  VDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVP  724
             D  +FGPL+LLLFF+Y+G   G+S  QVKE +KRDF+PAL+L  + WP  Q  NFR+VP
Sbjct  119  ADGFLFGPLDLLLFFSYVGLGQGRSIEQVKEDVKRDFIPALVLGGTIWPAVQIANFRFVP  178

Query  725  VQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            V+YQLLYVN+F +LDS FLSW+E QQ +ASGK+ F S
Sbjct  179  VRYQLLYVNLFCLLDSCFLSWIE-QQGDASGKRWFTS  214



>ref|XP_002986637.1| hypothetical protein SELMODRAFT_124507 [Selaginella moellendorffii]
 gb|EFJ12200.1| hypothetical protein SELMODRAFT_124507 [Selaginella moellendorffii]
Length=233

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 147/209 (70%), Gaps = 13/209 (6%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQR------LLISDS-  370
            M   W+WYQ  LA +P+ TQ+++SG+LWA+GD+VAQS++ S  K+Q       ++  D  
Sbjct  1    MRSAWSWYQGQLAAKPVRTQIVTSGILWAVGDMVAQSVSASVEKRQHKSQAFTIIAIDPQ  60

Query  371  -----GSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLAT  535
                 G +KD  ++ KRVGI+ M+G GF GP GHFWYEGL+  +  K RL+P SL+FLAT
Sbjct  61   VEPGPGKDKD-GLNWKRVGISSMFGVGFVGPVGHFWYEGLEHLVHNKLRLRPKSLRFLAT  119

Query  536  KVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFR  715
            K+A D L+FGP++L+ FFTY G + GKS   V++ + RDF+PA + E + WPV Q VNFR
Sbjct  120  KLAADALIFGPIHLVAFFTYSGLAAGKSWEVVRQELGRDFIPAFLTEGAVWPVVQVVNFR  179

Query  716  YVPVQYQLLYVNMFSMLDSAFLSWLEQQQ  802
            +VPVQ+QLLYVN F +LDSAFLSW + Q 
Sbjct  180  FVPVQHQLLYVNFFCLLDSAFLSWFKHQN  208



>ref|NP_001189964.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AEE76925.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=222

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 154/222 (69%), Gaps = 28/222 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            ML++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K++ L ++++  + D  
Sbjct  1    MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADAD  60

Query  386  ------------LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL  529
                          ++ KRV IT MY             EGLD+FIKLK R  P S +F+
Sbjct  61   AEIKVKWKQDAEFKVNWKRVAITSMY-------------EGLDKFIKLKLRYVPKSTRFV  107

Query  530  ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVN  709
            A KVA+D L+FGP++LL+FFTYMGF+TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  N
Sbjct  108  AAKVAMDGLIFGPVDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIAN  167

Query  710  FRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            FRYVPVQYQLLYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  168  FRYVPVQYQLLYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  208



>ref|XP_002990770.1| hypothetical protein SELMODRAFT_132224 [Selaginella moellendorffii]
 gb|EFJ08219.1| hypothetical protein SELMODRAFT_132224 [Selaginella moellendorffii]
Length=233

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 146/209 (70%), Gaps = 13/209 (6%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQR------LLISDS-  370
            M   W+WYQ  LA +P+ TQ+++SG+LWA+GD+VAQS++ S  K+Q       ++  D  
Sbjct  1    MRSAWSWYQGQLAAKPVRTQIVTSGILWAVGDMVAQSVSASVEKRQHKSQAFTIIAIDPQ  60

Query  371  -----GSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLAT  535
                 G +KD  ++ KRVGI+ M+G GF GP GHFWYEGL+  +  K RL+P SL+FLAT
Sbjct  61   VEPGPGKDKD-GLNWKRVGISSMFGVGFVGPVGHFWYEGLEHLVHNKLRLRPKSLRFLAT  119

Query  536  KVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFR  715
            K+A D L+FGP++L+ FFTY G + GK    V++ + RDF+PA + E + WPV Q VNFR
Sbjct  120  KLAADALIFGPIHLVAFFTYSGLAAGKRWEVVRQELGRDFIPAFLTEGAVWPVVQVVNFR  179

Query  716  YVPVQYQLLYVNMFSMLDSAFLSWLEQQQ  802
            +VPVQ+QLLYVN F +LDSAFLSW + Q 
Sbjct  180  FVPVQHQLLYVNFFCLLDSAFLSWFKHQN  208



>gb|ACG28641.1| mpv17 protein [Zea mays]
 gb|ACN27233.1| unknown [Zea mays]
 gb|AFW80474.1| mpv17 protein [Zea mays]
Length=225

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 152/217 (70%), Gaps = 12/217 (6%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITI-STSKKQRLLIS--------  364
            M R+W WYQ  LA  P+ TQV+SSG+LW +GD+ AQ++T  S S  +R   S        
Sbjct  1    MRRLWRWYQQCLAAHPVRTQVVSSGILWGLGDIGAQTVTYYSASPDRRGHDSSPPDPEDK  60

Query  365  DSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVA  544
            D+  NK+  +D KRVGIT  +G  F GP GH+WYE LD+ I+ +F  QPN+ +F+A+KVA
Sbjct  61   DNKDNKEFKVDWKRVGITSSFGFAFVGPVGHYWYEYLDRIIRRRF--QPNTFKFVASKVA  118

Query  545  VDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVP  724
             D  +FGPL+LLLFF+Y+G   G+S  QVKE +KRDF+PAL+L  + WP  Q  NFR+VP
Sbjct  119  ADGFLFGPLDLLLFFSYVGLGQGRSIEQVKEDVKRDFIPALVLGGTIWPAVQIANFRFVP  178

Query  725  VQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            V+YQLLYVN+F +LDS FLSW+E QQ +AS K+ F S
Sbjct  179  VRYQLLYVNLFCLLDSCFLSWIE-QQGDASWKRWFTS  214



>ref|XP_006643936.1| PREDICTED: protein Mpv17-like [Oryza brachyantha]
Length=214

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 151/208 (73%), Gaps = 5/208 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W WYQ  LA  P+ TQV+SSGVLW +GD+ AQ++T   S+  R   ++   +K+  
Sbjct  1    MRRLWRWYQQCLATHPVRTQVVSSGVLWGLGDIGAQAVT-HYSRSHRAKNTED-KDKEFK  58

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ID KRVGIT  +G  F GP GH+WYE LD+FI  ++  QP + +F+A+KVA D L+FGP+
Sbjct  59   IDWKRVGITSSFGFAFVGPVGHYWYEYLDRFILRRY--QPKTFKFVASKVAADGLLFGPV  116

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LLLFF+Y+G ++G+S  QVK+ +KRDF+PAL+L  + WP  Q  NFR++PV+YQLLYVN
Sbjct  117  DLLLFFSYVGLASGRSVDQVKDDVKRDFVPALVLGGTVWPAVQIANFRFIPVRYQLLYVN  176

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +F +LDS FLSW+E QQ +A  KQ F S
Sbjct  177  LFCLLDSCFLSWIE-QQGDAPWKQWFTS  203



>ref|XP_003565929.1| PREDICTED: protein Mpv17 [Brachypodium distachyon]
Length=218

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISD-SGSNKDL  388
            M R+W WYQ  L+  P+ TQV+SSG+LWA+GD+ AQ++T ++  +    + +    +K+ 
Sbjct  1    MRRLWRWYQQCLSSHPVRTQVVSSGILWALGDIGAQAVTHNSGARSHHQVDNPQDKDKEF  60

Query  389  TIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGP  568
             +D KRVGIT  +G  F GP GH+WYE LD+F++ ++  Q +S +F+ATKVA D L+FGP
Sbjct  61   KVDWKRVGITSSFGFAFVGPVGHYWYEYLDRFVRRRY--QRSSFKFVATKVAADGLLFGP  118

Query  569  LNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYV  748
            L+L LFF+Y+G ++G+S  QVK+ +KRD +PAL+L  + WP  Q  NFR++PV+YQLLYV
Sbjct  119  LDLALFFSYVGLASGRSVEQVKDDVKRDIIPALVLGGAIWPAVQIANFRFIPVRYQLLYV  178

Query  749  NMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            N+F +LDS FLSW+E QQ +A+ KQ F S
Sbjct  179  NLFCLLDSCFLSWIE-QQGDAAWKQWFTS  206



>gb|EEC70229.1| hypothetical protein OsI_00998 [Oryza sativa Indica Group]
Length=222

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 149/214 (70%), Gaps = 9/214 (4%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSN----  379
            M R+W WYQ  LA  P+ TQV+SSG+LW +GD+ AQ++T  ++  +         N    
Sbjct  1    MRRLWRWYQQCLATHPVRTQVVSSGILWGLGDIGAQAVTHYSAPGRPRHHQHHAKNPTED  60

Query  380  --KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
              K+  ID KRVGIT  +G  F GP GH+WYE LD+FI  ++  QP + +F+A+KVA D 
Sbjct  61   KDKEFKIDWKRVGITSSFGFAFVGPVGHYWYEYLDRFILRRY--QPKTFKFVASKVAADG  118

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
            L+FGP++LLLFF+Y+G ++G+S  QVK+ +KRDF+PAL+L  + WP  Q  NFR++PV+Y
Sbjct  119  LLFGPVDLLLFFSYVGLASGRSVEQVKDDVKRDFIPALVLGGTIWPAVQIANFRFIPVRY  178

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            QLLYVN+F +LDS FLSW++ QQ +A  KQ F S
Sbjct  179  QLLYVNLFCLLDSCFLSWID-QQGDAPWKQWFTS  211



>ref|NP_001042476.1| Os01g0228300 [Oryza sativa Japonica Group]
 dbj|BAB78679.1| MpV17 transgene -like [Oryza sativa Japonica Group]
 dbj|BAF04390.1| Os01g0228300 [Oryza sativa Japonica Group]
 gb|EEE54158.1| hypothetical protein OsJ_00968 [Oryza sativa Japonica Group]
Length=222

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 149/214 (70%), Gaps = 9/214 (4%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSN----  379
            M R+W WYQ  LA  P+ TQV+SSG+LW +GD+ AQ++T  ++  +         N    
Sbjct  1    MRRLWRWYQQCLATHPVRTQVVSSGILWGLGDIGAQAVTHYSAPGRPRHHQHHAKNPPED  60

Query  380  --KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
              K+  ID KRVGIT  +G  F GP GH+WYE LD+FI  ++  QP + +F+A+KVA D 
Sbjct  61   KDKEFKIDWKRVGITSSFGFAFVGPVGHYWYEYLDRFILRRY--QPKTFKFVASKVAADG  118

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
            L+FGP++LLLFF+Y+G ++G+S  QVK+ +KRDF+PAL+L  + WP  Q  NFR++PV+Y
Sbjct  119  LLFGPVDLLLFFSYVGLASGRSVEQVKDDVKRDFIPALVLGGTIWPAVQIANFRFIPVRY  178

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            QLLYVN+F +LDS FLSW++ QQ +A  KQ F S
Sbjct  179  QLLYVNLFCLLDSCFLSWID-QQGDAPWKQWFTS  211



>ref|XP_010656323.1| PREDICTED: PXMP2/4 family protein 4 isoform X2 [Vitis vinifera]
Length=209

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = +2

Query  335  TSKKQRLLISDSGSN--KDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQ  508
             S    LL   + SN  +D  ID KR  IT M+G GF GP GHFWYEGLD+FI+L+  LQ
Sbjct  29   CSIHHSLLREKASSNLCQDFKIDWKRTAITSMFGFGFVGPVGHFWYEGLDRFIRLRLLLQ  88

Query  509  PNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAW  688
            P S++F+A+KVA+D L+FGP  L +FF++MGFSTGK+ +QVKE +KRDFLPAL++ES AW
Sbjct  89   PASVRFVASKVAMDSLIFGPFELFVFFSHMGFSTGKNAAQVKEDLKRDFLPALIVESGAW  148

Query  689  PVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNE  853
            P  Q VNFRYVPV+YQLLYVN+F +LDS FLSW+E QQK+AS KQ F+S P S E
Sbjct  149  PFVQVVNFRYVPVRYQLLYVNLFCLLDSIFLSWME-QQKDASWKQWFSSSPSSKE  202



>ref|XP_008220029.1| PREDICTED: PXMP2/4 family protein 4-like isoform X2 [Prunus mume]
Length=176

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD--  385
            M R+W WYQN LAV P++TQVISSG++W  GD+ AQ+IT ST+K QR  I   G ++D  
Sbjct  1    MFRLWKWYQNSLAVHPIKTQVISSGLIWGFGDIAAQTITHSTAKAQRQ-IQTQGEDEDEE  59

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
            L I+ +RV  T ++G GF GP GH WYEGLD++I+ +  LQPNS +F+A+KVA+D  +FG
Sbjct  60   LKINWRRVCTTSLFGFGFVGPVGHLWYEGLDRYIRSRLLLQPNSFRFVASKVAIDGFLFG  119

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQ  730
            PL+LL+FFTYMGFS GKS  Q+KE +KRDFLPA +LE   WP+ Q VNFR++PV+
Sbjct  120  PLDLLVFFTYMGFSAGKSVPQIKEDVKRDFLPAFVLEGGIWPIVQVVNFRFIPVR  174



>ref|XP_008230052.1| PREDICTED: PXMP2/4 family protein 4-like [Prunus mume]
Length=185

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = +2

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
            ++ D  ++ KRV IT  +G  F GP GHFWYEGLD+FIKLK  LQP S +F+A KVA+D 
Sbjct  20   TDADFKVNWKRVAITSTFGFAFVGPVGHFWYEGLDKFIKLKLHLQPKSARFVAAKVAMDG  79

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
            L+FGPL+LL+FFTYMGFSTGK+  QVKE +KRDFLPAL LE   WP+ Q  NFRYVPV+Y
Sbjct  80   LIFGPLDLLVFFTYMGFSTGKNSVQVKEDLKRDFLPALALEGGVWPIVQIANFRYVPVRY  139

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            QLLYVN+F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  140  QLLYVNVFCLLDSAFLSWVE-QQKDAAWKQWFTS  172



>ref|XP_008795057.1| PREDICTED: protein Mpv17 isoform X2 [Phoenix dactylifera]
Length=186

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 141/219 (64%), Gaps = 33/219 (15%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML++W WYQN LAV P++TQ                                   +K+  
Sbjct  1    MLKLWRWYQNCLAVHPVKTQ--------------------------------HQEDKEFK  28

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            I+ KRV IT M+G  F GP GH+WYE LD++I+++ +LQP SL+F+A KVA D L+FGPL
Sbjct  29   INWKRVAITSMFGFAFVGPVGHYWYEYLDRYIRVRLQLQPKSLKFVAAKVAADGLLFGPL  88

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF++G+S  QVKE +KRDFLPAL++    WP  Q  NFR+VPV+YQLLYVN
Sbjct  89   DLLIFFSYMGFASGRSADQVKEDVKRDFLPALIVGGGVWPFVQVANFRFVPVRYQLLYVN  148

Query  752  MFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDEC  868
             F +LDS+FLSW+E QQ +A  KQ F+S+    + K + 
Sbjct  149  FFCLLDSSFLSWIE-QQGDAPWKQWFSSIGTLEKQKGQA  186



>gb|KDO48890.1| hypothetical protein CISIN_1g027783mg [Citrus sinensis]
Length=173

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  353  LLISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLA  532
            + ++   +++   ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+A
Sbjct  1    MCLTGQDADEKFKVNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVA  60

Query  533  TKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNF  712
            TKVA+D ++FGPL+L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q  NF
Sbjct  61   TKVAMDSIIFGPLDLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANF  120

Query  713  RYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            RYVPV+YQLLYVN+F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  121  RYVPVRYQLLYVNIFCLLDSAFLSWVE-QQKDAAWKQWFTS  160



>ref|XP_009102494.1| PREDICTED: PXMP2/4 family protein 2 isoform X2 [Brassica rapa]
Length=201

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = +2

Query  356  LISDSGSNKD--LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL  529
            L  D  ++KD    ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+
Sbjct  27   LDKDKEADKDAEFKVNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFV  86

Query  530  ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVN  709
            A KVA+D L+FGP++LL+FFTYMG++TGK+ S+VKE +KRDFLPAL LE  AWP+ Q  N
Sbjct  87   AAKVAMDGLIFGPIDLLVFFTYMGYATGKNTSEVKEGLKRDFLPALALEGGAWPLLQIAN  146

Query  710  FRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            FRYVPVQYQLLYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  147  FRYVPVQYQLLYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  187



>gb|KDO48889.1| hypothetical protein CISIN_1g027783mg [Citrus sinensis]
Length=184

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +2

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
            +++   ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+ATKVA+D 
Sbjct  19   ADEKFKVNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVATKVAMDS  78

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
            ++FGPL+L +FFTYMGFSTGK+ +QVKE +KRDFLPAL+LE   WP+ Q  NFRYVPV+Y
Sbjct  79   IIFGPLDLFVFFTYMGFSTGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANFRYVPVRY  138

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            QLLYVN+F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  139  QLLYVNIFCLLDSAFLSWVE-QQKDAAWKQWFTS  171



>ref|XP_006451172.1| hypothetical protein CICLE_v10009440mg [Citrus clementina]
 gb|ESR64412.1| hypothetical protein CICLE_v10009440mg [Citrus clementina]
Length=173

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  353  LLISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLA  532
            + ++   +++   ++ KRV +T  +G GF GP GHFWYEGLD+FI+LK +L P S +F+A
Sbjct  1    MCLTGQDADEKFKVNWKRVAVTSSFGFGFVGPVGHFWYEGLDRFIRLKLQLPPKSARFVA  60

Query  533  TKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNF  712
            TKVA+D ++FGPL+L +FFTYMGFS GK+ +QVKE +KRDFLPAL+LE   WP+ Q  NF
Sbjct  61   TKVAMDSIIFGPLDLFVFFTYMGFSAGKNVAQVKEDLKRDFLPALVLEGGIWPIVQVANF  120

Query  713  RYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            RYVPV+YQLLYVN+F +LDSAFLSW+E QQK+A+ KQ F S
Sbjct  121  RYVPVRYQLLYVNIFCLLDSAFLSWVE-QQKDAAWKQWFTS  160



>emb|CDY39538.1| BnaC07g07060D [Brassica napus]
Length=290

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +2

Query  362  SDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKV  541
             ++  + +  ++ KRV IT M+G GF GP GHFWYEGLD+FIKLK R  P S +F+A KV
Sbjct  120  KEADRDAEFKVNWKRVAITSMFGLGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKV  179

Query  542  AVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYV  721
            A+D L+FGP++LL+FFTYMG++TGK+ S+VKE +KRDFLPAL LE  AWP+ Q  NFRYV
Sbjct  180  AMDGLIFGPIDLLVFFTYMGYATGKNTSEVKEGLKRDFLPALALEGGAWPLLQIANFRYV  239

Query  722  PVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            PVQYQLLYVN+F ++DSAFLSW++ QQK+A+ KQ F +
Sbjct  240  PVQYQLLYVNIFCLIDSAFLSWVD-QQKDAAWKQWFTT  276


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLL  358
            M+++W WYQ  L V P++TQVISSG LW  GDV AQ IT ST+K   LL
Sbjct  1    MIKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKPPPLL  49



>ref|XP_001756423.1| predicted protein [Physcomitrella patens]
 gb|EDQ78819.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 141/217 (65%), Gaps = 6/217 (3%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQ----RLLISDSGSNKD  385
            + W WYQ  LA  P+ TQ+I+SGVLWA GD  AQSI+    ++Q     L+  DS     
Sbjct  10   QAWGWYQAKLAQSPVRTQMITSGVLWAAGDYCAQSISRDIGRRQVVKKGLVAVDSEKKVV  69

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
             + D KRV +   +G GF GP GH WYEGL+ F+    +L+ NS+ F+ATKVA DVLVFG
Sbjct  70   ESTDWKRVALASSFGVGFVGPIGHLWYEGLETFVMKGLKLRVNSVSFIATKVACDVLVFG  129

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            P++LL FF+YMG  +G   + VK  ++RDF+P  M E   W V Q  NFR +PV++QLLY
Sbjct  130  PIHLLAFFSYMGLMSGVPWATVKRDVERDFIPTYMTEGLGWGVVQVANFRLIPVRHQLLY  189

Query  746  VNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEP  856
            VN+F +LDSAFLSW++ Q  +A  K+   S+ +S +P
Sbjct  190  VNVFCLLDSAFLSWVKHQD-DAPWKRYLTSL-VSKKP  224



>ref|XP_007012049.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
3, partial [Theobroma cacao]
 gb|EOY29668.1| Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein isoform 
3, partial [Theobroma cacao]
Length=144

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = +2

Query  437  FFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGK  616
            F GP GH+WYEGLD++I+L+  LQPNS +F+ATKVA+D  +FGPL+LL+FFTYMGFS GK
Sbjct  1    FVGPVGHYWYEGLDRYIRLRLCLQPNSFRFVATKVAIDGFIFGPLDLLVFFTYMGFSAGK  60

Query  617  SGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQ  796
            S  QVKE +KRDF+PALMLE   WP+ Q  NFRY+PV+YQLLYVN F +LDS FLSW+EQ
Sbjct  61   SFPQVKENVKRDFVPALMLEGGVWPIVQVANFRYIPVRYQLLYVNFFCLLDSCFLSWIEQ  120

Query  797  QQKEASGKQCFASVPISNEPKDE  865
            Q+ +A  KQ   S+  S E + +
Sbjct  121  QE-DAPWKQWLNSLLPSKEKRGQ  142



>gb|ACH73030.1| hypothetical protein [Ziziphus jujuba]
Length=173

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +2

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
             +K+  I+ KRV  T  +G GF GP GHFWYEGLD+ I+L+ RL+P S +F+ATKVAVD 
Sbjct  8    EDKEFKINWKRVATTSFFGLGFVGPVGHFWYEGLDRIIRLRLRLRPKSFRFVATKVAVDG  67

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
             +FGPL+LL+FFTYMGFSTGKS  Q+KE +KRDFLPA +LE   WPV Q VNFR+VPV+Y
Sbjct  68   FLFGPLDLLVFFTYMGFSTGKSVPQIKEDVKRDFLPAFLLEGGVWPVLQVVNFRFVPVRY  127

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQ  823
            QLLYVN F +LDS  LSW+EQQ+ +A  KQ
Sbjct  128  QLLYVNFFCILDSCLLSWIEQQE-DAQWKQ  156



>ref|XP_008798737.1| PREDICTED: PXMP2/4 family protein 4-like isoform X4 [Phoenix 
dactylifera]
Length=171

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 122/162 (75%), Gaps = 3/162 (2%)
 Frame = +2

Query  368  SGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAV  547
            +  +K+L I+ KRV IT M+G  + GP GH+WYE LD++I+++ +LQP SL+F+  KVA 
Sbjct  6    TQEDKELKINWKRVAITSMFGFAYVGPVGHYWYEYLDRYIRVRLQLQPKSLKFVTAKVAA  65

Query  548  DVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPV  727
            D L+  PL+L +FF+YMGF++G+S  QVKE +KRDFLPAL++ +  WP  Q  NFR+VPV
Sbjct  66   DELLCWPLDLPIFFSYMGFASGRSVDQVKEDVKRDFLPALVVGAGVWPFLQVANFRFVPV  125

Query  728  QYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNE  853
            +YQLLYVN+F +LDS+FLSW+E QQ +A  KQ F  +PI  +
Sbjct  126  RYQLLYVNLFCLLDSSFLSWIE-QQGDAPWKQWF--IPIVTQ  164



>ref|XP_008798664.1| PREDICTED: PXMP2/4 family protein 4-like isoform X3 [Phoenix 
dactylifera]
Length=172

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 121/160 (76%), Gaps = 3/160 (2%)
 Frame = +2

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDV  553
             +K+L I+ KRV IT M+G  + GP GH+WYE LD++I+++ +LQP SL+F+  KVA D 
Sbjct  9    EDKELKINWKRVAITSMFGFAYVGPVGHYWYEYLDRYIRVRLQLQPKSLKFVTAKVAADE  68

Query  554  LVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQY  733
            L+  PL+L +FF+YMGF++G+S  QVKE +KRDFLPAL++ +  WP  Q  NFR+VPV+Y
Sbjct  69   LLCWPLDLPIFFSYMGFASGRSVDQVKEDVKRDFLPALVVGAGVWPFLQVANFRFVPVRY  128

Query  734  QLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNE  853
            QLLYVN+F +LDS+FLSW+E QQ +A  KQ F  +PI  +
Sbjct  129  QLLYVNLFCLLDSSFLSWIE-QQGDAPWKQWF--IPIVTQ  165



>ref|XP_002986651.1| hypothetical protein SELMODRAFT_446690 [Selaginella moellendorffii]
 gb|EFJ12214.1| hypothetical protein SELMODRAFT_446690 [Selaginella moellendorffii]
Length=232

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 132/205 (64%), Gaps = 11/205 (5%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTID  397
            R W+WY++ LA RP+ TQ I SG+LW  GDV+AQ I  S              +++  ID
Sbjct  5    RAWSWYRSQLAARPVRTQAIVSGILWGSGDVIAQKINASMQD----------DDEERPID  54

Query  398  RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNL  577
             KR     ++G GF GP GH+WY+GLD+F+K K  L PNS +F+  K+  D L+  P++L
Sbjct  55   LKRTAACCIFGLGFVGPAGHYWYQGLDRFVKRKLLLTPNSPRFIVAKLVPDALL-EPVHL  113

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
             LFF+ MGF+ GK  SQV   +KRD +PAL+     WP+ QAVNFR+VPV++QLLY+N  
Sbjct  114  GLFFSLMGFTAGKPSSQVFADVKRDIVPALLSGGMVWPLLQAVNFRFVPVEHQLLYLNSL  173

Query  758  SMLDSAFLSWLEQQQKEASGKQCFA  832
             +L+SAFLSW+ +Q+  A  K+  A
Sbjct  174  CLLESAFLSWVNKQEDAAWKKKLMA  198



>ref|XP_002990761.1| hypothetical protein SELMODRAFT_448158 [Selaginella moellendorffii]
 gb|EFJ08210.1| hypothetical protein SELMODRAFT_448158 [Selaginella moellendorffii]
Length=228

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 132/205 (64%), Gaps = 11/205 (5%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTID  397
            R W+WY++ LA RP+ TQ I SG+LW  GDV+AQ I  S              +++  ID
Sbjct  5    RAWSWYRSQLAARPVRTQAIVSGILWGSGDVIAQKINASMQD----------DDEERPID  54

Query  398  RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNL  577
             KR     ++G GF GP GH+WY+GLD+F+K K  L PNS +F+  K+  D L+  P++L
Sbjct  55   LKRTAACCIFGLGFVGPAGHYWYQGLDRFVKKKLLLTPNSPRFIVAKLVPDALL-EPVHL  113

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
             LFF+ MGF+ GK  SQV   +KRD +PAL+     WP+ QAVNFR+VPV++QLLY+N  
Sbjct  114  GLFFSLMGFTAGKPSSQVFADVKRDIVPALVSGGMVWPLLQAVNFRFVPVEHQLLYLNSL  173

Query  758  SMLDSAFLSWLEQQQKEASGKQCFA  832
             +L+SAFLSW+ +Q+  A  K+  A
Sbjct  174  CLLESAFLSWVNKQEDAAWKKKLMA  198



>dbj|BAJ90837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = +2

Query  359  ISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATK  538
            IS S  +K+  ID KRVGIT  +G  F GP GH+WY+ LD  ++   R QP S +F+A+K
Sbjct  32   ISTSDKDKEFKIDWKRVGITSSFGFAFVGPVGHYWYDYLDCLVRR--RYQPGSFKFVASK  89

Query  539  VAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRY  718
            VA D L+FGPL+L LFF+Y+G ++G+S  QVKE +KRD +PAL+L  + WP  Q  NFR+
Sbjct  90   VAADGLLFGPLDLGLFFSYVGLASGRSLEQVKEDVKRDIIPALVLGGAIWPAVQIANFRF  149

Query  719  VPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            +PV+YQLLYVN+F +LDS FLSW+E QQ +A+ KQ F S
Sbjct  150  IPVRYQLLYVNLFCLLDSCFLSWIE-QQGDAAWKQWFPS  187



>ref|XP_006382060.1| hypothetical protein POPTR_0006s25930g [Populus trichocarpa]
 gb|ERP59857.1| hypothetical protein POPTR_0006s25930g [Populus trichocarpa]
Length=161

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 121/194 (62%), Gaps = 33/194 (17%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            ML +W WYQN LAV P++ QVISSG +W  GD+ A+SI   T+KK   +           
Sbjct  1    MLELWKWYQNCLAVHPVKKQVISSGFIWGFGDIAAKSIAHHTAKKYHQI-----------  49

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
                +V + G                   +FI+ +  ++PNSL+F+  KVA+D  +FGPL
Sbjct  50   ----KVCMKGC------------------RFIRSRLLMRPNSLRFVGAKVAIDGFLFGPL  87

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +LL+FF+YMGF+TGKS  Q+++ +KRD +PA +LE    P+ +  NFR+VPV+YQLLYVN
Sbjct  88   DLLVFFSYMGFATGKSVPQIRKDLKRDLIPAFVLEGGIRPIVRVANFRFVPVRYQLLYVN  147

Query  752  MFSMLDSAFLSWLE  793
             F +LDS FLSWLE
Sbjct  148  FFCLLDSCFLSWLE  161



>ref|XP_010497744.1| PREDICTED: protein SYM1-like, partial [Camelina sativa]
Length=122

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +2

Query  464  YEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETI  643
            YEGLD+FIKLK R  P S +F+A KVA+D L+FGP++LL+FFTYMG++TGK+ ++VKE +
Sbjct  3    YEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLIFGPIDLLVFFTYMGYATGKNTAEVKEGL  62

Query  644  KRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQ  823
            KRDFLPAL LE  AWP+ Q  NFRYVPVQYQLLYVN+F ++DSAFLSW+E QQK+A+ KQ
Sbjct  63   KRDFLPALALEGGAWPLLQIANFRYVPVQYQLLYVNIFCLVDSAFLSWVE-QQKDAAWKQ  121



>ref|XP_006833304.1| hypothetical protein AMTR_s00109p00044680 [Amborella trichopoda]
 gb|ERM98582.1| hypothetical protein AMTR_s00109p00044680 [Amborella trichopoda]
Length=138

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +2

Query  464  YEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETI  643
            YEGLD+ +K +FRL P SL+F+A+KVA+D L+FGPL+L +FF+YMGFSTGK+ +QVKE +
Sbjct  5    YEGLDRVMKNRFRLPPKSLRFVASKVAIDGLIFGPLDLFVFFSYMGFSTGKTAAQVKEDV  64

Query  644  KRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQ  823
            KRDF+PA +LE + WP  Q  NFR+VPV+YQLLYVN+F +LDSAFLSW+E QQK+A  KQ
Sbjct  65   KRDFIPAFVLEGAIWPAVQMANFRFVPVRYQLLYVNIFCLLDSAFLSWVE-QQKDAPWKQ  123

Query  824  CFAS  835
             F S
Sbjct  124  WFTS  127



>ref|XP_010541768.1| PREDICTED: PXMP2/4 family protein 2-like [Tarenaya hassleriana]
Length=143

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 106/147 (72%), Gaps = 5/147 (3%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M+R+W WYQN LA+ P++TQVISSGV+W  GD++AQ+IT  T KK  L   +   N+   
Sbjct  1    MMRMWKWYQNCLAIHPVKTQVISSGVIWGSGDILAQTITQRTGKKH-LRQDEDERNESKK  59

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            ++ +RV    +YG GF GPFGHFWYEGLD+ IK + RLQP S +F+A KVA+D  +FGPL
Sbjct  60   LNWRRVAAASLYGLGFVGPFGHFWYEGLDRVIKTRLRLQPKSFKFVAAKVALDGFIFGPL  119

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRD  652
            +LL+F +YMGF+TGKS    KET  R+
Sbjct  120  DLLVFLSYMGFTTGKS----KETSLRE  142



>ref|XP_008798511.1| PREDICTED: PXMP2/4 family protein 4-like isoform X1 [Phoenix 
dactylifera]
Length=199

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 121/187 (65%), Gaps = 30/187 (16%)
 Frame = +2

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFW---------------------------YEG  472
             +K+L I+ KRV IT M+G  + GP GH+W                           YE 
Sbjct  9    EDKELKINWKRVAITSMFGFAYVGPVGHYWNKPEHLADIQTLLYVFFSLTGFLPLYRYEY  68

Query  473  LDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRD  652
            LD++I+++ +LQP SL+F+  KVA D L+  PL+L +FF+YMGF++G+S  QVKE +KRD
Sbjct  69   LDRYIRVRLQLQPKSLKFVTAKVAADELLCWPLDLPIFFSYMGFASGRSVDQVKEDVKRD  128

Query  653  FLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFA  832
            FLPAL++ +  WP  Q  NFR+VPV+YQLLYVN+F +LDS+FLSW+E QQ +A  KQ F 
Sbjct  129  FLPALVVGAGVWPFLQVANFRFVPVRYQLLYVNLFCLLDSSFLSWIE-QQGDAPWKQWF-  186

Query  833  SVPISNE  853
             +PI  +
Sbjct  187  -IPIVTQ  192



>ref|XP_008798587.1| PREDICTED: PXMP2/4 family protein 4-like isoform X2 [Phoenix 
dactylifera]
Length=194

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 121/187 (65%), Gaps = 30/187 (16%)
 Frame = +2

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFW---------------------------YEG  472
             +K+L I+ KRV IT M+G  + GP GH+W                           YE 
Sbjct  4    EDKELKINWKRVAITSMFGFAYVGPVGHYWNKPEHLADIQTLLYVFFSLTGFLPLYRYEY  63

Query  473  LDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRD  652
            LD++I+++ +LQP SL+F+  KVA D L+  PL+L +FF+YMGF++G+S  QVKE +KRD
Sbjct  64   LDRYIRVRLQLQPKSLKFVTAKVAADELLCWPLDLPIFFSYMGFASGRSVDQVKEDVKRD  123

Query  653  FLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFA  832
            FLPAL++ +  WP  Q  NFR+VPV+YQLLYVN+F +LDS+FLSW+E QQ +A  KQ F 
Sbjct  124  FLPALVVGAGVWPFLQVANFRFVPVRYQLLYVNLFCLLDSSFLSWIE-QQGDAPWKQWF-  181

Query  833  SVPISNE  853
             +PI  +
Sbjct  182  -IPIVTQ  187



>gb|EPS72405.1| hypothetical protein M569_02354, partial [Genlisea aurea]
Length=140

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = +2

Query  464  YEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETI  643
            Y+ LD  +K++ +LQPNS++F++ KVA+D ++FGPL+LL+FF+YMGF+TGK+ +QVKE +
Sbjct  5    YKSLDHMMKVRLKLQPNSVRFVSAKVAIDSIIFGPLDLLVFFSYMGFATGKTPAQVKEDV  64

Query  644  KRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQ  823
            KRDFLPAL+LE   WPV Q  NFR++PVQYQLLYVN F +LDS FLSW+EQQ+ +A+ KQ
Sbjct  65   KRDFLPALLLEGGIWPVVQVANFRFIPVQYQLLYVNFFCLLDSCFLSWVEQQE-DAAWKQ  123

Query  824  CFAS-VPISNE  853
             F + +P+  +
Sbjct  124  WFKTFLPLKKQ  134



>ref|XP_005650792.1| hypothetical protein COCSUDRAFT_21583 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26248.1| hypothetical protein COCSUDRAFT_21583 [Coccomyxa subellipsoidea 
C-169]
Length=215

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 114/199 (57%), Gaps = 19/199 (10%)
 Frame = +2

Query  206  NPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD  385
            N +  VWT Y++ L   P+ TQ I+SG LWA+GDV +Q I               G  K 
Sbjct  10   NSLRNVWTAYEHQLHSHPVRTQAITSGALWALGDVFSQKI--------------EGRKK-  54

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
              ID KR  +T  YGA F GP GH WY  LD+F + +FR+   S  F+ATKV +D  +FG
Sbjct  55   --IDFKRSLVTAGYGAVFIGPVGHGWYVALDKFARARFRI--GSPAFIATKVVLDEGLFG  110

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            P+++L FF YM  + G S   VK   K DF  A   E   WP  QAVNF  VPV++QLL 
Sbjct  111  PIHVLGFFAYMTLAEGGSWEDVKRKCKNDFWSAYAAELVFWPAFQAVNFWKVPVRHQLLA  170

Query  746  VNMFSMLDSAFLSWLEQQQ  802
            VN+  +LD+ FL W++QQ 
Sbjct  171  VNLACLLDATFLCWIQQQD  189



>gb|EMT29019.1| Protein SYM1 [Aegilops tauschii]
Length=240

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 131/230 (57%), Gaps = 24/230 (10%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITIS--------------TSKKQ  349
            M R+W WYQ  L+  P+ TQV+SSG+LWA+GD+ AQ++T                 S+  
Sbjct  1    MRRLWRWYQQSLSSYPVRTQVVSSGILWALGDIGAQAVTHKSASSHHHHAKNPEVASQPP  60

Query  350  RLLISDSGSNKDLT---IDRKRVGITGMYGAGFFGPF-----GHFWYEGLDQFIKLKFRL  505
              L+    ++  +    +D     +T   G+G F              GL   + L   L
Sbjct  61   LQLLPSPATDPRIPWSFLDAVAPQLTRSPGSGDFPGVIRIKSSKLIGRGLASQVHLDL-L  119

Query  506  QPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSA  685
              +     A+KVA D L+FGPL+L LFF+Y+G ++G+S  QVK+ +KR  +PAL+L  + 
Sbjct  120  SLDPWDITASKVAADGLLFGPLDLGLFFSYVGLASGRSLEQVKDDVKRGIIPALVLGGAI  179

Query  686  WPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            WP  Q  NFR++PV+YQLLYVN+F +LDS FLSW+E QQ +A+ KQ F S
Sbjct  180  WPAVQIANFRFIPVRYQLLYVNLFCLLDSCFLSWIE-QQGDAAWKQWFTS  228



>ref|XP_005847416.1| hypothetical protein CHLNCDRAFT_134283 [Chlorella variabilis]
 gb|EFN55314.1| hypothetical protein CHLNCDRAFT_134283 [Chlorella variabilis]
Length=214

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 108/192 (56%), Gaps = 20/192 (10%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            + R +  Y + LA  P  TQ++S+G+LWA GD +AQ +                  +D  
Sbjct  5    LARAFRVYADQLAQHPWGTQIVSTGMLWAAGDALAQRV------------------EDQP  46

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D +R  +T  YG+ F GP GH WY GLD+    +  L P SL F+  KV  D  +FGPL
Sbjct  47   FDLRRNLLTAAYGSAFIGPVGHAWYLGLDR--AARALLTPGSLAFVGGKVVADTAIFGPL  104

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            ++  +FT+M    G + + V+  ++RDF P    E + WP  QA NF+ VPVQYQLL VN
Sbjct  105  HVAGYFTHMTVCEGGTMADVRAKLRRDFWPTFSAELAVWPAVQAANFKLVPVQYQLLVVN  164

Query  752  MFSMLDSAFLSW  787
             F++LDS F+SW
Sbjct  165  TFTILDSCFMSW  176



>gb|KDD76330.1| hypothetical protein H632_c266p1 [Helicosporidium sp. ATCC 50920]
Length=311

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 112/185 (61%), Gaps = 19/185 (10%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y+  +A  P  TQ +SSGVLW +GD VAQ      S ++R  +             +R+ 
Sbjct  8    YRTCMARAPYTTQAVSSGVLWGMGDSVAQQW----SAEKRFNV-------------RRML  50

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
             T  YGA F GP GH+WY+ LD+ I L+F  +  SL F+A KVA D  VFGP+++  +F 
Sbjct  51   TTAAYGAAFIGPAGHWWYQALDK-IALRFARR-GSLAFVAGKVAADTAVFGPIHVGGYFG  108

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M  +   S     + ++RDF+P LM +S+ WP+ QA+NFR+VPV  QLL+VN F ++DS
Sbjct  109  VMAVAERSSWEDFAKKMRRDFVPTLMADSAVWPLIQALNFRFVPVSSQLLFVNSFVVVDS  168

Query  773  AFLSW  787
            AF+SW
Sbjct  169  AFMSW  173



>ref|XP_010490117.1| PREDICTED: protein SYM1-like [Camelina sativa]
Length=109

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +2

Query  545  VDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVP  724
            +D L+FGP++LL+FFTYMG++TGK+ ++VKE +KRDFLPAL LE  AWP+ Q  NFRYVP
Sbjct  1    MDGLIFGPIDLLVFFTYMGYATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVP  60

Query  725  VQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFAS  835
            VQYQLLYVN+F ++DSAFLSW+E QQK+A+ KQ F S
Sbjct  61   VQYQLLYVNIFCLVDSAFLSWVE-QQKDAAWKQWFTS  96



>gb|KHN41635.1| Hypothetical protein glysoja_036379 [Glycine soja]
Length=123

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 5/124 (4%)
 Frame = +2

Query  509  PNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAW  688
            P S++ + TKVA+D ++FGPL+L +FFTYMG   GK+  QVKE +KR+++PAL+LE   W
Sbjct  2    PKSVRSVGTKVAMDGIIFGPLHLFVFFTYMGLCAGKNLPQVKEDLKRNYVPALILEGGVW  61

Query  689  PVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDEC  868
            PV Q  NF YVPV+YQLLYVN F +LD AFLSWLE QQK+A  K+ FAS   +NE     
Sbjct  62   PVVQVFNFWYVPVKYQLLYVN-FYLLDRAFLSWLE-QQKDAPWKKLFASFHSTNEKGGH-  118

Query  869  K*RC  880
              RC
Sbjct  119  --RC  120



>ref|XP_007161548.1| hypothetical protein PHAVU_001G078700g [Phaseolus vulgaris]
 gb|ESW33542.1| hypothetical protein PHAVU_001G078700g [Phaseolus vulgaris]
Length=391

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (73%), Gaps = 14/113 (12%)
 Frame = +2

Query  464  YEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETI  643
            YEGLD+FI+LK  L+PNS +F+ATKVAVD  +FGPL+LL+FFTYMGFS GK+  Q+KE +
Sbjct  278  YEGLDRFIRLKLMLKPNSFRFVATKVAVDGFIFGPLDLLVFFTYMGFSAGKTVPQIKEDV  337

Query  644  KRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQ  802
            KRDFLPA +LE   WP+ Q  NFR++PV              S FLSW+EQQQ
Sbjct  338  KRDFLPAFVLEGGIWPIVQVANFRFIPV--------------SCFLSWVEQQQ  376



>ref|XP_001695053.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02205.1| predicted protein [Chlamydomonas reinhardtii]
Length=226

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 104/195 (53%), Gaps = 17/195 (9%)
 Frame = +2

Query  221  VWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDR  400
            +W  Y+  L  RP+ TQ ++S +LW  GDV+AQ +      +QR L           +D 
Sbjct  16   LWGKYERTLQRRPVLTQCVTSCILWGCGDVLAQRVA-----EQRRLSE---------VDA  61

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
            +RV  T  +GA F GP GHFWY  LD  +     L   S  FLA K+  D  + GPL ++
Sbjct  62   RRVVTTAAFGACFMGPVGHFWYHSLD--VVCARLLTAGSPSFLAAKLIADTAIMGPLYVV  119

Query  581  LFFTYMGFSTGKSGSQ-VKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
             F+ +       SG +  K+ I +DF+P    E + WP+ QA NF  +PV++QLL VN  
Sbjct  120  AFYAWGCALIDGSGVEGFKKKITKDFIPTFTAELAVWPLFQAFNFTRIPVEHQLLAVNGM  179

Query  758  SMLDSAFLSWLEQQQ  802
            +++D+ FLSW   Q 
Sbjct  180  TLIDACFLSWARSQD  194



>ref|XP_002956332.1| hypothetical protein VOLCADRAFT_107170 [Volvox carteri f. nagariensis]
 gb|EFJ42681.1| hypothetical protein VOLCADRAFT_107170 [Volvox carteri f. nagariensis]
Length=232

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 107/197 (54%), Gaps = 17/197 (9%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R+W  Y+  L+ RP+ TQ+ +S +LW  GDV+AQ      + +QR L           
Sbjct  10   MHRIWGAYERQLSRRPVLTQMATSCLLWGCGDVLAQR-----AVEQRRLSE---------  55

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            +D +RV  T  +GA F GP GHFWY+ LD  I  K  L   S  FLA K+  D  + GPL
Sbjct  56   LDGRRVVCTAAFGAAFMGPVGHFWYQQLD-VICAKL-LATGSPGFLAAKLIADTAIMGPL  113

Query  572  NLLLFFTY-MGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYV  748
             ++ F+ +      G      K+ I +DF+P    E + WP+ QA NF  +PV++QLL V
Sbjct  114  YVVAFYAWGCALIDGSGWEGFKKKIMQDFIPTYTAELAVWPLFQAFNFTRIPVEHQLLAV  173

Query  749  NMFSMLDSAFLSWLEQQ  799
            N  +++D+ FLSW   Q
Sbjct  174  NGATLVDACFLSWARSQ  190



>ref|XP_001695054.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02206.1| predicted protein [Chlamydomonas reinhardtii]
Length=288

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 15/205 (7%)
 Frame = +2

Query  206  NPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD  385
            NP+ R W  Y+  L   P+ TQ  SS +LW +GD +AQ I    S   +           
Sbjct  14   NPLSRAWNAYERSLRRHPVLTQAASSALLWGLGDAMAQRIEARCSGVAQ-----------  62

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
               D +R  +T  +G G  GP GH WY+ LD  + L+  L  +S + +  KV +D LV+ 
Sbjct  63   --PDGRRTALTAAFGGGIIGPSGHAWYQALDSLV-LRCGLVGSSRRAMLLKVVLDNLVYS  119

Query  566  PLNLLLFFTYMGFSTGK-SGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLL  742
            P  +L FF +   +  + S ++ KE ++  F+P ++ E+  WP   A+ F  VPV +QLL
Sbjct  120  PAYVLAFFAFGCLAIDRLSPAEFKEQLRSQFVPTMLAEALVWPPYMALVFSRVPVPHQLL  179

Query  743  YVNMFSMLDSAFLSWLEQQQKEASG  817
             VN+ ++ D  FLSW+      A+ 
Sbjct  180  AVNVATLFDVCFLSWVRCTHDHATA  204



>ref|XP_001594898.1| hypothetical protein SS1G_04706 [Sclerotinia sclerotiorum 1980]
 gb|EDO02230.1| hypothetical protein SS1G_04706 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=187

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 107/201 (53%), Gaps = 25/201 (12%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RP+ TQ I+S VL+A GDV+AQ            L+   G N    
Sbjct  1    MLR---WYQMKLAARPVLTQSITSAVLFATGDVLAQQ-----------LVEKKGINGH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+    +F++ K  L+  +L+ +A +VA D  +  PL
Sbjct  45   -EIARTGRMALYGGAIFGPIATNWF----KFLQNKVVLKNKNLE-MAARVAADQCIVAPL  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL LF T M       GS  K+ ++ ++  AL      WP  QAVNF+ VP+++++L VN
Sbjct  99   NLGLFLTTMSVL---EGSDPKKKLEANYSTALQKNYMIWPAVQAVNFKLVPLEHRVLVVN  155

Query  752  MFSMLDSAFLSWLEQQQKEAS  814
            + S+  + +LS+L  ++ + +
Sbjct  156  IVSLGWNCYLSYLNGRKSDVT  176



>ref|XP_002956281.1| hypothetical protein VOLCADRAFT_121508 [Volvox carteri f. nagariensis]
 gb|EFJ42630.1| hypothetical protein VOLCADRAFT_121508 [Volvox carteri f. nagariensis]
Length=336

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 101/201 (50%), Gaps = 18/201 (9%)
 Frame = +2

Query  206  NPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD  385
            NP  R W  Y+  L   P+ TQ  SS +LW +GD +AQ I             + G    
Sbjct  13   NPFGRAWAAYERSLRKHPVLTQAASSALLWGLGDAMAQRI------------ENRGRGG-  59

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
              ID +RV +T  +G    GP GH WY  L++ +         SL+ +  KV VD L++ 
Sbjct  60   --IDARRVALTAAFGGAVIGPAGHGWYLLLERLVLKLG--LACSLKSMLLKVTVDNLLYS  115

Query  566  PLNLLLFFTYMGFS-TGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLL  742
            P  +L FF Y   +  G S +   E ++ +F+P ++ E+  WP   A  F  VPV++QLL
Sbjct  116  PCYVLAFFAYGCMAIDGLSPAVFAEKMREEFVPTMLAEAMLWPPYMAFVFSRVPVKHQLL  175

Query  743  YVNMFSMLDSAFLSWLEQQQK  805
             VN+ ++ D  FLSW+  + +
Sbjct  176  AVNVATLFDVCFLSWVRTKDE  196



>ref|XP_001560976.1| hypothetical protein BC1G_00061 [Botrytis cinerea B05.10]
 emb|CCD45941.1| similar to integral membrane protein [Botrytis cinerea T4]
 gb|EMR89847.1| putative mpv17 pmp22 family protein [Botrytis cinerea BcDW1]
Length=187

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 99/194 (51%), Gaps = 25/194 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RP+ TQ ++S VL+A GDV+AQ            L+   G N    
Sbjct  1    MLR---WYQMKLAARPVLTQSVTSAVLFATGDVLAQQ-----------LVEKKGINDH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W++ L   + LK     N    +A +VA D  +  P+
Sbjct  45   -EIARTGRMALYGGAIFGPIATNWFKFLQNHVVLK-----NKNLEMAARVAADQCIVAPI  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL LF T M       G+  K+ I+ ++  AL      WP  QAVNF+ VP+++++L VN
Sbjct  99   NLGLFLTTMSVL---EGTDPKKKIEANYSTALQKNYMIWPAVQAVNFKLVPLEHRVLVVN  155

Query  752  MFSMLDSAFLSWLE  793
            + S+  + +LS+L 
Sbjct  156  IVSLGWNCYLSYLN  169



>emb|CEG67381.1| hypothetical protein RMATCC62417_03819 [Rhizopus microsporus]
Length=230

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 102/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  254  RPLETQVISSGVLWAIGDVVAQSITI-STSKKQRLLISDS-GSNKDLTIDRKRVGITGMY  427
            RP+ T  +++G+L  + D +AQSI+    SK +  ++ +    ++DL     R  +T  +
Sbjct  18   RPILTLCVTNGILGVLSDTLAQSISYYEASKIEPYIVPEKLREHEDLWPPSPRWDLTRTF  77

Query  428  GAGFF----GPFGHFWYEGLDQFIKLKFRLQPNSLQFLATK-VAVDVLVFGPLNLLLFFT  592
                +     P G  WY  LD+F  +     P +   +A K +A D L+F PL L+LFFT
Sbjct  78   RFAAYNFCVAPLGGTWYMFLDRFFPVPKNAAPRTANMMAIKRMATDQLLFAPLGLVLFFT  137

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             MG +       VKE  +  + PAL+     WP  Q +NF+++P+QY+L +V+   +L +
Sbjct  138  VMGLAETGKWEGVKEKFRDAYTPALITNYEVWPAVQFINFKWMPLQYRLPFVSSLGILWN  197

Query  773  AFLSWLEQQQKE  808
            A+LSWL    K+
Sbjct  198  AYLSWLNNASKQ  209



>emb|CEJ01706.1| hypothetical protein RMCBS344292_15728 [Rhizopus microsporus]
Length=249

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 102/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  254  RPLETQVISSGVLWAIGDVVAQSITI-STSKKQRLLISDS-GSNKDLTIDRKRVGITGMY  427
            RP+ T  +++G+L  + D +AQSI+    SK +  ++ +    ++DL     R  +T  +
Sbjct  37   RPILTLCVTNGILGVLSDTLAQSISYYEASKIEPYIVPEKLREHEDLWPPSPRWDLTRTF  96

Query  428  GAGFF----GPFGHFWYEGLDQFIKLKFRLQPNSLQFLATK-VAVDVLVFGPLNLLLFFT  592
                +     P G  WY  LD+F  +     P +   +A K +A D L+F P+ L+LFFT
Sbjct  97   RFAAYNFCVAPLGGTWYMFLDRFFPVPKNAAPRTANMMAIKRMATDQLLFAPMGLVLFFT  156

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             MG +       VKE  +  + PAL+     WP  Q +NF+++P+QY+L +V+   +L +
Sbjct  157  VMGLAETGKWEGVKEKFRDAYTPALITNYEVWPAVQFINFKWMPLQYRLPFVSSLGILWN  216

Query  773  AFLSWLEQQQKE  808
            A+LSWL    K+
Sbjct  217  AYLSWLNNASKQ  228



>ref|XP_006673361.1| integral membrane protein, Mpv17/PMP22 family, putative [Cordyceps 
militaris CM01]
 gb|EGX89906.1| integral membrane protein, Mpv17/PMP22 family, putative [Cordyceps 
militaris CM01]
Length=175

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 96/190 (51%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ I++ VL+A GD+ AQ            L+   G +K    D  R 
Sbjct  8    WYNGRLAARPLLTQSITTAVLFATGDITAQQ-----------LVDQRGLDKH---DFSRT  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + I L     PN    +  +VAVD  VF P  + LF 
Sbjct  54   GRMALYGGVVFGPAATTWFNFLSRRITL-----PNKRAEILARVAVDQSVFAPTMIGLFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    +E +++ + PAL      WP  Q +NF ++P+QY++L+ N+ S+  
Sbjct  109  SSMATMEGASA---QERLEKTWWPALQTNWMVWPFVQTINFAFLPLQYRVLFANVVSIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  +
Sbjct  166  NSYLSWVNSK  175



>emb|CEG84574.1| hypothetical protein RMATCC62417_18355 [Rhizopus microsporus]
Length=230

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 102/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  254  RPLETQVISSGVLWAIGDVVAQSITI-STSKKQRLLISDS-GSNKDLTIDRKRVGITGMY  427
            RP+ T  +++G+L  + D +AQSI+    SK +  ++ +    ++DL     R  +T  +
Sbjct  18   RPILTLCVTNGILGVLSDTLAQSISYYEASKIEPYIVPEKLREHEDLWPPSPRWDLTRTF  77

Query  428  GAGFF----GPFGHFWYEGLDQFIKLKFRLQPNSLQFLATK-VAVDVLVFGPLNLLLFFT  592
                +     P G  WY  LD+F  +     P +   +A K +A D L+F P+ L+LFFT
Sbjct  78   RFAAYNFCVAPLGGTWYMFLDRFFPVPKNAAPRTANVMAIKRMATDQLLFAPMGLVLFFT  137

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             MG +       VKE  +  + PAL+     WP  Q +NF+++P+QY+L +V+   +L +
Sbjct  138  VMGLAETGKWEGVKEKFRDAYTPALITNYEVWPAVQFINFKWMPLQYRLPFVSSLGILWN  197

Query  773  AFLSWLEQQQKE  808
            A+LSWL    K+
Sbjct  198  AYLSWLNNASKQ  209



>ref|XP_009216843.1| hypothetical protein GGTG_00828 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT80834.1| hypothetical protein GGTG_00828 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=193

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 108/215 (50%), Gaps = 28/215 (13%)
 Frame = +2

Query  221  VWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDR  400
            V+ WYQ  LA RPL TQ I++ VL+A GD+ AQ            L+   G  K    D 
Sbjct  2    VFAWYQARLAARPLLTQSITTAVLFATGDITAQQ-----------LVEKRGVEKH---DL  47

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
             R G   +YG   FGP    W++ L Q + LK     ++   +A +VAVD  +F P  + 
Sbjct  48   TRTGRMFLYGGAVFGPAATTWFKILQQRVVLK-----SANATIAARVAVDQGLFAPTFIG  102

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
            +F + M    G S    KE +++++  AL      WP  Q VNF++VP+ +++L+VN+ S
Sbjct  103  IFLSSMAVLEGGSP---KEKLQKNYFNALTANYMLWPFVQMVNFKFVPLHHRVLFVNVIS  159

Query  761  MLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            +  + +LS+L       SG + F       +PK +
Sbjct  160  IGWNCYLSFLN---SGGSGTEAFGD---EEKPKTK  188



>ref|XP_380906.1| hypothetical protein FG00730.1 [Fusarium graminearum PH-1]
 sp|Q4IPX8.1|SYM1_GIBZE RecName: Full=Protein SYM1 [Fusarium graminearum PH-1]
 gb|ESU05953.1| SYM1 protein [Fusarium graminearum PH-1]
 gb|EYB33556.1| hypothetical protein FG05_00730 [Fusarium graminearum]
 emb|CEF72725.1| unnamed protein product [Fusarium graminearum]
Length=175

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 95/190 (50%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY + LA RPL TQ +++  L+A GDV AQ            L+   G+ K    D  R 
Sbjct  7    WYNSRLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKRGAQKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  ++ N    +  +VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVRNNKKAEVLARVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GKS   VKE I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  SSMATMEGKS---VKERIDKTWWPALKANWMVWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>ref|XP_001220940.1| hypothetical protein CHGG_01719 [Chaetomium globosum CBS 148.51]
 gb|EAQ93484.1| hypothetical protein CHGG_01719 [Chaetomium globosum CBS 148.51]
Length=191

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 100/194 (52%), Gaps = 25/194 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RPL TQ I++ VL+A+GD+ AQ            L+   G  K   
Sbjct  1    MLR---WYQARLAARPLLTQAITTSVLFAVGDITAQQ-----------LVDKKGVEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R G   +YG   FGP    W++ L   + L     PN+      +VAVD  VF P 
Sbjct  45   -DLARTGRMALYGGVVFGPAAATWFKFLSARVNLS---SPNATML--ARVAVDQGVFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             + +F + M    G S S   E ++R +  AL+     WP  Q VNF+++P+Q++LL+VN
Sbjct  99   FIGVFLSSMAVLEGTSPS---EKLQRSYSEALLTNWMIWPFVQMVNFKFMPLQHRLLFVN  155

Query  752  MFSMLDSAFLSWLE  793
            + S+  + +LS+L 
Sbjct  156  VISIGWNCYLSFLN  169



>ref|XP_006814766.1| PREDICTED: protein Mpv17-like [Saccoglossus kowalevskii]
Length=194

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 104/191 (54%), Gaps = 20/191 (10%)
 Frame = +2

Query  215  LRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTI  394
            +R+W  Y +++A  PL++Q  SSGVL+ IGDVVAQ +           +   GSN +   
Sbjct  3    VRLWKSYIDFVAKYPLKSQAYSSGVLFFIGDVVAQQV-----------VERKGSNHN---  48

Query  395  DRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLN  574
               R     ++G    GP    WY  LD+  K   R Q  +L+    K+  D ++  PL 
Sbjct  49   -PYRTVRQTVFGLVIAGPALRGWYVLLDKIYKTS-RPQTAALK----KMVTDQIIMAPLF  102

Query  575  LLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNM  754
            +  FFT MG ++GKS  ++K+ +++D+   ++     WP  Q +NF ++P+Q+++L+VN 
Sbjct  103  IFTFFTVMGCASGKSLQKIKDKVRQDYFDTVIANYKVWPAFQLINFYFIPLQHRVLFVNT  162

Query  755  FSMLDSAFLSW  787
             ++  + +L+W
Sbjct  163  VALFWNTYLAW  173



>gb|KFM27615.1| Protein SYM1 [Auxenochlorella protothecoides]
Length=164

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 6/134 (4%)
 Frame = +2

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
             R  IT  YGA   GP GH WY  LD  I  +F   P SL+F    V +D ++F PL++L
Sbjct  2    HRTLITAAYGAFAVGPIGHVWYHKLDS-IATRFH-SPGSLRF----VLLDTVIFSPLHIL  55

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
             +F  M      S +     ++ DF+P L  E + WP  QA NF+++ V YQLL VN+ +
Sbjct  56   GYFGVMNVGERGSWADFSRKVEVDFVPTLAAELAVWPAIQAANFKFIRVDYQLLAVNLLT  115

Query  761  MLDSAFLSWLEQQQ  802
            + DSAF+SW    +
Sbjct  116  IFDSAFMSWCRATE  129



>ref|XP_009252794.1| hypothetical protein FPSE_01399 [Fusarium pseudograminearum CS3096]
 gb|EKJ78425.1| hypothetical protein FPSE_01399 [Fusarium pseudograminearum CS3096]
 emb|CEG02601.1| unnamed protein product [Fusarium pseudograminearum CS3487]
Length=175

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 94/190 (49%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++  L+A GDV AQ            L+   G+ K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKRGAQKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  ++ N    +  +VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVRNNKKAEVLARVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GKS   VKE I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  SSMATMEGKS---VKERIDKTWWPALKANWMVWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>gb|KFH70427.1| hypothetical protein MVEG_03277 [Mortierella verticillata NRRL 
6337]
Length=196

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 98/192 (51%), Gaps = 9/192 (5%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y   LA  P+ TQ  ++GVL+  GD++AQ +  S   K +    D+      + D  R G
Sbjct  5    YTRTLAKYPVWTQAFTTGVLFGTGDIIAQFLIESKPSKGK----DAAVPVTGSWDVARTG  60

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               ++GAGF GP  H WY+ LD+ I+L         + L  +VAVD L F P  +  FF 
Sbjct  61   RMAIFGAGFAGPVLHHWYKFLDRKIQLS-----TPFRSLLGRVAVDQLCFAPCFIASFFV  115

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
              GF  G +   ++  +++ +  AL      WP  Q +NF  VP+Q++L+ VN F++  +
Sbjct  116  GQGFLAGANKQTIQARLEKGYPGALKSNYMVWPAVQLLNFWCVPLQHRLMVVNTFALGWN  175

Query  773  AFLSWLEQQQKE  808
             +LS + Q  + 
Sbjct  176  TYLSHVNQTSRS  187



>emb|CCE35176.1| probable glomerulosclerosis protein Mpv17 [Claviceps purpurea 
20.1]
Length=175

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 99/190 (52%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ VL+A GD+ AQ            L+   G  K    D  R 
Sbjct  8    WYNARLAARPLLTQSVTTAVLFATGDITAQQ-----------LVEKKGLEKH---DLTRT  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG  FFGP    W+  L +    K  L+   ++ LA +VA D ++F P+ +  F 
Sbjct  54   GRMALYGGCFFGPVATTWFGLLAR----KVTLRNPRVETLA-RVACDQILFAPVMIGAFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    K+ +++ + PAL      WP+ Q VNF ++P+Q+++L+ N+ S+  
Sbjct  109  SSMATMEGASA---KDRLEKAWWPALKANWMVWPIVQTVNFTFLPLQHRVLFANVVSIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>gb|ESZ98317.1| hypothetical protein SBOR_1310 [Sclerotinia borealis F-4157]
Length=187

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 104/201 (52%), Gaps = 25/201 (12%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RP+ TQ +++ +L+A GDV+AQ +       +R  I D        
Sbjct  1    MLR---WYQMKLAARPVLTQSVTTAILFATGDVLAQQLV------ERKGIKDH-------  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W++ L   I LK     N    +A +VA D  V  P+
Sbjct  45   -EIVRTGRMALYGGAIFGPLATKWFKFLQTHIVLK-----NKNLEMAARVAADQCVVAPI  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L +F T M       G+  K+ ++ ++  AL      WP  QAVNF+ VP+++++L VN
Sbjct  99   SLGVFLTTMSVL---EGTDPKKKLETNYTTALQKNYMIWPAVQAVNFKLVPLEHRVLVVN  155

Query  752  MFSMLDSAFLSWLEQQQKEAS  814
            + S+  + +LS+L  ++ + +
Sbjct  156  IVSLGWNCYLSYLNGRKSDIT  176



>ref|XP_009523526.1| hypothetical protein PHYSODRAFT_359986 [Phytophthora sojae]
 gb|EGZ20809.1| hypothetical protein PHYSODRAFT_359986 [Phytophthora sojae]
Length=214

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 92/188 (49%), Gaps = 19/188 (10%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDL-TIDRK--  403
            Y  WL   PL T+ ++S VL+ IGD VAQ I  S S            N D  T+DR   
Sbjct  8    YDRWLRDSPLLTKGVTSAVLFGIGDRVAQRIERSESATD---------NADTDTVDRHGL  58

Query  404  -RVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
             R     ++G   F P GH WY  L++ ++ K          +  K+A D L+F P   L
Sbjct  59   HRTARMMLWGGVLFAPVGHAWYNFLERAVRGK------GAASIVKKIAADQLIFSPPLSL  112

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
             FFTY G S GK      ET      P L +  + WP+     F +VP+QY++L++N+ +
Sbjct  113  AFFTYAGCSEGKPLRDTMETALAKLPPTLAVNWTVWPLVHVGTFGFVPLQYRILFINVVN  172

Query  761  MLDSAFLS  784
            +  SAFLS
Sbjct  173  IGWSAFLS  180



>ref|XP_003002638.1| SYM1 [Verticillium alfalfae VaMs.102]
 gb|EEY21099.1| SYM1 [Verticillium alfalfae VaMs.102]
Length=172

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 22/191 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ I++G+L+A GD+VAQ             I   G+      D  R 
Sbjct  4    WYQARLAARPLLTQSITTGILFATGDIVAQQA-----------IEKKGTKGH---DLART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + +  +     ++      +VA D LVF P+ + +F 
Sbjct  50   GRMALYGGSVFGPVATTWFGFLARNVNFR-----STAATTIGRVATDQLVFAPVMIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    K  +++ + PAL      WP  QA NF  VP+Q++LL+VN+ S+  
Sbjct  105  SSMATLEGTSP---KAKLEKSYFPALTANWMVWPAVQAFNFALVPLQHRLLFVNVISIGW  161

Query  770  SAFLSWLEQQQ  802
            + FLS L   +
Sbjct  162  NCFLSALNSAK  172



>ref|XP_007594041.1| sym-1 [Colletotrichum fioriniae PJ7]
 gb|EXF82324.1| sym-1 [Colletotrichum fioriniae PJ7]
Length=171

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 98/190 (52%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ I++ +L+A GD+ AQ            L+   G  K    +  R 
Sbjct  4    WYQARLAARPLLTQSITTAILFATGDITAQQ-----------LVDKRGLEKH---EWART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W++ L   I LK     N    +  +VAVD  VF P+ + +F 
Sbjct  50   GRMALYGGVIFGPVATTWFKFLQNNIVLK-----NKNAEMLARVAVDQGVFAPVMISVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S   +KE + +++  AL      WP  Q VNF++VP+ +++L+VN+ S+  
Sbjct  105  SSMATLEGGS---IKEKLDKNYKTALTSNYMLWPFVQVVNFKFVPLHHRVLFVNVISIGW  161

Query  770  SAFLSWLEQQ  799
            +++LS+L  Q
Sbjct  162  NSYLSFLNSQ  171



>ref|XP_003656540.1| hypothetical protein THITE_2121301 [Thielavia terrestris NRRL 
8126]
 gb|AEO70204.1| hypothetical protein THITE_2121301 [Thielavia terrestris NRRL 
8126]
Length=171

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 99/194 (51%), Gaps = 25/194 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RPL TQ +++ +L+AIGDV AQ            L+   G  K   
Sbjct  1    MLR---WYQARLAARPLLTQAVTTSILFAIGDVTAQQ-----------LVDKKGLEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R G   +YG   FGP    W+  L + + L+    PN+   +  +VA D  +F P 
Sbjct  45   -DLARTGRMALYGGVVFGPAAATWFRLLSRHVNLR---SPNAT--ILARVACDQGIFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             + +F + M    G S    +E + + +  AL+     WP  Q VNF+ VP+Q++LL+VN
Sbjct  99   FIGVFLSSMAVLEGTSP---REKLAKSYSDALLTNWMIWPFVQLVNFKLVPLQHRLLFVN  155

Query  752  MFSMLDSAFLSWLE  793
            + S+  + +LS+L 
Sbjct  156  VVSIGWNCYLSFLN  169



>ref|XP_002908286.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61369.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=206

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 104/221 (47%), Gaps = 34/221 (15%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M R    Y  WL   PL T+ ++S +L+ +GD +AQ I  +++                T
Sbjct  1    MRRFRVRYDRWLRDSPLLTKGVTSAILFGLGDRIAQRIDTNSAD---------------T  45

Query  392  IDRKRVGITG---MYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVF  562
             DR+ +  T    ++G   F P GH WY  L++ ++ K          +A K+A D L+F
Sbjct  46   DDRRGLEQTARMMLWGGVLFAPIGHVWYNCLEKAVRGK------GTAAVAKKIAADQLIF  99

Query  563  GPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLL  742
             P   L FFTY G S GK   +  E+      P L +  + WP+     F +VP+QY++L
Sbjct  100  SPPLSLTFFTYAGVSDGKPLRETVESAVAKLPPTLAVNWTVWPLVHVCTFGFVPLQYRIL  159

Query  743  YVNMFSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            ++N  ++  SAFLS +        G+       +SN PK E
Sbjct  160  FINAVNIGWSAFLSRMATND---DGQ-------VSNAPKIE  190



>emb|CCF32955.1| sym-1 [Colletotrichum higginsianum]
Length=171

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 97/190 (51%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ I++ VL+A GD+ AQ            L+   G  K    D  R 
Sbjct  4    WYQARLAARPLLTQSITTAVLFATGDITAQQ-----------LVDKRGLEKH---DFART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W++ L   + LK     N    +  +VAVD  VF P+ + +F 
Sbjct  50   GRMALYGGVIFGPVATNWFKFLQHNVVLK-----NKNAEILARVAVDQGVFAPVMISVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M       GS ++E + +++  AL      WP  Q +NF+ VP+ +++L+VN+ S+  
Sbjct  105  SSMA---TLEGSSIQEKLDKNYKTALTSNYMLWPFVQMINFKLVPLHHRVLFVNVISIGW  161

Query  770  SAFLSWLEQQ  799
            +++LS+L  Q
Sbjct  162  NSYLSFLNSQ  171



>gb|EWG94415.1| Sym1p [Saccharomyces cerevisiae R103]
Length=197

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 100/211 (47%), Gaps = 20/211 (9%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            YQ  L  RP  T  I +G L+ IGDV AQ           LL   S  NK    D KR  
Sbjct  7    YQASLKRRPKTTNAIMTGALFGIGDVSAQ-----------LLFPTSKVNKGY--DYKRTA  53

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               +YG+  F   G  WY+ L+  I ++ R Q      +  +VAVD L F PL L  +FT
Sbjct  54   RAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQ-YHWSNMVLRVAVDQLAFAPLGLPFYFT  112

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M    G+S    K  IK  + P L+   + WP+ QA+NF  VP+Q++LL VN+ ++  +
Sbjct  113  CMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWN  172

Query  773  AFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             +LS+   +  E         VP+   P  E
Sbjct  173  TYLSYKNSKVMEKD------KVPVHYPPVVE  197



>ref|XP_002838969.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83160.1| unnamed protein product [Tuber melanosporum]
Length=200

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 106/207 (51%), Gaps = 24/207 (12%)
 Frame = +2

Query  227  TWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKR  406
            TWY+  L  RP+ TQ +S+  L+A GDV+AQ             I    S+   T +  R
Sbjct  3    TWYRTALTKRPVLTQCLSTSFLFAAGDVIAQQA-----------IEQRRSDGLRTHNPYR  51

Query  407  VGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLF  586
                 +YG   FGP    WY    +F++   R+  +    + ++VA+D  +F P++L LF
Sbjct  52   TLRMAIYGGSIFGPLVVNWY----KFLQTAVRIPASPSLEIVSRVALDQTLFTPVHLTLF  107

Query  587  FTYMGFSTGKSG---------SQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQL  739
            F+ M    G  G          +V+  ++ ++L  L    + WP  Q VNFR+VP+++++
Sbjct  108  FSSMATMEGIMGDDGRELGTEERVRGKLRDNWLQGLRANWTVWPGVQLVNFRFVPLEHRV  167

Query  740  LYVNMFSMLDSAFLSWLEQQQKEASGK  820
            L VN+ S+  +++LS+L QQ K   G+
Sbjct  168  LVVNLVSLGWNSYLSYLNQQGKGREGE  194



>gb|EPE06672.1| integral membrane mpv17 pmp22 [Ophiostoma piceae UAMH 11346]
Length=185

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 97/191 (51%), Gaps = 9/191 (5%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY+  LA RPL TQ I++ VL+A GD+ AQ + + T   +    +D   +     D  R 
Sbjct  4    WYKARLAARPLLTQSITTAVLFATGDITAQQL-VETRTPKGDKTADGKDDAPAGHDFMRT  62

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    WY  L + + L         + +  +VA D  +F P+ + +F 
Sbjct  63   GRMALYGGAVFGPAAATWYNILQRHVVLS-----TPRKTMLARVAADQGIFAPVFIGVFL  117

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    G S    KE I++ ++ AL      WP AQ VNF  VP+++++L+VN+ S+  
Sbjct  118  GSMAVLEGGS---PKEKIQKQYVNALTANYMLWPAAQMVNFSVVPLEHRVLFVNLVSIGW  174

Query  770  SAFLSWLEQQQ  802
            +++LS L   +
Sbjct  175  NSYLSILNSSK  185



>ref|XP_009657846.1| SYM1 protein [Verticillium dahliae VdLs.17]
 gb|EGY15683.1| SYM1 protein [Verticillium dahliae VdLs.17]
Length=172

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 96/191 (50%), Gaps = 22/191 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ I++G+L+A GD+VAQ             I   G+ KD   D  R 
Sbjct  4    WYQARLAARPLLTQSITTGILFATGDIVAQQA-----------IEKKGT-KDY--DLART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + +  +     ++      +VA D LVF P+ + +F 
Sbjct  50   GRMALYGGSVFGPVATTWFGFLARNVNFR-----STAATTIGRVATDQLVFAPVMIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    K  +++ + PAL      WP  QA NF  VP+Q++LL+VN+ S+  
Sbjct  105  SSMATLEGTSP---KAKLEKSYWPALTANWLIWPAVQAFNFALVPLQHRLLFVNVISIGW  161

Query  770  SAFLSWLEQQQ  802
            + FLS L   +
Sbjct  162  NCFLSALNSAK  172



>ref|XP_003678385.1| hypothetical protein NCAS_0J00670 [Naumovozyma castellii CBS 
4309]
 emb|CCC72046.1| hypothetical protein NCAS_0J00670 [Naumovozyma castellii CBS 
4309]
Length=208

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 96/195 (49%), Gaps = 3/195 (2%)
 Frame = +2

Query  215  LRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTI  394
            ++++  Y   L   P  T  I +G L+ +GD+ AQ +   T + ++    D    K    
Sbjct  1    MKLFNLYNRCLRTHPKTTNAIMTGTLFGVGDISAQILFAPTEQPKQ---GDEIEQKKKNF  57

Query  395  DRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLN  574
            D  R     +YG+  F   G  WY+ L   +KL  R Q N    +  KV+VD L F PL 
Sbjct  58   DWHRTSRAVIYGSMIFSFIGDKWYKILQNNVKLPLRFQHNKSLSMLYKVSVDQLAFAPLG  117

Query  575  LLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNM  754
            +  +F+ M    G +   V+  IK  +   L+     WP+ Q VNF +VP+Q++LL VN+
Sbjct  118  VPFYFSCMTIMEGGTMKDVETKIKTQWWRTLVTNWCVWPLFQMVNFTWVPLQHRLLAVNV  177

Query  755  FSMLDSAFLSWLEQQ  799
             ++  + +LS++  +
Sbjct  178  VAIFWNTYLSYMNSR  192



>gb|EDZ70530.1| YLR251Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EGA73768.1| Sym1p [Saccharomyces cerevisiae AWRI796]
 gb|EGA85668.1| Sym1p [Saccharomyces cerevisiae VL3]
 gb|EWG84484.1| Sym1p [Saccharomyces cerevisiae R008]
 gb|EWG89647.1| Sym1p [Saccharomyces cerevisiae P301]
 gb|EWH17112.1| Sym1p [Saccharomyces cerevisiae P283]
Length=197

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/217 (33%), Positives = 105/217 (48%), Gaps = 20/217 (9%)
 Frame = +2

Query  215  LRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTI  394
            +++  +Y+  L  RP  T  I +G L+ IGDV AQ           LL   S  NK    
Sbjct  1    MKLLHFYEASLKRRPKTTNAIMTGALFGIGDVSAQ-----------LLFPTSKVNKGY--  47

Query  395  DRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLN  574
            D KR     +YG+  F   G  WY+ L+  I ++ R Q +    +  +VAVD L F PL 
Sbjct  48   DYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQYH-WSNMVLRVAVDQLAFAPLG  106

Query  575  LLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNM  754
            L  +FT M    G+S    K  IK  + P L+   + WP+ QA+NF  VP+Q++LL VN+
Sbjct  107  LPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNV  166

Query  755  FSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             ++  + +LS+   +  E         VP+   P  E
Sbjct  167  VAIFWNTYLSYKNSKVMEKD------KVPVHYPPVVE  197



>ref|XP_007833748.1| Protein sym-1 [Pestalotiopsis fici W106-1]
 gb|ETS81974.1| Protein sym-1 [Pestalotiopsis fici W106-1]
Length=172

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 98/194 (51%), Gaps = 25/194 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RPL TQ I++ VL+A GD+ AQ +           +   G  K   
Sbjct  1    MLR---WYQARLAARPLLTQSITTAVLFATGDITAQQV-----------VEKKGLEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R G   +YG   FGP    W++ L + + L+     N    +  +VA D  +F P 
Sbjct  45   -DLSRTGRMFLYGGAVFGPAATTWFKFLQRNVVLR-----NKNAEIVARVACDQGLFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             + +F + M    G S    ++ +++ +LPAL      WP  Q VNF++VP+ +++L+VN
Sbjct  99   FIGIFLSSMAIMEGGSP---RDKLEKSYLPALQTNYLIWPFVQLVNFKFVPLHHRVLFVN  155

Query  752  MFSMLDSAFLSWLE  793
              S+  + +LS+L 
Sbjct  156  FISIGWNCYLSFLN  169



>ref|NP_013352.1| Sym1p [Saccharomyces cerevisiae S288c]
 sp|Q06563.1|SYM1_YEAST RecName: Full=Protein SYM1; AltName: Full=Stress-inducible yeast 
MPV17 protein 1 [Saccharomyces cerevisiae S288c]
 gb|AAB67389.1| Ylr251wp [Saccharomyces cerevisiae]
 gb|AAS56537.1| YLR251W [Saccharomyces cerevisiae]
 gb|EDN59467.1| stress-inducible yeast mpv17 [Saccharomyces cerevisiae YJM789]
 gb|EDV08580.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gb|EEU06781.1| Sym1p [Saccharomyces cerevisiae JAY291]
 emb|CAY81480.1| Sym1p [Saccharomyces cerevisiae EC1118]
 tpg|DAA09565.1| TPA: Sym1p [Saccharomyces cerevisiae S288c]
 gb|EGA61250.1| Sym1p [Saccharomyces cerevisiae FostersO]
 gb|EGA77769.1| Sym1p [Saccharomyces cerevisiae Vin13]
 gb|EGA81723.1| Sym1p [Saccharomyces cerevisiae Lalvin QA23]
 dbj|GAA25120.1| K7_Sym1p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EHN05610.1| Sym1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW08856.1| Sym1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|AHY78621.1| Sym1p [Saccharomyces cerevisiae YJM993]
Length=197

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 100/211 (47%), Gaps = 20/211 (9%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y+  L  RP  T  I +G L+ IGDV AQ           LL   S  NK    D KR  
Sbjct  7    YEASLKRRPKTTNAIMTGALFGIGDVSAQ-----------LLFPTSKVNKGY--DYKRTA  53

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               +YG+  F   G  WY+ L+  I ++ R Q      +  +VAVD L F PL L  +FT
Sbjct  54   RAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQ-YHWSNMVLRVAVDQLAFAPLGLPFYFT  112

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M    G+S    K  IK  + P L+   + WP+ QA+NF  VP+Q++LL VN+ ++  +
Sbjct  113  CMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWN  172

Query  773  AFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             +LS+   +  E         VP+   P  E
Sbjct  173  TYLSYKNSKVMEKD------KVPVHYPPVVE  197



>ref|XP_005535986.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79700.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=312

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 100/199 (50%), Gaps = 23/199 (12%)
 Frame = +2

Query  206  NPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD  385
            NP+  +W  Y   LA RPL T++ +S V + +GDV+AQ        KQ+L          
Sbjct  110  NPLAALWALYLQNLAKRPLLTKMFTSLVGFGLGDVLAQHFL----DKQKL----------  155

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
               D+KR+     +G    G  GH+WY+ LDQ IK         ++ + +KVA+D L++ 
Sbjct  156  ---DKKRLFRMMSFGFLIHGSTGHYWYQFLDQMIK------GTGVREVVSKVALDQLLWA  206

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            P+   +F  Y    +G S  +  + IK D    +    S WPVA A+NFR+VP   +LLY
Sbjct  207  PIFTAIFLGYTSLLSGASTEETVKKIKADTFTGVRASWSVWPVAHAINFRFVPPSQRLLY  266

Query  746  VNMFSMLDSAFLSWLEQQQ  802
            +N   +  + FLS L   +
Sbjct  267  INSIQIAYNMFLSILATSR  285



>gb|EFQ30791.1| Mpv17/PMP22 family protein [Colletotrichum graminicola M1.001]
Length=171

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 97/190 (51%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY+  LA RPL TQ I++GVL+A GD+ AQ            L+   G  K    D  R 
Sbjct  4    WYRARLAARPLLTQSITTGVLFATGDITAQQ-----------LVDKRGLEKH---DFSRT  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                +YG   FGP    W++ L   + LK     N    +  +V VD  VF P+ + +F 
Sbjct  50   ARMALYGGAIFGPIATNWFKFLQNNVVLK-----NKNAEILARVVVDQGVFAPVMIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S   V+E + +++  AL      WP  Q VNF+ +P+Q++LL+VN+ S+  
Sbjct  105  SSMATLEGGS---VQEKLDKNYKTALTSNYMLWPFVQMVNFKLIPLQHRLLFVNVISIGW  161

Query  770  SAFLSWLEQQ  799
            +++LS+L  +
Sbjct  162  NSYLSFLNSK  171



>ref|XP_007753564.1| protein sym1 [Cladophialophora yegresii CBS 114405]
 gb|EXJ64997.1| protein sym1 [Cladophialophora yegresii CBS 114405]
Length=172

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 92/188 (49%), Gaps = 22/188 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ +++ VL+  GD +AQ             +   G  K    D  R 
Sbjct  5    WYQAKLAKRPLLTQAVTTAVLFGAGDTLAQQA-----------VEKKGFEKH---DLART  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                 YG   FGP    WY  L + I LK +   N+   +A +V  D  VF   NL  F 
Sbjct  51   ARMCTYGGLVFGPAATKWYSFLQKNINLKSQ---NAT--IAARVLADQTVFATCNLAFFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M       G+  KE + + +LP L    + WP  QAVNF++VP+++++L VN+ S+  
Sbjct  106  STMSVL---EGTDPKEKLAKSYLPGLKANWALWPAVQAVNFKFVPLEHRVLIVNIVSLGW  162

Query  770  SAFLSWLE  793
            + FLS+L 
Sbjct  163  NCFLSYLN  170



>ref|XP_008601247.1| Mpv17/PMP22 family protein [Beauveria bassiana ARSEF 2860]
 gb|EJP63123.1| Mpv17/PMP22 family protein [Beauveria bassiana ARSEF 2860]
 gb|KGQ11701.1| Protein SYM1 [Beauveria bassiana D1-5]
Length=175

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 92/190 (48%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ I++ VL+A GD+ AQ            L+   G  K    D  R 
Sbjct  8    WYNGRLAARPLLTQSITTAVLFATGDITAQQ-----------LVDQRGLEKH---DFART  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + +       PN       +V VD  VF P  + +F 
Sbjct  54   GRMALYGGVVFGPAATTWFNFLARRVT-----SPNKRVETLARVFVDQSVFAPTMIAVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    KE +++ + PAL      WP  Q +NF ++P+QY++L+ N+ S+  
Sbjct  109  SSMATMEGNSA---KERLEKTWWPALRTNWMVWPFVQTINFAFLPLQYRVLFANVISIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  +
Sbjct  166  NSYLSWVNSK  175



>gb|EGU89103.1| hypothetical protein FOXB_00376 [Fusarium oxysporum Fo5176]
 gb|ENH61552.1| Protein SYM1 [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWY92750.1| protein SYM1 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ51954.1| protein SYM1 [Fusarium oxysporum Fo47]
 gb|EWZ87006.1| protein SYM1 [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA51809.1| protein SYM1 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK49247.1| protein SYM1 [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK96294.1| protein SYM1 [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL43993.1| protein SYM1 [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL89271.1| protein SYM1 [Fusarium oxysporum f. sp. conglutinans race 2 54008]
Length=175

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 92/190 (48%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++  L+A GDV AQ            L+   G  K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKKGVEKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLTRVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  SSMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>ref|XP_004337490.1| peroxisomal membrane 22 kDa family protein, partial [Acanthamoeba 
castellanii str. Neff]
 gb|ELR15477.1| peroxisomal membrane 22 kDa family protein, partial [Acanthamoeba 
castellanii str. Neff]
Length=248

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 97/189 (51%), Gaps = 17/189 (9%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y    A RP  T ++++GVLW  GDV++Q              +D  +  DL  D +R  
Sbjct  34   YSRATAERPYRTNILTAGVLWFSGDVISQK-------------ADGRAWSDL--DWRRTA  78

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
                YG    GP   +WY  L++  K     Q +  +++A KVA D L+F P  LLLFF+
Sbjct  79   RITAYGLCVAGPVYCWWYSFLER--KTAHLAQRSVWKYIAAKVAADQLIFEPPYLLLFFS  136

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
                  G +  Q++  +K+D+L   +++   WP AQ +NFR+V   YQ L VN   +  +
Sbjct  137  LTSIMEGHTLHQIRSKLKQDYLSTFIVDCQVWPFAQVLNFRFVNPLYQSLVVNGVCVGWN  196

Query  773  AFLSWLEQQ  799
            A+LS+++ +
Sbjct  197  AYLSFVKHK  205



>ref|XP_008890629.1| hypothetical protein PPTG_00827 [Phytophthora parasitica INRA-310]
 gb|ETN24572.1| hypothetical protein PPTG_00827 [Phytophthora parasitica INRA-310]
Length=208

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 94/197 (48%), Gaps = 15/197 (8%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y  WL   PL T+ ++S +L+ +GD +AQ I    + ++         + D     +R  
Sbjct  8    YDRWLRDSPLLTKGVTSAILFGLGDRIAQRIETGDADQR---------DADDCHGLQRTA  58

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               ++G   F P GH WY  L++ ++ K          +  K+A D LVF P   L FFT
Sbjct  59   RMMVWGGLLFAPIGHAWYNFLEKAVRGK------GTATVVKKIAADQLVFSPPLSLAFFT  112

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
            Y G + GK   +  ET      P L +  + WP+     F +VP+QY++L++N+ ++  S
Sbjct  113  YAGVTEGKPLPETVETAVVKLPPTLAVNWTVWPLVHVCTFGFVPLQYRILFINVVNIGWS  172

Query  773  AFLSWLEQQQKEASGKQ  823
             FLS +     + S  Q
Sbjct  173  TFLSRMASSDGKVSNAQ  189



>gb|EXM30510.1| protein SYM1 [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=175

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 92/190 (48%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++  L+A GD+ AQ            L+   G  K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAFLFATGDITAQQ-----------LVEKKGVEKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLTRVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  SSMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>ref|XP_963854.2| hypothetical protein NCU02117 [Neurospora crassa OR74A]
 ref|XP_009855263.1| hypothetical protein NEUTE1DRAFT_89193 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q7SCY7.2|SYM1_NEUCR RecName: Full=Protein sym-1 [Neurospora crassa OR74A]
 gb|EAA34618.2| sym-1 [Neurospora crassa OR74A]
 gb|EGO51621.1| hypothetical protein NEUTE1DRAFT_89193 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ78381.1| hypothetical protein NEUTE2DRAFT_102282 [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83914.1| hypothetical protein GE21DRAFT_312 [Neurospora crassa]
Length=172

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 101/192 (53%), Gaps = 23/192 (12%)
 Frame = +2

Query  227  TWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSG-SNKDLTIDRK  403
            +WY+  LA RPL TQ +++ +L+ +GDV AQ            L+   G SN DLT    
Sbjct  3    SWYKAQLAARPLLTQAVTTSILFGVGDVAAQQ-----------LVDRRGLSNHDLT----  47

Query  404  RVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLL  583
            R G   +YG   FGP    W+    +F++ +  +  ++ + +  +VA D  +F P  + +
Sbjct  48   RTGRMVLYGGAVFGPAATTWF----RFLQKRVVVPGSTNKTILARVAADQGLFAPTFIGI  103

Query  584  FFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSM  763
            F   M       G+ VKE +++++  AL      WP  Q VNF+ VP+ +++L+VN+ S+
Sbjct  104  FLGSMAV---LEGTDVKEKLQKNYWEALSTNWMVWPFVQMVNFKVVPLDHRVLFVNVISI  160

Query  764  LDSAFLSWLEQQ  799
              + +LSWL  Q
Sbjct  161  GWNCYLSWLNGQ  172



>gb|ETI56561.1| hypothetical protein F443_00970 [Phytophthora parasitica P1569]
 gb|ETK96346.1| hypothetical protein L915_00911 [Phytophthora parasitica]
 gb|ETL49713.1| hypothetical protein L916_00898 [Phytophthora parasitica]
 gb|ETM02708.1| hypothetical protein L917_00866 [Phytophthora parasitica]
 gb|ETM55911.1| hypothetical protein L914_00905 [Phytophthora parasitica]
 gb|ETO85235.1| hypothetical protein F444_00979 [Phytophthora parasitica P1976]
 gb|ETP26359.1| hypothetical protein F441_00946 [Phytophthora parasitica CJ01A1]
 gb|ETP54252.1| hypothetical protein F442_00924 [Phytophthora parasitica P10297]
Length=208

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 94/197 (48%), Gaps = 15/197 (8%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y  WL   PL T+ ++S +L+ +GD +AQ I    + ++         + D     +R  
Sbjct  8    YDRWLRDSPLLTKGVTSAILFGLGDRIAQRIETGDADQR---------DADDCHGLQRTA  58

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               ++G   F P GH WY  L++ ++ K          +  K+A D LVF P   L FFT
Sbjct  59   RMMVWGGLLFAPIGHAWYNFLEKAVRGK------GTATVVKKIAADQLVFSPPLSLAFFT  112

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
            Y G + GK   +  ET      P L +  + WP+     F +VP+QY++L++N+ ++  S
Sbjct  113  YAGVTEGKPLRETVETAVVKLPPTLAVNWTVWPLVHVCTFGFVPLQYRILFINVVNIGWS  172

Query  773  AFLSWLEQQQKEASGKQ  823
             FLS +     + S  Q
Sbjct  173  TFLSRMASSDGKVSNAQ  189



>gb|KFY20731.1| hypothetical protein V491_03473 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=170

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 25/195 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WY+  LA RPL TQ +++ +L++ GD++AQ             +   G  K   
Sbjct  1    MLR---WYRMKLATRPLLTQSVTTAILFSTGDIMAQQA-----------VERKGIEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+  L   I     + PN    +A +V VD L+F P 
Sbjct  45   -EFVRTGRMALYGGAIFGPAATTWFRFLQTRI-----VMPNKKLEIAARVGVDQLLFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL +F + M    G S S   E + + +  AL      WP  Q VNF +VP+ Y++L+VN
Sbjct  99   NLFVFLSTMSVLEGVSPS---EKLAKTYTGALQSNWMVWPFVQVVNFSFVPLDYRVLFVN  155

Query  752  MFSMLDSAFLSWLEQ  796
              S+  + +LS++ +
Sbjct  156  GLSIFWNCYLSYISK  170



>gb|KHN96844.1| Mpv17/PMP22 [Metarhizium album ARSEF 1941]
Length=175

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 97/191 (51%), Gaps = 24/191 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSG-SNKDLTIDRKR  406
            WY   LA RPL TQ +++ VL+A GD+ AQ            L+ + G    DLT    R
Sbjct  8    WYNARLAARPLLTQSVTTAVLFATGDITAQQ-----------LVENKGIKGHDLT----R  52

Query  407  VGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLF  586
             G   +YG   FGP    W+     F+    R +   ++ LA +VA D  +F P+ +  F
Sbjct  53   TGRMALYGGCVFGPVATTWFG----FLARNIRFKNPRVETLA-RVACDQTLFAPVMISAF  107

Query  587  FTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSML  766
             + M    G S    +E +++ + PAL      WP  Q +NF ++P+Q+++L+ N+ S+ 
Sbjct  108  LSSMATMEGASA---RERLEKTWWPALKTNWMVWPFVQTINFTFLPLQHRVLFANIVSIG  164

Query  767  DSAFLSWLEQQ  799
             +++LSW+  Q
Sbjct  165  WNSYLSWVNSQ  175



>ref|XP_007811254.1| integral membrane protein, Mpv17/PMP22 family, putative [Metarhizium 
acridum CQMa 102]
 gb|EFY88983.1| integral membrane protein, Mpv17/PMP22 family, putative [Metarhizium 
acridum CQMa 102]
Length=175

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 95/190 (50%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ VL+A GD+ AQ            L+   G       D  R 
Sbjct  8    WYNARLAARPLLTQSVTTAVLFATGDITAQQ-----------LVEKKGIKGH---DLSRT  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+    R +   ++ LA +VA D   F P+ + +F 
Sbjct  54   GRMALYGGCVFGPVATTWFG----FLARNIRFRNPRVETLA-RVACDQSFFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    KE +++ + PAL      WP+ Q +NF ++P+Q+++L+ N+ S+  
Sbjct  109  SSMATMEGASA---KERLEKTWWPALKTNWMVWPIVQTINFTFLPLQHRVLFANIVSIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>ref|XP_008080883.1| hypothetical protein GLAREA_11910 [Glarea lozoyensis ATCC 20868]
 gb|EPE31828.1| hypothetical protein GLAREA_11910 [Glarea lozoyensis ATCC 20868]
Length=179

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 29/205 (14%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSG-SNKDL  388
            MLR   WYQ  LA  PL TQ I++ VL+A GD +AQ            L+   G +N +L
Sbjct  1    MLR---WYQMKLAKSPLLTQSITTAVLFATGDTMAQQ-----------LVEKKGLANHEL  46

Query  389  TIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGP  568
                 R G   +YG   FGP    W+    +F++ K  L+  +L+ +A +VA D  +F  
Sbjct  47   A----RTGRMALYGGAIFGPAATTWF----KFLQNKIVLKNKNLEIVA-RVAADQTIFAS  97

Query  569  LNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYV  748
             NL +F + M       GS  K+ ++  +  AL      WP  QA+NF+ VP+ +++L V
Sbjct  98   TNLFVFLSSMAI---MEGSSPKDKLESTYATALQKNWMVWPFVQAINFKLVPLHHRVLVV  154

Query  749  NMFSMLDSAFLSWLEQQ--QKEASG  817
            N+ S+  + +LS+L  Q  +KE + 
Sbjct  155  NVISLGWNCYLSFLNSQGGKKEVAA  179



>gb|KFY02708.1| hypothetical protein O988_01958 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=991

 Score =   102 bits (255),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 63/211 (30%), Positives = 103/211 (49%), Gaps = 22/211 (10%)
 Frame = +2

Query  164  RDQYPPLQeeeeeeNPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSK  343
            R  + P+Q+ +        +  WY+  LA RP+ TQ +++ VL+A GD++AQ        
Sbjct  803  RMLHSPIQKIDPRRTRFAVMLNWYRMKLATRPMLTQSVTTAVLFATGDIMAQQA------  856

Query  344  KQRLLISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQ  523
                 +   G  K   +   R G   +YG   FGP    W+    +F++ K  L PN   
Sbjct  857  -----VERKGIEKHEFV---RTGRMALYGGAIFGPAATTWF----KFLQTKVVL-PNKKL  903

Query  524  FLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQA  703
             +  +V VD L+F P NL +F + M    G S    +E + + +  AL      WP  Q 
Sbjct  904  EICARVGVDQLLFAPTNLFVFLSTMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQV  960

Query  704  VNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQ  796
            VNF +VP+ Y++L+VN  S+  + +LS++ +
Sbjct  961  VNFSFVPLNYRVLFVNGLSIFWNCYLSYISK  991



>gb|KFX86855.1| hypothetical protein V490_08777 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=989

 Score =   102 bits (255),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 63/211 (30%), Positives = 103/211 (49%), Gaps = 22/211 (10%)
 Frame = +2

Query  164  RDQYPPLQeeeeeeNPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSK  343
            R  + P+Q+ +        +  WY+  LA RP+ TQ +++ VL+A GD++AQ        
Sbjct  801  RMLHSPIQKIDPRRTRFAVMLNWYRMKLATRPMLTQSVTTAVLFATGDIMAQQA------  854

Query  344  KQRLLISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQ  523
                 +   G  K   +   R G   +YG   FGP    W+    +F++ K  L PN   
Sbjct  855  -----VERKGIEKHEFV---RTGRMALYGGAIFGPAATTWF----KFLQTKVVL-PNKKL  901

Query  524  FLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQA  703
             +  +V VD L+F P NL +F + M    G S    +E + + +  AL      WP  Q 
Sbjct  902  EICARVGVDQLLFAPTNLFVFLSTMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQV  958

Query  704  VNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQ  796
            VNF +VP+ Y++L+VN  S+  + +LS++ +
Sbjct  959  VNFSFVPLDYRVLFVNGLSIFWNCYLSYISK  989



>gb|KFY09174.1| hypothetical protein V491_08356 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=170

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 99/195 (51%), Gaps = 25/195 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WY+  LA RP+ TQ +++ +L+A GD++AQ             +   G  K   
Sbjct  1    MLR---WYRMKLATRPMLTQSVTTAILFATGDIMAQQA-----------VERKGIEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+    +F++ K  + PN    +A +V VD L+F P 
Sbjct  45   -EFVRTGRMALYGGAIFGPAATTWF----RFLQTKVVI-PNKKLEIAARVGVDQLLFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL +F + M    G S    +E + + +  AL      WP  Q VNF +VP+ Y++L+VN
Sbjct  99   NLFVFLSTMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQVVNFSFVPLDYRVLFVN  155

Query  752  MFSMLDSAFLSWLEQ  796
              S+  + +LS++ +
Sbjct  156  GLSIFWNCYLSYISK  170



>emb|CCT62895.1| probable glomerulosclerosis protein Mpv17 [Fusarium fujikuroi 
IMI 58289]
Length=175

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 91/190 (48%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++  L+A GD+ AQ            L+   G  K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAFLFATGDITAQQ-----------LVEKKGVEKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVPENKKAEVLTRVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  GSMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>gb|KFY88078.1| hypothetical protein V500_06576 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ13546.1| hypothetical protein V502_06550 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=170

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 96/195 (49%), Gaps = 25/195 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WY+  LA RP+ TQ +++ +L+A GD++AQ             +   G  K   
Sbjct  1    MLR---WYRMKLATRPMLTQSVTTAILFATGDIMAQQA-----------VERKGIEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W++ L   + L     PN    +  +V VD L+F P 
Sbjct  45   -EFVRTGRMALYGGAIFGPAATTWFKFLQTKVVL-----PNKKLEICARVGVDQLLFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL +F + M    G S    +E + + +  AL      WP  Q VNF +VP+ Y++L+VN
Sbjct  99   NLFVFLSTMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQVVNFSFVPLDYRVLFVN  155

Query  752  MFSMLDSAFLSWLEQ  796
              S+  + +LS++ +
Sbjct  156  GLSIFWNCYLSYISK  170



>gb|EMT61325.1| Protein SYM1 [Fusarium oxysporum f. sp. cubense race 4]
 gb|EXL93872.1| protein SYM1 [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=175

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 91/190 (48%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++  L+A GDV AQ            L+   G  K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKKGVEKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLTRVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  GSMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>ref|NP_001090480.1| uncharacterized protein LOC779393 [Xenopus laevis]
 gb|AAI23161.1| MGC154358 protein [Xenopus laevis]
Length=200

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 102/195 (52%), Gaps = 20/195 (10%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTID  397
            R+WT Y   L   PL  + ++S   + +GD++AQ   +               +K+   D
Sbjct  4    RLWTKYNAALETNPLLIKAVTSLTGFTLGDILAQKFVMP--------------DKEKGYD  49

Query  398  RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNL  577
              R    G +G    GP GH++Y  LD+      ++   +++ +ATKVA+D L++ P   
Sbjct  50   LMRTVRLGSFGFLVHGPTGHYFYSWLDK------QIPGTAMKTVATKVAIDQLLWNPCFG  103

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
            ++FF+Y+G + GKS + ++  IK D   A++   + W  A  VNFR+VP   +LLY+N  
Sbjct  104  VMFFSYLGLAEGKSFADIQTKIKNDLTTAVVGSWTVWIPAHFVNFRFVPSSQRLLYINSI  163

Query  758  SMLDSAFLSWLEQQQ  802
             +  + FLS+L  ++
Sbjct  164  QIGYNIFLSFLGNKK  178



>ref|XP_007739255.1| protein sym1 [Cladophialophora psammophila CBS 110553]
 gb|EXJ75938.1| protein sym1 [Cladophialophora psammophila CBS 110553]
Length=173

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 95/191 (50%), Gaps = 22/191 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ +++ VL+A GD +AQ         +R  I +         D  R 
Sbjct  5    WYQAKLAKRPLLTQSVTTAVLFAAGDTLAQQAV------ERKGIRNH--------DSART  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                +YG   FGP    WY  L + I      Q +++  LA +V  D  +F   +L  F 
Sbjct  51   ARMCLYGGCAFGPAATKWYAFLQKHINF----QSHNVTILA-RVFADQTIFATCHLAFFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M       GS  KE + + +LP L    + WP+ QAVNF+ VP+++++L VN+ S+  
Sbjct  106  SSMSV---LEGSDPKEKLAKSYLPGLKANWTVWPLVQAVNFKLVPLEHRVLVVNVVSLGW  162

Query  770  SAFLSWLEQQQ  802
            + FLS+L   +
Sbjct  163  NCFLSYLNSSK  173



>gb|KFY48054.1| hypothetical protein V495_01651 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY57363.1| hypothetical protein V497_05611 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=170

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 95/189 (50%), Gaps = 22/189 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY+  LA RP+ TQ +++ VL+A GD++AQ             +   G  K    +  R 
Sbjct  4    WYRMKLATRPMLTQSVTTAVLFATGDIMAQQA-----------VERKGIEKH---EFVRT  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+    +F++ K  L PN    +  +V VD L+F P NL +F 
Sbjct  50   GRMALYGGAIFGPAATTWF----KFLQTKVVL-PNKKLEICARVGVDQLLFAPTNLFVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    +E + + +  AL      WP  Q VNF +VP+ Y++L+VN  S+  
Sbjct  105  STMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQVVNFSFVPLDYRVLFVNGLSIFW  161

Query  770  SAFLSWLEQ  796
            + +LS++ +
Sbjct  162  NCYLSYISK  170



>ref|XP_011127820.1| hypothetical protein AOL_s00215g316 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX43580.1| hypothetical protein AOL_s00215g316 [Arthrobotrys oligospora 
ATCC 24927]
Length=173

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 99/191 (52%), Gaps = 22/191 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  L  RP+ TQVI++  L+  GD+ AQ          R  ++D    + L +     
Sbjct  4    WYQAKLNQRPVLTQVITTAFLFGAGDITAQQAV------DRRGVADHDFPRTLRMT----  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                 +G  FFGP    WY+ L    ++ F   PN  + L  +VA D ++F P+NLL FF
Sbjct  54   ----AWGGCFFGPVAVQWYKLLG---RISFPGHPN--RELLARVAADQIIFTPVNLLCFF  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            T M   T   G   KE ++R +L  L      WP  Q VNF++VP++++LL VN+ S+  
Sbjct  105  TGM---TVLEGGNPKEKLERSYLTTLRNNWMLWPTVQLVNFKFVPLEHRLLVVNVISLGW  161

Query  770  SAFLSWLEQQQ  802
            +++LS+   ++
Sbjct  162  NSYLSYANTRK  172



>gb|EGA57584.1| Sym1p [Saccharomyces cerevisiae FostersB]
Length=196

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 100/212 (47%), Gaps = 23/212 (11%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y+  L  RP  T  I +G L+ IGDV AQ           LL   S  NK    D KR  
Sbjct  7    YEASLKRRPKTTNAIMTGALFGIGDVSAQ-----------LLFPTSKVNKGY--DYKRTA  53

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPN-SLQFLATKVAVDVLVFGPLNLLLFF  589
               +YG+  F   G  WY+ L+   K+  R +P      +  +VAVD L F PL L  +F
Sbjct  54   RAVIYGSLIFSFIGDKWYKILN---KIYMRNRPQYHWSNMVLRVAVDQLAFAPLGLPFYF  110

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            T M    G+S    K  IK  + P L+   + WP+ QA+NF  VP+Q++LL VN+ ++  
Sbjct  111  TCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFW  170

Query  770  SAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
            + +LS+   +  E         VP+   P  E
Sbjct  171  NTYLSYKNSKVMEKD------KVPVHYPPVVE  196



>ref|XP_005538717.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82681.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=187

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 95/191 (50%), Gaps = 19/191 (10%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M   W+ Y   LA +PL+ + ++S + + IGD+VAQ   +   K                
Sbjct  1    MATFWSKYTQLLAEKPLQVKTMTSFIGFTIGDLVAQIPALMDGKPW--------------  46

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R      +G    GP GH+WYE LD+ I  +      S   + +K+A+D L++ P+
Sbjct  47   -DAARTARMASFGLVLHGPIGHYWYEFLDRTIMPQ---ASKSTAAVVSKMAIDQLLWAPV  102

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
               LFF+YM  + GK   +  E ++    P L +  + WP+A  +NFR++P   ++LY+N
Sbjct  103  FTSLFFSYMQAAEGKP-ERAPEVVREKLWPTLKVNWTVWPLAHLINFRFIPSSQRILYIN  161

Query  752  MFSMLDSAFLS  784
               +  +AFLS
Sbjct  162  TVQVGYNAFLS  172



>ref|XP_001801590.1| hypothetical protein SNOG_11347 [Phaeosphaeria nodorum SN15]
 gb|EAT81055.1| hypothetical protein SNOG_11347 [Phaeosphaeria nodorum SN15]
Length=193

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 98/188 (52%), Gaps = 22/188 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  L   PL TQ I++ VL++ GDV+AQ            L+   G ++    D  R 
Sbjct  5    WYQAKLKSAPLLTQSITTAVLFSTGDVMAQQ-----------LVEKRGFDQH---DPMRT  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
               G YG   FGP    WY  L + + LK +   NS   +A +VA D L+F P+N+ LF 
Sbjct  51   ARMGAYGGVIFGPAATKWYGFLTKNVNLKGK---NST--IAARVACDQLIFAPVNMGLFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M +  G S    K+ ++  ++P L      WP  Q  NF+YVP+++++L VN+ S+  
Sbjct  106  SSMAYLEGAS---PKKRLEDAYVPGLTKNFMIWPWVQFTNFKYVPMEHRVLVVNIISLGW  162

Query  770  SAFLSWLE  793
            + +LS+L 
Sbjct  163  NCYLSFLN  170



>gb|EYE94996.1| hypothetical protein EURHEDRAFT_412854 [Aspergillus ruber CBS 
135680]
Length=173

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 95/194 (49%), Gaps = 25/194 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ+ LA +P+ T  ++S +L+  GDV+AQ            L+   G  K   
Sbjct  1    MLR---WYQSKLAKQPILTASVTSAILFGSGDVLAQQ-----------LVDRRGLEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R G   +YG   FGP    W+  L + + LK     NS   +  +VA D  +F P 
Sbjct  45   -DIARTGRMALYGGAIFGPAATTWFGFLQRHVVLK-----NSKATIVARVAADQCLFTPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L  F + M       GS   E ++  F+P+     + WP+ Q VNF +VP++Y++L VN
Sbjct  99   HLTCFLSSMAI---MEGSDPIEKLRTTFVPSYKANLTIWPLVQGVNFTFVPLEYRVLAVN  155

Query  752  MFSMLDSAFLSWLE  793
            + S+  +  LS + 
Sbjct  156  LVSLGWNCLLSMIN  169



>ref|XP_004346946.1| Mpv17 protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW47317.1| Mpv17 protein [Capsaspora owczarzaki ATCC 30864]
Length=194

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 99/208 (48%), Gaps = 21/208 (10%)
 Frame = +2

Query  221  VWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDR  400
            +W+WY   L  RP+    IS+G L A GD++AQ             I   G + DL    
Sbjct  3    LWSWYLYMLERRPIVMSAISTGTLMATGDLIAQQA-----------IDRKGRDHDLV---  48

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKL-KFRLQPNSLQFLATKVAVDVLVFGPLNL  577
             R       G  F GP    WY GL++ +   K   +  +L    TK+A+D  VF P  +
Sbjct  49   -RTARMAAIGFCFVGPVMRLWYTGLEKIVPASKLSTRTAAL----TKMAIDQTVFAPFII  103

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
              F+  +G     S +Q++  ++ +    L+     WP  Q +NF +VP+Q+++L VN  
Sbjct  104  SSFYVNLGLLHNDSMAQIETRLRSELKDTLIANWKVWPATQLLNFYFVPMQHRVLVVNAV  163

Query  758  SMLDSAFLSWLEQQQKEASGKQCFASVP  841
            S+  +++L W    +K+ S ++  A+ P
Sbjct  164  SLGWNSYLGW-RAHRKDPSIEEVVAASP  190



>ref|XP_007816811.1| integral membrane protein, Mpv17/PMP22 family, putative [Metarhizium 
robertsii ARSEF 23]
 gb|EFZ03548.1| Mpv17/PMP22 [Metarhizium robertsii ARSEF 23]
 gb|EXV00001.1| Mpv17/PMP22 family protein [Metarhizium robertsii]
 gb|KFG82571.1| putative integral membrane protein, Mpv17/PMP22 family [Metarhizium 
anisopliae]
 gb|KID64803.1| Mpv17/PMP22, partial [Metarhizium anisopliae ARSEF 549]
 gb|KID75219.1| Mpv17/PMP22, partial [Metarhizium brunneum ARSEF 3297]
 gb|KID89700.1| Mpv17/PMP22 [Metarhizium guizhouense ARSEF 977]
 gb|KID99163.1| Mpv17/PMP22, partial [Metarhizium majus ARSEF 297]
Length=175

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 95/190 (50%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ VL+A GD+ AQ            L+   G       D  R 
Sbjct  8    WYNARLAARPLLTQSVTTAVLFATGDITAQQ-----------LVEKKGIKGH---DFTRT  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+    R +   ++ LA +VA D  +F P+ + +F 
Sbjct  54   GRMALYGGCVFGPVATTWFG----FLARNIRFRNPRVETLA-RVACDQSLFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    KE +++ + PAL      WP  Q +NF ++P+Q+++L+ N+ S+  
Sbjct  109  SSMATMEGASA---KERLEKTWWPALKTNWMVWPFVQTINFTFLPLQHRVLFANIVSIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>gb|ESA19537.1| hypothetical protein GLOINDRAFT_134941 [Rhizophagus irregularis 
DAOM 181602]
Length=184

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 95/195 (49%), Gaps = 19/195 (10%)
 Frame = +2

Query  224  WTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRK  403
            ++WY+N L  RP+  Q I++G L+A GD++AQ I      +QR L S          +  
Sbjct  4    FSWYKNHLFRRPILIQTITTGTLFAAGDIIAQQIV-----EQRGLKSH---------NFY  49

Query  404  RVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLL  583
            R    G +G    GP    WY  LD+ I +K     N +  L T+V +D  +F P  +  
Sbjct  50   RTLRLGGFGLCIAGPSTAIWYRTLDRVITIK-----NPMLGLLTRVTLDQAIFAPCFITT  104

Query  584  FFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSM  763
            FF       G+  SQ+ E +    +P L+     WP  Q +NF ++P+ Y+ L VN  ++
Sbjct  105  FFVGQALLEGQENSQILEKLGDTLVPTLINNYKLWPAVQLLNFHFIPLNYRTLVVNCVAL  164

Query  764  LDSAFLSWLEQQQKE  808
              + +LS + ++  +
Sbjct  165  GWNTYLSVINKKSSD  179



>ref|XP_007588885.1| putative mpv17 pmp22 family protein [Neofusicoccum parvum UCRNP2]
 gb|EOD43674.1| putative mpv17 pmp22 family protein [Neofusicoccum parvum UCRNP2]
Length=189

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 107/218 (49%), Gaps = 30/218 (14%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA RPL TQ I++ +L+A GD +AQ I      KQ              
Sbjct  1    MLR---WYQLKLAQRPLLTQSITTAILFATGDTMAQQIVERKGWKQH-------------  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R      YG   FGP    W++ L      + +L+  +   LA +VA D  +F P 
Sbjct  45   -EWDRTARMAGYGGIIFGPAATTWFKALQ-----RIQLKSTNGTILA-RVAADQFLFAPT  97

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            N+ LF + M    G S    KE +   + PAL      WP  Q  NF++VP+++++L VN
Sbjct  98   NMCLFLSTMAVLEGGS---PKEKLASTYGPALTKNWMVWPFVQVANFKFVPLEHRVLVVN  154

Query  752  MFSMLDSAFLSWLEQQ-QKEASGKQCFASVPISNEPKD  862
            + S+  + +LS+L  Q   +A+G +   + P++ E K+
Sbjct  155  VISLGWNCYLSFLNSQGGAKAAGTE---AGPLAAEKKE  189



>ref|XP_006966661.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47554.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS00869.1| putative integral membrane protein, Mpv17/PMP22 family [Trichoderma 
reesei RUT C-30]
Length=188

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 94/190 (49%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RP  TQ +++ VL+A GD+ AQ +      K                D  R 
Sbjct  7    WYNGRLAARPFLTQGVTTAVLFATGDITAQQLVEKRGIKGH--------------DTSRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                +YG   FGP    W      F+  + RL+   ++ LA +VA D L+F P+ + +F 
Sbjct  53   SRMALYGGCVFGPVATTWL----GFLARRVRLRNARVETLA-RVAADQLLFAPVMIGVFL  107

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GKS    KE + + + PAL      WP  Q VNF ++P+QY+LL+ N+ S+  
Sbjct  108  SSMATMEGKSP---KERLDQTWWPALKANWVLWPAVQFVNFTFLPLQYRLLFANVISIGW  164

Query  770  SAFLSWLEQQ  799
            +++LSW+  +
Sbjct  165  NSYLSWVNSK  174



>emb|CBN79011.1| peroxisomal membrane protein-related [Ectocarpus siliculosus]
Length=203

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 100/199 (50%), Gaps = 22/199 (11%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M  +W  Y   LA +PL  + ++S   + +GD++AQ                  S +D  
Sbjct  1    MSGIWAAYNKALAAQPLLVKAMTSFTGFTVGDILAQKFI---------------SPED-D  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R    G +GA   GP GH++Y  LD       +L       +A+KVA+D  ++ P+
Sbjct  45   YDFMRTLRLGTFGALVHGPTGHYFYGMLDA------KLPGTKPMTVASKVAIDQTIWNPI  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
              ++FFTY+G + GKS   +++ IK D   A+M   + W  A  +NF++VP   +LLY+N
Sbjct  99   FGVMFFTYLGLAEGKSVDDIQKKIKNDLATAVMGSWTVWIPAHTINFKFVPTSQRLLYIN  158

Query  752  MFSMLDSAFLSWLEQQQKE  808
               +  + FLS+L  ++ +
Sbjct  159  TIQIGYNIFLSFLGNKKAD  177



>gb|KDB18115.1| putative integral membrane protein, Mpv17/PMP22 family [Ustilaginoidea 
virens]
Length=181

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 99/195 (51%), Gaps = 22/195 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ VL+A GD+ AQ +  S   K+           DLT    R 
Sbjct  8    WYNARLAARPLLTQSVTTAVLFAAGDITAQQLVESKGLKR----------HDLT----RT  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG  FFGP    W+  L + +  +    P  ++ LA +VA D  +F P+   +  
Sbjct  54   GRMALYGGCFFGPVATTWFRFLARNVTFR---HPR-VETLA-RVACDQALFAPV---MIG  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
             ++G      G+  KE ++  +  AL      WP  Q +NF ++P+Q+++L+ N+ S+  
Sbjct  106  AFLGSMATMEGASAKERLETTWWSALKTNWLVWPFVQTINFTFLPLQHRVLFANVVSIGW  165

Query  770  SAFLSWLEQQQKEAS  814
            +++LSW+  Q K  S
Sbjct  166  NSYLSWVNSQSKGHS  180



>gb|ELR03552.1| hypothetical protein GMDG_01303 [Pseudogymnoascus destructans 
20631-21]
Length=170

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 94/195 (48%), Gaps = 25/195 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WY+  LA RP+ TQ +++ +L+A GD++AQ             +   G  K   
Sbjct  1    MLR---WYRMKLATRPMLTQSVTTAILFATGDIMAQQA-----------VERKGVEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+  L   + L     PN    +  +V VD L+F P 
Sbjct  45   -EFVRTGRMALYGGAIFGPAATTWFRFLQTRVVL-----PNKKLEICARVGVDQLLFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL +F + M    G S    +E + + +  AL      WP  Q VNF  VP+ Y++L+VN
Sbjct  99   NLFVFLSTMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQVVNFSVVPLDYRVLFVN  155

Query  752  MFSMLDSAFLSWLEQ  796
              S+  + +LS++ +
Sbjct  156  GLSIFWNCYLSYISK  170



>ref|XP_007297121.1| Mpv17/PMP22 family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD12663.1| Mpv17/PMP22 family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=174

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 95/190 (50%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RP+ TQ +++ VL+A GD +AQ            L+   G  K    D  R 
Sbjct  4    WYQMKLASRPILTQSVTTAVLFATGDTMAQQ-----------LVEKKGLEKH---DLART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W++    F++ K  LQ  + + +A +VA D  +F   NL  F 
Sbjct  50   GRMALYGGAIFGPAATTWFK----FLQNKIVLQNKNAEIIA-RVACDQTLFASTNLFCFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    ++ +++ +  AL      WP  Q VNF+ VP+ +++L VN+ S+  
Sbjct  105  SSMAIMEGTSP---QDKLEQSYWTALRSNWMVWPFIQCVNFKLVPLHHRVLVVNVISLGW  161

Query  770  SAFLSWLEQQ  799
            + +LS+L  Q
Sbjct  162  NCYLSFLNSQ  171



>gb|EWG36396.1| protein SYM1 [Fusarium verticillioides 7600]
Length=175

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 91/190 (48%), Gaps = 21/190 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++  L+A GDV AQ            L+   G  K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKKGVEKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+     F+  +  +  N    + ++VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLSRVACDQLGFAPVMIGVFL  108

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  
Sbjct  109  GSMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGW  165

Query  770  SAFLSWLEQQ  799
            +++LSW+  Q
Sbjct  166  NSYLSWVNSQ  175



>gb|KFY69245.1| hypothetical protein V496_00405 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY79642.1| hypothetical protein V499_01397 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFY95730.1| hypothetical protein V498_03172 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
 gb|KFZ16795.1| hypothetical protein V501_02053 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=170

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 94/195 (48%), Gaps = 25/195 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WY+  LA RP+ TQ +++ +L+A GD++AQ             +   G  K   
Sbjct  1    MLR---WYRMKLATRPMLTQSVTTAILFATGDIMAQQA-----------VERKGIEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+  L   + L     PN    +  +V VD L+F P 
Sbjct  45   -EFVRTGRMALYGGAIFGPAATTWFRFLQTRVVL-----PNKKLEICARVGVDQLLFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL +F + M    G S    +E + + +  AL      WP  Q VNF  VP+ Y++L+VN
Sbjct  99   NLFVFLSTMSILEGVSP---REKLAKTYTGALQSNWMVWPFVQVVNFSVVPLDYRVLFVN  155

Query  752  MFSMLDSAFLSWLEQ  796
              S+  + +LS++ +
Sbjct  156  GLSIFWNCYLSYISK  170



>ref|XP_007792574.1| putative integral membrane mpv17 pmp22 protein [Eutypa lata UCREL1]
 gb|EMR68320.1| putative integral membrane mpv17 pmp22 protein [Eutypa lata UCREL1]
Length=172

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 98/197 (50%), Gaps = 25/197 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ+ LA RPL TQ I++ VL+A GD+ AQ            L+   G  K   
Sbjct  1    MLR---WYQSKLASRPLLTQSITTAVLFATGDITAQQ-----------LVEKRGLEKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+  L + + L+     ++   +A +VA D LVF P 
Sbjct  45   -EYARTGRMFLYGGAIFGPAATMWFGFLQRNVVLR-----SANATIAARVAADQLVFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             + +F   M    G S S   + + + +  AL      WP  Q  NF++VP+QY++L VN
Sbjct  99   FIGIFLGSMAVMEGGSPS---DKLAKSYPSALQANYMLWPFVQLANFKFVPLQYRVLLVN  155

Query  752  MFSMLDSAFLSWLEQQQ  802
            + S+  + FLS L  ++
Sbjct  156  VVSIGWNCFLSLLNSKK  172



>ref|XP_008723026.1| hypothetical protein G647_01404 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI28952.1| hypothetical protein G647_01404 [Cladophialophora carrionii CBS 
160.54]
Length=172

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 89/188 (47%), Gaps = 22/188 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ +++ VL+  GD +AQ             +   G  K    D  R 
Sbjct  5    WYQAKLAKRPLLTQAVTTAVLFGAGDTLAQQA-----------VEKKGFEKH---DLART  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                 YG   FGP    WY  L + I LK     +    +A +V  D  VF   NL  F 
Sbjct  51   ARMCTYGGLVFGPAATKWYGFLQKNINLK-----SHNATIAARVLADQTVFATCNLAFFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M       G+  +E + + +LP L    + WP  QAVNF+ VP+++++L VN+ S+  
Sbjct  106  STMSVL---EGTDPREKLAKSYLPGLKANWAIWPAVQAVNFKLVPLEHRVLVVNIVSLGW  162

Query  770  SAFLSWLE  793
            + FLS+L 
Sbjct  163  NCFLSYLN  170



>gb|EWY92751.1| protein SYM1 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ51955.1| protein SYM1 [Fusarium oxysporum Fo47]
 gb|EWZ87007.1| protein SYM1 [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA51810.1| protein SYM1 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK49248.1| protein SYM1 [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK96295.1| protein SYM1 [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL43994.1| protein SYM1 [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL89272.1| protein SYM1 [Fusarium oxysporum f. sp. conglutinans race 2 54008]
Length=171

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 91/189 (48%), Gaps = 21/189 (11%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y   LA RPL TQ +++  L+A GDV AQ            L+   G  K    D  R G
Sbjct  4    YNARLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKKGVEKH---DLVRTG  49

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F +
Sbjct  50   RMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLTRVACDQLGFAPVMIGVFLS  105

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  +
Sbjct  106  SMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGWN  162

Query  773  AFLSWLEQQ  799
            ++LSW+  Q
Sbjct  163  SYLSWVNSQ  171



>gb|KIH89476.1| protein Mpv17 [Sporothrix brasiliensis 5110]
Length=172

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 96/192 (50%), Gaps = 22/192 (11%)
 Frame = +2

Query  227  TWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKR  406
             WY+  LA RPL TQ +++ VL+A+GD+ AQ            L+   G       D  R
Sbjct  3    AWYKARLAARPLLTQSVTTAVLFAVGDITAQQ-----------LVERRGPTGH---DSMR  48

Query  407  VGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLF  586
             G   +YG   FGP    WY  L + + L         + +  +VA D  VF P+ + +F
Sbjct  49   TGRMALYGGAVFGPAAATWYGILQRHVVLS-----TPRKTMLARVAADQGVFAPVFIGVF  103

Query  587  FTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSML  766
             + M    G S    +E +++++  AL      WP AQ VNF  VP+++++L+VN+ S+ 
Sbjct  104  LSSMAVLEGGSP---QEKLEKNYKNALTANYMLWPAAQMVNFSLVPLEHRVLFVNLVSIG  160

Query  767  DSAFLSWLEQQQ  802
             +++LS+L   +
Sbjct  161  WNSYLSYLNSSK  172



>emb|CDW91795.1| mpv17 pmp22 family protein [Stylonychia lemnae]
Length=266

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 100/195 (51%), Gaps = 20/195 (10%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y   L+ RPL T++I+SG + A GD++ Q+              ++ + K+ + + +R  
Sbjct  75   YNYHLSTRPLVTKMITSGAIGAFGDLLCQTF-------------ENRTKKEKSYNLQRTK  121

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATK-VAVDVLVFGPLNLLLFF  589
               + G  F  P  H  Y      I L  RL P      A K +A+D LVF P+ + +F+
Sbjct  122  SFFLTGTFFIAPLLHLSYS-----IVLP-RLVPELTTVGAIKKLALDQLVFAPVVVTMFY  175

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              + F  GK   Q  E +K  F+P ++     WP+A  +NF ++P+QYQ+L+ NM S+L 
Sbjct  176  PVINFIEGKPFQQSIEDLKNKFIPTMITNYKIWPLANFINFTFIPIQYQVLWANMISLLF  235

Query  770  SAFLSWLEQQQKEAS  814
            +A LS++   +  A+
Sbjct  236  NACLSFIHNNKSIAN  250



>dbj|GAM22026.1| hypothetical protein SAMD00019534_052010, partial [Acytostelium 
subglobosum LB1]
Length=204

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 102/199 (51%), Gaps = 15/199 (8%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITIS-TSKKQRLLISDSGSNKDLTI  394
            R+W  Y   L   PL T+ +S+  L   GDV+AQ +     S  +R+        K   +
Sbjct  10   RLWQPYLRALDSYPLVTKSLSTAALMGTGDVIAQRLEYHYKSPSERM------KTKGFEV  63

Query  395  D-RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
            D R+ + +TG+ GA F GP  HFWY+ LD  ++ +  L       +  K+A+D L F P+
Sbjct  64   DVRRALTMTGV-GAFFSGPLLHFWYKRLDILVRGEGAL------VVVKKLALDQLAFAPV  116

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             +  F   MG   GK+ SQ  + I+ D   AL    + WP+A A+NF  +P   ++LYV+
Sbjct  117  VISAFIGLMGTLNGKTPSQCIQAIQNDLFFALKANWTLWPLANAINFALIPPSLRVLYVS  176

Query  752  MFSMLDSAFLSWLEQQQKE  808
              S+  + FLS L  ++ +
Sbjct  177  TVSVFWNIFLSNLGNKKHD  195



>gb|EWM26132.1| mpv17-like protein [Nannochloropsis gaditana]
 gb|EWM26133.1| mpv17-like protein [Nannochloropsis gaditana]
Length=190

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 100/195 (51%), Gaps = 20/195 (10%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTID  397
            R+W+ Y   L   PL  + ++S   + IGDV+AQ       +K                D
Sbjct  4    RLWSQYNVALEKNPLLIKALTSLTGFTIGDVLAQKFVTPDEEKGY--------------D  49

Query  398  RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNL  577
              R    G +G    GP GHF+Y  LD+      ++   +++ +ATKVA+D L++ P   
Sbjct  50   LMRTVRLGSFGFLVHGPTGHFFYGWLDK------QIPGTAMKTVATKVAIDQLLWNPCFG  103

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
            ++FF+Y+G + GKS + ++  IK D   A++   + W  A  +NFR+VP   +LLY+N  
Sbjct  104  VMFFSYLGLAEGKSFTDIQAKIKNDLATAVVGSWTVWIPAHFINFRFVPSNQRLLYINSI  163

Query  758  SMLDSAFLSWLEQQQ  802
             +  + FLS+L  ++
Sbjct  164  QIGYNIFLSFLGNKK  178



>emb|CEJ88834.1| Putative Protein SYM1 [Torrubiella hemipterigena]
Length=174

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 92/190 (48%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RP  TQ I++  L+A GD+ AQ            L+   G+      D  R 
Sbjct  7    WYNAKLASRPFLTQSITTAALFATGDIAAQQ-----------LVEKKGAKDH---DFART  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP   FWY     F+  +   Q   ++ +A +V  D  VF P+ + +F 
Sbjct  53   GRMTLYGGTVFGPVATFWYG----FLARRVVFQSKKIETIA-RVTCDQTVFAPVMIGVF-  106

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              +G      G+  ++ I++ + PAL      WP  Q +NF  VP+Q++LL+ N+ ++  
Sbjct  107  --LGSMAKLEGTDAQKRIEKTWWPALKANWMVWPAVQTINFAVVPLQFRLLFANVVAIGW  164

Query  770  SAFLSWLEQQ  799
            + +LSW+  Q
Sbjct  165  NCYLSWINSQ  174



>gb|ERS96861.1| hypothetical protein HMPREF1624_07070 [Sporothrix schenckii ATCC 
58251]
Length=172

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 96/191 (50%), Gaps = 22/191 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY+  LA RPL TQ +++ VL+A+GDV AQ            L+   G       D  R 
Sbjct  4    WYKARLAARPLLTQSVTTAVLFAVGDVTAQQ-----------LVERRGPTGH---DSMRT  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    WY  L + + L         + +  +VA D  VF P+ + +F 
Sbjct  50   GRMALYGGTVFGPAAATWYGILQRHVVLS-----TPRKTMLARVAADQGVFAPVFIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    +E +++++  AL      WP AQ VNF  VP+++++L+VN+ S+  
Sbjct  105  SSMAVLEGGSP---QEKLEKNYKNALTANYMLWPAAQMVNFSLVPLEHRVLFVNLVSIGW  161

Query  770  SAFLSWLEQQQ  802
            +++LS+L   +
Sbjct  162  NSYLSYLNSSK  172



>gb|EXM30511.1| protein SYM1 [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=171

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 91/189 (48%), Gaps = 21/189 (11%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y   LA RPL TQ +++  L+A GD+ AQ            L+   G  K    D  R G
Sbjct  4    YNARLAARPLLTQSVTTAFLFATGDITAQQ-----------LVEKKGVEKH---DLVRTG  49

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F +
Sbjct  50   RMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLTRVACDQLGFAPVMIGVFLS  105

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  +
Sbjct  106  SMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGWN  162

Query  773  AFLSWLEQQ  799
            ++LSW+  Q
Sbjct  163  SYLSWVNSQ  171



>gb|ENH82799.1| integral membrane mpv17 pmp22 [Colletotrichum orbiculare MAFF 
240422]
Length=221

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 105/211 (50%), Gaps = 27/211 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ I++ +L+A GD+ AQ +      K                D  R 
Sbjct  4    WYQARLAARPLLTQSITTSILFATGDITAQQLVDKRGLKGH--------------DWSRT  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+    +F++    L+  +L+ LA +V VD  VF P+ + +F 
Sbjct  50   GRMALYGGTIFGPAATTWF----KFLQKNIVLRNKNLEILA-RVGVDQGVFAPVMIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS---  760
            + M    G S    +E +++++  AL      WP  QAVNF++VP+ +++L+VN+ S   
Sbjct  105  SSMAVLEGGSP---QEKLQKNYTTALTSNFLLWPFVQAVNFKFVPLHHRVLFVNVISIDE  161

Query  761  --MLDSAFLSWLEQQQKEASGKQCFASVPIS  847
              +L  A  +++  ++++A     FA   + 
Sbjct  162  KDLLGKAADTYIADEREQALPSVGFAKTDVE  192



>gb|KDN69708.1| putative Mpv17/PMP22 family protein [Colletotrichum sublineola]
Length=175

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 95/189 (50%), Gaps = 22/189 (12%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y+  LA RPL TQ I++GVL+A GD+ AQ            L+   G  K    D  R  
Sbjct  9    YRARLAARPLLTQSITTGVLFATGDITAQQ-----------LVDKRGLEKH---DFSRTA  54

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
                YG   FGP    W++ L   I LK     N    +  +VAVD  VF P+ + +F +
Sbjct  55   RMAFYGTAVFGPIATNWFKFLQNNIVLK-----NKNAEMLARVAVDQGVFAPVMIGVFLS  109

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M    G S   V+E + +++  AL      WP  Q VNF+ +P+ ++LL+VN+ S+  +
Sbjct  110  SMATLEGGS---VQEKLDKNYKTALTSNYMLWPFVQMVNFKLIPLHHRLLFVNVISIGWN  166

Query  773  AFLSWLEQQ  799
            ++LS+L  +
Sbjct  167  SYLSFLNSK  175



>ref|XP_001827254.1| protein sym1 [Aspergillus oryzae RIB40]
 sp|Q2TXA2.1|SYM1_ASPOR RecName: Full=Protein sym1 [Aspergillus oryzae RIB40]
 dbj|BAE66121.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT75837.1| peroxisomal membrane protein [Aspergillus oryzae 3.042]
 gb|KDE81776.1| peroxisomal membrane protein [Aspergillus oryzae 100-8]
Length=173

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 90/192 (47%), Gaps = 22/192 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA +P+ T  ++S VL+  GDV+AQ +           +   G  K    D  R 
Sbjct  4    WYQAKLAKQPILTASVTSAVLFGSGDVLAQQV-----------VDRKGLEKH---DFART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + + LK     NS   +  +VA D  +F P +L  F 
Sbjct  50   GRMALYGGAIFGPAATTWFGFLQRNVVLK-----NSKATIVARVAADQCLFTPTHLTCFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            T M       GS   E  +  FLP+     + WP+ Q VNF  VP++Y++L VN+ S+  
Sbjct  105  TSMAI---MEGSDPIEKWRNSFLPSYKANLTIWPLVQGVNFSIVPLEYRVLVVNLVSLGW  161

Query  770  SAFLSWLEQQQK  805
            +  LS +    K
Sbjct  162  NCLLSMINSGDK  173



>ref|XP_001276424.1| integral membrane protein, Mpv17/PMP22 family, putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW14998.1| integral membrane protein, Mpv17/PMP22 family, putative [Aspergillus 
clavatus NRRL 1]
Length=186

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 95/188 (51%), Gaps = 22/188 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  L  RPL TQ +++  L+A+GD +AQ             +   G  K    D  R 
Sbjct  4    WYQRSLIQRPLLTQSLTTACLFAVGDGLAQQA-----------VEKRGIAKH---DVMRT  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W++ L + I L     P++ + +  +VA D L+F P  + +F 
Sbjct  50   GRMALYGGAVFGPLATKWFQFLQKRINL-----PSTQKTVVARVAADQLLFAPTVIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    G S    ++ +++ + PAL    + WPV Q +NF  VP+QY++L VN+ ++  
Sbjct  105  SSMSIMEGGSP---QDKLQKAYWPALQANWTVWPVLQLMNFALVPLQYRVLTVNVLNIGW  161

Query  770  SAFLSWLE  793
            + FLS L 
Sbjct  162  NCFLSLLN  169



>gb|EFA78150.1| pmp22 family protein [Polysphondylium pallidum PN500]
Length=537

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 95/197 (48%), Gaps = 14/197 (7%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTID  397
            ++W  Y   L   PL T+ I++GVL   GDV+AQSI   T+        D    K    D
Sbjct  355  KLWNPYLRALDSHPLITKSITTGVLMGTGDVLAQSIEHYTN--------DDKHKKKFKWD  406

Query  398  RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNL  577
             KR       G  F GP  HFWY+ LD+ +  +  +       +A K+A D + F P+ +
Sbjct  407  TKRTLTMTSVGMVFSGPCLHFWYKTLDRLVVGEGAM------VVAKKIAFDQIAFAPVVI  460

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
              F   M    GK+ SQ   TIK D   AL    S WP+AQ + F  VP   ++LYV+  
Sbjct  461  SAFIFIMNSINGKTPSQSLTTIKTDLPSALKANWSLWPMAQIICFSIVPPSLRVLYVSTV  520

Query  758  SMLDSAFLSWLEQQQKE  808
            S+  + FLS L  + K+
Sbjct  521  SVFWNIFLSQLGNKHKK  537



>gb|EWM28134.1| mpv17-like protein [Nannochloropsis gaditana]
Length=289

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 104/199 (52%), Gaps = 22/199 (11%)
 Frame = +2

Query  206  NPMLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKD  385
            NP+  +W  Y   L  +PL T+ ++S V +++GD++AQ                   +K 
Sbjct  99   NPLQLLWKGYNQLLKDQPLLTKALTSFVGFSVGDLLAQKFI----------------DKS  142

Query  386  LTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
              +D KR+     +G    GP GH++Y  LD       ++   S   +A+KVA+D L++ 
Sbjct  143  EVVDLKRLLKLAFFGLLVHGPTGHYFYGFLDG------KMPGTSAVTVASKVAIDQLLWN  196

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
            P+   +FF ++G + G++   +K  I++D   ++    + WP+A A+NFR++P   +LLY
Sbjct  197  PIFGTMFFGWLGLTEGQNLEGIKNRIEKDLWASVKGSWTVWPIAHAINFRFIPNSQRLLY  256

Query  746  VNMFSMLDSAFLSWLEQQQ  802
            +N   +  + FLS+L  + 
Sbjct  257  INSVQIGYNMFLSFLANRN  275



>ref|XP_005703050.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
 gb|EME26530.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
Length=202

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 99/205 (48%), Gaps = 19/205 (9%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTID  397
            R+W  Y   LA RPL  +V++S V  A+GDV+AQ   +   ++  +L +   S+      
Sbjct  11   RLWYRYNRALATRPLPVKVVTSTVGLALGDVIAQLPLMYEGERWDVLRTLRFSS------  64

Query  398  RKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNL  577
                     +G    GP  H WY+ LD+ I       P S + +  K  +D L++ P+  
Sbjct  65   ---------FGLVVHGPLSHVWYQFLDKHI---LATAPKSFRAVVAKTMMDQLLWAPVFT  112

Query  578  LLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMF  757
             +FF Y+  + G  G  + E I+    P L +    WP A   NFR+VP   ++LYVN+ 
Sbjct  113  SVFFAYLKAAQGNWGDIIPE-IRHKLWPTLKVNWLVWPAAHIFNFRFVPDSQRVLYVNII  171

Query  758  SMLDSAFLSWLEQQQKEASGKQCFA  832
            ++  +AFLS +   +K +   Q  A
Sbjct  172  ALGYNAFLSSMAATKKVSDPLQVIA  196



>ref|XP_008020534.1| hypothetical protein SETTUDRAFT_162002 [Setosphaeria turcica 
Et28A]
 gb|EOA91209.1| hypothetical protein SETTUDRAFT_162002 [Setosphaeria turcica 
Et28A]
Length=193

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 91/190 (48%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  L   PL TQ I++ VL+A GD +AQ             +   G +K    D  R 
Sbjct  5    WYQAKLRTAPLLTQSITTAVLFATGDTMAQQG-----------VERRGLDKH---DLMRT  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W++ L + + L     P+    +  +VA D  +F P+N+ LF 
Sbjct  51   GRMALYGGCIFGPAATKWFDFLVRRVNL-----PSKNGTIVARVACDQFLFAPVNMALFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M +  G S  Q    +K  +LP        WP  Q  NF+YVP + ++L VN+ S+  
Sbjct  106  SSMAYMEGNSPVQ---RLKDAYLPGYQKNLMIWPFVQFTNFKYVPAEMRVLVVNIISLGW  162

Query  770  SAFLSWLEQQ  799
            + +LS+L  Q
Sbjct  163  NCYLSFLNSQ  172



>gb|EXL93873.1| protein SYM1 [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=171

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 90/189 (48%), Gaps = 21/189 (11%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y   LA RPL TQ +++  L+A GDV AQ            L+   G  K    D  R G
Sbjct  4    YNARLAARPLLTQSVTTAFLFATGDVTAQQ-----------LVEKKGVEKH---DLVRTG  49

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               +YG   FGP    W+     F+  +  +  N    + T+VA D L F P+ + +F  
Sbjct  50   RMALYGGFVFGPVATTWFA----FLARRVNVPGNKKAEVLTRVACDQLGFAPVMIGVFLG  105

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M    GKS    +E I + + PAL      WP  Q +NF  +P+QY+L + N+ ++  +
Sbjct  106  SMATMEGKSA---QERIDKAWWPALKANWMLWPAVQVINFSLIPLQYRLFFANIIAIGWN  162

Query  773  AFLSWLEQQ  799
            ++LSW+  Q
Sbjct  163  SYLSWVNSQ  171



>gb|KFH45512.1| hypothetical protein ACRE_036540 [Acremonium chrysogenum ATCC 
11550]
Length=175

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 94/191 (49%), Gaps = 24/191 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ +L+A GD+ AQ            L+   G  K    D  R 
Sbjct  8    WYNGRLAARPLLTQAVTTSILFATGDITAQQ-----------LVERRGLEKH---DLTRT  53

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLA-TKVAVDVLVFGPLNLLLF  586
            G   +YG   FGP    W+  L +      R+ P++ +     +VA D L F P+ + +F
Sbjct  54   GRMALYGGFVFGPVATTWFNFLAR------RVNPSNKRLTTMARVACDQLAFAPVMIGVF  107

Query  587  FTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSML  766
             + M    G S    K  ++  + PAL      WP  Q VNF ++P+Q+++L+ N+ S+ 
Sbjct  108  LSSMATMEGGSP---KHKLEITWWPALKANWMVWPFVQMVNFTFLPLQHRVLFANVVSIG  164

Query  767  DSAFLSWLEQQ  799
             +++LSW+  Q
Sbjct  165  WNSYLSWVNNQ  175



>ref|XP_002180247.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48438.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=179

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 100/187 (53%), Gaps = 13/187 (7%)
 Frame = +2

Query  224  WTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRK  403
            W  Y + L  +PL T+ ++S V W +GDV+AQ      S+ Q +   D  + K L+  R 
Sbjct  1    WAAYNDALDSKPLFTKAMTSLVGWGLGDVLAQ--VRFDSRAQSM---DQFTGK-LSF-RT  53

Query  404  RVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLL  583
            R     ++G  + GP GH++Y  LD       +++    Q +A KV +D +++ P+ + +
Sbjct  54   RFVTLSVFGFIYHGPSGHYFYNWLDG------KIKGTRAQDVALKVGIDQILWCPIFMTV  107

Query  584  FFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSM  763
            FFTY+G   G S + +   IK D L A       WP+  AVNF+++  +++L+++N   +
Sbjct  108  FFTYLGLCNGDSFNTIGNKIKNDLLSACQGSWKVWPIVHAVNFKFISSKHRLVFINAVQV  167

Query  764  LDSAFLS  784
              + FLS
Sbjct  168  AFNMFLS  174



>gb|EHN01156.1| Sym1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EJT41858.1| SYM1-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=197

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 103/217 (47%), Gaps = 20/217 (9%)
 Frame = +2

Query  215  LRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTI  394
            +R+   Y+  L  RP  T  I +G L+ IGDV AQ +   TSK       D G       
Sbjct  1    MRLLHLYEVSLKRRPKTTNAIMTGALFGIGDVSAQFL-FPTSK------VDKG------F  47

Query  395  DRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLN  574
            D KR     +YG+  F   G  WY  L+  + ++ + Q      +  +VAVD L F PL 
Sbjct  48   DYKRTARAVVYGSLIFSFIGDKWYRILNNRVYMRNKPQ-YHWSNMVLRVAVDQLAFAPLG  106

Query  575  LLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNM  754
            L  +FT M    G+S    K  I  ++ P L+   + WP+ QAVNF  VP+Q++LL VN+
Sbjct  107  LPFYFTCMSIMEGESLDVAKLKIGEEWWPTLLTNWAVWPIFQAVNFSIVPLQHRLLAVNV  166

Query  755  FSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             ++  + +LS+   +  E         VP+   P  E
Sbjct  167  VAIFWNTYLSYKNSKVTEKE------RVPVHYPPVVE  197



>ref|XP_007277456.1| integral membrane mpv17 pmp22 [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA33476.1| integral membrane mpv17 pmp22 [Colletotrichum gloeosporioides 
Nara gc5]
Length=172

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 99/191 (52%), Gaps = 22/191 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ I++ +L+A GD+ AQ            L+   G  K    +  R 
Sbjct  4    WYQARLAARPLLTQSITTAILFATGDLTAQQ-----------LVEKRGLEKH---EWART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+    +F++    L+  +L+ LA +V VD  VF P+ + +F 
Sbjct  50   GRMALYGGTIFGPAATTWF----KFLQNNVVLRNKNLEILA-RVGVDQGVFAPVMIGVFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M       G   +E +++ +  AL      WP  Q VNF+ VP+ +++L+VN+ S+  
Sbjct  105  SSMAV---LEGVPPQEKLEKSYTTALTSNYMLWPFVQMVNFKLVPLHHRVLFVNVISIGW  161

Query  770  SAFLSWLEQQQ  802
            +++LS+L  Q+
Sbjct  162  NSYLSFLNSQK  172



>gb|ELT87101.1| hypothetical protein CAPTEDRAFT_150250 [Capitella teleta]
Length=204

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 94/194 (48%), Gaps = 24/194 (12%)
 Frame = +2

Query  278  SSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVGITGMYGAGFFGPFGH  457
              GVL  +GD+  Q +    + K +L             D KR G   + G    GP  H
Sbjct  28   GCGVLMGLGDIATQLLVHEKTDKVKL-------------DWKRTGRMVVMGVAL-GPLFH  73

Query  458  FWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKE  637
             WY  LD++      L   SL  +A K+  D  V  P  LLLFF  MG   G+S  ++K 
Sbjct  74   GWYSMLDRY------LPGRSLSTVAKKLVADQGVACPGFLLLFFGGMGLMEGQSQEEIKS  127

Query  638  TIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQ-KEAS  814
             IK  F+P ++ +   WP  QA+NFR+VP Q+++LYV   ++    FLS+++ ++  E  
Sbjct  128  EIKCKFVPLIIADCCFWPPMQAINFRFVPPQFRVLYVACCTLFWDGFLSYMKYKKFDEED  187

Query  815  G---KQCFASVPIS  847
            G   K+   S P S
Sbjct  188  GNFLKKLLKSTPDS  201



>ref|XP_003718248.1| hypothetical protein MGG_00752 [Magnaporthe oryzae 70-15]
 gb|EHA48664.1| hypothetical protein MGG_00752 [Magnaporthe oryzae 70-15]
Length=197

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 95/191 (50%), Gaps = 22/191 (12%)
 Frame = +2

Query  221  VWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDR  400
            V+ WYQ  LA RPL TQ I++ VL+A GD+ AQ            L+   G  K    D 
Sbjct  2    VFAWYQARLAARPLLTQSITTAVLFATGDITAQQ-----------LVEKRGLEKH---DF  47

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
             R G    YG   FGP    W+  L + + LK     N+   +  +VAVD  +F P  + 
Sbjct  48   VRTGRMFAYGGIIFGPAATTWFGILQRHVVLK-----NANATILARVAVDQGLFAPTFVG  102

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
            +F + M       GS  +E +K  +  AL      WP  Q VNF++VP+ +++L+VN+ S
Sbjct  103  VFLSSMAI---LEGSSPQEKLKSTYSTALTSNYMLWPFVQLVNFKFVPLHHRVLFVNVIS  159

Query  761  MLDSAFLSWLE  793
            +  + +LS+L 
Sbjct  160  IGWNCYLSFLN  170



>ref|XP_002384507.1| integral membrane protein, Mpv17/PMP22 family, putative [Aspergillus 
flavus NRRL3357]
 gb|EED45571.1| integral membrane protein, Mpv17/PMP22 family, putative [Aspergillus 
flavus NRRL3357]
Length=188

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 85/178 (48%), Gaps = 22/178 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA +P+ T  ++S VL+  GDV+AQ +           +   G  K    D  R 
Sbjct  4    WYQAKLAKQPILTASVTSAVLFGSGDVLAQQV-----------VDRKGLEKH---DFART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + + LK     NS   +  +VA D  +F P +L  F 
Sbjct  50   GRMALYGGAIFGPAATTWFGFLQRNVVLK-----NSKATIVARVAADQCLFTPTHLTCFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSM  763
            T M       GS   E  +  FLP+     + WP+ Q VNF  VP++Y++L VN+ S+
Sbjct  105  TSMAI---MEGSDPIEKWRNSFLPSYKANLTIWPLVQGVNFSIVPLEYRVLVVNLVSL  159



>gb|EEH40591.2| hypothetical protein PAAG_09044 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=173

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 92/192 (48%), Gaps = 22/192 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ + S +L+  GDV+AQ +      +                D  R 
Sbjct  4    WYQVQLARRPLLTQSVGSAILFGAGDVLAQQLVDRADTEHH--------------DYART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                +YG  FFGP    WY+ +D+ I L      +    LA ++A D L+F P ++  F 
Sbjct  50   ARMVLYGGAFFGPGASTWYKFMDRHIILS-----SPKLTLAARIAGDQLLFTPTHMFAFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GK     +E ++  +  A       WP  QA+NF +VP+Q+++L VN+ S+  
Sbjct  105  SSMSIMEGKDP---REKLRNSYWAAYKANLMIWPWVQAINFTFVPLQHRVLVVNIVSLGW  161

Query  770  SAFLSWLEQQQK  805
            +  LS +  +++
Sbjct  162  NCILSVINSRKQ  173



>ref|XP_004359177.1| pmp22 family protein [Dictyostelium fasciculatum]
 gb|EGG21327.1| pmp22 family protein [Dictyostelium fasciculatum]
Length=194

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 94/196 (48%), Gaps = 13/196 (7%)
 Frame = +2

Query  221  VWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDR  400
            +W  Y   L   PL  + +++G L   GDV+AQSI       +     +    K    D 
Sbjct  10   IWKPYIRALDRFPLIVKSLTTGTLMGTGDVMAQSI-------EYYRYGEKTKKKSFEWDI  62

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
             R       G  F GP  HFWY  LD+  K + ++       +A K+A D L+F P  + 
Sbjct  63   GRTMTMSGVGLCFSGPVLHFWYRKLDRVFKGEGKI------VVAKKLACDQLLFAPCVIS  116

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
            +F   M     KS + +   IKRD  PAL++  S WP+AQ V F  +P   ++L+V++ S
Sbjct  117  VFMGIMDTLNHKSPNSILPRIKRDLPPALLVNWSLWPLAQTVTFSVIPPHLRVLFVSIVS  176

Query  761  MLDSAFLSWLEQQQKE  808
            +  + FLS L  ++ +
Sbjct  177  VFWNIFLSQLGNKKDD  192



>gb|EHK25202.1| hypothetical protein TRIVIDRAFT_81939 [Trichoderma virens Gv29-8]
Length=190

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 97/206 (47%), Gaps = 22/206 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RP  TQ +++ VL+A GD+ AQ            L+   G+      D  R 
Sbjct  7    WYNGRLAARPYLTQGVTTAVLFATGDITAQQ-----------LVEKRGAKGH---DVSRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W   L +  ++ FR   N+    A +VA D L+F P+ + +F 
Sbjct  53   GRMALYGGCVFGPVATTWLGFLAR--RVTFR---NARVETAARVAADQLLFAPVMIGVFL  107

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    GKS  +  ET    +  AL      WP  Q VNF ++P+QY+LL+ N+ S+  
Sbjct  108  GSMATMEGKSPQKRLETT---WWSALKANWVLWPAVQFVNFTFLPLQYRLLFANVISIGW  164

Query  770  SAFLSWLEQQQKEASGKQCFASVPIS  847
            +++LSW+  +    S      + P +
Sbjct  165  NSYLSWVNSKGGNKSKDHELVAAPAT  190



>ref|XP_007687660.1| hypothetical protein COCMIDRAFT_26058 [Bipolaris oryzae ATCC 
44560]
 gb|EUC45791.1| hypothetical protein COCMIDRAFT_26058 [Bipolaris oryzae ATCC 
44560]
Length=193

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 94/198 (47%), Gaps = 26/198 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ+ L   PL TQ I++ VL+A GD +AQ             +   G +K    D  R 
Sbjct  5    WYQSKLRTSPLLTQSITTAVLFATGDTMAQQG-----------VERRGLDKH---DLTRT  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G    YG   FGP    W+  L   + L     P+    +  +VA D  +F PLN+ +F 
Sbjct  51   GRMAAYGGCIFGPAATKWFGFLVSRVNL-----PSKNGTIIARVACDQFLFAPLNMTVFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M +  G S +Q    +K  F+P        WP  Q VNF+YVP + ++L VN+ S+  
Sbjct  106  SSMAYMEGNSPTQ---RLKDAFVPGYQKNLMIWPWVQFVNFKYVPAEMRVLVVNIISLGW  162

Query  770  SAFLSWLEQQQKEASGKQ  823
            + +LS+L      A GK+
Sbjct  163  NCYLSYLN----SAGGKK  176



>gb|EME48377.1| hypothetical protein DOTSEDRAFT_161874 [Dothistroma septosporum 
NZE10]
Length=187

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (49%), Gaps = 24/204 (12%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA  PL TQ +++ +L+A GD +AQ            L+   G   +  
Sbjct  1    MLR---WYQARLASSPLLTQSVTTAILFATGDTMAQQ-----------LVEKKGIANN--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    W+  L +  K+    +PN+   +  +V  D  VF   
Sbjct  45   -EWARAGRMALYGGCVFGPAATMWFGFLQR--KVVIPNKPNAT--IVARVLTDQTVFAST  99

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            NL  F + M       G+  KE +K+ +  AL      WP+ QA NF++VP+++++L VN
Sbjct  100  NLFCFLSSMAL---MEGTDPKEKLKQSYGTALQKNWMVWPIVQATNFKFVPLEHRVLVVN  156

Query  752  MFSMLDSAFLSWLEQQQKEASGKQ  823
            + S+  + +LS+L      +  K+
Sbjct  157  VVSLGWNCYLSYLNSAPSGSHNKE  180



>ref|XP_005707818.1| peroxisomal membrane MPV17/PMP22-like protein isoform 2 [Galdieria 
sulphuraria]
 ref|XP_005707819.1| peroxisomal membrane MPV17/PMP22-like protein isoform 1 [Galdieria 
sulphuraria]
 gb|EME31298.1| peroxisomal membrane MPV17/PMP22-like protein isoform 2 [Galdieria 
sulphuraria]
 gb|EME31299.1| peroxisomal membrane MPV17/PMP22-like protein isoform 1 [Galdieria 
sulphuraria]
Length=186

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 97/204 (48%), Gaps = 21/204 (10%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M  +W  Y   L   PL+ + ++S   + +GD++AQS  + +                  
Sbjct  1    MAGIWARYNAALTANPLKVKTLTSFFGFTLGDLIAQSPDMLSGNPW--------------  46

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R      +G    GP GH+WY+ LD+ +       P S   +ATK A+D L++ P+
Sbjct  47   -DYMRTARFSAFGLCIHGPIGHYWYQFLDRTVMTN---APKSGLAVATKTAIDQLLWAPI  102

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
               +FF++M    G    QV E +K    P + +    WP+A  +NFR+VP   ++LY+N
Sbjct  103  FTSIFFSFMKTVEGHP-DQVTEEVKTKLWPTMKVNWGVWPLAHLINFRFVPSSQRILYIN  161

Query  752  MFSMLDSAFLSWL--EQQQKEASG  817
               +  + FLS +   + ++E SG
Sbjct  162  SVQIGYNTFLSTMAASKTKEEVSG  185



>ref|XP_001395222.2| protein sym1 [Aspergillus niger CBS 513.88]
Length=173

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 94/198 (47%), Gaps = 25/198 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA +P+ T  ++S +L+  GDV+AQ            L+   G +K   
Sbjct  1    MLR---WYQARLAKQPILTASVTSALLFGSGDVLAQQ-----------LVDRKGFDKH--  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R G   +YG   FGP    WY  L + + L      N+   L  +V  D  VF P 
Sbjct  45   -DLARTGRMALYGGAIFGPAATTWYGVLQRHVVLN-----NAKTTLIARVIADQCVFTPA  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L  F + M       G+   E  +  F+P+     + WP+ Q VNF  VP++Y++L+VN
Sbjct  99   HLTCFLSSMAI---MEGTDPIEKWRNGFVPSFKANLAIWPLVQGVNFAIVPLEYRVLFVN  155

Query  752  MFSMLDSAFLSWLEQQQK  805
            + ++  +  LS +   +K
Sbjct  156  LVALGWNCLLSLINSGEK  173



>ref|XP_003352903.1| hypothetical protein SMAC_05017 [Sordaria macrospora k-hell]
 emb|CCC09259.1| unnamed protein product [Sordaria macrospora k-hell]
Length=172

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 97/193 (50%), Gaps = 25/193 (13%)
 Frame = +2

Query  227  TWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSG-SNKDLTIDRK  403
             WY+  LA RPL TQ I++ +L+ +GDV AQ            L+   G SN D+T    
Sbjct  3    NWYKAKLAARPLLTQSITTAILFGVGDVTAQQ-----------LVDRRGLSNHDVT----  47

Query  404  RVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSL-QFLATKVAVDVLVFGPLNLL  580
            R G    YG   FGP    W+  L + + +     P S  + +  +VA D  +F P  + 
Sbjct  48   RTGRMVFYGGAVFGPAATTWFRVLQKHVVI-----PGSANKTILARVAADQGLFAPTFIG  102

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
            +F + M       G+ V + +K+++  AL      WP  Q VNF+ VP+ +++L+VN+ S
Sbjct  103  IFLSSMAV---MEGTDVGDKLKKNYWEALSTNWMVWPFVQLVNFKMVPLDHRVLFVNVIS  159

Query  761  MLDSAFLSWLEQQ  799
            +  + +LSWL  +
Sbjct  160  IGWNCYLSWLNGK  172



>ref|XP_001027141.1| Mpv17 / PMP22 family protein [Tetrahymena thermophila]
 gb|EAS06899.1| Mpv17/PMP22 family protein [Tetrahymena thermophila SB210]
Length=221

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 97/197 (49%), Gaps = 9/197 (5%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            +LR+   Y  +    P ++ ++S+G L+  GD++ Q I     +K+     +  SN  +T
Sbjct  7    VLRLVERYNKYTEQNPAKSIILSTGFLFGAGDLLTQQIDRYYERKEH----EGDSNYQVT  62

Query  392  -IDRKRVGITGMYGAGFFGPFGHFWY-EGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFG  565
             I++ R+    +YG  F GPF + WY   L +   +      + L     K+A+D +V  
Sbjct  63   PINKMRIAHMCLYGLTFMGPFSYVWYTHALPKIAPITIEACKSQL---FKKIAIDQVVGS  119

Query  566  PLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLY  745
             +    F   M    GKS S+  + IK DF+   + +   WP  Q +NFRYVP+  Q LY
Sbjct  120  GIQYSSFLVAMTLLGGKSISENSKKIKEDFVQCCISDVFVWPWVQFLNFRYVPIHMQALY  179

Query  746  VNMFSMLDSAFLSWLEQ  796
            VN  S+  +A++S +  
Sbjct  180  VNFVSVFWNAYISAIHH  196



>emb|CCX33601.1| Similar to Protein SYM1; acc. no. Q4IPX8 [Pyronema omphalodes 
CBS 100304]
Length=247

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 101/201 (50%), Gaps = 23/201 (11%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            M  ++  YQ  +A  P  T  I+SG+L+ +GDV+AQ             I   G  +   
Sbjct  1    MANIFRAYQRQIANHPFRTGAITSGLLFGMGDVIAQQ-----------GIEKKGIQQHNF  49

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
                R+     YG   FGP    WY+ L+++I +K R  PN    + ++VA D L+F P+
Sbjct  50   AATARMA---AYGTCVFGPAAVGWYKVLEKYIVIKNR--PNVE--MISRVAADQLIFAPV  102

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             + +FF  M       G   +E +   +  AL    + WP  Q +NFR+VP++ ++L+ N
Sbjct  103  GIAVFFASMA---TMEGGNAQEKLAESWWVALRANWNVWPAVQLINFRFVPLEMRVLFAN  159

Query  752  MFSMLDSAFLSWLE--QQQKE  808
            + S+  +++LSWL   QQ K+
Sbjct  160  VISVGWNSYLSWLNSLQQNKK  180



>ref|XP_002542852.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP77519.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=177

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 94/198 (47%), Gaps = 25/198 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ  LA  PL TQ I S VL+  GDV+AQ +        R+ I +        
Sbjct  1    MLR---WYQARLARNPLLTQSIGSAVLFGAGDVLAQQLV------DRVGIENH-------  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             +  R G   +YG   FGP    WY+ L + + LK     N    L  +V  D L+F P 
Sbjct  45   -NYARTGRMALYGGAIFGPAAATWYKFLARNVALK-----NRTLTLVARVCSDQLLFTPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
            +L  F + M       G+   E ++  FLPA       WP  QA NF  VP+++++L VN
Sbjct  99   HLFAFLSSMSV---MEGNDPIEKLRTSFLPAYKANLMLWPWVQAANFSLVPLEHRVLVVN  155

Query  752  MFSMLDSAFLSWLEQQQK  805
            + S+  +  LS +  +++
Sbjct  156  VVSLGWNCILSLINSKKQ  173



>emb|CDM38143.1| Protein sym1 [Penicillium roqueforti FM164]
Length=174

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 91/198 (46%), Gaps = 25/198 (13%)
 Frame = +2

Query  212  MLRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLT  391
            MLR   WYQ+ LA RP+ T  I+S  L+  GDV+AQ        ++              
Sbjct  1    MLR---WYQSKLAKRPILTASITSAFLFGSGDVLAQQAVDRKGLQEH-------------  44

Query  392  IDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPL  571
             D  R G   +YG   FGP    W+  L + + LK      +    A +VA D + F P 
Sbjct  45   -DFARTGRMALYGGAVFGPVATTWFGILQRHVVLK-----GTASTTAARVAADQVFFAPT  98

Query  572  NLLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVN  751
             L  F + M       G+   E +K  F+PA       WP  Q VNF ++P++ +LL+VN
Sbjct  99   QLTCFLSSMAI---MEGADPVERLKTAFVPAYKANLMVWPFVQGVNFTFIPLELRLLFVN  155

Query  752  MFSMLDSAFLSWLEQQQK  805
            + S+  + FLS +   ++
Sbjct  156  VVSLGWNCFLSLMNSGEE  173



>gb|EHK40338.1| hypothetical protein TRIATDRAFT_302717 [Trichoderma atroviride 
IMI 206040]
Length=188

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 92/193 (48%), Gaps = 22/193 (11%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ VL+A GD+ AQ +      K                D  R 
Sbjct  7    WYNGRLAARPLLTQGVTTAVLFATGDLTAQQLVEKKGLKNH--------------DVART  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W   L +  ++ FR   N+      +VA D  +F P+ + +F 
Sbjct  53   GRMALYGGCVFGPVATTWLGFLAR--RVTFR---NARVETLARVAADQTLFAPVMIGVFL  107

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    GKS    KE +   + PAL      WP  Q +NF ++P+QY+LL+ N+ S+  
Sbjct  108  GSMATMEGKS---PKERLDTTWWPALKANWMLWPFVQFINFTFLPLQYRLLFANVISIGW  164

Query  770  SAFLSWLEQQQKE  808
            +++LSW+  Q + 
Sbjct  165  NSYLSWVNSQGQN  177



>ref|XP_003053748.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU48035.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=174

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 95/190 (50%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL TQ +++ VL+A GD+ AQ            L+   G  K    D  R 
Sbjct  7    WYNARLAARPLLTQSVTTAVLFATGDITAQQ-----------LVEKKGVEKH---DLVRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+  L + +  + R     ++ LA +VA D L F P+ + +F 
Sbjct  53   GRMALYGGFVFGPVATTWFGFLARNVNARNR----KVETLA-RVACDQLAFAPVMIGVF-  106

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              +G      G+  K+ I+  + PAL      WP  Q +NF ++P+Q+++ + N+ S+  
Sbjct  107  --LGSMATMEGNDPKKRIETTWWPALKANWMLWPFVQVINFSFIPLQHRVFFANIVSIGW  164

Query  770  SAFLSWLEQQ  799
            +++LSW+  +
Sbjct  165  NSYLSWINNR  174



>ref|XP_011104570.1| sym1p [Saccharomyces arboricola H-6]
 gb|EJS42531.1| sym1p [Saccharomyces arboricola H-6]
Length=197

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 103/217 (47%), Gaps = 20/217 (9%)
 Frame = +2

Query  215  LRVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTI  394
            +R+   Y+  L  +P  T  I +G L+ IGDV AQ +   TSK             D   
Sbjct  1    MRLLHLYEASLKRKPKTTNAIMTGALFGIGDVSAQFL-FPTSKI------------DKNY  47

Query  395  DRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLN  574
            D KR     +YG+  F   G  WY  L+  I +  + Q +       +VAVD L F PL 
Sbjct  48   DYKRTARAVVYGSLIFSFIGDKWYRILNNKIYMHNKPQYH-WSNTVLRVAVDQLAFAPLG  106

Query  575  LLLFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNM  754
            L  +FT M    G+S    K  IK  + P L+   + WP+ QAVNF  VP+Q++LL  N+
Sbjct  107  LPFYFTCMSILEGRSFDIAKLKIKEQWWPTLLTNWAVWPIFQAVNFSVVPLQHRLLAANV  166

Query  755  FSMLDSAFLSWLEQQQKEASGKQCFASVPISNEPKDE  865
             ++  + +LS+  +  K   G++    VP+   P  E
Sbjct  167  VAIFWNTYLSY--KNSKVTEGEK----VPVHYPPVVE  197



>gb|ESX01924.1| Protein required for ethanol metabolism [Ogataea parapolymorpha 
DL-1]
Length=188

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 96/194 (49%), Gaps = 16/194 (8%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            Y+ + A RPL   +IS+G+L+  GD +AQ I      K +              D  R  
Sbjct  5    YKTFFARRPLMANMISTGILFGTGDALAQ-ICFPQDPKAKY-------------DYLRTM  50

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
               +YG   FGP G+  Y+ +D  IK     QP  L     +V+ D LV+ P+ + L+++
Sbjct  51   RAVIYGGAVFGPIGNRLYKFVDT-IKFPLPWQPKRLYDTIARVSFDQLVWAPIGIPLYYS  109

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             +    G    ++K  ++  +L  L+     WP+ QA NF + PV+Y+LL VN+ S++ +
Sbjct  110  CITLMEGYGIPEIKAKLREVYLDTLINNWKVWPLFQAFNFWFTPVRYRLLAVNIISIVWN  169

Query  773  AFLSWLEQQQKEAS  814
             +LS +E Q   A 
Sbjct  170  CYLS-IENQMSNAK  182



>ref|XP_002789043.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=179

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 88/185 (48%), Gaps = 22/185 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ  LA RPL TQ + S +L+  GDV+AQ +      +                D  R 
Sbjct  4    WYQVQLARRPLLTQSVGSAILFGAGDVLAQQLVDRADTEHH--------------DYART  49

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
                +YG  FFGP    WY+ +D+ I L     P     LA ++A D L+F P ++  F 
Sbjct  50   ARMVLYGGAFFGPGASTWYKFMDRHIILS---SPKLT--LAARIAGDQLLFTPTHMFAFL  104

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M    GK     +E ++  +  A       WP  QA+NF +VP+Q+++L VN+ S+  
Sbjct  105  SSMSIMEGKDP---REKLRNSYWAAYKANLMIWPWVQAINFTFVPLQHRVLVVNIVSLGW  161

Query  770  SAFLS  784
            +  LS
Sbjct  162  NCILS  166



>gb|KFA55001.1| hypothetical protein S40293_02290 [Stachybotrys chartarum IBT 
40293]
 gb|KFA79098.1| hypothetical protein S40288_07021 [Stachybotrys chartarum IBT 
40288]
Length=174

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 97/190 (51%), Gaps = 22/190 (12%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   LA RPL T  +++ VL+A GDV AQ            L+   G+      D  R 
Sbjct  7    WYNAKLAARPLFTSSVTTAVLFATGDVTAQQ-----------LVERRGAKAH---DLTRT  52

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G   +YG   FGP    W+ GL   + LK  ++   ++ L ++VA D L+F P+ + +F 
Sbjct  53   GRMALYGGCVFGPVATTWF-GL---LSLKVVMRNKRIEML-SRVACDQLLFAPVMIGVFL  107

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
              M    G+S    ++ +++ +  AL      WP  Q +NF YVP+ Y++L+ N+ S+  
Sbjct  108  GSMATMEGQSA---QKRLEKTWWSALKTNWMIWPFVQMINFSYVPLAYRVLFANVISIGW  164

Query  770  SAFLSWLEQQ  799
            +++LSW+  +
Sbjct  165  NSYLSWVNSK  174



>ref|XP_007714977.1| hypothetical protein COCCADRAFT_28442 [Bipolaris zeicola 26-R-13]
 gb|EUC30714.1| hypothetical protein COCCADRAFT_28442 [Bipolaris zeicola 26-R-13]
 gb|EUN24100.1| hypothetical protein COCVIDRAFT_29146 [Bipolaris victoriae FI3]
Length=193

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 94/198 (47%), Gaps = 26/198 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ+ L   PL TQ I++ VL+A GD +AQ             +   G +K    D  R 
Sbjct  5    WYQSKLRTSPLLTQSITTAVLFATGDTMAQQG-----------VERRGLDKH---DLART  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G    YG   FGP    W+  L   + L     P+    +  +VA D  +F P+N+ +F 
Sbjct  51   GRMAAYGGCIFGPAATKWFGFLVSRVNL-----PSKNGTIIARVACDQFLFAPVNMTVFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M +  G S +Q    +K  F+P        WP  Q VNF+YVP + ++L VN+ S+  
Sbjct  106  SSMAYMEGNSPTQ---RLKDAFVPGYQKNLMIWPWVQFVNFKYVPAEMRVLVVNIISLGW  162

Query  770  SAFLSWLEQQQKEASGKQ  823
            + +LS+L      A GK+
Sbjct  163  NCYLSYLN----SAGGKK  176



>ref|XP_003841062.1| similar to integral membrane protein [Leptosphaeria maculans 
JN3]
 emb|CBX97583.1| similar to integral membrane protein [Leptosphaeria maculans 
JN3]
Length=186

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 87/187 (47%), Gaps = 21/187 (11%)
 Frame = +2

Query  233  YQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRVG  412
            YQ  L   PL TQ +++ VL+A GD +AQ             +   G  K    D  R  
Sbjct  8    YQAKLKTAPLLTQSVTTAVLFATGDTLAQQA-----------VEKRGFEKH---DPMRTA  53

Query  413  ITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFFT  592
                YG   FGP    WY  L + I +      +  + L  +VA D +VF PLN+ LF +
Sbjct  54   RMAAYGGAIFGPAATKWYALLTRHINIP----ASPTRTLCARVAADQVVFAPLNMTLFLS  109

Query  593  YMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDS  772
             M +  G S   V++ +   FLP        WP  Q  NF+YVP+++++L VN  S+  +
Sbjct  110  SMAYLEGAS---VRQRLADAFLPGYQKNLMLWPWVQFANFKYVPMEFRVLVVNFVSLGWN  166

Query  773  AFLSWLE  793
             +LS L 
Sbjct  167  CYLSALN  173



>ref|XP_009603125.1| PREDICTED: PXMP2/4 family protein 4-like [Nicotiana tomentosiformis]
Length=246

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 96/198 (48%), Gaps = 25/198 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WY   L  RP+ T+ I+  ++    D+ +Q+I  S S++  L+              + +
Sbjct  72   WYLEMLNSRPILTKTITCTLILIAADLSSQTIAGSLSEQYDLI--------------RTL  117

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLAT--KVAVDVLVFGPLNLLL  583
             + G YG    GP  HFWY  L  F   +          + T  K+A+  +V+GP    +
Sbjct  118  RVAG-YGVLILGPSLHFWYNALSAFFPKR--------DVITTFKKIALGQIVYGPTMNAI  168

Query  584  FFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSM  763
            FF+    + G+S S++   +KRD +P  +     WP+   + F++VPV  Q L VN FS 
Sbjct  169  FFSMNAAAQGESNSEIAARLKRDLVPTAINGLMYWPICDFITFKFVPVHLQPLVVNTFSY  228

Query  764  LDSAFLSWLEQQQKEASG  817
            + + +L+++  QQK AS 
Sbjct  229  VWNVYLTYMASQQKVASA  246



>emb|CBJ27540.1| conserved unknown protein [Ectocarpus siliculosus]
Length=297

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 95/194 (49%), Gaps = 22/194 (11%)
 Frame = +2

Query  221  VWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDR  400
            +W  Y + LA +PL T+ ++S   +A+GD++AQ                   +K   ID 
Sbjct  126  IWAAYMSLLASQPLLTKSLTSMTGFALGDLLAQKFI----------------DKKEEIDL  169

Query  401  KRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLL  580
             R+     +GA   G  GHF+Y  LD  I     L       +A KV +D +++ P+   
Sbjct  170  PRLLKLASFGALIHGSSGHFFYNFLDSKIPGTAALT------VAKKVFIDQVLWNPIFGC  223

Query  581  LFFTYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFS  760
            +FF YMG   G   S + E IK +   ++    + WPVA A+NFR +P   +LLY+N   
Sbjct  224  MFFGYMGAVDGMGPSGISEKIKNNLWTSVKGSWTVWPVAHAINFRMIPTSQRLLYINTIQ  283

Query  761  MLDSAFLSWLEQQQ  802
            +  + FLS + Q++
Sbjct  284  IFYNCFLSVIAQRE  297



>ref|XP_007758902.1| hypothetical protein A1O7_06711 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ59279.1| hypothetical protein A1O7_06711 [Cladophialophora yegresii CBS 
114405]
Length=262

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/228 (30%), Positives = 106/228 (46%), Gaps = 33/228 (14%)
 Frame = +2

Query  218  RVWTWYQNWLAVRPLETQVISSGVLWAIGDVVAQSIT--------ISTSKKQRLLISDSG  373
            R+ + + ++ A RP+ T +I++ VL  I D VAQSIT          ++   R LIS   
Sbjct  39   RLISKFNSYYAQRPVLTTMITNAVLGGIADTVAQSITAFRARQAMFPSTTDSRYLISSGV  98

Query  374  SNKDLTIDRKRVGITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFL--------  529
              +DL  + K   ++        GP   F +E L +F+   F + P  LQFL        
Sbjct  99   ELEDL--NEKPATLSPDLAPRRIGP-QPFDFERLTRFMSYGFIMAP--LQFLWFGRLTKW  153

Query  530  ------------ATKVAVDVLVFGPLNLLLFFTYMGFSTGKSGSQVKETIKRDFLPALML  673
                          +VA+D L+F P+ L  FFT+M  + G    +V    K  +LP L  
Sbjct  154  FPIGPKNGNTQALKRVAMDQLIFAPVGLSCFFTFMTVTEGGGRKEVATKFKDIYLPTLRA  213

Query  674  ESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLDSAFLSWLEQQQKEASG  817
                WP  Q +NFR +P+Q+Q+ +V+   +  +A+LS     + EA G
Sbjct  214  NYILWPAVQIINFRVMPLQFQIPFVSTIGIAWTAYLSLTNSSEDEAQG  261



>ref|XP_007704473.1| hypothetical protein COCSADRAFT_40738 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD59542.1| hypothetical protein COCSADRAFT_40738 [Bipolaris sorokiniana 
ND90Pr]
Length=193

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 94/198 (47%), Gaps = 26/198 (13%)
 Frame = +2

Query  230  WYQNWLAVRPLETQVISSGVLWAIGDVVAQSITISTSKKQRLLISDSGSNKDLTIDRKRV  409
            WYQ+ L   PL TQ I++ VL+A GD +AQ             +   G +K    D  R 
Sbjct  5    WYQSKLRTSPLLTQSITTAVLFATGDTMAQQG-----------VERRGLDKH---DLMRT  50

Query  410  GITGMYGAGFFGPFGHFWYEGLDQFIKLKFRLQPNSLQFLATKVAVDVLVFGPLNLLLFF  589
            G    YG   FGP    W+  L + + L     P+    +  +VA D  +F P+N+ +F 
Sbjct  51   GRMAAYGGCIFGPAATTWFGFLVRRVNL-----PSKNGTIVARVACDQFLFAPVNMTVFL  105

Query  590  TYMGFSTGKSGSQVKETIKRDFLPALMLESSAWPVAQAVNFRYVPVQYQLLYVNMFSMLD  769
            + M +  G S +Q    +K  F+P        WP  Q  NF+YVP + ++L VN+ S+  
Sbjct  106  SSMAYMEGNSPTQ---RLKDAFVPGYQKNLMIWPWVQFANFKYVPAEMRVLVVNIISLGW  162

Query  770  SAFLSWLEQQQKEASGKQ  823
            + +LS+L      A GK+
Sbjct  163  NCYLSYLN----SAGGKK  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1887598073020