BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21064_g3_i1 len=1304 path=[4812:0-665 5478:666-691 9344:692-1303]

Length=1304
                                                                      Score     E

ref|XP_009361266.1|  PREDICTED: peroxidase 5-like                       506   1e-175   
ref|XP_010045225.1|  PREDICTED: peroxidase 5-like                       506   1e-175   
ref|XP_009769971.1|  PREDICTED: peroxidase 5-like                       506   3e-175   
ref|XP_004307916.1|  PREDICTED: peroxidase 5-like                       504   6e-175   
ref|XP_009605400.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    504   1e-174   
ref|XP_006347525.1|  PREDICTED: peroxidase 5-like                       503   2e-174   
ref|XP_010048379.1|  PREDICTED: peroxidase 5-like                       503   3e-174   
ref|XP_003634164.2|  PREDICTED: peroxidase 5                            501   1e-172   
sp|A7QEU4.2|PER5_VITVI  RecName: Full=Peroxidase 5; Flags: Precursor    498   3e-172   Vitis vinifera
ref|XP_007039219.1|  Peroxidase 5                                       496   1e-171   
ref|XP_011075883.1|  PREDICTED: peroxidase 5-like                       496   2e-171   
ref|XP_008234631.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    496   3e-171   
ref|XP_008377046.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    491   2e-169   
ref|XP_004235031.1|  PREDICTED: peroxidase 5                            489   6e-169   
ref|XP_006470493.1|  PREDICTED: peroxidase 5-like                       489   1e-168   
gb|KDO66295.1|  hypothetical protein CISIN_1g041695mg                   486   4e-168   
gb|KDP30908.1|  hypothetical protein JCGZ_15520                         483   2e-166   
gb|EYU45326.1|  hypothetical protein MIMGU_mgv1a009971mg                481   1e-165   
ref|XP_007136358.1|  hypothetical protein PHAVU_009G038500g             479   6e-165   
ref|XP_003602405.1|  Peroxidase                                         479   6e-165   
gb|AHL39183.1|  class III peroxidase                                    479   6e-165   
ref|XP_006374082.1|  hypothetical protein POPTR_0015s00590g             476   1e-163   
gb|AHL39182.1|  class III peroxidase                                    475   4e-163   
ref|XP_002321949.2|  hypothetical protein POPTR_0015s00580g             474   6e-163   Populus trichocarpa [western balsam poplar]
ref|XP_010103062.1|  Peroxidase 5                                       474   1e-162   
gb|KHG13653.1|  Peroxidase 5                                            471   1e-161   
gb|KHN19575.1|  Peroxidase 5                                            470   3e-161   
ref|XP_011003281.1|  PREDICTED: peroxidase 5-like                       470   3e-161   
ref|XP_004502775.1|  PREDICTED: peroxidase 5-like                       469   9e-161   
ref|NP_001241968.1|  uncharacterized protein LOC100779031 precursor     468   1e-160   
dbj|BAA77387.1|  peroxidase 1                                           468   2e-160   Scutellaria baicalensis [Baikal skullcap]
gb|AFK42142.1|  unknown                                                 467   4e-160   
ref|XP_011003280.1|  PREDICTED: peroxidase 5-like                       464   4e-159   
emb|CDP12791.1|  unnamed protein product                                477   6e-159   
ref|XP_011043754.1|  PREDICTED: peroxidase 5-like                       463   2e-158   
gb|AAF63024.1|AF244921_1  peroxidase prx12 precursor                    460   3e-157   Spinacia oleracea
ref|XP_010671317.1|  PREDICTED: peroxidase 5-like                       453   2e-154   
ref|XP_010671316.1|  PREDICTED: peroxidase 5-like                       451   1e-153   
ref|XP_006846424.1|  hypothetical protein AMTR_s00018p00028320          448   8e-153   
gb|AHL39170.1|  class III peroxidase                                    446   6e-152   
ref|XP_010919027.1|  PREDICTED: peroxidase 5-like                       445   2e-151   
ref|XP_008808268.1|  PREDICTED: peroxidase 5-like                       445   2e-151   
ref|XP_008808296.1|  PREDICTED: peroxidase 5-like                       445   2e-151   
ref|XP_010919026.1|  PREDICTED: peroxidase 5-like                       444   3e-151   
ref|XP_003602406.1|  Peroxidase                                         444   4e-151   
ref|XP_011043751.1|  PREDICTED: peroxidase 5-like                       443   1e-150   
ref|XP_010671321.1|  PREDICTED: peroxidase 5-like                       434   5e-147   
ref|XP_009400935.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    434   5e-147   
ref|XP_006446429.1|  hypothetical protein CICLE_v10017508mg             430   3e-145   
ref|XP_008808270.1|  PREDICTED: peroxidase 5-like                       425   1e-143   
ref|XP_008808267.1|  PREDICTED: peroxidase 5-like                       424   3e-143   
gb|EPS60748.1|  hypothetical protein M569_14053                         422   9e-143   
ref|XP_002317837.2|  hypothetical protein POPTR_0012s00700g             406   6e-137   Populus trichocarpa [western balsam poplar]
gb|EPS67213.1|  hypothetical protein M569_07559                         418   8e-135   
ref|XP_004985933.1|  PREDICTED: peroxidase 5-like                       401   3e-134   
ref|XP_006840300.1|  hypothetical protein AMTR_s00045p00066730          400   1e-133   
ref|XP_006650985.1|  PREDICTED: peroxidase 5-like                       399   4e-133   
ref|XP_006840299.1|  hypothetical protein AMTR_s00045p00065690          393   1e-130   
gb|AAM52320.1|AC105363_9  Putative peroxidase                           391   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010671314.1|  PREDICTED: peroxidase 5-like                       386   2e-128   
emb|CBI23099.3|  unnamed protein product                                392   2e-127   
ref|XP_008246297.1|  PREDICTED: peroxidase 5-like                       380   6e-126   
gb|KCW44165.1|  hypothetical protein EUGRSUZ_L02416                     375   2e-124   
ref|XP_010041692.1|  PREDICTED: peroxidase 5-like                       376   2e-124   
ref|XP_010032734.1|  PREDICTED: peroxidase 5-like                       375   4e-124   
emb|CAN68183.1|  hypothetical protein VITISV_028562                     375   5e-124   Vitis vinifera
ref|XP_010032732.1|  PREDICTED: peroxidase 5-like                       375   6e-124   
ref|XP_007031236.1|  Class III peroxidase 70                            374   1e-123   
ref|XP_010270944.1|  PREDICTED: peroxidase 5-like                       374   1e-123   
ref|NP_001048793.1|  Os03g0121200                                       374   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010032733.1|  PREDICTED: peroxidase 5-like                       373   3e-123   
gb|AAM52317.1|AC105363_6  Putative peroxidase                           372   3e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74412.1|  hypothetical protein OsI_09774                          372   3e-123   Oryza sativa Indica Group [Indian rice]
gb|KCW52190.1|  hypothetical protein EUGRSUZ_J01619                     372   5e-123   
ref|XP_010659811.1|  PREDICTED: peroxidase 5-like                       372   5e-123   
ref|XP_009799014.1|  PREDICTED: peroxidase 5-like                       372   7e-123   
gb|KCW52189.1|  hypothetical protein EUGRSUZ_J01618                     371   1e-122   
ref|XP_006649294.1|  PREDICTED: peroxidase 5-like                       371   1e-122   
ref|XP_006662005.1|  PREDICTED: peroxidase 5-like                       371   2e-122   
ref|XP_004304932.1|  PREDICTED: peroxidase 5-like                       370   4e-122   
ref|XP_010034487.1|  PREDICTED: peroxidase 5-like                       370   4e-122   
gb|KCW52187.1|  hypothetical protein EUGRSUZ_J01616                     369   5e-122   
ref|XP_010659743.1|  PREDICTED: peroxidase 5-like                       369   7e-122   
gb|ABS44862.1|  putative peroxidase                                     369   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009598825.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    369   2e-121   
ref|XP_010069738.1|  PREDICTED: peroxidase 5-like                       369   2e-121   
ref|XP_009768802.1|  PREDICTED: peroxidase 5-like                       368   4e-121   
emb|CBI39654.3|  unnamed protein product                                367   3e-120   
ref|NP_001048794.1|  Os03g0121300                                       365   4e-120   Oryza sativa Japonica Group [Japonica rice]
gb|KCW52188.1|  hypothetical protein EUGRSUZ_J01617                     365   4e-120   
ref|XP_002465968.1|  hypothetical protein SORBIDRAFT_01g049140          365   5e-120   Sorghum bicolor [broomcorn]
ref|XP_009411413.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    365   5e-120   
gb|KCW58172.1|  hypothetical protein EUGRSUZ_H00889                     364   8e-120   
ref|XP_010032731.1|  PREDICTED: peroxidase 5-like                       364   8e-120   
ref|XP_009629163.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    365   1e-119   
ref|XP_004985934.1|  PREDICTED: peroxidase 5-like                       363   2e-119   
ref|XP_007207711.1|  hypothetical protein PRUPE_ppa025326mg             362   4e-119   
ref|XP_011092685.1|  PREDICTED: peroxidase 5-like                       363   4e-119   
ref|XP_002450360.1|  hypothetical protein SORBIDRAFT_05g004180          363   5e-119   Sorghum bicolor [broomcorn]
gb|KHN30703.1|  Peroxidase 5                                            361   1e-118   
ref|XP_003535856.1|  PREDICTED: peroxidase 5-like                       361   2e-118   
gb|KHN29593.1|  Peroxidase 5                                            361   2e-118   
ref|XP_003536264.1|  PREDICTED: peroxidase 5-like                       360   3e-118   
gb|KHN00317.1|  Peroxidase 5                                            360   3e-118   
ref|XP_008673305.1|  PREDICTED: hypothetical protein isoform X1         360   3e-118   
ref|XP_002530462.1|  Cationic peroxidase 1 precursor, putative          360   3e-118   Ricinus communis
gb|ACN25837.1|  unknown                                                 360   3e-118   Zea mays [maize]
ref|XP_003534685.2|  PREDICTED: peroxidase 5-like                       360   3e-118   
gb|ACU20445.1|  unknown                                                 360   4e-118   Glycine max [soybeans]
ref|XP_010921346.1|  PREDICTED: peroxidase 5-like                       360   4e-118   
gb|KCW52185.1|  hypothetical protein EUGRSUZ_J01614                     359   4e-118   
ref|XP_011077203.1|  PREDICTED: peroxidase 5-like                       365   4e-118   
ref|XP_006840292.1|  hypothetical protein AMTR_s00045p00063130          360   6e-118   
ref|XP_010671315.1|  PREDICTED: peroxidase 5-like                       359   6e-118   
ref|XP_010040180.1|  PREDICTED: peroxidase 5-like                       360   6e-118   
gb|KDP37026.1|  hypothetical protein JCGZ_06082                         359   6e-118   
gb|KCW45421.1|  hypothetical protein EUGRSUZ_L00890                     359   6e-118   
ref|XP_006358573.1|  PREDICTED: peroxidase 5-like                       359   8e-118   
ref|XP_010921348.1|  PREDICTED: peroxidase 5-like                       358   1e-117   
ref|XP_011077202.1|  PREDICTED: peroxidase 5-like                       362   1e-117   
ref|XP_008662930.1|  PREDICTED: peroxidase 5-like                       358   2e-117   
ref|XP_004231304.1|  PREDICTED: peroxidase 5-like                       358   2e-117   
ref|XP_004251979.1|  PREDICTED: peroxidase 5-like                       359   3e-117   
ref|XP_004960409.1|  PREDICTED: peroxidase 5-like                       358   3e-117   
gb|EAY79346.1|  hypothetical protein OsI_34475                          358   3e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_010911662.1|  PREDICTED: peroxidase 5-like                       357   3e-117   
ref|XP_008781200.1|  PREDICTED: peroxidase 5-like                       357   4e-117   
ref|XP_010234947.1|  PREDICTED: peroxidase 5-like                       357   4e-117   
ref|XP_004495876.1|  PREDICTED: peroxidase 5-like                       357   6e-117   
ref|XP_008781197.1|  PREDICTED: peroxidase 5-like                       357   8e-117   
ref|XP_010921347.1|  PREDICTED: peroxidase 5-like                       355   2e-116   
dbj|BAK03531.1|  predicted protein                                      355   3e-116   
ref|NP_001065172.1|  Os10g0536700                                       355   3e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010069737.1|  PREDICTED: peroxidase 5-like                       355   4e-116   
ref|XP_010026045.1|  PREDICTED: peroxidase 5-like                       355   4e-116   
ref|XP_007153060.1|  hypothetical protein PHAVU_003G003200g             355   4e-116   
gb|KDP34818.1|  hypothetical protein JCGZ_11180                         354   5e-116   
ref|XP_010024692.1|  PREDICTED: peroxidase 5-like                       354   6e-116   
ref|XP_010024694.1|  PREDICTED: peroxidase 5-like                       354   7e-116   
ref|XP_002467585.1|  hypothetical protein SORBIDRAFT_01g030530          354   9e-116   Sorghum bicolor [broomcorn]
ref|XP_004960411.1|  PREDICTED: peroxidase 5-like                       354   1e-115   
ref|XP_002530464.1|  Peroxidase 3 precursor, putative                   353   2e-115   Ricinus communis
ref|XP_007145114.1|  hypothetical protein PHAVU_007G211100g             353   2e-115   
ref|XP_006654965.1|  PREDICTED: peroxidase 5-like                       353   2e-115   
ref|XP_010069739.1|  PREDICTED: peroxidase 5-like                       353   3e-115   
gb|KCW58173.1|  hypothetical protein EUGRSUZ_H00890                     352   3e-115   
ref|NP_001141025.1|  uncharacterized protein LOC100273104 precursor     353   4e-115   Zea mays [maize]
ref|XP_008461392.1|  PREDICTED: peroxidase 5-like                       353   4e-115   
gb|AFW57508.1|  peroxidase 1                                            352   7e-115   
gb|KCW61137.1|  hypothetical protein EUGRSUZ_H03910                     350   1e-114   
gb|KCW61140.1|  hypothetical protein EUGRSUZ_H03915                     350   1e-114   
ref|XP_010938174.1|  PREDICTED: peroxidase 5-like                       351   1e-114   
ref|XP_009335532.1|  PREDICTED: peroxidase 5-like                       350   1e-114   
ref|XP_008388923.1|  PREDICTED: peroxidase 5-like                       351   1e-114   
gb|KCW58170.1|  hypothetical protein EUGRSUZ_H00887                     351   2e-114   
ref|XP_009365500.1|  PREDICTED: peroxidase 5-like                       351   2e-114   
ref|XP_007161518.1|  hypothetical protein PHAVU_001G076000g             351   2e-114   
gb|EMT07621.1|  Peroxidase 5                                            350   4e-114   
ref|XP_004983811.1|  PREDICTED: peroxidase 5-like                       350   4e-114   
ref|XP_002440543.1|  hypothetical protein SORBIDRAFT_09g002810          350   4e-114   Sorghum bicolor [broomcorn]
gb|KCW52186.1|  hypothetical protein EUGRSUZ_J01615                     348   5e-114   
ref|XP_007051236.1|  Class III peroxidase 70                            349   7e-114   
dbj|BAJ95224.1|  predicted protein                                      349   9e-114   
ref|NP_001148340.1|  peroxidase 1 precursor                             348   2e-113   Zea mays [maize]
ref|XP_010674523.1|  PREDICTED: peroxidase 5-like                       348   2e-113   
gb|EMT10333.1|  Peroxidase 5                                            348   2e-113   
gb|KDP37024.1|  hypothetical protein JCGZ_06080                         347   2e-113   
ref|XP_003555769.1|  PREDICTED: peroxidase 5-like                       348   3e-113   
ref|XP_004968663.1|  PREDICTED: peroxidase 1-like                       348   3e-113   
ref|XP_006353128.1|  PREDICTED: peroxidase 5-like                       348   5e-113   
pdb|3HDL|A  Chain A, Crystal Structure Of Highly Glycosylated Per...    346   5e-113   
ref|XP_009401741.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    347   6e-113   
ref|XP_002272800.1|  PREDICTED: peroxidase 5                            347   6e-113   Vitis vinifera
emb|CBI39655.3|  unnamed protein product                                363   6e-113   
ref|XP_004136139.1|  PREDICTED: peroxidase 5-like                       347   7e-113   
gb|EYU39444.1|  hypothetical protein MIMGU_mgv1a009735mg                346   2e-112   
ref|XP_004953531.1|  PREDICTED: peroxidase 5-like                       345   2e-112   
gb|EMT13671.1|  Peroxidase 5                                            345   3e-112   
ref|XP_003533700.1|  PREDICTED: peroxidase 5-like                       345   3e-112   
ref|XP_006574525.1|  PREDICTED: peroxidase 5-like                       345   4e-112   
ref|XP_009382469.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    345   4e-112   
ref|XP_003568991.1|  PREDICTED: peroxidase 5-like                       345   5e-112   
gb|EMS60334.1|  Peroxidase 5                                            345   5e-112   
gb|KDP27791.1|  hypothetical protein JCGZ_18871                         344   6e-112   
ref|XP_010941488.1|  PREDICTED: peroxidase 5-like                       343   6e-112   
ref|XP_003591332.1|  Peroxidase                                         344   6e-112   
tpe|CAH69312.1|  TPA: class III peroxidase 70 precursor                 344   7e-112   
ref|XP_010093296.1|  Peroxidase 5                                       343   1e-111   
ref|XP_002439234.1|  hypothetical protein SORBIDRAFT_09g002830          344   1e-111   Sorghum bicolor [broomcorn]
ref|XP_003589739.1|  Peroxidase                                         343   2e-111   
ref|XP_007145112.1|  hypothetical protein PHAVU_007G210900g             342   3e-111   
gb|EEE58234.1|  hypothetical protein OsJ_09210                          340   3e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007153059.1|  hypothetical protein PHAVU_003G003100g             342   4e-111   
ref|XP_004498110.1|  PREDICTED: peroxidase 5-like                       342   7e-111   
ref|XP_002440652.1|  hypothetical protein SORBIDRAFT_09g004650          342   2e-110   Sorghum bicolor [broomcorn]
gb|EYU39450.1|  hypothetical protein MIMGU_mgv1a009721mg                340   3e-110   
ref|XP_003565723.1|  PREDICTED: peroxidase 5-like                       341   3e-110   
ref|XP_002978679.1|  hypothetical protein SELMODRAFT_177154             339   7e-110   
ref|XP_008776272.1|  PREDICTED: peroxidase 5-like                       339   1e-109   
ref|XP_002984610.1|  hypothetical protein SELMODRAFT_181167             338   2e-109   
ref|NP_001140982.1|  uncharacterized protein LOC100273061 precursor     339   2e-109   Zea mays [maize]
ref|XP_009411414.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    337   2e-109   
ref|XP_009387798.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    334   4e-109   
ref|NP_001141388.1|  uncharacterized protein LOC100273479 precursor     337   8e-109   Zea mays [maize]
ref|XP_010906360.1|  PREDICTED: peroxidase 5-like                       335   1e-108   
ref|XP_010906352.1|  PREDICTED: peroxidase 5-like                       335   2e-108   
gb|ACG35820.1|  peroxidase 66 precursor                                 335   2e-108   Zea mays [maize]
ref|XP_010553703.1|  PREDICTED: peroxidase 5-like                       335   2e-108   
ref|XP_003558949.1|  PREDICTED: peroxidase 5-like                       335   2e-108   
ref|XP_003568990.1|  PREDICTED: peroxidase 5-like                       335   3e-108   
ref|XP_002440653.1|  hypothetical protein SORBIDRAFT_09g004660          336   4e-108   Sorghum bicolor [broomcorn]
ref|XP_008461391.1|  PREDICTED: peroxidase 5-like                       334   6e-108   
ref|XP_009382231.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    333   7e-108   
ref|XP_006444582.1|  hypothetical protein CICLE_v10021010mg             334   1e-107   
ref|XP_004977108.1|  PREDICTED: peroxidase 1-like                       334   1e-107   
ref|XP_010674524.1|  PREDICTED: peroxidase 5-like                       333   1e-107   
emb|CAN71282.1|  hypothetical protein VITISV_027092                     333   1e-107   Vitis vinifera
ref|XP_004298124.1|  PREDICTED: peroxidase 5-like                       332   4e-107   
ref|XP_002516915.1|  Cationic peroxidase 2 precursor, putative          332   4e-107   Ricinus communis
ref|XP_010271091.1|  PREDICTED: peroxidase 5-like                       332   4e-107   
ref|XP_010914719.1|  PREDICTED: peroxidase 5-like                       332   4e-107   
ref|XP_002452710.1|  hypothetical protein SORBIDRAFT_04g031120          332   6e-107   Sorghum bicolor [broomcorn]
ref|XP_003591355.1|  Peroxidase                                         332   7e-107   
ref|XP_002987767.1|  hypothetical protein SELMODRAFT_126670             331   8e-107   
ref|XP_004135971.1|  PREDICTED: peroxidase 5-like                       331   1e-106   
gb|AIX03725.1|  peroxidase                                              331   2e-106   
ref|XP_003558948.1|  PREDICTED: peroxidase 5-like                       330   2e-106   
ref|XP_002993742.1|  hypothetical protein SELMODRAFT_137572             330   4e-106   
ref|XP_008793597.1|  PREDICTED: peroxidase 5-like                       329   8e-106   
ref|XP_007035579.1|  Cationic peroxidase 2 precursor                    329   1e-105   
emb|CDP04200.1|  unnamed protein product                                328   2e-105   
ref|XP_010674605.1|  PREDICTED: peroxidase 5-like                       327   4e-105   
ref|XP_011077167.1|  PREDICTED: peroxidase 5-like                       325   1e-104   
ref|XP_004136140.1|  PREDICTED: peroxidase 5-like                       326   1e-104   
ref|XP_008649365.1|  PREDICTED: peroxidase 5                            327   1e-104   
gb|AAS75401.1|  peroxidase                                              326   1e-104   Zea mays [maize]
ref|XP_002963661.1|  hypothetical protein SELMODRAFT_266691             325   2e-104   
ref|XP_004135967.1|  PREDICTED: peroxidase 5-like                       325   2e-104   
gb|AAS75393.1|  peroxidase                                              326   2e-104   Zea mays [maize]
emb|CDM82175.1|  unnamed protein product                                325   3e-104   
ref|XP_004158168.1|  PREDICTED: peroxidase 5-like                       325   3e-104   
gb|AAS75400.1|  peroxidase                                              325   4e-104   Zea mays [maize]
gb|AAS75394.1|  peroxidase                                              325   5e-104   Zea mays [maize]
gb|AAS75395.1|  peroxidase                                              325   5e-104   Zea mays [maize]
ref|NP_001136740.1|  uncharacterized protein LOC100216881 precursor     324   7e-104   Zea mays [maize]
emb|CAC21393.1|  peroxidase                                             324   8e-104   Zea mays [maize]
ref|XP_004167191.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    323   1e-103   
ref|XP_002455568.1|  hypothetical protein SORBIDRAFT_03g013220          324   2e-103   Sorghum bicolor [broomcorn]
ref|XP_008647554.1|  PREDICTED: uncharacterized protein LOC100273...    322   7e-103   
gb|KDP37025.1|  hypothetical protein JCGZ_06081                         317   3e-102   
ref|XP_004977105.1|  PREDICTED: peroxidase 1-like                       320   4e-102   
ref|XP_009342265.1|  PREDICTED: peroxidase 3-like                       318   5e-102   
ref|XP_009411603.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    318   7e-102   
gb|ACN36789.1|  unknown                                                 319   7e-102   Zea mays [maize]
ref|XP_008664057.1|  PREDICTED: peroxidase 5-like                       320   9e-102   
tpe|CAH69257.1|  TPA: class III peroxidase 14 precursor                 318   3e-101   
ref|XP_002455566.1|  hypothetical protein SORBIDRAFT_03g013200          318   4e-101   Sorghum bicolor [broomcorn]
ref|NP_001054728.1|  Os05g0162000                                       317   4e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567633.1|  PREDICTED: peroxidase 1-like                       317   5e-101   
tpe|CAH69314.1|  TPA: class III peroxidase 72 precursor                 317   5e-101   
ref|NP_001141196.1|  hypothetical protein                               317   7e-101   Zea mays [maize]
gb|EAY96656.1|  hypothetical protein OsI_18569                          316   1e-100   Oryza sativa Indica Group [Indian rice]
ref|NP_001042908.1|  Os01g0327400                                       316   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977106.1|  PREDICTED: peroxidase 1-like                       316   2e-100   
dbj|BAJ88342.1|  predicted protein                                      315   2e-100   
gb|EAY73798.1|  hypothetical protein OsI_01677                          315   2e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002991860.1|  hypothetical protein SELMODRAFT_134234             314   2e-100   
gb|KHN00230.1|  Peroxidase 5                                            312   2e-100   
ref|XP_006645835.1|  PREDICTED: peroxidase 1-like                       315   3e-100   
ref|XP_010254706.1|  PREDICTED: peroxidase 5-like                       314   5e-100   
ref|XP_008793417.1|  PREDICTED: peroxidase 5-like                       311   6e-100   
ref|XP_002993021.1|  hypothetical protein SELMODRAFT_236655             313   1e-99    
gb|EMS47566.1|  Peroxidase 5                                            318   1e-99    
gb|EMT01151.1|  Peroxidase 1                                            314   1e-99    
ref|XP_004968662.1|  PREDICTED: peroxidase 1-like                       313   2e-99    
ref|XP_002527239.1|  Peroxidase 27 precursor, putative                  312   3e-99    Ricinus communis
gb|AHH91639.1|  POD4 protein                                            309   3e-99    
ref|XP_008341973.1|  PREDICTED: peroxidase 3-like                       311   5e-99    
ref|XP_003567635.1|  PREDICTED: peroxidase 1-like                       311   1e-98    
ref|XP_009342252.1|  PREDICTED: peroxidase 3                            310   1e-98    
ref|XP_004167193.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    310   2e-98    
ref|XP_010275557.1|  PREDICTED: peroxidase 5-like                       309   2e-98    
ref|XP_008673330.1|  PREDICTED: hypothetical protein isoform X2         308   3e-98    
gb|KFK42864.1|  hypothetical protein AALP_AA1G049000                    309   3e-98    
gb|EMS59037.1|  Peroxidase 5                                            309   3e-98    
ref|XP_004136142.1|  PREDICTED: peroxidase 5-like                       309   4e-98    
gb|KHN46511.1|  Peroxidase 5                                            306   6e-98    
gb|KHM99076.1|  Peroxidase 5                                            305   9e-98    
ref|XP_006654966.1|  PREDICTED: peroxidase 5-like                       308   9e-98    
ref|XP_001762477.1|  predicted protein                                  308   1e-97    
ref|XP_011003205.1|  PREDICTED: peroxidase 56-like                      307   1e-97    
ref|XP_008230094.1|  PREDICTED: peroxidase 3                            307   2e-97    
ref|XP_004984274.1|  PREDICTED: peroxidase 2-like                       307   2e-97    
ref|XP_010035573.1|  PREDICTED: peroxidase 27-like                      306   4e-97    
gb|AFW57500.1|  hypothetical protein ZEAMMB73_740114                    304   4e-97    
gb|EMS57163.1|  Peroxidase 5                                            311   6e-97    
ref|XP_002889542.1|  CBRCI35                                            305   7e-97    
ref|XP_008461441.1|  PREDICTED: peroxidase 5-like                       305   8e-97    
ref|XP_009118603.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    305   9e-97    
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   305   1e-96    
ref|XP_006305430.1|  hypothetical protein CARUB_v10009829mg             304   1e-96    
ref|XP_002280216.1|  PREDICTED: peroxidase 27                           305   2e-96    
gb|KCW58174.1|  hypothetical protein EUGRSUZ_H00891                     302   2e-96    
ref|XP_008379618.1|  PREDICTED: peroxidase 3                            304   3e-96    
ref|XP_007215666.1|  hypothetical protein PRUPE_ppa008540mg             304   3e-96    
ref|NP_172018.1|  peroxidase 3                                          303   4e-96    
ref|XP_010251114.1|  PREDICTED: peroxidase 5-like                       304   4e-96    
gb|AAM61240.1|  putative peroxidase                                     303   4e-96    
ref|XP_008458688.1|  PREDICTED: peroxidase 5-like                       302   4e-96    
emb|CDY10037.1|  BnaC08g44140D                                          303   4e-96    
ref|XP_009353255.1|  PREDICTED: peroxidase 3                            303   5e-96    
ref|XP_002309830.2|  hypothetical protein POPTR_0007s02570g             303   5e-96    
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       303   6e-96    
gb|KGN63270.1|  hypothetical protein Csa_2G421020                       303   6e-96    
ref|XP_006645837.1|  PREDICTED: peroxidase 1-like                       304   7e-96    
ref|XP_006387149.1|  hypothetical protein POPTR_1693s00200g             303   7e-96    
ref|XP_004287925.1|  PREDICTED: peroxidase 3-like                       303   8e-96    
ref|XP_008455840.1|  PREDICTED: peroxidase 39-like                      303   9e-96    
emb|CDY46845.1|  BnaA10g03290D                                          302   1e-95    
ref|XP_004151878.1|  PREDICTED: peroxidase 39-like                      302   1e-95    
ref|XP_008341978.1|  PREDICTED: peroxidase 3-like                       302   1e-95    
ref|XP_006380314.1|  hypothetical protein POPTR_0007s02560g             302   1e-95    
ref|XP_009628416.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    303   1e-95    
gb|AAT72298.1|  CBRCI35                                                 302   1e-95    
ref|XP_006418047.1|  hypothetical protein EUTSA_v10008189mg             302   2e-95    
gb|EMS48378.1|  Peroxidase 2                                            302   2e-95    
ref|XP_002991681.1|  hypothetical protein SELMODRAFT_186230             301   2e-95    
gb|EAY73797.1|  hypothetical protein OsI_01676                          303   4e-95    
ref|XP_007219585.1|  hypothetical protein PRUPE_ppa023401mg             298   4e-95    
ref|XP_010522326.1|  PREDICTED: peroxidase 3                            301   6e-95    
gb|AHL39150.1|  class III peroxidase                                    300   6e-95    
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       300   7e-95    
gb|EMS51265.1|  Peroxidase 5                                            300   9e-95    
ref|XP_010109530.1|  Peroxidase 3                                       308   1e-94    
ref|XP_009781189.1|  PREDICTED: peroxidase 5-like                       300   1e-94    
ref|XP_002280274.1|  PREDICTED: peroxidase 3                            300   1e-94    
ref|NP_001130801.1|  hypothetical protein precursor                     298   1e-94    
ref|XP_011003204.1|  PREDICTED: peroxidase 27-like                      300   1e-94    
ref|XP_002991057.1|  hypothetical protein SELMODRAFT_132865             299   1e-94    
ref|XP_006855827.1|  hypothetical protein AMTR_s00037p00025630          299   2e-94    
ref|XP_002274157.2|  PREDICTED: peroxidase 27-like                      299   2e-94    
gb|EYU24799.1|  hypothetical protein MIMGU_mgv1a019406mg                299   3e-94    
ref|XP_002309832.1|  peroxidase precursor family protein                299   3e-94    
ref|XP_010484852.1|  PREDICTED: peroxidase 3-like                       298   3e-94    
ref|XP_004287926.1|  PREDICTED: peroxidase 27-like                      298   3e-94    
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         298   4e-94    
gb|AAG46141.1|AC082644_23  putative peroxidase                          298   4e-94    
ref|NP_001050187.1|  Os03g0368300                                       298   4e-94    
ref|NP_001050186.2|  Os03g0368000                                       298   5e-94    
ref|XP_009619824.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    298   6e-94    
ref|XP_010271617.1|  PREDICTED: peroxidase 27-like                      298   6e-94    
ref|XP_002461102.1|  hypothetical protein SORBIDRAFT_02g040770          298   6e-94    
ref|XP_010908222.1|  PREDICTED: peroxidase 3-like                       298   8e-94    
ref|XP_008230092.1|  PREDICTED: peroxidase 27-like                      297   9e-94    
gb|EMT06835.1|  hypothetical protein F775_43196                         296   1e-93    
ref|XP_010475209.1|  PREDICTED: peroxidase 3                            297   1e-93    
ref|XP_002521298.1|  Peroxidase 3 precursor, putative                   293   1e-93    
ref|XP_008784560.1|  PREDICTED: peroxidase 3-like                       297   1e-93    
emb|CBI28955.3|  unnamed protein product                                298   1e-93    
gb|EEC75333.1|  hypothetical protein OsI_11725                          297   1e-93    
ref|XP_010267773.1|  PREDICTED: peroxidase 3                            296   2e-93    
ref|XP_007224113.1|  hypothetical protein PRUPE_ppa015674mg             296   2e-93    
ref|NP_001068411.1|  Os11g0661600                                       296   2e-93    
ref|XP_002467805.1|  hypothetical protein SORBIDRAFT_01g034420          296   2e-93    
emb|CCJ34832.1|  horseradish peroxidase isoenzyme HRP_2021              296   3e-93    
ref|XP_003568989.1|  PREDICTED: peroxidase 5-like                       296   3e-93    
gb|KDP41154.1|  hypothetical protein JCGZ_03648                         296   3e-93    
gb|EMT10332.1|  Peroxidase 5                                            296   4e-93    
ref|XP_010931832.1|  PREDICTED: peroxidase 3-like                       296   4e-93    
ref|XP_010457608.1|  PREDICTED: peroxidase 3-like                       296   5e-93    
gb|EAY81751.1|  hypothetical protein OsI_36925                          295   5e-93    
ref|XP_001776111.1|  predicted protein                                  295   5e-93    
gb|EAY90161.1|  hypothetical protein OsI_11726                          295   6e-93    
gb|EYU39448.1|  hypothetical protein MIMGU_mgv1a009726mg                295   6e-93    
tpe|CAH69313.1|  TPA: class III peroxidase 71 precursor                 295   6e-93    
ref|XP_004136141.1|  PREDICTED: cationic peroxidase 2-like              296   6e-93    
ref|XP_004167192.1|  PREDICTED: cationic peroxidase 2-like              295   8e-93    
gb|EYU39445.1|  hypothetical protein MIMGU_mgv11b018535mg               295   9e-93    
ref|NP_001054574.1|  Os05g0135500                                       295   9e-93    
ref|XP_004986969.1|  PREDICTED: peroxidase 2-like                       295   9e-93    
ref|XP_008461438.1|  PREDICTED: peroxidase 5-like                       295   1e-92    
ref|XP_004968760.1|  PREDICTED: peroxidase 2-like                       294   1e-92    
ref|XP_008804375.1|  PREDICTED: peroxidase 3-like                       294   1e-92    
ref|XP_008777796.1|  PREDICTED: peroxidase 3-like                       295   1e-92    
ref|XP_007217744.1|  hypothetical protein PRUPE_ppa008516mg             294   2e-92    
ref|XP_009780196.1|  PREDICTED: peroxidase 5-like                       295   2e-92    
ref|NP_188814.1|  peroxidase 30                                         294   2e-92    
ref|XP_008221883.1|  PREDICTED: peroxidase 44-like                      295   2e-92    
ref|XP_002277612.1|  PREDICTED: peroxidase 64                           293   2e-92    
dbj|BAJ95147.1|  predicted protein                                      294   2e-92    
ref|XP_004971523.1|  PREDICTED: peroxidase 5-like                       294   2e-92    
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             294   2e-92    
ref|XP_010680401.1|  PREDICTED: peroxidase 64 isoform X2                293   3e-92    
gb|ABK93918.1|  unknown                                                 293   3e-92    
emb|CDY49518.1|  BnaC05g03300D                                          293   3e-92    
emb|CAA66965.1|  peroxidase                                             293   3e-92    
ref|XP_010240935.1|  PREDICTED: peroxidase 27-like                      293   4e-92    
emb|CAA67360.1|  peroxidase ATP7a                                       293   5e-92    
ref|XP_008656069.1|  PREDICTED: peroxidase 2-like                       293   5e-92    
ref|XP_004239722.1|  PREDICTED: peroxidase 5-like                       293   6e-92    
gb|AAM61382.1|  putative peroxidase                                     293   6e-92    
dbj|BAA96643.1|  putative peroxidase 1                                  293   6e-92    
ref|XP_003567628.1|  PREDICTED: peroxidase 1-like                       294   7e-92    
ref|XP_002883319.1|  peroxidase 30                                      293   7e-92    
gb|ACW82412.1|  putative peroxidase                                     292   7e-92    
ref|XP_010908221.1|  PREDICTED: peroxidase 1-like                       292   9e-92    
ref|XP_010524488.1|  PREDICTED: peroxidase 30                           292   9e-92    
gb|EAY73611.1|  hypothetical protein OsI_01497                          292   1e-91    
gb|EMT01340.1|  Peroxidase 2                                            291   2e-91    
ref|XP_004515086.1|  PREDICTED: peroxidase 3-like                       291   2e-91    
ref|XP_006346000.1|  PREDICTED: peroxidase 5-like                       292   2e-91    
ref|XP_002529736.1|  Peroxidase 27 precursor, putative                  291   3e-91    
emb|CDY33143.1|  BnaCnng07140D                                          292   3e-91    
ref|XP_010240936.1|  PREDICTED: peroxidase 27-like                      291   3e-91    
ref|XP_008656073.1|  PREDICTED: peroxidase 2-like                       291   3e-91    
ref|XP_009145451.1|  PREDICTED: peroxidase 30                           291   3e-91    
ref|XP_006644127.1|  PREDICTED: peroxidase 1-like                       292   4e-91    
ref|NP_001054572.1|  Os05g0135200                                       291   4e-91    
emb|CBI28956.3|  unnamed protein product                                301   4e-91    
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      291   4e-91    
ref|XP_006654017.1|  PREDICTED: peroxidase 5-like                       291   4e-91    
gb|AAG46133.1|AC082644_15  putative peroxidase                          290   5e-91    
gb|EYU39442.1|  hypothetical protein MIMGU_mgv1a009821mg                290   5e-91    
gb|EYU39443.1|  hypothetical protein MIMGU_mgv1a009818mg                290   6e-91    
ref|XP_010240937.1|  PREDICTED: peroxidase 3-like                       290   8e-91    
gb|AFS28711.1|  putative peroxidase                                     289   8e-91    
tpe|CAH69255.1|  TPA: class III peroxidase 12 precursor                 290   1e-90    
gb|EYU24798.1|  hypothetical protein MIMGU_mgv1a009213mg                290   1e-90    
ref|XP_010267772.1|  PREDICTED: peroxidase 56-like                      290   1e-90    
gb|KHN41871.1|  Peroxidase 64                                           289   1e-90    
ref|XP_002455648.1|  hypothetical protein SORBIDRAFT_03g016510          289   1e-90    
gb|EYU24792.1|  hypothetical protein MIMGU_mgv1a009974mg                289   1e-90    
ref|XP_008242033.1|  PREDICTED: peroxidase 64                           289   1e-90    
emb|CDO98877.1|  unnamed protein product                                288   1e-90    
ref|XP_004144487.1|  PREDICTED: peroxidase 56-like                      289   1e-90    
ref|XP_006652863.1|  PREDICTED: peroxidase 1-like                       290   2e-90    
ref|XP_006590734.1|  PREDICTED: peroxidase 64-like                      289   2e-90    
gb|EYU36806.1|  hypothetical protein MIMGU_mgv1a010125mg                289   2e-90    
ref|XP_007226228.1|  hypothetical protein PRUPE_ppa016743mg             290   2e-90    
gb|AAD11482.1|  peroxidase precursor                                    290   2e-90    
ref|XP_006406236.1|  hypothetical protein EUTSA_v10021123mg             289   2e-90    
ref|XP_006298132.1|  hypothetical protein CARUB_v10014176mg             289   2e-90    
ref|XP_006447517.1|  hypothetical protein CICLE_v10017908mg             289   2e-90    
ref|XP_010931180.1|  PREDICTED: peroxidase 3-like isoform X1            289   2e-90    
ref|XP_002457707.1|  hypothetical protein SORBIDRAFT_03g011950          289   2e-90    
ref|NP_001042903.1|  Os01g0326000                                       290   2e-90    
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      289   2e-90    
ref|XP_004984276.1|  PREDICTED: peroxidase 2-like                       288   2e-90    
emb|CDY13252.1|  BnaC09g24040D                                          288   3e-90    
ref|XP_004487389.1|  PREDICTED: peroxidase 3-like                       288   3e-90    
ref|NP_001050188.1|  Os03g0368600                                       291   3e-90    
ref|XP_010931166.1|  PREDICTED: peroxidase 56-like                      289   3e-90    
gb|AHZ89831.1|  peroxidase                                              288   3e-90    
gb|EEC70539.1|  hypothetical protein OsI_01672                          289   3e-90    
gb|KFK39497.1|  hypothetical protein AALP_AA3G251500                    288   4e-90    
ref|XP_006356923.1|  PREDICTED: peroxidase 3-like                       288   4e-90    
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           288   4e-90    
ref|XP_002982182.1|  hypothetical protein SELMODRAFT_421525             288   4e-90    
ref|XP_010063312.1|  PREDICTED: peroxidase 64-like                      288   4e-90    
ref|XP_007202250.1|  hypothetical protein PRUPE_ppa008831mg             288   4e-90    
ref|XP_004159200.1|  PREDICTED: peroxidase 56-like                      288   5e-90    
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             288   6e-90    
ref|XP_011037006.1|  PREDICTED: peroxidase 3-like                       288   6e-90    
ref|NP_001050193.1|  Os03g0369400                                       288   7e-90    
ref|XP_010488198.1|  PREDICTED: peroxidase 30-like                      287   8e-90    
ref|XP_007223978.1|  hypothetical protein PRUPE_ppa014723mg             287   9e-90    
ref|XP_006855828.1|  hypothetical protein AMTR_s00037p00030970          287   9e-90    
ref|XP_011100418.1|  PREDICTED: peroxidase 27-like                      287   9e-90    
ref|XP_010510594.1|  PREDICTED: peroxidase 30                           287   9e-90    
ref|XP_009387463.1|  PREDICTED: peroxidase 47-like                      287   9e-90    
ref|XP_006340946.1|  PREDICTED: peroxidase 64-like                      287   9e-90    
ref|XP_010033528.1|  PREDICTED: peroxidase 64-like                      286   1e-89    
gb|EYU24791.1|  hypothetical protein MIMGU_mgv1a010031mg                287   1e-89    
emb|CAA67337.1|  peroxidase                                             287   1e-89    
gb|ABQ23446.1|  putative peroxidase                                     287   1e-89    
gb|ACU23988.1|  unknown                                                 286   1e-89    
gb|EAY90172.1|  hypothetical protein OsI_11737                          287   1e-89    
ref|XP_010680021.1|  PREDICTED: peroxidase 16-like                      287   1e-89    
ref|XP_002531135.1|  Peroxidase 64 precursor, putative                  286   1e-89    
ref|XP_009353257.1|  PREDICTED: peroxidase 27-like                      286   1e-89    
gb|ABM66586.1|  putative peroxidase                                     286   1e-89    
emb|CAJ86371.1|  OSIGBa0117N13.15                                       286   1e-89    
gb|EYU39447.1|  hypothetical protein MIMGU_mgv1a022629mg                287   1e-89    
ref|XP_003517158.1|  PREDICTED: peroxidase 64                           286   2e-89    
gb|KDP23966.1|  hypothetical protein JCGZ_25354                         286   2e-89    
ref|XP_011078263.1|  PREDICTED: peroxidase 64-like                      286   2e-89    
ref|XP_001783214.1|  predicted protein                                  285   2e-89    
gb|AHJ86268.1|  peroxidase                                              286   2e-89    
gb|ACT35472.1|  peroxidase 30                                           287   2e-89    
ref|NP_192868.1|  peroxidase 39                                         286   2e-89    
ref|XP_006356924.1|  PREDICTED: peroxidase 3-like                       286   2e-89    
ref|XP_002457708.1|  hypothetical protein SORBIDRAFT_03g011960          286   3e-89    
ref|XP_008801590.1|  PREDICTED: peroxidase 5-like                       286   3e-89    
gb|AEX55230.1|  peroxidase ATP17a-like protein                          286   3e-89    
ref|XP_006594890.1|  PREDICTED: peroxidase 3                            286   3e-89    
gb|EYU24795.1|  hypothetical protein MIMGU_mgv1a021569mg                285   3e-89    
ref|XP_009796592.1|  PREDICTED: peroxidase 64-like                      285   3e-89    
ref|XP_008221882.1|  PREDICTED: peroxidase 5-like                       286   3e-89    
ref|XP_010696607.1|  PREDICTED: peroxidase 3                            286   3e-89    
gb|ABE66389.1|  peroxidase                                              285   5e-89    



>ref|XP_009361266.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=328

 Score =   506 bits (1304),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/306 (79%), Positives = 268/306 (88%), Gaps = 0/306 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             + ++LQVGFY+ SC  AE IVKDEVQKAF  D GV AGLVRMHFHDCFVRGCD SVLIDS
Sbjct  23    VHSQLQVGFYTTSCTLAETIVKDEVQKAFFRDPGVTAGLVRMHFHDCFVRGCDASVLIDS  82

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T+SNTAEKDSPANNPSLRGFEVID AKARLE+ C+GVVSCADI+AFAARDS+ +T G GY
Sbjct  83    TSSNTAEKDSPANNPSLRGFEVIDKAKARLEAACRGVVSCADIVAFAARDSIVLTRGLGY  142

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             DVPAGRRDGRVS AS+IP NLP P+FNV  LT  F+NKGFTQ+EMVTLSGAHTIGRSHCT
Sbjct  143   DVPAGRRDGRVSKASDIPGNLPLPTFNVNNLTQHFANKGFTQQEMVTLSGAHTIGRSHCT  202

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRLY+FN+TT QDPSLDP YAAQLKQ+CPQGN+NANLVVPMDP SP +TD SYY  I
Sbjct  203   SFSNRLYNFNATTNQDPSLDPAYAAQLKQQCPQGNTNANLVVPMDPASPTVTDASYYAGI  262

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NRGLFTSDQTLLT+ +TAN+V+QNA  P  W  KF+AAMVKMGQ+ VLTGNAGEIRAN
Sbjct  263   LKNRGLFTSDQTLLTNSATANQVKQNARIPFLWKNKFSAAMVKMGQLEVLTGNAGEIRAN  322

Query  275   CRVVNS  258
             CRV+NS
Sbjct  323   CRVINS  328



>ref|XP_010045225.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW88589.1| hypothetical protein EUGRSUZ_A00966 [Eucalyptus grandis]
Length=322

 Score =   506 bits (1304),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 274/321 (85%), Gaps = 9/321 (3%)
 Frame = -1

Query  1199  LLTCQLIVL-------KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             LL C  +VL       +++LQVGFY  SC  AE IVKDEV+KAF+ D+G+AAGLVRMHFH
Sbjct  4     LLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFH  63

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGC+GSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLE++CKGVVSCADILA
Sbjct  64    DCFVRGCEGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAMCKGVVSCADILA  123

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARDSVE  GGFGYDVPAGRRDGRVSLASE   NLPPPSFNV QLT LF+NKGFTQEEM
Sbjct  124   FAARDSVEKAGGFGYDVPAGRRDGRVSLASET-TNLPPPSFNVDQLTQLFANKGFTQEEM  182

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD  501
             VTLSGAHTIGRSHCTSFNNRLYSFN+T  QDPSLDP YA+ LKQ+CPQGN +  LVVPMD
Sbjct  183   VTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQQCPQGN-DPTLVVPMD  241

Query  500   PFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMG  321
             P SP + D SYY  ILANRGLFTSDQTLLT+ +TAN+V QNA  P  W   FAAAMVKMG
Sbjct  242   PPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARIPSIWKSNFAAAMVKMG  301

Query  320   QISVLTGNAGEIRANCRVVNS  258
             +I VLTG+AGEIRANCRV+NS
Sbjct  302   KIGVLTGSAGEIRANCRVINS  322



>ref|XP_009769971.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=329

 Score =   506 bits (1302),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 249/329 (76%), Positives = 280/329 (85%), Gaps = 2/329 (1%)
 Frame = -1

Query  1241  SSRIRMLSCYSTLALLT-CQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAA  1065
             S+R+ M   ++ L LL  C+ ++L+A+LQVGFYS SC  AE IVK EV KAF+ D GVAA
Sbjct  2     SARMLMNGVWAALILLVLCECMMLEAQLQVGFYSSSCSMAEFIVKQEVAKAFIKDIGVAA  61

Query  1064  GLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGV  885
             GLVRMHFHDCFVRGCDGSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLES+C+GV
Sbjct  62    GLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLESVCQGV  121

Query  884   VSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSN  705
             VSCADI+AFAARDSVE+T GFGY VPAGRRDGR+SLASE   NLP P+FNV QLT  F N
Sbjct  122   VSCADIVAFAARDSVEITRGFGYAVPAGRRDGRISLASET-RNLPSPAFNVDQLTQNFKN  180

Query  704   KGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN  525
              G TQEEMVTLSGAHTIGRSHC SF++RLYSFNSTT QDPSLDP YAAQLKQ+CPQG+++
Sbjct  181   MGLTQEEMVTLSGAHTIGRSHCGSFSSRLYSFNSTTSQDPSLDPGYAAQLKQQCPQGSTD  240

Query  524   ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKF  345
              +L VPM+P SPAITDV YYT+ILANRGLFTSDQTLLT+P+T  +V QNA S + W  KF
Sbjct  241   TSLGVPMNPASPAITDVGYYTDILANRGLFTSDQTLLTNPATVIQVIQNARSSLLWKSKF  300

Query  344   AAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             A AMVKMGQI +LT  AGEIRANCRV+NS
Sbjct  301   AFAMVKMGQIGILTSTAGEIRANCRVINS  329



>ref|XP_004307916.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   504 bits (1299),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 244/332 (73%), Positives = 283/332 (85%), Gaps = 8/332 (2%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIV---LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDR  1077
             MSS  ++     S   +L C L+    + ++LQVGFY GSC  AE IVK+EV+K F+ +R
Sbjct  1     MSSQNLK-----SVYIVLFCVLLCRRGVDSQLQVGFYGGSCNIAEFIVKEEVRKGFIGNR  55

Query  1076  GVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESL  897
             GVAAGLVR+HFHDCFVRGCD SVLIDST SNTAEKD+PANNPSLRGFEVID+AKARLES+
Sbjct  56    GVAAGLVRLHFHDCFVRGCDASVLIDSTTSNTAEKDAPANNPSLRGFEVIDNAKARLESI  115

Query  896   CKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTN  717
             CKGVVSCADI+AFAARDSVE+TGG GYDVPAGRRDGRVS+AS+   NLPPP+ NV QLT 
Sbjct  116   CKGVVSCADIVAFAARDSVELTGGLGYDVPAGRRDGRVSVASDTFTNLPPPTANVNQLTQ  175

Query  716   LFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ  537
             LF+NKGFTQ+EMVTLSGAHTIGRSHC SF+NRLYSFN+TT QDPSLDP+YAAQLKQ+CPQ
Sbjct  176   LFANKGFTQDEMVTLSGAHTIGRSHCGSFSNRLYSFNATTNQDPSLDPRYAAQLKQQCPQ  235

Query  536   GNSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISW  357
             GN+N NLVV M+P SP   DV+YY +ILANRGLFTSDQTL+++ +TAN+V QNA +P  W
Sbjct  236   GNTNPNLVVAMNPSSPFTNDVAYYADILANRGLFTSDQTLISNSATANQVNQNARNPFLW  295

Query  356   GLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               KFAAAMVKMG++ VLTGNAGEIRANCRV+N
Sbjct  296   NYKFAAAMVKMGRLGVLTGNAGEIRANCRVIN  327



>ref|XP_009605400.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=329

 Score =   504 bits (1297),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 247/329 (75%), Positives = 277/329 (84%), Gaps = 2/329 (1%)
 Frame = -1

Query  1241  SSRIRMLSCYSTLALLT-CQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAA  1065
             S+R+ M   ++ L  +  C+ I+L+A+LQVGFY  SC   E IVK EV KAF+ DRGVAA
Sbjct  2     SARMLMSGVWAALIFVVLCECIMLEAQLQVGFYGSSCSMVEFIVKQEVTKAFIKDRGVAA  61

Query  1064  GLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGV  885
             GLVRMHFHDCFVRGCDGSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLES+C+GV
Sbjct  62    GLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLESVCRGV  121

Query  884   VSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSN  705
             VSCADI+AFAARDSVE+T GFGY VPAGRRDGR+SLASE   NLP P+ NV QLT  F N
Sbjct  122   VSCADIVAFAARDSVEITRGFGYAVPAGRRDGRISLASET-RNLPSPALNVDQLTQNFKN  180

Query  704   KGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN  525
              G TQEEMVTLSGAHTIGRSHC SF +RLY+FNSTT QDPSLDP YAAQLKQ+CPQG+++
Sbjct  181   MGLTQEEMVTLSGAHTIGRSHCGSFTSRLYNFNSTTSQDPSLDPGYAAQLKQQCPQGSTD  240

Query  524   ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKF  345
              +LVVPM+P SP ITDV YYT+ILANRGLFTSDQTLLT+P+TA +V QNA S + W  KF
Sbjct  241   TSLVVPMNPASPDITDVGYYTDILANRGLFTSDQTLLTNPTTAIQVTQNARSSLLWKSKF  300

Query  344   AAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             A AMVKMGQI VLT  AGEIRANCRV+NS
Sbjct  301   AFAMVKMGQIGVLTSTAGEIRANCRVINS  329



>ref|XP_006347525.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=325

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 240/314 (76%), Positives = 274/314 (87%), Gaps = 1/314 (0%)
 Frame = -1

Query  1199  LLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGC  1020
             L+ C+ ++L+A+LQVGFY  SC  AE IV+ EV  AF  ++GVAAGLVRMHFHDCFVRGC
Sbjct  13    LVLCECMMLEAQLQVGFYDNSCSMAEFIVRQEVTNAFFINKGVAAGLVRMHFHDCFVRGC  72

Query  1019  DGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSV  840
             DGSVLIDST++N+AEKDSPANNPSLRGFEVIDSAKARLES+C+GVVSCADI+AFAARDSV
Sbjct  73    DGSVLIDSTSTNSAEKDSPANNPSLRGFEVIDSAKARLESVCQGVVSCADIVAFAARDSV  132

Query  839   EMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAH  660
              +TGGFGY+VPAGRRDGR+SLASE   +LPPP+ NV QLT  F N G TQEEMVTLSGAH
Sbjct  133   AITGGFGYEVPAGRRDGRISLASET-TSLPPPTLNVDQLTQNFKNMGLTQEEMVTLSGAH  191

Query  659   TIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAIT  480
             TIGRSHC +F NRLYSFNSTT QDPSLDP YAAQLKQ+CP+G+++A+LVVPM+P SPAIT
Sbjct  192   TIGRSHCLAFRNRLYSFNSTTSQDPSLDPSYAAQLKQQCPEGSTDASLVVPMNPVSPAIT  251

Query  479   DVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTG  300
             D  YYT+ILANRGLFTSDQTLLT+P+TA +V QNA  P  W  KFA+AMVKMGQI VLTG
Sbjct  252   DECYYTDILANRGLFTSDQTLLTNPTTAIQVIQNARYPFLWKSKFASAMVKMGQIGVLTG  311

Query  299   NAGEIRANCRVVNS  258
              AGEIRANCRV+NS
Sbjct  312   TAGEIRANCRVINS  325



>ref|XP_010048379.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW89059.1| hypothetical protein EUGRSUZ_A01385 [Eucalyptus grandis]
Length=322

 Score =   503 bits (1295),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 249/321 (78%), Positives = 276/321 (86%), Gaps = 9/321 (3%)
 Frame = -1

Query  1199  LLTCQLIVL-------KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             LL C  +VL       +++LQVGFY  SC  AE IVKDEV+KAF+ D+G+AAGLVRMHFH
Sbjct  4     LLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFH  63

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGC+GSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLE++CKGVVSCADILA
Sbjct  64    DCFVRGCEGSVLIDSTLSNTAEKDSPANNPSLRGFEVIDSAKARLETMCKGVVSCADILA  123

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARDSVE+TGGFGY+VPAGRRDGRVSLA E   NLP PSFNV QLT LF+NKGFTQEEM
Sbjct  124   FAARDSVEITGGFGYNVPAGRRDGRVSLAPETI-NLPLPSFNVNQLTQLFANKGFTQEEM  182

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD  501
             VTLSGAHTIGRSHCTSFNNRLYSFN+T  QDPSLDP YA+ LKQRCPQ N+++ LVVPMD
Sbjct  183   VTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQRCPQ-NNDSTLVVPMD  241

Query  500   PFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMG  321
             P SP + D SYY  ILANRGLFTSDQTLLT+ +TAN+V QNA +P  W   FAAAMVKMG
Sbjct  242   PPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARNPFIWKKIFAAAMVKMG  301

Query  320   QISVLTGNAGEIRANCRVVNS  258
             +I VLTG+AGEIRANCRV+NS
Sbjct  302   KIGVLTGSAGEIRANCRVINS  322



>ref|XP_003634164.2| PREDICTED: peroxidase 5 [Vitis vinifera]
Length=368

 Score =   501 bits (1289),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 250/334 (75%), Positives = 283/334 (85%), Gaps = 1/334 (0%)
 Frame = -1

Query  1259  NKSEMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCD  1080
             +K  MSS R+  LS    L  L C  + L+A+LQVGFY  SCG AE IVKDEV+K F+ D
Sbjct  36    HKEVMSSKRVTWLSLTWVLVFL-CLSVELEAQLQVGFYRTSCGLAEFIVKDEVRKGFIRD  94

Query  1079  RGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLES  900
              GVA GLVRMHFHDCFVRGCDGSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLE+
Sbjct  95    SGVAPGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEA  154

Query  899   LCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLT  720
             +CKGVVSCADI+AFAARDSVE+TGG GYDVPAGRRDGR+SLASE   NLPPP+F V QLT
Sbjct  155   VCKGVVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPPTFTVDQLT  214

Query  719   NLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP  540
               FSNKG TQ+EMVTLSGAHTIGRSHC+SF+NRLY+FN T+ QDP+LDPQYAA LK +CP
Sbjct  215   QFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYAASLKTQCP  274

Query  539   QGNSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPIS  360
             QG++N NLVVPM+P SP+ITDV YY ++L NRGLFTSDQTLLTD +TA +VRQNAG+P  
Sbjct  275   QGSTNTNLVVPMNPSSPSITDVGYYVDVLRNRGLFTSDQTLLTDTTTATQVRQNAGNPFL  334

Query  359   WGLKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             W  KFA+AMVKMGQ+ VL G AG+IRANCRV+NS
Sbjct  335   WKNKFASAMVKMGQLGVLIGEAGQIRANCRVINS  368



>sp|A7QEU4.2|PER5_VITVI RecName: Full=Peroxidase 5; Flags: Precursor [Vitis vinifera]
Length=329

 Score =   498 bits (1282),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 249/330 (75%), Positives = 281/330 (85%), Gaps = 1/330 (0%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             MSS R+  LS    L  L C  + L+A+LQVGFY  SCG AE IVKDEV+K F+ D GVA
Sbjct  1     MSSKRVTWLSLTWVLVFL-CLSVELEAQLQVGFYRTSCGLAEFIVKDEVRKGFIRDSGVA  59

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
              GLVRMHFHDCFVRGCDGSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLE++CKG
Sbjct  60    PGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAVCKG  119

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADI+AFAARDSVE+TGG GYDVPAGRRDGR+SLASE   NLPPP+F V QLT  FS
Sbjct  120   VVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPPTFTVDQLTQFFS  179

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
             NKG TQ+EMVTLSGAHTIGRSHC+SF+NRLY+FN T+ QDP+LDPQYAA LK +CPQG++
Sbjct  180   NKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYAASLKTQCPQGST  239

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             N NLVVPM+P SP+ITDV YY ++L NRGLFTSDQTLLTD +TA +VRQNAG+P  W  K
Sbjct  240   NTNLVVPMNPSSPSITDVGYYVDVLRNRGLFTSDQTLLTDTTTATQVRQNAGNPFLWKNK  299

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FA+AMVKMGQ+ VL G AG+IRANCRV+NS
Sbjct  300   FASAMVKMGQLGVLIGEAGQIRANCRVINS  329



>ref|XP_007039219.1| Peroxidase 5 [Theobroma cacao]
 gb|EOY23720.1| Peroxidase 5 [Theobroma cacao]
Length=330

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 233/324 (72%), Positives = 276/324 (85%), Gaps = 3/324 (1%)
 Frame = -1

Query  1229  RMLSCYSTLAL-LTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             ++   ++ LA+ L CQ +   ++LQ+GFY  +C   E IVK+EV KAF+ + GV AGL+R
Sbjct  8     KLTRVFTILAVVLFCQSV--HSQLQIGFYRDTCSLVEFIVKEEVTKAFIKENGVVAGLMR  65

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHDCFVRGCDGSVL+DST S+TAEKDS ANNPSLRG+EVID+AKARLE++CKGVVSCA
Sbjct  66    MHFHDCFVRGCDGSVLLDSTPSSTAEKDSFANNPSLRGYEVIDNAKARLEAVCKGVVSCA  125

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DI+AFAARDS+E+TGG GYDVPAGRRDGR SLASEI  NLPPP+FNV QLT +F+ KGFT
Sbjct  126   DIVAFAARDSIEITGGLGYDVPAGRRDGRTSLASEIIGNLPPPTFNVSQLTQMFAKKGFT  185

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
             QEEMVTLSG HTIGRSHCTSF+NRLY+F+ T +QDPSLDP+YAA LKQ+CPQGN + NLV
Sbjct  186   QEEMVTLSGGHTIGRSHCTSFSNRLYNFSGTGMQDPSLDPRYAAMLKQQCPQGNKDTNLV  245

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             VPM+P SP+ITD  YY +ILANRGLFTSD TLLT+P+TAN+V QNA +P+ W  KF AAM
Sbjct  246   VPMNPSSPSITDAGYYVDILANRGLFTSDHTLLTNPATANQVTQNARNPMQWRAKFGAAM  305

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             VKMGQ+ VLTG AGEIRANCRV+N
Sbjct  306   VKMGQLEVLTGTAGEIRANCRVIN  329



>ref|XP_011075883.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=325

 Score =   496 bits (1277),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 239/317 (75%), Positives = 271/317 (85%), Gaps = 2/317 (1%)
 Frame = -1

Query  1205  LALLTCQLIVL-KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             + LL C  IV  +A+LQVGFY  SCG AELIVK EV+  F+ D+GVAAGLVR+HFHDCFV
Sbjct  10    ILLLVCLYIVESEAQLQVGFYQSSCGLAELIVKQEVRIGFIKDKGVAAGLVRLHFHDCFV  69

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLIDST SNTAEKD+P NNPSLRGFEVID+AK+RLE++CKGVVSCADILAFAAR
Sbjct  70    RGCDGSVLIDSTPSNTAEKDAPPNNPSLRGFEVIDNAKSRLEAICKGVVSCADILAFAAR  129

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DS+E+TGG GYDVPAGRRDGRVS+ASE  +NLPPP+F+V QLT +F+ KG TQEEMVTLS
Sbjct  130   DSIEITGGLGYDVPAGRRDGRVSVASEALSNLPPPTFDVNQLTKMFATKGLTQEEMVTLS  189

Query  668   GAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSP  489
             GAHT+GRSHCTSF NRLY+FNS + QDP+LD  YAAQL+Q+CPQ NSNANLVVPMDP SP
Sbjct  190   GAHTLGRSHCTSFINRLYNFNSNSSQDPTLDTTYAAQLRQKCPQ-NSNANLVVPMDPSSP  248

Query  488   AITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISV  309
             A TDV YY  +LANRGL TSDQTLLT P T  +V QN  +P  W  KFAAAMVKMG+I V
Sbjct  249   AFTDVGYYKGVLANRGLLTSDQTLLTSPQTQFQVVQNVQNPFLWRNKFAAAMVKMGKIGV  308

Query  308   LTGNAGEIRANCRVVNS  258
             LTGNAGE+RANCRV+NS
Sbjct  309   LTGNAGEVRANCRVINS  325



>ref|XP_008234631.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Prunus mume]
Length=327

 Score =   496 bits (1276),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/326 (73%), Positives = 277/326 (85%), Gaps = 0/326 (0%)
 Frame = -1

Query  1235  RIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLV  1056
             R + L+C S + +       + ++LQVGFY+ SC  AELIVKDEV+K F  + GVAAGLV
Sbjct  2     RPQNLNCVSIVLIAASLCHSVHSQLQVGFYTTSCTLAELIVKDEVRKGFFKNPGVAAGLV  61

Query  1055  RMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             R+HFHDCFVRGCD SVLIDST+SN AEKDSPANNPSLRGFEVIDSAKARLE++C+GVVSC
Sbjct  62    RLHFHDCFVRGCDASVLIDSTSSNKAEKDSPANNPSLRGFEVIDSAKARLEAVCRGVVSC  121

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADI+AFAARDS+E+T G GY VPAGRRDGR+S AS+   NLPPPSFNV QL+ LF+NKGF
Sbjct  122   ADIVAFAARDSIEITRGLGYIVPAGRRDGRISQASDTFTNLPPPSFNVDQLSKLFANKGF  181

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL  516
             TQEEMVTLSGAHTIGRSH T+F+NRLY+FN T+ QDPSLDPQYAAQLKQ+CPQGN++ NL
Sbjct  182   TQEEMVTLSGAHTIGRSHSTAFSNRLYNFNRTSRQDPSLDPQYAAQLKQQCPQGNTSPNL  241

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
             VV M+P SPA+TD SYY +ILANRGLFTSDQTLLT+ +TAN+V QNA  P  W  KFA A
Sbjct  242   VVLMNPASPAVTDTSYYADILANRGLFTSDQTLLTNSATANQVNQNAKMPFLWRTKFATA  301

Query  335   MVKMGQISVLTGNAGEIRANCRVVNS  258
             MVKMG++ VLTGNAGEI+ANCRV+NS
Sbjct  302   MVKMGRLEVLTGNAGEIQANCRVINS  327



>ref|XP_008377046.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Malus domestica]
Length=333

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 233/306 (76%), Positives = 261/306 (85%), Gaps = 0/306 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             + ++LQVGFY+ SC  AE IVKDEVQKAF  D GV AGLVRMHFHDCFVRGCD SVLIDS
Sbjct  28    VHSQLQVGFYTTSCTLAETIVKDEVQKAFFRDPGVTAGLVRMHFHDCFVRGCDASVLIDS  87

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T+SNTAEKDSPANNPSLRGFEVID AKARLE+ C+GV+SCADI+AFAARDS+ +T G GY
Sbjct  88    TSSNTAEKDSPANNPSLRGFEVIDKAKARLEAACRGVISCADIVAFAARDSIVLTRGLGY  147

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             DVPAGRRD R S AS+    LP P+FNV  LT LF+NKGFTQEEMVTLSGAHTIGRSHCT
Sbjct  148   DVPAGRRDSRSSKASDXTRKLPFPTFNVDNLTQLFANKGFTQEEMVTLSGAHTIGRSHCT  207

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRL +F +TT QDPSLDP YAAQLKQ+CPQGN+NANLVVPMDP SP +TD SYY  I
Sbjct  208   SFSNRLTNFXATTNQDPSLDPAYAAQLKQQCPQGNTNANLVVPMDPASPIVTDASYYAGI  267

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NRGLFTSDQTLLT+P+TAN+V+ NA  P+ W  KF+AAMVKMGQ+ VL GNAGEIRAN
Sbjct  268   LKNRGLFTSDQTLLTNPATANQVKHNARIPLLWKKKFSAAMVKMGQLEVLMGNAGEIRAN  327

Query  275   CRVVNS  258
             CR +NS
Sbjct  328   CRAINS  333



>ref|XP_004235031.1| PREDICTED: peroxidase 5 [Solanum lycopersicum]
Length=325

 Score =   489 bits (1260),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 237/325 (73%), Positives = 276/325 (85%), Gaps = 2/325 (1%)
 Frame = -1

Query  1232  IRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             +RML   + + L+ C+ ++L+A+LQVGFY  SC  AE IV+ EV  AF+ ++GVAAGLVR
Sbjct  3     VRML-INALIFLVLCECMMLEAQLQVGFYDNSCSMAEFIVRQEVTNAFLRNKGVAAGLVR  61

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHDCFVRGCDGSVLIDSTA+N+AEKDSPANNPSLRGF+VIDSAKARLES+C+GVVSCA
Sbjct  62    MHFHDCFVRGCDGSVLIDSTATNSAEKDSPANNPSLRGFKVIDSAKARLESVCEGVVSCA  121

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DI+AFAARDSV +TGG GY+VPAGRRDGR+SLASE   +LPPP+ +V QLT  F + G T
Sbjct  122   DIVAFAARDSVVITGGLGYEVPAGRRDGRISLASET-RSLPPPTLDVDQLTQNFRSMGLT  180

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
             QEEMVTLSGAHTIGRSHC +F NRLYSFNSTT QDPSLD  YAAQLKQ+CP+G+++A+LV
Sbjct  181   QEEMVTLSGAHTIGRSHCLAFRNRLYSFNSTTSQDPSLDLSYAAQLKQQCPEGSTDASLV  240

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             VPM+P SP  TD  YYT+ILANRGLFTSDQTLLTDP+TA +V QNA  P  W  KFA+AM
Sbjct  241   VPMNPVSPGTTDEYYYTDILANRGLFTSDQTLLTDPTTAIQVLQNARFPFLWKSKFASAM  300

Query  332   VKMGQISVLTGNAGEIRANCRVVNS  258
              KMGQI VLTG AGEIRANCRV+NS
Sbjct  301   AKMGQIGVLTGTAGEIRANCRVINS  325



>ref|XP_006470493.1| PREDICTED: peroxidase 5-like [Citrus sinensis]
Length=328

 Score =   489 bits (1258),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/315 (74%), Positives = 268/315 (85%), Gaps = 2/315 (1%)
 Frame = -1

Query  1205  LALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVR  1026
             + +L C  +   ++LQVGFY  SC  AELIVKDEV+K+ + D+GVAAGLVRMHFHDCFVR
Sbjct  16    IVVLLCTSV--NSQLQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVR  73

Query  1025  GCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARD  846
             GCD SVLIDST+SNTAEKDSP NNPSLRGFEVID+AKA LES+CKG+VSCADI+AFAARD
Sbjct  74    GCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARD  133

Query  845   SVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSG  666
             SVE++GG GYDVP+GRRDGR+SLASE   NLPPP+F V QLT  F+NKGFTQEEMVTLSG
Sbjct  134   SVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSG  193

Query  665   AHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPA  486
             AHTIGRSHCTSF+NRLY+F+ T  QDPSL+P YAAQLKQ+C Q  +N NLVVPM+P SP+
Sbjct  194   AHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNPGSPS  253

Query  485   ITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVL  306
             I D  YY +IL NRGLFTSDQTLL+DP+TA++V QNA +P  W   FAAAMVKMGQI VL
Sbjct  254   IADTGYYIDILRNRGLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVL  313

Query  305   TGNAGEIRANCRVVN  261
             T +AGEIRANCRVVN
Sbjct  314   TASAGEIRANCRVVN  328



>gb|KDO66295.1| hypothetical protein CISIN_1g041695mg, partial [Citrus sinensis]
Length=301

 Score =   486 bits (1252),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 231/301 (77%), Positives = 261/301 (87%), Gaps = 0/301 (0%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             LQVGFY  SC  AELIVKDEV+K+ + D+GVAAGLVRMHFHDCFVRGCD SVLIDST+SN
Sbjct  1     LQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSN  60

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             TAEKDSP NNPSLRGFEVID+AKA LES+CKG+VSCADI+AFAARDSVE++GG GYDVP+
Sbjct  61    TAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPS  120

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDGR+SLASE   NLPPP+F V QLT  F+NKGFTQEEMVTLSGAHTIGRSHCTSF+N
Sbjct  121   GRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSN  180

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANR  444
             RLY+F+ T  QDPSL+P YAAQLKQ+C Q  +N NLVVPM+P SP+I D  YY +IL NR
Sbjct  181   RLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNPGSPSIADTGYYIDILRNR  240

Query  443   GLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVV  264
             GLFTSDQTLL+DP+TA++V QNA +P  W   FAAAMVKMGQI VLT +AGEIRANCRVV
Sbjct  241   GLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVV  300

Query  263   N  261
             N
Sbjct  301   N  301



>gb|KDP30908.1| hypothetical protein JCGZ_15520 [Jatropha curcas]
Length=328

 Score =   483 bits (1243),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 267/319 (84%), Gaps = 0/319 (0%)
 Frame = -1

Query  1217  CYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             C  TL +L CQ  V   +LQVG+YS SC  AE IVKD V+  F  D+GV A L+RMHFHD
Sbjct  10    CTITLLILFCQFGVRNCQLQVGYYSSSCSVAEFIVKDAVRDGFSKDKGVPAALLRMHFHD  69

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCDGSVLIDS++SNTAEKD+PANNPSLRGFEVID+AK+RLE++CKG+VSCADILAF
Sbjct  70    CFVRGCDGSVLIDSSSSNTAEKDNPANNPSLRGFEVIDNAKSRLEAVCKGIVSCADILAF  129

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARDS+E++GG GYDVPAGRRDGR+SL+S++  NLP P+FNV QLT LF+NKGF+Q EMV
Sbjct  130   AARDSIELSGGLGYDVPAGRRDGRISLSSDVSTNLPAPTFNVNQLTQLFANKGFSQAEMV  189

Query  677   TLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDP  498
             TLSG HTIGRSHCTSF+NRLY+FN T+  DPSLD  YAA+LKQ+CPQ +++  LVVPM+P
Sbjct  190   TLSGGHTIGRSHCTSFSNRLYNFNQTSSSDPSLDGMYAAKLKQQCPQSSTDNGLVVPMNP  249

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              SP   D  YY +ILANRGLF SDQTLLT+P+TA +V QNA +P+ W  KFAAAMVKMG 
Sbjct  250   SSPGTIDAGYYIDILANRGLFISDQTLLTNPATATQVSQNARNPLLWQTKFAAAMVKMGG  309

Query  317   ISVLTGNAGEIRANCRVVN  261
             + VLTGNAGEIRANCRV+N
Sbjct  310   LDVLTGNAGEIRANCRVIN  328



>gb|EYU45326.1| hypothetical protein MIMGU_mgv1a009971mg [Erythranthe guttata]
Length=325

 Score =   481 bits (1238),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 268/324 (83%), Gaps = 2/324 (1%)
 Frame = -1

Query  1229  RMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             +    + ++ L  C ++  +A+LQ GFY  SCG AE IVK EV+  F  D G+AAGLVR+
Sbjct  4     KQFQTFVSVLLFLC-IVESEAQLQTGFYRSSCGIAEFIVKQEVRNGFFKDNGIAAGLVRL  62

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCDGSVLIDSTASN AEKDSPANNPSLRGFEVID+AKAR+E+ CKGVVSCAD
Sbjct  63    HFHDCFVRGCDGSVLIDSTASNKAEKDSPANNPSLRGFEVIDNAKARIEAFCKGVVSCAD  122

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDS+E+TGGFGYDVP+GR+DGRVSL +E   NLPPPSFNV QLT  F+NKG TQ
Sbjct  123   ILAFAARDSIEITGGFGYDVPSGRKDGRVSLDTEASQNLPPPSFNVNQLTQAFANKGLTQ  182

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVV  510
             EEMVTLSGAHT+GRSHCTSF+NRLYSF++ T QDPSLD  YA+QL+Q+CP+G +  N VV
Sbjct  183   EEMVTLSGAHTLGRSHCTSFSNRLYSFSTNTSQDPSLDAFYASQLRQQCPRG-TGPNPVV  241

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
             PMDPFSPA TDV YY  +L+NRGLFTSDQTL+T P T  +V QNA +P  W  KFAAAMV
Sbjct  242   PMDPFSPAQTDVGYYRGVLSNRGLFTSDQTLMTSPITQAQVFQNAQNPFLWANKFAAAMV  301

Query  329   KMGQISVLTGNAGEIRANCRVVNS  258
              MG+I VLTGN+GEIRA+CRV+NS
Sbjct  302   NMGKIGVLTGNSGEIRASCRVINS  325



>ref|XP_007136358.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
 gb|ESW08352.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
Length=327

 Score =   479 bits (1234),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 229/326 (70%), Positives = 268/326 (82%), Gaps = 0/326 (0%)
 Frame = -1

Query  1235  RIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLV  1056
             R  ML C + + ++         ELQVGFYS SCG AE IVKDEV+KA   + G+AAGLV
Sbjct  2     RSTMLKCITIVLVVYLMNQNAHCELQVGFYSYSCGMAEFIVKDEVRKAVSNNPGIAAGLV  61

Query  1055  RMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             RMHFHDCF+RGCD SVL+DST SNTAEKDSPAN PSLRG+EVID AKA+LE++C G+VSC
Sbjct  62    RMHFHDCFIRGCDASVLLDSTPSNTAEKDSPANKPSLRGYEVIDHAKAQLEAVCPGIVSC  121

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADI+AFAARDSVE+ GG GYDVPAGRRDGR+SLAS+    LPPP+FNV QLT LF+ KG 
Sbjct  122   ADIVAFAARDSVELAGGLGYDVPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGL  181

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL  516
             TQ+EMVTLSGAHTIGRSHC+SF+NRLY+F+ T+ +DPSLDP YAA LK++CPQG++N NL
Sbjct  182   TQDEMVTLSGAHTIGRSHCSSFSNRLYNFSGTSSKDPSLDPSYAALLKRQCPQGSTNPNL  241

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
             VVPM+P SP I DV YY +IL+NRGLFTSDQTLLT+  TA++V+QNA     W  KFA A
Sbjct  242   VVPMNPSSPGIADVGYYVDILSNRGLFTSDQTLLTNAETASQVKQNARDGYQWASKFADA  301

Query  335   MVKMGQISVLTGNAGEIRANCRVVNS  258
             MVKMGQISVLTGNAGEIR NCRVV+S
Sbjct  302   MVKMGQISVLTGNAGEIRTNCRVVSS  327



>ref|XP_003602405.1| Peroxidase [Medicago truncatula]
 gb|AES72656.1| peroxidase family protein [Medicago truncatula]
Length=327

 Score =   479 bits (1233),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 224/304 (74%), Positives = 260/304 (86%), Gaps = 0/304 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++L+VGFY+ SCG AE IVKDEV+K+F  + G+AAGLVRMHFHDCF+RGCD SVL+DST 
Sbjct  24    SQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTL  83

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
             SN AEKDSPAN PSLRGFEVID+AKA+LE  CKG+VSCADI+AFAARDSVE+ GG GYDV
Sbjct  84    SNIAEKDSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYDV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG++SLAS+    LPPP+FNV QLT LF+ KG TQ+EMVTLSGAHTIGRSHC++F
Sbjct  144   PAGRRDGKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSAF  203

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             + RLY+F+ST++QDPSLDP YAA LK++CPQGN+N NLVVPMDP SP   DV YY +ILA
Sbjct  204   SKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDILA  263

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGLFTSDQTLLT+  TA +V QNA +P  W  KFA AMVKMGQ+ VLTGNAGEIR NCR
Sbjct  264   NRGLFTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNCR  323

Query  269   VVNS  258
             VVNS
Sbjct  324   VVNS  327



>gb|AHL39183.1| class III peroxidase [Populus trichocarpa]
Length=330

 Score =   479 bits (1234),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 234/332 (70%), Positives = 270/332 (81%), Gaps = 4/332 (1%)
 Frame = -1

Query  1247  MSSSRIRM--LSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRG  1074
             MSS ++    L C+  + L   Q +   ++L+VGFY  SC  AE IVK  V+  F  DRG
Sbjct  1     MSSKKLSRPCLVCWVVVFLFCTQSV--HSQLEVGFYRSSCKMAEFIVKSAVRDGFNKDRG  58

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLC  894
             VAAGLVRMHFHDCFVRGCD SVL+DST SN AEKDSPANNPSLRGFEVID+AKARLE+ C
Sbjct  59    VAAGLVRMHFHDCFVRGCDASVLLDSTTSNKAEKDSPANNPSLRGFEVIDNAKARLETEC  118

Query  893   KGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNL  714
             KG+VSCADILAFAARDS+E+TGGFGYDVPAGRRDG VSLASE+  NLPPP+FNV QLT  
Sbjct  119   KGIVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVLTNLPPPTFNVDQLTQN  178

Query  713   FSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG  534
             F+NKGF+QEEMVTLSG HTIGRSHCTSF+NRLY+FN TT QDP LD  YA  LKQ CPQG
Sbjct  179   FANKGFSQEEMVTLSGGHTIGRSHCTSFSNRLYNFNGTTSQDPILDATYATSLKQMCPQG  238

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
             +++ +LVVPM+P SPA TD  YY +ILANRGLFTSDQTLLT+ +TAN+V  NA + + W 
Sbjct  239   STDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATANQVNINARNSMLWK  298

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
              KFAAAM KMG++ VLTGNAGEIRA+CRV+NS
Sbjct  299   RKFAAAMQKMGKLDVLTGNAGEIRADCRVINS  330



>ref|XP_006374082.1| hypothetical protein POPTR_0015s00590g [Populus trichocarpa]
 gb|ERP51879.1| hypothetical protein POPTR_0015s00590g [Populus trichocarpa]
Length=330

 Score =   476 bits (1226),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 269/332 (81%), Gaps = 4/332 (1%)
 Frame = -1

Query  1247  MSSSRIRM--LSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRG  1074
             MSS ++    L C+  + L   Q +   ++L+VGFY  SC  AE IVK  V+  F  DRG
Sbjct  1     MSSKKLSRPCLVCWVVVFLFCNQSV--HSQLEVGFYRSSCKMAEFIVKSAVRDGFNKDRG  58

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLC  894
             VAAGLVRMHFHDCFVRGCD SVL+DST SN AEKDSPANNPSLRGFEVID+AKARLE+ C
Sbjct  59    VAAGLVRMHFHDCFVRGCDASVLLDSTTSNKAEKDSPANNPSLRGFEVIDNAKARLETEC  118

Query  893   KGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNL  714
             KG+VSCADILAFAARDS+E+TGGFGYDVPAGRRDG VSLASE+  NLPPP+FNV QLT  
Sbjct  119   KGIVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVLTNLPPPTFNVDQLTQN  178

Query  713   FSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG  534
             F+NKGF+QEEMVTLSG HTIGRSHCTSF+NRLY+FN TT QDP LD  YA  LKQ CPQG
Sbjct  179   FANKGFSQEEMVTLSGGHTIGRSHCTSFSNRLYNFNGTTSQDPILDATYATSLKQMCPQG  238

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
             +++ +LVVPM+P SPA TD  YY +ILANRGLFTSDQTLLT+ +TA +V  NA + + W 
Sbjct  239   STDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATATQVNINARNSMLWK  298

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
              KFAAAM KMG++ VLTGNAGEIRA+CRV+NS
Sbjct  299   RKFAAAMQKMGKLDVLTGNAGEIRADCRVINS  330



>gb|AHL39182.1| class III peroxidase [Populus trichocarpa]
Length=329

 Score =   475 bits (1222),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 272/330 (82%), Gaps = 3/330 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             MSS ++  LS    +A+L CQ +  +++LQVGFY  SC RAELIV++ V+     DRGVA
Sbjct  3     MSSKKLTQLSVICWVAVLFCQSV--QSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGVA  60

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGLVRMHFHDCFVRGC+GSVL+DST+SNTAEKDSPANNPSLRG+EV+D A+A+LE+ C+G
Sbjct  61    AGLVRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANNPSLRGYEVVDDARAKLEAECRG  120

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDS ++TGG  YDVPAGRRDG VSL +E  ++LPPP+ NV QLT  F+
Sbjct  121   VVSCADILAFAARDSFDLTGGISYDVPAGRRDGTVSLVAET-SDLPPPTLNVDQLTQNFA  179

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              KG +QEEMVTLSG HTIGRSHCTSF +RLY+F+ T  QDPSLD  YAA LKQ+CPQ ++
Sbjct  180   KKGLSQEEMVTLSGGHTIGRSHCTSFRDRLYNFSGTNSQDPSLDATYAASLKQKCPQAST  239

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             + NLVVPMD  +P I+DVSYY +ILANRGLFTSDQTLL++ +TA++V  N+ SP+ W  K
Sbjct  240   DTNLVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVNSNSRSPLGWKRK  299

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FAAAMVKMGQI VLTGN GEIRANCRV+NS
Sbjct  300   FAAAMVKMGQIEVLTGNTGEIRANCRVINS  329



>ref|XP_002321949.2| hypothetical protein POPTR_0015s00580g [Populus trichocarpa]
 gb|EEF06076.2| hypothetical protein POPTR_0015s00580g [Populus trichocarpa]
Length=329

 Score =   474 bits (1221),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 272/330 (82%), Gaps = 3/330 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             MSS ++  LS    +A+L CQ +  +++LQVGFY  SC RAELIV++ V+     DRGVA
Sbjct  3     MSSKKLTQLSVICWVAVLFCQSV--QSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGVA  60

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGLVRMHFHDCFVRGC+GSVL+DST+SNTAEKDSPANNPSLRG+EV+D A+A+LE+ C+G
Sbjct  61    AGLVRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANNPSLRGYEVVDDARAKLEAECRG  120

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDS ++TGG  YDVPAGRRDG VSL +E  ++LPPP+ NV QLT  F+
Sbjct  121   VVSCADILAFAARDSFDLTGGISYDVPAGRRDGTVSLVAET-SDLPPPTLNVDQLTQNFA  179

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              KG +QEEMVTLSG HTIGRSHCTSF +RLY+F+ T  QDPSLD  YAA LKQ+CPQ ++
Sbjct  180   KKGLSQEEMVTLSGRHTIGRSHCTSFRDRLYNFSGTNSQDPSLDATYAASLKQKCPQAST  239

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             + NLVVPMD  +P I+DVSYY +ILANRGLFTSDQTLL++ +TA++V  N+ SP+ W  K
Sbjct  240   DTNLVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVNSNSRSPLGWKRK  299

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FAAAMVKMGQI VLTGN GEIRANCRV+NS
Sbjct  300   FAAAMVKMGQIEVLTGNTGEIRANCRVINS  329



>ref|XP_010103062.1| Peroxidase 5 [Morus notabilis]
 gb|EXB94711.1| Peroxidase 5 [Morus notabilis]
Length=332

 Score =   474 bits (1219),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 237/330 (72%), Positives = 272/330 (82%), Gaps = 14/330 (4%)
 Frame = -1

Query  1223  LSCYST--LALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             ++C ST  L +L+CQ +   +EL+VGFYS SC  AE IVKDEV+K  + D GVAAGLVR+
Sbjct  7     ITCLSTVLLVILSCQSV--HSELRVGFYSLSCPFAEYIVKDEVRKGLIKDPGVAAGLVRL  64

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCD SVLIDST SNTAEKDSPANNPSLRGFEVID+AKARLE++CKGVVSCAD
Sbjct  65    HFHDCFVRGCDASVLIDSTPSNTAEKDSPANNPSLRGFEVIDNAKARLEAVCKGVVSCAD  124

Query  869   ILAFAARDSVEM-------TGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLF  711
             I+AFAARDS E        TGG  YDVPAGRRDGR+SL+SE  +NLPPP+FNV QLT LF
Sbjct  125   IVAFAARDSTEFVRGTIFQTGGLIYDVPAGRRDGRISLSSET-SNLPPPTFNVDQLTQLF  183

Query  710   SNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGN  531
               KG TQEEMVTLSGAHTIGRSHC+SF++RLY+FN  + QDPS DP YA++LKQ+CPQG 
Sbjct  184   VKKGLTQEEMVTLSGAHTIGRSHCSSFSDRLYNFNGKSSQDPSWDPTYASRLKQQCPQG-  242

Query  530   SNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGL  351
              NAN VVPM+P SPAI+DV YY +ILANRGLFTSDQT L+  +TAN+V Q A  PI W  
Sbjct  243   -NANTVVPMNPSSPAISDVGYYVDILANRGLFTSDQTFLSTSATANQVNQYAKYPILWMS  301

Query  350   KFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             KFAAAMVKMGQ+ VLTG+AGEIRANCRV+N
Sbjct  302   KFAAAMVKMGQLDVLTGSAGEIRANCRVIN  331



>gb|KHG13653.1| Peroxidase 5 [Gossypium arboreum]
Length=329

 Score =   471 bits (1212),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/332 (67%), Positives = 272/332 (82%), Gaps = 6/332 (2%)
 Frame = -1

Query  1250  EMSSSRIRMLSCYSTLALLT-CQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRG  1074
             +M  S++ ++S   ++ L + C L    ++LQVGFY  +C   E IVK+EV KA + DRG
Sbjct  3     KMRPSKLSLVSVILSVLLFSQCVL----SQLQVGFYKDTCRLVEFIVKEEVVKAIIKDRG  58

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLC  894
             +AA L+RMHFHDCFVRGCD S+L+DST S+ AEKDS ANNPSLRG+EVID+AKARLE +C
Sbjct  59    LAAALMRMHFHDCFVRGCDASILLDSTPSSIAEKDSFANNPSLRGYEVIDNAKARLEVVC  118

Query  893   KGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNL  714
             KGVVSCADI+AFAARDS+EM GG GYDVPAGRRDGR SLASEI  NLPPP+FNV QLT +
Sbjct  119   KGVVSCADIVAFAARDSIEMAGGLGYDVPAGRRDGRTSLASEIIGNLPPPTFNVDQLTQM  178

Query  713   FSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG  534
             F+NKGFTQEEMVTLSG HT+GRSHC+SF++RLY+F+ T  QD SLDP YAA+LKQ+CPQG
Sbjct  179   FANKGFTQEEMVTLSGGHTLGRSHCSSFSDRLYNFSGTLKQDASLDPTYAAKLKQQCPQG  238

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
             +++ N+VVPM   +P+I D  YY +ILANRGLFTSD TLLT P+TAN+V +NA +PI W 
Sbjct  239   STDPNVVVPMTS-TPSIADAGYYIDILANRGLFTSDHTLLTSPATANQVAENAKNPIQWK  297

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
              KFAAAMVKMGQ+ VLTG+ GEIRANCRV+ S
Sbjct  298   AKFAAAMVKMGQLDVLTGSEGEIRANCRVIKS  329



>gb|KHN19575.1| Peroxidase 5 [Glycine soja]
Length=327

 Score =   470 bits (1209),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 263/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1223  LSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHF  1044
             L C +T  +L        +ELQVG+YS SC  AE IVKDEV+K    + G+AAGLVRMHF
Sbjct  6     LKCITTFFILYLFNQNAHSELQVGYYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHF  65

Query  1043  HDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADIL  864
             HDCF+RGCD SVL+DST  NTAEKDSPAN PSLRG+EVID+AKA+LE++C G+VSCADI+
Sbjct  66    HDCFIRGCDASVLLDSTPLNTAEKDSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIV  125

Query  863   AFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEE  684
             AFAARDSVE   G GYDVPAGRRDGR+SLAS+    LPPP+FNV QLT LF+ KG TQ+E
Sbjct  126   AFAARDSVEFARGLGYDVPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDE  185

Query  683   MVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPM  504
             MVTLSGAHTIGRSHC++F++RLY+F++T+ QDPSLDP YAA LK++CPQG++N NLVVPM
Sbjct  186   MVTLSGAHTIGRSHCSAFSSRLYNFSTTSSQDPSLDPSYAALLKRQCPQGSTNQNLVVPM  245

Query  503   DPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKM  324
             DP SP I DV YY +ILANRGLFTSDQTLLT+  TA++V+QNA  P  W  +FA AMVKM
Sbjct  246   DPSSPGIADVGYYVDILANRGLFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKM  305

Query  323   GQISVLTGNAGEIRANCRVVNS  258
             GQI VL GNAGEIR NCRVVNS
Sbjct  306   GQIIVLKGNAGEIRTNCRVVNS  327



>ref|XP_011003281.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=328

 Score =   470 bits (1209),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 271/330 (82%), Gaps = 3/330 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             MSS R+  LS    +A+L  Q +  +++LQVGFY  SC RAELIV++ V+     DRGVA
Sbjct  2     MSSKRLTQLSVVCWVAVLFFQSV--QSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGVA  59

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGLVRMHFHDCFVRGC+GSVL+DST+SNTAEKDSPAN+ SLRG+EV+D AKA+LE+ C+G
Sbjct  60    AGLVRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANSNSLRGYEVVDDAKAKLEAECRG  119

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDS ++TGG  YDVPAGRRDG VSLA+E  ++LPPP+ NV QLT  F+
Sbjct  120   VVSCADILAFAARDSFDLTGGISYDVPAGRRDGTVSLAAET-SDLPPPTLNVDQLTQNFA  178

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              KG +QEEMVTLSG HTIGRSHCTSF NRLY+F+    QDPSLD  YAA LKQ+CPQ ++
Sbjct  179   KKGLSQEEMVTLSGGHTIGRSHCTSFRNRLYNFSGANSQDPSLDATYAASLKQKCPQAST  238

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             + NLVVPMD  +P I+DVSYY +ILANRGLFTSDQTLL++ +TA++V+ N+ SP+ W  K
Sbjct  239   DPNLVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVKSNSRSPLGWKRK  298

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FAAAMVKMGQI VLTGN GEIRANCRV+NS
Sbjct  299   FAAAMVKMGQIEVLTGNTGEIRANCRVINS  328



>ref|XP_004502775.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   469 bits (1206),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 257/304 (85%), Gaps = 0/304 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++L+VGFYS SCG AELIVKDEV+K+F  + G+AAGLVRMHFHDCF+RGCD SVL+DST 
Sbjct  24    SQLEVGFYSYSCGMAELIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTP  83

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
             SNTAEKDSPAN PSLRGFEVID+AKA+LE++C G VSCADI+AFAARDSVE+ GG GYDV
Sbjct  84    SNTAEKDSPANKPSLRGFEVIDNAKAKLEAVCNGTVSCADIIAFAARDSVELAGGIGYDV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG++SLAS+   +LPPP+FNV QLT LF+ KG TQEEMVTLSGAHTIGR+HC++F
Sbjct  144   PAGRRDGKISLASDTRTDLPPPTFNVNQLTQLFAKKGLTQEEMVTLSGAHTIGRAHCSAF  203

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLY+F+ST  QDP+LD  Y   LK++CPQGN+N NL VPMDP SP   DV YY NIL 
Sbjct  204   SNRLYNFSSTLKQDPNLDSSYVPLLKRQCPQGNTNPNLAVPMDPSSPGTADVGYYINILE  263

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RGLFTSDQTLLT+  TA +V +NA +P  W  KFA AMVKMGQI VLTGNAGEIR NCR
Sbjct  264   DRGLFTSDQTLLTNTGTARQVNKNARNPYLWADKFADAMVKMGQIGVLTGNAGEIRTNCR  323

Query  269   VVNS  258
             +VNS
Sbjct  324   MVNS  327



>ref|NP_001241968.1| uncharacterized protein LOC100779031 precursor [Glycine max]
 gb|ACU20835.1| unknown [Glycine max]
Length=327

 Score =   468 bits (1205),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 263/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1223  LSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHF  1044
             L C +T  +L        +ELQVG+YS SC  AE IVKDEV+K    + G+AAGLVRMHF
Sbjct  6     LKCITTFFILYLFNQNAHSELQVGYYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHF  65

Query  1043  HDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADIL  864
             HDCF+RGCD SVL+DST  NTAEKDSPAN PSLRG+EVID+AKA+LE++C G+VSCADI+
Sbjct  66    HDCFIRGCDASVLLDSTPLNTAEKDSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIV  125

Query  863   AFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEE  684
             AFAARDSVE   G GY+VPAGRRDGR+SLAS+    LPPP+FNV QLT LF+ KG TQ+E
Sbjct  126   AFAARDSVEFARGLGYNVPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDE  185

Query  683   MVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPM  504
             MVTLSGAHTIGRSHC++F++RLY+F++T+ QDPSLDP YAA LK++CPQG++N NLVVPM
Sbjct  186   MVTLSGAHTIGRSHCSAFSSRLYNFSTTSSQDPSLDPSYAALLKRQCPQGSTNQNLVVPM  245

Query  503   DPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKM  324
             DP SP I DV YY +ILANRGLFTSDQTLLT+  TA++V+QNA  P  W  +FA AMVKM
Sbjct  246   DPSSPGIADVGYYVDILANRGLFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKM  305

Query  323   GQISVLTGNAGEIRANCRVVNS  258
             GQI VL GNAGEIR NCRVVNS
Sbjct  306   GQIIVLKGNAGEIRTNCRVVNS  327



>dbj|BAA77387.1| peroxidase 1 [Scutellaria baicalensis]
Length=322

 Score =   468 bits (1203),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 262/319 (82%), Gaps = 1/319 (0%)
 Frame = -1

Query  1214  YSTLALLTCQLIVL-KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             +  LA   C  IVL +A+LQ GFY  SCG AE IVK EV+ AF  D G+AAGL+R+HFHD
Sbjct  3     FKVLAAFFCYYIVLSEAQLQKGFYQLSCGFAETIVKQEVRNAFFRDSGIAAGLIRLHFHD  62

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCDGSVLIDST SNTAEKDSP NNPSLRGFEV+D+ K RLE  C GVVSCADILA+
Sbjct  63    CFVRGCDGSVLIDSTGSNTAEKDSPPNNPSLRGFEVVDAIKRRLEVSCPGVVSCADILAY  122

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARDSVE+T G GYDV AGRRDGRVSLASE  +NLPPPSFNV QLT  F+NKG +Q+EMV
Sbjct  123   AARDSVEITRGLGYDVLAGRRDGRVSLASEALSNLPPPSFNVDQLTRAFANKGLSQDEMV  182

Query  677   TLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDP  498
             TLSGAHT+GRSHCTSFNNRLY+F+++++QDP+LD  YA+QLKQ+CPQG++N NLVVPMDP
Sbjct  183   TLSGAHTLGRSHCTSFNNRLYNFSTSSMQDPTLDLAYASQLKQQCPQGSANPNLVVPMDP  242

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              +PA++DVSYY  +LANRGLFTSDQTLLT P T  +V QNA +   W  KFA AMV MG 
Sbjct  243   PTPAVSDVSYYRGVLANRGLFTSDQTLLTSPQTRAQVLQNAQNQFLWWRKFAGAMVSMGN  302

Query  317   ISVLTGNAGEIRANCRVVN  261
             I V+TG AGEIR +CRV+N
Sbjct  303   IGVITGGAGEIRRDCRVIN  321



>gb|AFK42142.1| unknown [Medicago truncatula]
Length=327

 Score =   467 bits (1202),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 255/304 (84%), Gaps = 0/304 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++L+VGFY+ SCG AE IVKDEV+K+F  + G+AAGLVRMHFHDCF+RGCD SVL+DST 
Sbjct  24    SQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTL  83

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
             SN AEKDSPAN PSLRGFEVID+AKA+LE   KG+VSCADI+AFAARDSVE+ GG GYDV
Sbjct  84    SNIAEKDSPANKPSLRGFEVIDNAKAKLEEERKGIVSCADIVAFAARDSVELAGGLGYDV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRD ++SLAS+    LPPP+FNV QLT LF+ KG TQ+EMVTLSG HTIGRSHC++F
Sbjct  144   PAGRRDEKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGVHTIGRSHCSAF  203

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             + RLY+F+ST++QDPSLDP YAA LK++CPQGN+N NLVVPMDP SP   D  YY +ILA
Sbjct  204   SKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADEGYYNDILA  263

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGLFTSDQT LT+  TA +V QNA +P  W  KFA AMVKMGQ+ VLTGNAGEIR NCR
Sbjct  264   NRGLFTSDQTFLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNCR  323

Query  269   VVNS  258
             VVNS
Sbjct  324   VVNS  327



>ref|XP_011003280.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=330

 Score =   464 bits (1195),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 228/332 (69%), Positives = 264/332 (80%), Gaps = 4/332 (1%)
 Frame = -1

Query  1247  MSSSRIRM--LSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRG  1074
             MSS ++    L C+  + L   Q +   ++L+VGFY  SC  AE IVK  V+  F  DRG
Sbjct  1     MSSKKLSQPCLVCWVVVFLFCTQSV--HSQLEVGFYRSSCKMAEFIVKGAVRDGFNKDRG  58

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLC  894
             VAAGLVRMHFHDCFV GCD SVL+DST SN AEKDS ANNPSLRGFEVID+AKARLE+ C
Sbjct  59    VAAGLVRMHFHDCFVGGCDASVLLDSTPSNKAEKDSTANNPSLRGFEVIDNAKARLETEC  118

Query  893   KGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNL  714
             KG VSCADILAFAARDS+E+TGGFGYDVPAGRRDG VSLASE+  NLP P FNV QLT  
Sbjct  119   KGTVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVSTNLPTPKFNVDQLTQN  178

Query  713   FSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG  534
             F+NKGF+QEEMVTLSG HTIGRSHCTSF  RLY+F+ TT QDP+LD  YA  LKQ CPQG
Sbjct  179   FANKGFSQEEMVTLSGGHTIGRSHCTSFRKRLYNFSGTTSQDPTLDATYATSLKQMCPQG  238

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
             +++ +LVVPM+P SPA TD  YY +ILANRGLFTSDQTLLT+ +TA +V  NA + + W 
Sbjct  239   STDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATATQVNINARNSMLWK  298

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
              KFAAAM+KMG++ VLTGNAGEIRA+CRV+NS
Sbjct  299   SKFAAAMLKMGKLDVLTGNAGEIRADCRVINS  330



>emb|CDP12791.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   477 bits (1227),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 231/337 (69%), Positives = 274/337 (81%), Gaps = 2/337 (1%)
 Frame = -1

Query  1265  KTNKSEMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFV  1086
             +  +S M+S+++  +     L +  C +I L A+LQVGFY+G C   E ++K+EV+ AF+
Sbjct  342   RRRRSIMASNKLSFILSTFILVVYQC-VIPLNAQLQVGFYNGVCDFVESMIKEEVRDAFI  400

Query  1085  CDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARL  906
              DRGVAAGLVRMHFHDCFVRGCDGSVLIDST SN AEKD+PANNPSLRGFEVID AK+RL
Sbjct  401   LDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTPSNQAEKDAPANNPSLRGFEVIDDAKSRL  460

Query  905   ESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQ  726
             E LC G+VSCADILA+AARDSVE+TGG GYDVPAGRRDGR+S + E   NLP P+  V Q
Sbjct  461   EFLCPGIVSCADILAYAARDSVEITGGPGYDVPAGRRDGRISSSREASANLPSPALGVNQ  520

Query  725   LTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQR  546
             L   F+NKG   +EMVTLSGAHTIGRSHC SF+NRL++FN+TT QDPS+DP YAAQL Q+
Sbjct  521   LIQAFANKGLRPDEMVTLSGAHTIGRSHCISFSNRLFNFNTTTTQDPSMDPSYAAQLAQQ  580

Query  545   CPQGN-SNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGS  369
             CPQG+ SN NLVVPMDP +P + D  YY NILANRGLFTSDQTLLT+PSTAN+V QNA +
Sbjct  581   CPQGSISNPNLVVPMDPSTPTVMDTCYYDNILANRGLFTSDQTLLTNPSTANQVIQNAQN  640

Query  368   PISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             P+ W  KFA AMV+MGQI VLTG+AGEIRANCRV+N+
Sbjct  641   PLLWENKFADAMVRMGQIGVLTGDAGEIRANCRVINN  677


 Score =   370 bits (949),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 230/305 (75%), Gaps = 5/305 (2%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             +KA+L VGFY+  C R E I+ +EV KAF+ D+G+A GLVR HFHDCFVRGCDGS+ IDS
Sbjct  18    IKAQLVVGFYNSRCPRTESIIGEEVLKAFLKDKGIAPGLVRAHFHDCFVRGCDGSLFIDS  77

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T +N AEKD P N  +LRG EV+D+AKARLE+ CKGVVSCADILA+AARDSV +TGG G+
Sbjct  78    TPTNVAEKDGPPNGITLRGLEVVDNAKARLEAECKGVVSCADILAYAARDSVVITGGRGW  137

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDGR+S A+E   ++P P  N+ Q+T  F+ K  T +EM+ LSGAHTIGRSHCT
Sbjct  138   GVPAGRRDGRISRAAETI-DIPGPFQNLDQITQAFAKKNMTLDEMIALSGAHTIGRSHCT  196

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC---PQGNSNANLVVPMDPFSPAITDVSYY  465
             SF+NRLY F+    QDPSLD   AA LK +C   PQG+ + NLVVPM+  SPA+ + SYY
Sbjct  197   SFSNRLYDFSPANSQDPSLDRFLAALLKIQCPQGPQGDVDPNLVVPMNR-SPALFENSYY  255

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
              +ILA+R + TSDQTL+T P + +EVR+ A +   W   FA AMVKM QI VLTG AGEI
Sbjct  256   RDILAHRVVLTSDQTLITSPESLSEVREYAFNEREWQEDFADAMVKMSQIEVLTGTAGEI  315

Query  284   RANCR  270
             R+NCR
Sbjct  316   RSNCR  320



>ref|XP_011043754.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=329

 Score =   463 bits (1191),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 267/330 (81%), Gaps = 2/330 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             +SS ++  +     +A+L C  +  ++ LQVGFY  SC RAE IV+  V+ A   DRGVA
Sbjct  2     VSSKKLTQMCVTFWVAVLFCPSV--QSHLQVGFYRNSCRRAESIVRGAVRDALRQDRGVA  59

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGLVR+HFHDCFVRGC+GSVL+DST+SN AEKDSPAN PSLRGFEVID AKARLE+ CKG
Sbjct  60    AGLVRLHFHDCFVRGCEGSVLLDSTSSNKAEKDSPANFPSLRGFEVIDDAKARLEAECKG  119

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDS ++TGG  YDVPAGRRDG VSLASE  +NLPPP+FNV QLT  FS
Sbjct  120   VVSCADILAFAARDSFDLTGGLDYDVPAGRRDGIVSLASETFSNLPPPNFNVDQLTRRFS  179

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
             +KG TQEEMVTLSGAHTIG SHC++F  RLY+F+ T  QDPSLD QYAA L++ CPQ ++
Sbjct  180   DKGLTQEEMVTLSGAHTIGTSHCSAFTYRLYNFSGTNSQDPSLDSQYAASLRKSCPQDST  239

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             + NL VPMD  +P I+DV+YY +ILANRGLF+SDQ LLT+P+TA+EV+ NA SP  W  K
Sbjct  240   DPNLEVPMDTRTPTISDVNYYKDILANRGLFSSDQILLTNPATASEVKSNARSPSGWKRK  299

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FAAAMVKMGQI VLTGN GEIRANCRV+N+
Sbjct  300   FAAAMVKMGQIEVLTGNKGEIRANCRVINT  329



>gb|AAF63024.1|AF244921_1 peroxidase prx12 precursor [Spinacia oleracea]
Length=331

 Score =   460 bits (1183),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 227/326 (70%), Positives = 262/326 (80%), Gaps = 3/326 (1%)
 Frame = -1

Query  1238  SRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGL  1059
             S +R L  +S L+ L+ QL   +A+LQVGFY  SC  AE IV++EV K F+ D+GVA GL
Sbjct  9     SSVRFLVLFSVLSCLSVQL---EAQLQVGFYCESCPSAERIVREEVMKGFMNDKGVAPGL  65

Query  1058  VRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVS  879
             VRMHFHDCFVRGCDGSVLIDST+SNTAEKDSPANNPSLRGFEVIDSAK RLE+ CKGVVS
Sbjct  66    VRMHFHDCFVRGCDGSVLIDSTSSNTAEKDSPANNPSLRGFEVIDSAKTRLEAECKGVVS  125

Query  878   CADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKG  699
             CADILAFAARDSV MT G  YDVP+GR+DGRVSL SE   N+P  +FNV +LT  F+NK 
Sbjct  126   CADILAFAARDSVAMTRGQRYDVPSGRKDGRVSLVSEGFQNIPGFTFNVTRLTQSFANKN  185

Query  698   FTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN  519
              TQEEMVTLSGAHTIGRSHCTS +NRLY+F+ T   DP+LD +YA QL+Q+CPQG++N+N
Sbjct  186   LTQEEMVTLSGAHTIGRSHCTSVSNRLYNFSGTNGADPTLDSKYAGQLQQQCPQGSTNSN  245

Query  518   LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAA  339
              VV MDP SP ITDV+YY ++LAN+GLF SDQTLLTD +TANEV QN  +   W  KFAA
Sbjct  246   QVVLMDPVSPFITDVNYYQDVLANKGLFRSDQTLLTDSNTANEVNQNGRNQFLWMRKFAA  305

Query  338   AMVKMGQISVLTGNAGEIRANCRVVN  261
             AMV MGQI VLTG  GEIR NC V+N
Sbjct  306   AMVNMGQIEVLTGTNGEIRTNCSVIN  331



>ref|XP_010671317.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010671319.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   453 bits (1165),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 218/312 (70%), Positives = 260/312 (83%), Gaps = 0/312 (0%)
 Frame = -1

Query  1196  LTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCD  1017
              +C  + L+A+L+VGFY  SC  AE IV++EV K F+ D+G+A GLVRMHFHDCFVRGCD
Sbjct  20    FSCLCVQLEAQLRVGFYCNSCPLAERIVREEVMKGFMNDKGIAPGLVRMHFHDCFVRGCD  79

Query  1016  GSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVE  837
             GSVLIDST+SNTAEKDSPAN+PSLRGFEVID+AK RLES CKGVVSCADILAFAARDSV 
Sbjct  80    GSVLIDSTSSNTAEKDSPANSPSLRGFEVIDNAKTRLESQCKGVVSCADILAFAARDSVA  139

Query  836   MTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHT  657
             +T G  Y+VP+GRRDGRVS  SE+  NLP  SFNV QLT  F+NK  TQEEMVTLSGAHT
Sbjct  140   ITRGQSYNVPSGRRDGRVSSESEVLQNLPGFSFNVDQLTQNFANKNLTQEEMVTLSGAHT  199

Query  656   IGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITD  477
             +GRSHCTS  +RLY+FN T   D +L+ +YA QL+Q+CP+G+++++LVV MDP +P +TD
Sbjct  200   LGRSHCTSVGSRLYNFNGTNGPDSTLESKYAGQLQQQCPEGSTDSSLVVSMDPQTPFVTD  259

Query  476   VSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGN  297
             V+YY ++LANRGLFTSDQTLL++ +TANEV QNA +   W  KFAAAMVKMGQI VLTGN
Sbjct  260   VNYYQDLLANRGLFTSDQTLLSNSNTANEVNQNARNQFLWMRKFAAAMVKMGQIEVLTGN  319

Query  296   AGEIRANCRVVN  261
             AGEIRANCRV+N
Sbjct  320   AGEIRANCRVIN  331



>ref|XP_010671316.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   451 bits (1160),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 249/305 (82%), Gaps = 0/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             LKA+LQ GFY  SC  AE IVKDEV++AF  DRG AAGLVR+HFHDCFVRGCD SVL+DS
Sbjct  30    LKADLQPGFYMQSCPMAEFIVKDEVRQAFFSDRGYAAGLVRLHFHDCFVRGCDASVLLDS  89

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  N AEKD+ ANNPSLRGF+VID+AKARLE+LC G VSCADILA+AARDSVEMTGGFGY
Sbjct  90    TPGNAAEKDAEANNPSLRGFDVIDNAKARLENLCPGTVSCADILAYAARDSVEMTGGFGY  149

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             DVP GRRDGRVS +SE   NLPPP  +V  LT +F +KG TQEEMV LSGAHTIGRSHCT
Sbjct  150   DVPGGRRDGRVSSSSEATRNLPPPFADVDLLTKIFGSKGLTQEEMVILSGAHTIGRSHCT  209

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+ RLYSF++T  QDPS++  YAAQL+++CP GN+ AN+VVPMDP SP I+D +YY NI
Sbjct  210   SFSKRLYSFSTTAAQDPSINSAYAAQLQRQCPAGNAGANIVVPMDPISPTISDTAYYRNI  269

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NRGLFTSDQ LL+D +TA+ V   A +P  WG KFA AM  MGQI VLTG+ GEIR+N
Sbjct  270   LNNRGLFTSDQALLSDSTTASLVTLYARNPGLWGRKFATAMGSMGQIGVLTGDEGEIRSN  329

Query  275   CRVVN  261
             CRV+N
Sbjct  330   CRVIN  334



>ref|XP_006846424.1| hypothetical protein AMTR_s00018p00028320 [Amborella trichopoda]
 gb|ERN08099.1| hypothetical protein AMTR_s00018p00028320 [Amborella trichopoda]
Length=325

 Score =   448 bits (1153),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 249/305 (82%), Gaps = 0/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
              +A+L+VGFYS  C  AE IVKD V+ A   D G+AA L+ M+FHDCFVRGCDGS+LIDS
Sbjct  21    FEAQLEVGFYSQRCSPAERIVKDAVRSAVSNDVGLAADLIHMYFHDCFVRGCDGSILIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
              ++NTAEKD  AN  SLR F V+DSAK++LE +CKGVVSCADILAFAARD+ EM GG G+
Sbjct  81    NSTNTAEKDFFANKISLRSFGVLDSAKSKLEDMCKGVVSCADILAFAARDAAEMVGGIGW  140

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             DVPAGRRDGR+SLASE   NLP P+F VPQLT LF +KG TQEEMVTLSGAHTIGRSHCT
Sbjct  141   DVPAGRRDGRISLASENLANLPAPTFTVPQLTQLFLSKGLTQEEMVTLSGAHTIGRSHCT  200

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRL++F+ST+ QDPSLDP+YA QLK +CP+GN+N NLVVPMDP SP + D +YY NI
Sbjct  201   SFSNRLFNFSSTSSQDPSLDPRYATQLKSKCPKGNTNTNLVVPMDPLSPTVLDNAYYKNI  260

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LANRGLFTSD  LL+DPST+++V + A +   W  KF AAMV+MGQI VLTGNAGEIR N
Sbjct  261   LANRGLFTSDHALLSDPSTSSQVSEYAANVFLWRTKFGAAMVRMGQIGVLTGNAGEIRRN  320

Query  275   CRVVN  261
             CR VN
Sbjct  321   CRAVN  325



>gb|AHL39170.1| class III peroxidase [Populus trichocarpa]
Length=323

 Score =   446 bits (1147),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 259/330 (78%), Gaps = 8/330 (2%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             +SS ++  L     +A+L CQ +  ++ LQVGFY  SCGRAE IV+         DRGVA
Sbjct  2     VSSKKLTQLCVTFWVAVLFCQSV--QSHLQVGFYRNSCGRAESIVRG------AGDRGVA  53

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGLVR+HFHDCFVR C   VL+DST+SN AEK S AN PSLRGFEVID AKARLE+ C+G
Sbjct  54    AGLVRLHFHDCFVRACVVLVLLDSTSSNKAEKHSTANYPSLRGFEVIDDAKARLEAECQG  113

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDS ++TGGF YDV AGRRDG VSLASE  +NLPPP+FNV QLT  FS
Sbjct  114   VVSCADILAFAARDSFDLTGGFDYDVQAGRRDGIVSLASETYSNLPPPTFNVDQLTQRFS  173

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
             +KG TQEEMVTLSGAHTIG SHC SF  RLY+F+ T  QDPSLD QYAA L++ CPQ ++
Sbjct  174   DKGLTQEEMVTLSGAHTIGNSHCRSFTYRLYNFSGTNSQDPSLDSQYAASLRKSCPQDST  233

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             + NL VPMD  +P I+DV+YY +ILANRGLF+SDQ LLT+P+TA+EV+ NA SP  W  K
Sbjct  234   DPNLEVPMDTRTPTISDVNYYKDILANRGLFSSDQILLTNPATASEVKSNARSPSGWKKK  293

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FAAAMVKMGQI VLTGN GEIRANCRV+NS
Sbjct  294   FAAAMVKMGQIEVLTGNKGEIRANCRVINS  323



>ref|XP_010919027.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   445 bits (1144),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 252/305 (83%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L+A+LQVGFY  +C +AE+IVK +V +A   + G+AAGLVRMHFHDCFVRGCDGSVLIDS
Sbjct  21    LEAQLQVGFYDTTCPQAEIIVKTQVTQALASNIGLAAGLVRMHFHDCFVRGCDGSVLIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T++NTAEKDS  N  SLRGFEVI SAKA+LE+ C+GVVSCADILAFAARDS+ +TGG  Y
Sbjct  81    TSTNTAEKDSSINK-SLRGFEVIYSAKAQLEATCEGVVSCADILAFAARDSIALTGGLSY  139

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDG VSLASE   NLP P+FNV Q+T  F  KG TQ++MVTLSGAHTIGRSHC+
Sbjct  140   QVPAGRRDGTVSLASETFTNLPGPNFNVDQVTQSFEVKGLTQDQMVTLSGAHTIGRSHCS  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRLY F++ T QDPSLD  YAAQLKQ+CPQG+++ NLVVPMDP +P I D SYY +I
Sbjct  200   SFSNRLYDFSTNTKQDPSLDATYAAQLKQQCPQGSTDPNLVVPMDPPTPNIVDTSYYNDI  259

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NRGLFTSDQTLL++ +TA+ VRQNA + + W  KFAAAMV MGQI VLTGN GEIR N
Sbjct  260   LGNRGLFTSDQTLLSEAATASLVRQNAANSLLWQNKFAAAMVAMGQIGVLTGNNGEIRLN  319

Query  275   CRVVN  261
             CRV+N
Sbjct  320   CRVIN  324



>ref|XP_008808268.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   445 bits (1144),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 250/305 (82%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L+A+L+VGFY  +C +AE IVK +V KA   + G+AAGLVRMHFHDCFVRGCDGSVLIDS
Sbjct  21    LEAQLKVGFYGTTCPQAEPIVKLQVTKALASNIGLAAGLVRMHFHDCFVRGCDGSVLIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T++NTAEKDS  N  SLRGFEVIDSAKA+LE+ C GVVSCADILAFAARDS+ MTGG  Y
Sbjct  81    TSTNTAEKDSSINT-SLRGFEVIDSAKAQLEATCNGVVSCADILAFAARDSIAMTGGISY  139

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDGRVSLAS+   NLP PS NV QLT  F  KG TQ++MVTLSGAHTIGRSHC+
Sbjct  140   QVPAGRRDGRVSLASDTFANLPAPSSNVDQLTQSFQVKGLTQDQMVTLSGAHTIGRSHCS  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRLY+FN+T  QDPSLD  YAAQLKQ+CPQG++N NLVVPMDP SP I D SYY +I
Sbjct  200   SFSNRLYNFNTTVKQDPSLDATYAAQLKQQCPQGSTNPNLVVPMDPPSPNIVDTSYYNDI  259

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NRGLFTSDQTLL++ +TA+ V QNA + + W  KFAAAMV MGQ+ VLTG+ GEIR N
Sbjct  260   LVNRGLFTSDQTLLSEAATASHVTQNAANSLLWQNKFAAAMVAMGQVGVLTGSNGEIRLN  319

Query  275   CRVVN  261
             CR +N
Sbjct  320   CRAIN  324



>ref|XP_008808296.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   445 bits (1144),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 250/305 (82%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L+A+L+VGFY  +C +AELIVK  V KA   + G+AAGLVR+HFHDCFVRGCDGSVLIDS
Sbjct  21    LEAQLEVGFYDATCPQAELIVKLLVTKAVASNIGLAAGLVRLHFHDCFVRGCDGSVLIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T++NTAEKDS  N  SLRGFEVIDSAKA LE+ C GVVSCADILAFAARDS+ +TGG  Y
Sbjct  81    TSTNTAEKDSSINT-SLRGFEVIDSAKALLEATCNGVVSCADILAFAARDSIALTGGISY  139

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDGRVSLAS+   NLP PSFNV QLT  F  KG TQ++MVTLSGAHTIGRSHC+
Sbjct  140   QVPAGRRDGRVSLASDTFANLPAPSFNVDQLTQSFQAKGLTQDQMVTLSGAHTIGRSHCS  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRLY+FN+T  QDPSLD  YAAQLK++CPQG++N+NLVVPMDP SP I D +YY +I
Sbjct  200   SFSNRLYNFNTTVKQDPSLDATYAAQLKKQCPQGSTNSNLVVPMDPPSPNIVDTNYYNDI  259

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NRGLFTSDQTLL+  +TA+ V+QNA + + W  KFA AMV MGQ+ VLTG+ GEIR N
Sbjct  260   LVNRGLFTSDQTLLSKATTASHVKQNAANSLLWQNKFATAMVAMGQVGVLTGSNGEIRLN  319

Query  275   CRVVN  261
             CR +N
Sbjct  320   CRAIN  324



>ref|XP_010919026.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   444 bits (1142),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 249/305 (82%), Gaps = 1/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L+A+LQVGFY   C +AELIVK +V  A + + G+AAGLVRMHFHDCF+RGCDGSVLIDS
Sbjct  21    LEAQLQVGFYDSICPQAELIVKTQVTVALLSNIGLAAGLVRMHFHDCFIRGCDGSVLIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T++NTAEKDS  N  SLRGF+VIDSAKA LE+ C G+VSCADILA AARDS+E+TGG  Y
Sbjct  81    TSTNTAEKDSSINK-SLRGFDVIDSAKALLEATCPGMVSCADILAIAARDSIELTGGLSY  139

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             +VPAGRRDG VSLASE   NLP P FNV QLT  F  KG TQE+MVTLSGAHTIGRSHC+
Sbjct  140   EVPAGRRDGTVSLASETFTNLPGPGFNVDQLTQSFKVKGLTQEQMVTLSGAHTIGRSHCS  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRLY+F++T  +DPSLD  YAAQL Q CPQG+++ NLVVPMDP SP I D  YY+NI
Sbjct  200   SFSNRLYNFSTTVKEDPSLDATYAAQLMQECPQGSTDPNLVVPMDPSSPNIVDTGYYSNI  259

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LANRGLFTSDQTLL+  +TA +VRQNA + + W  KFAAAMV MGQI VLTG+ GEIR N
Sbjct  260   LANRGLFTSDQTLLSQVATAGQVRQNAANSMLWQNKFAAAMVAMGQIGVLTGSNGEIRRN  319

Query  275   CRVVN  261
             CRVVN
Sbjct  320   CRVVN  324



>ref|XP_003602406.1| Peroxidase [Medicago truncatula]
 gb|AES72657.1| peroxidase family protein [Medicago truncatula]
Length=316

 Score =   444 bits (1141),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 214/304 (70%), Positives = 249/304 (82%), Gaps = 11/304 (4%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++L+VGFY+ SCG AE IVKDEV+K+F  + G+AAGL           GCD SVL+DST 
Sbjct  24    SQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGL-----------GCDASVLLDSTL  72

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
             SN AEKDSPAN PSLRGFEVID+AKA+LE  CKG+VSCADI+AFAARDSVE+ GG GYDV
Sbjct  73    SNIAEKDSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYDV  132

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG++SLAS+    LPPP+FNV QLT LF+ KG TQ+EMVTLSGAHTIGRSHC++F
Sbjct  133   PAGRRDGKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSAF  192

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             + RLY+F+ST++QDPSLDP YAA LK++CPQGN+N NLVVPMDP SP   DV YY +ILA
Sbjct  193   SKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDILA  252

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGLFTSDQTLLT+  TA +V QNA +P  W  KFA AMVKMGQ+ VLTGNAGEIR NCR
Sbjct  253   NRGLFTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNCR  312

Query  269   VVNS  258
             VVNS
Sbjct  313   VVNS  316



>ref|XP_011043751.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=329

 Score =   443 bits (1139),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 258/330 (78%), Gaps = 2/330 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             +SS ++  +     +A+L C  +  ++ LQVGFY  SC RAE IV+  V+ A   DRGVA
Sbjct  2     VSSKKLTQMCVTFWVAVLFCPSV--QSHLQVGFYRNSCRRAESIVRRAVRHAIHQDRGVA  59

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGL+RMHFHDCFVRGC+GSVL+DST SN AEKDSP N PSL GFEVID AKA+LE+ C+G
Sbjct  60    AGLIRMHFHDCFVRGCEGSVLLDSTPSNKAEKDSPVNFPSLHGFEVIDDAKAKLEAECQG  119

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDS ++TGG  YDVPAGRRDG VSLASE  +NLPPP+FNV QLT  FS
Sbjct  120   VVSCADILAFAARDSFDLTGGLDYDVPAGRRDGIVSLASETFSNLPPPNFNVDQLTRRFS  179

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
             +KG TQEEMVTLSGAHTIG S C SF +RLY+F+ T   DPSLD +YAA L++ CPQ ++
Sbjct  180   DKGLTQEEMVTLSGAHTIGDSLCKSFTDRLYNFSGTNSPDPSLDSRYAASLRKSCPQDST  239

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
             + N  VPMD  +P I+DV+YY +ILANRGLFTSDQTLLT+ +TA EV+ NA S   W  K
Sbjct  240   DPNFEVPMDTRTPTISDVNYYKDILANRGLFTSDQTLLTNIATAREVKSNARSSSRWKRK  299

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             FAAAMVKMGQI VLTGN GEIR NCRV+NS
Sbjct  300   FAAAMVKMGQIEVLTGNKGEIRENCRVINS  329



>ref|XP_010671321.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 257/324 (79%), Gaps = 3/324 (1%)
 Frame = -1

Query  1232  IRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             I  L  +  L+ L+ Q+I  +A+L+VGFYS SC  AE IV++EV K F  +RGVA GL+R
Sbjct  7     IHSLILFFALSCLSVQII--EAQLRVGFYSRSCPSAERIVREEVMKGFNKNRGVAPGLIR  64

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHDCFVRGCD S+LID+T+SN AEKDSPAN+PSLRGFEVID+AKARLE+ CKGVVSCA
Sbjct  65    MHFHDCFVRGCDASILIDTTSSNNAEKDSPANSPSLRGFEVIDNAKARLEAQCKGVVSCA  124

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DIL FAARDSV +T G  Y V AGRRDGR+SL SE+  ++P  +FNV QLT  F  K  T
Sbjct  125   DILTFAARDSVAITLGPRYAVQAGRRDGRISLMSEVLQDVPGFTFNVDQLTQSFLKKKLT  184

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
             QEEMVTLSGAHTIGRSHCTS  NRLY+FN TT  DP+LD +YA +L+Q+CPQG S + LV
Sbjct  185   QEEMVTLSGAHTIGRSHCTSITNRLYNFNGTTGPDPTLDSRYAGRLQQQCPQG-SASTLV  243

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             VPMD  +P ITDV+YY ++LANRGLFTSDQTLLT+ +TA EV QNA +   W  KFAAAM
Sbjct  244   VPMDTRTPFITDVNYYRDVLANRGLFTSDQTLLTNSNTAKEVSQNARNQFLWMRKFAAAM  303

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             +KMG+I VLTG+AGEIR NC V+N
Sbjct  304   IKMGEIEVLTGSAGEIRTNCSVIN  327



>ref|XP_009400935.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=329

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 250/312 (80%), Gaps = 2/312 (1%)
 Frame = -1

Query  1190  CQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGS  1011
             C   VL+A+LQVGFY  +C +AE I+  EV++A   + G+AAGLVRMHFHDCFVRGCDGS
Sbjct  18    CYSSVLEAQLQVGFYKSTCPQAESIIASEVRRALSSNIGLAAGLVRMHFHDCFVRGCDGS  77

Query  1010  VLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMT  831
             VLIDS+++NTAEKDS  NNPSLRGFEVID+AK RLE+ C+GVVSCADILA AARDSV MT
Sbjct  78    VLIDSSSNNTAEKDSFINNPSLRGFEVIDNAKTRLEAACQGVVSCADILALAARDSVVMT  137

Query  830   GGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIG  651
             GG  Y VPAGRRDGRVSL SE+  +LP P+F+V QLT  F++KG TQ+EMVTLSGAHTIG
Sbjct  138   GGVMYQVPAGRRDGRVSLVSEVLASLPGPTFDVDQLTRSFTSKGLTQDEMVTLSGAHTIG  197

Query  650   RSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVS  471
             RSHC +F++RL+ FNST   DPSLD  YA+QLKQ+CPQG+++ +LV  MDP SP   D +
Sbjct  198   RSHCAAFSSRLFDFNSTDGHDPSLDSAYASQLKQQCPQGSNDTSLVAFMDPRSPYTLDTA  257

Query  470   YYTNILANRGLFTSDQTLLTDPSTANEVRQN--AGSPISWGLKFAAAMVKMGQISVLTGN  297
             YY N+L NRGLF SDQ L TD +TA  V+QN  AG  I+W  KFAAAMVKMGQI VLTG+
Sbjct  258   YYANLLQNRGLFASDQALATDSTTAGLVKQNAAAGGGIAWKRKFAAAMVKMGQIDVLTGS  317

Query  296   AGEIRANCRVVN  261
              GEIR+ CRV+N
Sbjct  318   DGEIRSRCRVIN  329



>ref|XP_006446429.1| hypothetical protein CICLE_v10017508mg [Citrus clementina]
 gb|ESR59669.1| hypothetical protein CICLE_v10017508mg [Citrus clementina]
Length=340

 Score =   430 bits (1105),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 244/315 (77%), Gaps = 25/315 (8%)
 Frame = -1

Query  1205  LALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVR  1026
             + +L C ++   ++LQVGFY  SC  AELIVKDEV+K+ + D+GVAAGLVRMHFHDCFVR
Sbjct  51    IVVLLCTIV--NSQLQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVR  108

Query  1025  GCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARD  846
             GCD SVLIDST+SNTAEKDSP NNPSLRGFEVID+AKA LES+CKG+VSCADI+AFAARD
Sbjct  109   GCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARD  168

Query  845   SVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSG  666
             SVE++GG GYDVP+GRRDGR+SLASE       P  +                       
Sbjct  169   SVEISGGLGYDVPSGRRDGRISLASEALTQSTSPYIH-----------------------  205

Query  665   AHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPA  486
             +HTIGRSHCTSF+NRLY+F+ T  QDPSL+P YAAQLKQ+CPQ  +N NLVVPM+P SP+
Sbjct  206   SHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCPQDGTNPNLVVPMNPGSPS  265

Query  485   ITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVL  306
             I D  YY +IL NRGLFTSDQTLL+DP TA++V QNA +P  W   FAAAMVKMGQI VL
Sbjct  266   IADTGYYIDILRNRGLFTSDQTLLSDPETASQVNQNAKTPKLWKTNFAAAMVKMGQIGVL  325

Query  305   TGNAGEIRANCRVVN  261
             T +AGEIRANCRVVN
Sbjct  326   TASAGEIRANCRVVN  340



>ref|XP_008808270.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=332

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/302 (67%), Positives = 243/302 (80%), Gaps = 0/302 (0%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             EL +G+Y  +C +AE IV DEV+KA   D G+AA LVRMHFHDCFVRGCDGS+LIDST +
Sbjct  28    ELHMGYYGKTCPQAEFIVLDEVKKAVAGDAGLAADLVRMHFHDCFVRGCDGSILIDSTPN  87

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKD+P NNPSL GFE+ID+AK RLE+ CKG+VSCADI+AFAARD+V +TGG  Y+VP
Sbjct  88    NMAEKDAPPNNPSLEGFEIIDNAKKRLEAECKGMVSCADIVAFAARDAVVLTGGLFYEVP  147

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             AGRRDGRVS+A+E   NLPPPSF++ QLT  F+ KG +Q+EM+ LSGAHTIG+SHC+SF+
Sbjct  148   AGRRDGRVSIANEALTNLPPPSFDLNQLTQSFAQKGLSQDEMIILSGAHTIGQSHCSSFS  207

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILAN  447
             +RLY+FNS   QDPSLDP YAAQLKQ CP  +S AN  VPMDP SP+  D SYY+N+L N
Sbjct  208   SRLYNFNSAFSQDPSLDPAYAAQLKQECPNTSSGANQEVPMDPKSPSTFDTSYYSNLLVN  267

Query  446   RGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRV  267
             RGLFTSDQTL++ P+TA +V QNA   + +  KF  AM KMG+I VLTG+ GEIR NCRV
Sbjct  268   RGLFTSDQTLMSTPATAAKVWQNAADWLGFQKKFGQAMRKMGKIGVLTGSEGEIRCNCRV  327

Query  266   VN  261
             VN
Sbjct  328   VN  329



>ref|XP_008808267.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=313

 Score =   424 bits (1089),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 243/305 (80%), Gaps = 0/305 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L+A+L +G+Y  +C +AE +V DEV+KA   + G AA LVRMHFHDCFVRGCDGS+LIDS
Sbjct  6     LEAQLHMGYYDKTCPQAEFVVMDEVKKAVAGNIGFAAALVRMHFHDCFVRGCDGSILIDS  65

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T +N AEKD+P NNPS+ GFE+ID+AK RLE+ CK  VSCADILAFAARD+V +TGGF Y
Sbjct  66    TPNNMAEKDAPPNNPSMVGFEIIDNAKKRLEAECKRTVSCADILAFAARDAVVLTGGFFY  125

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              V AGRRDG+VS+A+E   NLPPPSF++ QLT  F+ KG +Q+EM+ LSGAHTIGRSHC+
Sbjct  126   KVLAGRRDGKVSIANETLTNLPPPSFDLNQLTQSFAQKGLSQDEMIFLSGAHTIGRSHCS  185

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF+NRL +FNST  QDPSLDP YA QLKQ CP  +S AN VVPMDP SP   D SYY+NI
Sbjct  186   SFSNRLDNFNSTFSQDPSLDPAYAGQLKQECPNTSSGANQVVPMDPNSPNTFDTSYYSNI  245

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LANRGLFTSDQTL++ P+TA +VRQNA   + +  KF  AM KMG+I VLTG+ GEIR N
Sbjct  246   LANRGLFTSDQTLMSTPATAAKVRQNAADWLGFQKKFGKAMRKMGKIGVLTGSEGEIRCN  305

Query  275   CRVVN  261
             CRVVN
Sbjct  306   CRVVN  310



>gb|EPS60748.1| hypothetical protein M569_14053, partial [Genlisea aurea]
Length=318

 Score =   422 bits (1086),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 240/304 (79%), Gaps = 1/304 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A+L V FY   C  A  I+++EV  AF  DRG+AAGLVRMHFHDCFVRGCDGSVLIDST 
Sbjct  16    AQLTVNFYDSVCPNARFIIREEVSNAFNRDRGLAAGLVRMHFHDCFVRGCDGSVLIDSTP  75

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
             SN AEKD+P NNPSLRGFEVID+AK R+E+ C GVVSCADILAFAARDSVE+TGG+ ++V
Sbjct  76    SNKAEKDAPPNNPSLRGFEVIDAAKRRIEAACPGVVSCADILAFAARDSVEITGGYRFEV  135

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGRVSLASE+  N+P P+F++ QLT  F NKG TQEEMVTLSGAHTIGRSHCT+ 
Sbjct  136   PAGRRDGRVSLASEVLTNIPAPTFDLNQLTQSFQNKGLTQEEMVTLSGAHTIGRSHCTTI  195

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
              +RLY+F+ST   DPSLDP YA +LKQRCP  N  A+LV+PMDP +P  TDV YY  ++ 
Sbjct  196   TDRLYNFSSTASTDPSLDPAYANELKQRCPP-NPAADLVLPMDPVTPDRTDVEYYREVIR  254

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGLF SD  LLT  +T ++V  N   P +W  KF+ AMVK+GQ  VLTG+AGEIR NCR
Sbjct  255   NRGLFQSDAALLTSTNTRDQVVLNVRDPNAWFTKFSDAMVKLGQTGVLTGSAGEIRRNCR  314

Query  269   VVNS  258
             V+NS
Sbjct  315   VINS  318



>ref|XP_002317837.2| hypothetical protein POPTR_0012s00700g, partial [Populus trichocarpa]
 gb|EEE96057.2| hypothetical protein POPTR_0012s00700g, partial [Populus trichocarpa]
Length=274

 Score =   406 bits (1043),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 199/274 (73%), Positives = 227/274 (83%), Gaps = 1/274 (0%)
 Frame = -1

Query  1076  GVAAGLVRMHFHDCFVRGCDGSVL-IDSTASNTAEKDSPANNPSLRGFEVIDSAKARLES  900
             GVAAGLVR+HFHDCFVR C  + L +DST+SN AEK S AN PSLRGFEVID AKARLE+
Sbjct  1     GVAAGLVRLHFHDCFVRVCACAWLRLDSTSSNKAEKHSTANYPSLRGFEVIDDAKARLEA  60

Query  899   LCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLT  720
              C+GVVSCADILAFAARDS ++TGGF YDV AGRRDG VSLASE  +NLPPP+FNV QLT
Sbjct  61    ECQGVVSCADILAFAARDSFDLTGGFDYDVQAGRRDGIVSLASETYSNLPPPTFNVDQLT  120

Query  719   NLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP  540
               FS+KG TQEEMVTLSGAHTIG SHC SF  RLY+F+ T  QDPSLD QYAA L++ CP
Sbjct  121   QRFSDKGLTQEEMVTLSGAHTIGNSHCRSFTYRLYNFSGTNSQDPSLDSQYAASLRKSCP  180

Query  539   QGNSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPIS  360
             Q +++ NL VPMD  +P I+DV+YY +ILANRGLF+SDQ LLT+P+TA+EV+ NA SP  
Sbjct  181   QDSTDPNLEVPMDTRTPTISDVNYYKDILANRGLFSSDQILLTNPATASEVKSNARSPSG  240

Query  359   WGLKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             W  KFAAAMVKMGQI VLTGN GEIRANCRV+NS
Sbjct  241   WKKKFAAAMVKMGQIEVLTGNKGEIRANCRVINS  274



>gb|EPS67213.1| hypothetical protein M569_07559 [Genlisea aurea]
Length=790

 Score =   418 bits (1075),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 199/302 (66%), Positives = 238/302 (79%), Gaps = 1/302 (0%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L VGFY G+C  A+ I+ +EV  AF  D G+AAGL+RMHFHDCFVRGCDGS+LIDST S
Sbjct  489   QLSVGFYDGTCPSAQYIISEEVANAFYGDPGLAAGLLRMHFHDCFVRGCDGSILIDSTQS  548

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKD+P NNPSLRGF+VIDSAK+R+E+ C G+VSCADILAFAARDSV++TGG  Y+VP
Sbjct  549   NKAEKDAPPNNPSLRGFQVIDSAKSRIENDCPGIVSCADILAFAARDSVDITGGLWYEVP  608

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             AGRRDGRVSL SE+  N+P P+FN+ QLT  F++KG TQ+EMVTLSGAHTIGRSHCTS  
Sbjct  609   AGRRDGRVSLLSEVVANIPAPTFNLAQLTQSFASKGLTQQEMVTLSGAHTIGRSHCTSIT  668

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILAN  447
              RLY+F++T  QDP+LD  YA QLK+ CPQ N   NLV+PMDP +P  TDV YY  +L N
Sbjct  669   TRLYNFSTTQSQDPNLDSAYATQLKKECPQ-NPGPNLVLPMDPVTPDRTDVEYYREVLGN  727

Query  446   RGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRV  267
             +GLF SDQ L T  ST +EV +N  +   W  KFAAAMVK+G + VLTG+AGEIR NCR 
Sbjct  728   KGLFASDQALATSGSTRDEVVRNVANEEGWRNKFAAAMVKLGGVGVLTGDAGEIRINCRA  787

Query  266   VN  261
             VN
Sbjct  788   VN  789



>ref|XP_004985933.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=316

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 229/304 (75%), Gaps = 3/304 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             LQ  FY  +C +AE IV+ EV +    D G AAGLVRMHFHDCFVRGCD S+L++ST  N
Sbjct  13    LQPNFYGATCPQAETIVRQEVIRWLHSDMGFAAGLVRMHFHDCFVRGCDASILLESTPDN  72

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             TAE+DSP NNPSLRGFEVIDSAKARLE  C GVVSCADILAFAARDSV ++GG  YDVP 
Sbjct  73    TAERDSPVNNPSLRGFEVIDSAKARLEDACPGVVSCADILAFAARDSVALSGGPRYDVPG  132

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG +S+ASE+ +N+P P+FN+ QLT  F+ KG TQEEMVTLSGAHTIGR+HCT+F++
Sbjct  133   GRRDGTLSMASEVADNIPAPTFNLDQLTQSFAAKGLTQEEMVTLSGAHTIGRAHCTAFSD  192

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCP---QGNSNANLVVPMDPFSPAITDVSYYTNIL  453
             RLY+F++T V DP+LDP + AQL+  CP    G  +  LVVPM+P +P   D  YY  +L
Sbjct  193   RLYNFSATGVADPTLDPPFLAQLQHACPAAGDGGVDPGLVVPMEPRTPHALDTLYYWGVL  252

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
              NRGLF SDQ LL    TA +VRQ+A     W LKFAAAMVKMGQI VLTG  G+IRA C
Sbjct  253   RNRGLFASDQALLASAPTAAQVRQSAYGGYPWKLKFAAAMVKMGQIQVLTGGGGQIRAKC  312

Query  272   RVVN  261
               VN
Sbjct  313   SAVN  316



>ref|XP_006840300.1| hypothetical protein AMTR_s00045p00066730 [Amborella trichopoda]
 gb|ERN01975.1| hypothetical protein AMTR_s00045p00066730 [Amborella trichopoda]
Length=349

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/327 (61%), Positives = 240/327 (73%), Gaps = 4/327 (1%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIV---LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLV  1056
             M   + TL LL   +I+   +   L+VGFY+ +C +AE ++ D V  A   + G+AAGL+
Sbjct  1     MSPSFRTLCLLLVGVIIPVLVNGALEVGFYNETCPQAEQLIFDAVSTAVTANPGIAAGLI  60

Query  1055  RMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             RM+FHDCFVRGCDGSVL+DSTA N AEKDSP NNPSLRGFEVID AKA +E++C   VSC
Sbjct  61    RMYFHDCFVRGCDGSVLLDSTADNQAEKDSPVNNPSLRGFEVIDEAKAAIETVCPNTVSC  120

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             AD+LAFAARDS  +TGG  Y +PAGRRDG VS+A+E  +NLPPPSFNV QL + F+ K  
Sbjct  121   ADVLAFAARDSTSLTGGLNYTLPAGRRDGNVSIANETFSNLPPPSFNVTQLVDNFAIKNL  180

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP-QGNSNAN  519
             T EEMVTLSG HTIGRSHCTSF +RLY+F+ST+  DP+LD  YAA L+  CP   ++N  
Sbjct  181   TLEEMVTLSGGHTIGRSHCTSFVSRLYNFSSTSQVDPTLDADYAATLQSLCPFNASTNNE  240

Query  518   LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAA  339
               VPMD F+P   DV+YY  +  N GLFTSDQTLLT+ ST+  V +N GSP  W  +FAA
Sbjct  241   TTVPMDVFTPDDLDVNYYVGVTQNFGLFTSDQTLLTNDSTSALVEENIGSPDVWQARFAA  300

Query  338   AMVKMGQISVLTGNAGEIRANCRVVNS  258
             AM+KMG I VLTG  GEIR NCRVVNS
Sbjct  301   AMIKMGDIEVLTGTDGEIRTNCRVVNS  327



>ref|XP_006650985.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=336

 Score =   399 bits (1024),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 190/304 (63%), Positives = 234/304 (77%), Gaps = 3/304 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+ GFY+ +C +AE IV+ EV +A   + G+AAGLVRMHFHDCFVRGCDGSVL++ST  +
Sbjct  33    LRPGFYAATCPQAETIVRQEVARALYANAGLAAGLVRMHFHDCFVRGCDGSVLLESTPDS  92

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AE+DSP NNPSLRGFEVIDSAK RLE+ C GVVSCAD+LA+AARDSV +TGG  YDVP 
Sbjct  93    AAERDSPINNPSLRGFEVIDSAKVRLEAACPGVVSCADVLAYAARDSVALTGGPRYDVPG  152

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG VSL SE+ +N+P P+F + +LT  F+ KG TQEEMVTLSGAHTIGR+HCTSF++
Sbjct  153   GRRDGTVSLESEVADNIPAPTFTLDELTRSFAAKGLTQEEMVTLSGAHTIGRAHCTSFSD  212

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS---NANLVVPMDPFSPAITDVSYYTNIL  453
             RLY+F++    DPS+ P + +QL++ CP G     +ANL VPM+P +P   D  YY  +L
Sbjct  213   RLYNFSAMGAADPSVAPAFLSQLRRACPAGPDGAVDANLAVPMEPRTPNGFDALYYWAVL  272

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
              NRGLFTSDQ LL+ P TA +VRQ+A     W LKFAAAMVKMGQ+ VLTG++GEIR  C
Sbjct  273   RNRGLFTSDQALLSSPPTAAQVRQSAYGGYPWKLKFAAAMVKMGQVEVLTGSSGEIRTKC  332

Query  272   RVVN  261
               VN
Sbjct  333   AAVN  336



>ref|XP_006840299.1| hypothetical protein AMTR_s00045p00065690 [Amborella trichopoda]
 gb|ERN01974.1| hypothetical protein AMTR_s00045p00065690 [Amborella trichopoda]
Length=348

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 236/323 (73%), Gaps = 4/323 (1%)
 Frame = -1

Query  1214  YSTLALLTCQLIV---LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHF  1044
             + TL L    +I    +K +L++GFY  +C  AEL+V D V +A   + G+AAGL+RM F
Sbjct  5     FRTLCLFLIVVIAPAAVKCDLEIGFYDQTCQGAELLVFDAVARAVNANPGIAAGLIRMFF  64

Query  1043  HDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADIL  864
             HDCFVRGCDGSVLIDSTA N+AEKDSP NNPSLRGFEVID AKA +E++C   VSCAD+L
Sbjct  65    HDCFVRGCDGSVLIDSTAGNSAEKDSPINNPSLRGFEVIDKAKAAIEAVCPKTVSCADVL  124

Query  863   AFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEE  684
             AFAARDS  +TGG  + VPAGRRDGR+S+ASE   NLPPP+FN  QL   F+ K  T EE
Sbjct  125   AFAARDSTALTGGLNFPVPAGRRDGRISIASETFTNLPPPTFNATQLEQSFARKNLTLEE  184

Query  683   MVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL-VVP  507
             MVTLSGAH+IGRSHC+SF  RLY+F+ST   DP+LDP YA  L+ +CP   S  N+ VVP
Sbjct  185   MVTLSGAHSIGRSHCSSFVRRLYNFSSTNQVDPTLDPGYATFLQSQCPFNASTNNVTVVP  244

Query  506   MDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVK  327
             MD F+P   DV YY  +  + GLFTSDQTLLT+ ST   V +N  +P  W ++FA AM+K
Sbjct  245   MDVFTPNDLDVGYYVGLTQHFGLFTSDQTLLTNSSTRPFVEENIVNPGVWAIRFAKAMIK  304

Query  326   MGQISVLTGNAGEIRANCRVVNS  258
             MG+I VLTG  GEIR NCRV+NS
Sbjct  305   MGKIEVLTGTTGEIRTNCRVINS  327



>gb|AAM52320.1|AC105363_9 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69277.1| TPA: class III peroxidase 35 precursor [Oryza sativa Japonica 
Group]
 gb|EAZ25397.1| hypothetical protein OsJ_09215 [Oryza sativa Japonica Group]
Length=319

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/305 (62%), Positives = 227/305 (74%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L   FY+ +C +AE IV+ EV +A   + G AAGLVRMHFHDCFVRGCDGSVL++ST+ N
Sbjct  15    LHPNFYAATCPQAETIVRQEVTRALYTNIGFAAGLVRMHFHDCFVRGCDGSVLLESTSDN  74

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AE+DSP NNPSLRGFEVID+AKARLE+ C GVVSCAD+LA+AARD V +TGG  YDVP 
Sbjct  75    VAERDSPINNPSLRGFEVIDAAKARLEAACPGVVSCADVLAYAARDGVALTGGPRYDVPG  134

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG  SL  E+ +N+P P+F + QLT  F+ KG TQEEMVTLSGAHT+GR+HCTSF++
Sbjct  135   GRRDGTASLEPEVADNIPAPTFTLDQLTQSFAAKGLTQEEMVTLSGAHTVGRAHCTSFSD  194

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRC----PQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             RLY+F++T   DPS+DP    QL++ C    P G  +A LVVPM+P +P   D  YY  +
Sbjct  195   RLYNFSATGAADPSVDPALLPQLRRACPAAGPDGAVDAGLVVPMEPRTPNGFDALYYWAV  254

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L NR LFTSDQ LL+ P TA +VRQ A     W LKFAAAMVKMGQI VLTG +GEIR  
Sbjct  255   LRNRALFTSDQALLSSPPTAAQVRQTAYGGYPWKLKFAAAMVKMGQIEVLTGGSGEIRTK  314

Query  275   CRVVN  261
             C  VN
Sbjct  315   CSAVN  319



>ref|XP_010671314.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 234/308 (76%), Gaps = 5/308 (2%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             ++A L+VGFY   C  AE I+K+EV K+F  ++G+A GL+R+HFHDCFVRGCDGS+LIDS
Sbjct  21    IEAALEVGFYRDKCPSAEAIIKEEVSKSFDQNKGIAPGLIRLHFHDCFVRGCDGSILIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T +N AE D P N  ++RG EVID+AKAR+E+ CKGVVSCADIL++AARDSV +TGG  +
Sbjct  81    TPTNQAEIDGPPNGITIRGREVIDNAKARIEATCKGVVSCADILSYAARDSVVITGGLYW  140

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             DVPAGRRDGR+S ASE   ++P PSFN+ QLT  F+NKG TQ++MV LSGAHTIGRSHCT
Sbjct  141   DVPAGRRDGRISRASETL-DIPAPSFNLDQLTQSFANKGLTQDDMVALSGAHTIGRSHCT  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP---QGNSNANLVVPMDPFSPAITDVSYY  465
             SF NRLY+F+STT+QDP L P YA  LKQ+CP   QGN N +LVV M+  +P + + SYY
Sbjct  200   SFTNRLYNFSSTTMQDPKLSPIYAQFLKQQCPRDSQGNVNQDLVVFMNQ-TPYVFESSYY  258

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
              N+  + GLFTSDQ LL    T  EV   A + ++W   F  AM+KM QI VLTGN GEI
Sbjct  259   QNLFQHTGLFTSDQALLDRQETTREVALYAVNNLAWQRDFVQAMIKMSQIEVLTGNQGEI  318

Query  284   RANCRVVN  261
             RANCRV+N
Sbjct  319   RANCRVIN  326



>emb|CBI23099.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/303 (65%), Positives = 234/303 (77%), Gaps = 6/303 (2%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             ++AELQVGFY   C RAE IVKDEV+KAF  DRG+A GL+R+HFHDCFVRGCD S+L+DS
Sbjct  19    IEAELQVGFYRDKC-RAESIVKDEVEKAFDRDRGIAPGLLRLHFHDCFVRGCDASILVDS  77

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  N  EKD P N  +LRG EVIDSAKARLE+ CKGVVSCAD LAFAARD+VE++ GFG+
Sbjct  78    TPMNVGEKDGPPNVNTLRGTEVIDSAKARLEAECKGVVSCADTLAFAARDAVEISNGFGW  137

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDGRVSLASE   ++P P  N+ QLT  F+ KG TQEEMVTLSGAHTIG +HCT
Sbjct  138   SVPAGRRDGRVSLASETL-DIPAPFLNLDQLTQSFAKKGLTQEEMVTLSGAHTIGHAHCT  196

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC---PQGNSNANLVVPMDPFSPAITDVSYY  465
             SF+NRLY FN+++ QDPSL+P YA  LK++C   PQG  + NLVV M+ FSPA+ D SYY
Sbjct  197   SFSNRLYDFNASSSQDPSLNPLYAEDLKRQCPRGPQGTVDPNLVVDMN-FSPAVMDSSYY  255

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
             T++L +RGLFTSDQ L T  +TA +V   A + + W  +FA AMVKM QI VLTG  GEI
Sbjct  256   TDVLHHRGLFTSDQALTTSQATARQVTTYAVNRLLWESEFAKAMVKMSQIEVLTGTDGEI  315

Query  284   RAN  276
             R N
Sbjct  316   RTN  318


 Score =   369 bits (946),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = -1

Query  1259  NKSEMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCD  1080
             +K  MSS R+  LS    L  L C  + L+A+LQVGFY  SCG AE IVKDEV+K F+ D
Sbjct  344   HKEVMSSKRVTWLSLTWVLVFL-CLSVELEAQLQVGFYRTSCGLAEFIVKDEVRKGFIRD  402

Query  1079  RGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLES  900
              GVA GLVRMHFHDCFVRGCDGSVLIDST SNTAEKDSPANNPSLRGFEVIDSAKARLE+
Sbjct  403   SGVAPGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEA  462

Query  899   LCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLT  720
             +CKGVVSCADI+AFAARDSVE+TGG GYDVPAGRRDGR+SLASE   NLPPP+F V QLT
Sbjct  463   VCKGVVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPPTFTVDQLT  522

Query  719   NLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQY  567
               FSNKG TQ+EMVTLSGAHTIGRSHC+SF+NRLY+FN T+ QDP+LDPQY
Sbjct  523   QFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQY  573



>ref|XP_008246297.1| PREDICTED: peroxidase 5-like [Prunus mume]
Length=327

 Score =   380 bits (976),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 232/331 (70%), Gaps = 6/331 (2%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAEL--QVGFYSGSCGRAELIVKDEVQKAFVCDRG  1074
             MS++ +RM    S +  L   ++V  A    +VGFY  SC  AE IV+  V KA   + G
Sbjct  1     MSAATLRM----SLIFFLAMSMVVFMASAAPKVGFYQRSCPAAEAIVRKAVNKAVAKNPG  56

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLC  894
             +AAGL+RMHFHDCFVRGCD S+L+DST    +EK+ PANNPSLRGFEVID AKA +E+ C
Sbjct  57    IAAGLIRMHFHDCFVRGCDASILLDSTPGQPSEKEHPANNPSLRGFEVIDEAKAEIEAKC  116

Query  893   KGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNL  714
                VSCADILAFAARDS    GG  YDVP+GRRDGRVSL  E   +LP PSFN  QL   
Sbjct  117   PKTVSCADILAFAARDSALEVGGINYDVPSGRRDGRVSLQDEPTQHLPSPSFNAKQLEES  176

Query  713   FSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG  534
             F+ KG + +EMVTLSGAH+IG SHC+SF++RLY FN+T  QDPS+DP +A  LK++CP+ 
Sbjct  177   FARKGLSLDEMVTLSGAHSIGVSHCSSFSDRLYFFNATHPQDPSMDPIFARNLKKKCPRS  236

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
             ++N  + VP+D  +P   D  YYT++  + GL TSDQTLLT  STA  VR NA    +W 
Sbjct  237   SNNDRVTVPLDILTPNRLDNKYYTDLKNHHGLLTSDQTLLTSHSTAGIVRNNARFGTAWA  296

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
              KFAAAMVKMG I VLTG  GEIR NC+VVN
Sbjct  297   NKFAAAMVKMGSIDVLTGRQGEIRNNCKVVN  327



>gb|KCW44165.1| hypothetical protein EUGRSUZ_L02416, partial [Eucalyptus grandis]
Length=302

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 214/301 (71%), Gaps = 0/301 (0%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST  N
Sbjct  2     LQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGN  61

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y VPA
Sbjct  62    PSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAVPA  121

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG VSL  E   +LPP  FN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF+N
Sbjct  122   GRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSFSN  181

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANR  444
             RLYSFN+T  QDPS+D + A QLK +CP     ++  VP+D  +P   D  YYTN+   R
Sbjct  182   RLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKNRR  241

Query  443   GLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVV  264
             GL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I VLTGN GEIR  CRVV
Sbjct  242   GLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRKCRVV  301

Query  263   N  261
             N
Sbjct  302   N  302



>ref|XP_010041692.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 215/303 (71%), Gaps = 0/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  21    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  80

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  81    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  140

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   +LPP  FN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  141   PAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  200

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLYSFN+T  QDPS+D + A QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  201   SNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  260

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
              RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I VLTGN GEIR  CR
Sbjct  261   RRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRKCR  320

Query  269   VVN  261
             VVN
Sbjct  321   VVN  323



>ref|XP_010032734.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   375 bits (963),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 218/303 (72%), Gaps = 0/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  24    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  83

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  84    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   NLPP  FN  QL   F++KG + +EMVTLSGAH+IG SHC+SF
Sbjct  144   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  203

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             ++RLYSFN+T  QDPS+D + A+QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  204   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  263

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I VLTG+ GEIR  CR
Sbjct  264   HRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGSEGEIRRKCR  323

Query  269   VVN  261
             VVN
Sbjct  324   VVN  326



>emb|CAN68183.1| hypothetical protein VITISV_028562 [Vitis vinifera]
Length=322

 Score =   375 bits (963),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 228/319 (71%), Gaps = 6/319 (2%)
 Frame = -1

Query  1199  LLTCQLIVL-----KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             LL C +  L      A L+VGFY  +C  AE IV+  V KA   + G+AAGL+RMHFHDC
Sbjct  4     LLFCIMFFLTVSVSSASLKVGFYKYTCPSAETIVRKVVNKAVSRNPGMAAGLIRMHFHDC  63

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCDGSVL+DST  N +EK++PANNPSLRGFEVID+AKA +E+ C   VSCAD+LAFA
Sbjct  64    FVRGCDGSVLLDSTPGNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFA  123

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARDS    GG  Y VP+GRRDGRVSL  E   +LPPP FN  QL + F+ KG T +EMVT
Sbjct  124   ARDSAYKVGGINYAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVT  183

Query  674   LSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDP  498
             LSGAH+IG SHC+SF+NRLYSFN+T  QDPS+DP++A  LK +C P  N+ ++  VP++ 
Sbjct  184   LSGAHSIGVSHCSSFSNRLYSFNATHPQDPSMDPEFARHLKTKCPPPSNTGSDPTVPLEI  243

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              +P   D  YY ++  +RGL  SDQTL   PSTA  V+ NA    +WG KFAAAMV+MG 
Sbjct  244   QTPNKLDNKYYKDLKNHRGLLASDQTLFYSPSTARMVKNNARYGENWGNKFAAAMVRMGA  303

Query  317   ISVLTGNAGEIRANCRVVN  261
             I VLTG  GEIR NCRVVN
Sbjct  304   IDVLTGTQGEIRKNCRVVN  322



>ref|XP_010032732.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   375 bits (962),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 217/303 (72%), Gaps = 0/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  24    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  83

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  84    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   NLPP  FN  QL   F++KG + +EMVTLSGAH+IG SHC+SF
Sbjct  144   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  203

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             ++RLYSFN+T  QDPS+D + A+QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  204   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  263

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I +LTGN GEIR  C 
Sbjct  264   HRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGNEGEIRRKCT  323

Query  269   VVN  261
             VVN
Sbjct  324   VVN  326



>ref|XP_007031236.1| Class III peroxidase 70 [Theobroma cacao]
 gb|EOY11738.1| Class III peroxidase 70 [Theobroma cacao]
Length=329

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 224/320 (70%), Gaps = 1/320 (0%)
 Frame = -1

Query  1217  CYSTLALLTCQLIVLK-AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             C++T  L     I    A L+VGFY  SC  AE  V+  V KA   + G+AA L+RMHFH
Sbjct  10    CFTTFFLAIFLTISFSSATLKVGFYQSSCPSAEAAVRKAVDKAVSRNPGMAAALIRMHFH  69

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCD SVL+DST    +EK+ PANNPSLRGFEVID AKA +E+ C   VSCADILA
Sbjct  70    DCFVRGCDASVLLDSTPGRPSEKEHPANNPSLRGFEVIDQAKAEIEAQCPRTVSCADILA  129

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARDS    GG  Y VP+GRRDGRVSL  E   NLPPP FN  QL + F+ KG   +EM
Sbjct  130   FAARDSAYKVGGIKYAVPSGRRDGRVSLRDEGFGNLPPPFFNAKQLEDNFARKGLNLDEM  189

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD  501
             VTLSGAH+IG SHC+SF+NRL+SFN+T +QDPSLDP++A QL++RCP   S+ +  VP+D
Sbjct  190   VTLSGAHSIGVSHCSSFSNRLFSFNATHLQDPSLDPEFARQLRKRCPAPGSSRDPTVPLD  249

Query  500   PFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMG  321
               SP   D  YY  +  + GL TSDQTLL+  +TA  VR+NA    +W  KF AAMVKMG
Sbjct  250   VLSPHRLDNKYYEVLKNHHGLLTSDQTLLSSRATAKIVRENARHGKAWAKKFTAAMVKMG  309

Query  320   QISVLTGNAGEIRANCRVVN  261
              I VLTG+ GEIR NCRVVN
Sbjct  310   YIDVLTGSKGEIRKNCRVVN  329



>ref|XP_010270944.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=339

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 226/332 (68%), Gaps = 3/332 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             +SS    ML C+     ++       A L+VGFYS +C  AE IV+  V KA   + G+ 
Sbjct  8     ISSQMPTMLYCFICFLAISTMASGSTASLKVGFYSSTCPSAEAIVRKAVTKAISQNPGIG  67

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGL+RMHFHDCFVRGCD SVL+DST  N AEK  PANNPSLRGFEVID AKA +E++C  
Sbjct  68    AGLIRMHFHDCFVRGCDASVLLDSTPGNDAEKSHPANNPSLRGFEVIDMAKAHIEAVCPQ  127

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
              VSCADI+AFAARDS    GG  Y VPAGRRDG +S +++I  NLPPPSF   QL + F+
Sbjct  128   TVSCADIIAFAARDSAYKLGGINYAVPAGRRDGLISRSADIRANLPPPSFTAKQLEDRFA  187

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP---Q  537
              KG + EEMVTLSGAH+IG SHC+SF NRLY+FN+T  QDPS+DP YAA LK RCP    
Sbjct  188   GKGLSLEEMVTLSGAHSIGVSHCSSFLNRLYNFNATHPQDPSMDPDYAAFLKTRCPPTST  247

Query  536   GNSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISW  357
               S+ +  VP+D  +P   D  YY N+  + GL TSD TL++  STA  VR NA  P +W
Sbjct  248   AGSSLDPTVPLDVLTPNRLDNKYYKNLKNHHGLLTSDWTLMSSHSTAWMVRNNAKHPSAW  307

Query  356   GLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               KFAAAMV MG I VLTG  GEIR +C VVN
Sbjct  308   ASKFAAAMVHMGYIDVLTGTQGEIRKSCSVVN  339



>ref|NP_001048793.1| Os03g0121200 [Oryza sativa Japonica Group]
 gb|ABF93699.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10707.1| Os03g0121200 [Oryza sativa Japonica Group]
 dbj|BAG96194.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 225/329 (68%), Gaps = 2/329 (1%)
 Frame = -1

Query  1250  EMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGV  1071
             E   SR   L   S   +        +A+LQVG+Y   C  AE+IV++EV KA   + G+
Sbjct  2     EARGSRGMRLWLLSVAVMAMAMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGM  61

Query  1070  AAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCK  891
             AAGLVR+HFHDCFVRGCD SVL+DST  N AEKD+P N  SLRGFEVIDSAK+RLE+ C 
Sbjct  62    AAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEKDAPPNT-SLRGFEVIDSAKSRLETACF  120

Query  890   GVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLF  711
             GVVSCAD+LAFAARD++ + GG  Y VP GRRDG VS+A E   NLPPPS NV QL  +F
Sbjct  121   GVVSCADVLAFAARDALALVGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMF  180

Query  710   SNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGN  531
               KG TQ EMV LSGAHTIG SHC+SF+NRLYS      QDPS+DP Y A L  +CPQ  
Sbjct  181   GAKGLTQAEMVALSGAHTIGVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQ  240

Query  530   SN-ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
                A  +VPMD  +P   D +YY  I+ANRGL +SDQ LL D +TA +V     +P S+ 
Sbjct  241   GQPAAGMVPMDAVTPNAFDTNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQ  300

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRV  267
               FAAAMVKMG I VLTGNAG IR NCRV
Sbjct  301   TDFAAAMVKMGSIGVLTGNAGTIRTNCRV  329



>ref|XP_010032733.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 214/303 (71%), Gaps = 0/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  24    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNSGIGAGLIRMHFHDCFVRGCDASILLDSTP  83

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  84    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   +LPP  FN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  144   PAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  203

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLYSFN+T  QDPS+D + A QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  204   SNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  263

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
              RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I VLTGN GEIR  C 
Sbjct  264   RRGLLTSDQTLSNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRKCM  323

Query  269   VVN  261
             VVN
Sbjct  324   VVN  326



>gb|AAM52317.1|AC105363_6 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69275.1| TPA: class III peroxidase 33 precursor [Oryza sativa Japonica 
Group]
Length=311

 Score =   372 bits (956),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 220/305 (72%), Gaps = 2/305 (1%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             +A+LQVG+Y   C  AE+IV++EV KA   + G+AAGLVR+HFHDCFVRGCD SVL+DST
Sbjct  8     QAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDST  67

Query  992   ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
               N AEKD+P N  SLRGFEVIDSAK+RLE+ C GVVSCAD+LAFAARD++ + GG  Y 
Sbjct  68    QGNRAEKDAPPNT-SLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQ  126

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             VP GRRDG VS+A E   NLPPPS NV QL  +F  KG TQ EMV LSGAHTIG SHC+S
Sbjct  127   VPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSS  186

Query  632   FNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN-ANLVVPMDPFSPAITDVSYYTNI  456
             F+NRLYS      QDPS+DP Y A L  +CPQ     A  +VPMD  +P   D +YY  I
Sbjct  187   FSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAI  246

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             +ANRGL +SDQ LL D +TA +V     +P S+   FAAAMVKMG I VLTGNAG IR N
Sbjct  247   VANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTN  306

Query  275   CRVVN  261
             CRV +
Sbjct  307   CRVAS  311



>gb|EEC74412.1| hypothetical protein OsI_09774 [Oryza sativa Indica Group]
Length=313

 Score =   372 bits (956),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 220/305 (72%), Gaps = 2/305 (1%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             +A+LQVG+Y   C  AE+IV++EV KA   + G+AAGLVR+HFHDCFVRGCD SVL+DST
Sbjct  10    QAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDST  69

Query  992   ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
               N AEKD+P N  SLRGFEVIDSAK+RLE+ C GVVSCAD+LAFAARD++ + GG  Y 
Sbjct  70    QGNRAEKDAPPNT-SLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQ  128

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             VP GRRDG VS+A E   NLPPPS NV QL  +F  KG TQ EMV LSGAHTIG SHC+S
Sbjct  129   VPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSS  188

Query  632   FNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN-ANLVVPMDPFSPAITDVSYYTNI  456
             F+NRLYS      QDPS+DP Y A L  +CPQ     A  +VPMD  +P   D +YY  I
Sbjct  189   FSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAI  248

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             +ANRGL +SDQ LL D +TA +V     +P S+   FAAAMVKMG I VLTGNAG IR N
Sbjct  249   VANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTN  308

Query  275   CRVVN  261
             CRV +
Sbjct  309   CRVAS  313



>gb|KCW52190.1| hypothetical protein EUGRSUZ_J01619, partial [Eucalyptus grandis]
Length=313

 Score =   372 bits (955),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 216/301 (72%), Gaps = 0/301 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  13    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  72

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  73    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  132

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   NLPP  FN  QL   F++KG + +EMVTLSGAH+IG SHC+SF
Sbjct  133   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  192

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             ++RLYSFN+T  QDPS+D + A+QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  193   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  252

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I VLTG+ GEIR  CR
Sbjct  253   HRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGSEGEIRRKCR  312

Query  269   V  267
             V
Sbjct  313   V  313



>ref|XP_010659811.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=322

 Score =   372 bits (956),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 228/319 (71%), Gaps = 6/319 (2%)
 Frame = -1

Query  1199  LLTCQLIVL-----KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             LL C +  L      A L+VGFY  +C  AE IV+  V KA   + G+AAGL+RMHFHDC
Sbjct  4     LLFCIMFFLTVSVSSASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDC  63

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCDGSVL+DST  N +EK++PANNPSLRGFEVID+AKA +E+ C   VSCAD+LAFA
Sbjct  64    FVRGCDGSVLLDSTPGNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFA  123

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARDS    GG  Y VP+GRRDGRVSL  E   +LPPP FN  QL + F+ KG T +EMVT
Sbjct  124   ARDSAYKVGGVNYAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVT  183

Query  674   LSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDP  498
             LSGAH+IG SHC+SF+NRLYSFN+T  QDPS+DP++A  LK +C P  N+ ++  V ++ 
Sbjct  184   LSGAHSIGVSHCSSFSNRLYSFNATHPQDPSMDPEFARYLKTKCPPPSNTGSDPTVALEV  243

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              +P   D  YY ++  +RGL TSDQTL   PSTA  V+ NA    +WG KFAAAMV+MG 
Sbjct  244   QTPNRLDNKYYKDLKNHRGLLTSDQTLFDSPSTARMVKNNARYGENWGNKFAAAMVRMGA  303

Query  317   ISVLTGNAGEIRANCRVVN  261
             I VLTG  GEIR NCRVVN
Sbjct  304   IDVLTGTQGEIRKNCRVVN  322



>ref|XP_009799014.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=334

 Score =   372 bits (956),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 221/306 (72%), Gaps = 3/306 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VGFY  +C  AE IV+  V KA   + G+ AG++RMHFHDCFVRGCD S+L+DST 
Sbjct  29    ASLKVGFYQSNCPNAEAIVRKTVNKAVSRNPGLGAGIIRMHFHDCFVRGCDASILLDSTP  88

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N  EK+ PANNPSLRG+EVID+AKA LES+C   VSC+DI+AFAARDS    GG  Y V
Sbjct  89    GNPTEKEHPANNPSLRGYEVIDAAKAALESVCPQTVSCSDIIAFAARDSAYKLGGIRYSV  148

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGRVS+  E   +LPP +FN  QL   F+ KG + +EMVTLSGAH+IGR+HC+SF
Sbjct  149   PAGRRDGRVSILDEPNEHLPPFTFNAKQLEENFARKGLSLDEMVTLSGAHSIGRTHCSSF  208

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA---NLVVPMDPFSPAITDVSYYTN  459
             ++RLYSFNST  QDPS+DP+ A QL++RCP  N++    +  VP+D  +P   D  YY N
Sbjct  209   SSRLYSFNSTHTQDPSMDPRLAKQLRKRCPSPNNDGTGNDPTVPLDVVTPNRLDNKYYVN  268

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  +RGL TSDQTL   P TA  VR NA   ++W  K+AAAMVKMG I V+TG  GEIR 
Sbjct  269   LKNHRGLLTSDQTLWNSPLTAGMVRSNAIHGVNWARKYAAAMVKMGSIEVMTGKQGEIRK  328

Query  278   NCRVVN  261
             NCRVVN
Sbjct  329   NCRVVN  334



>gb|KCW52189.1| hypothetical protein EUGRSUZ_J01618, partial [Eucalyptus grandis]
Length=313

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 215/301 (71%), Gaps = 0/301 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  13    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  72

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  73    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  132

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   NLPP  FN  QL   F++KG + +EMVTLSGAH+IG SHC+SF
Sbjct  133   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  192

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             ++RLYSFN+T  QDPS+D + A+QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  193   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  252

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I +LTGN GEIR  C 
Sbjct  253   HRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGNEGEIRRKCT  312

Query  269   V  267
             V
Sbjct  313   V  313



>ref|XP_006649294.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=325

 Score =   371 bits (953),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 230/306 (75%), Gaps = 6/306 (2%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             KA+LQVGFY  SC +AE+IV+DEV KA   + G+AAGLVRMHFHDCFV+GCD SVL+DS 
Sbjct  24    KAQLQVGFYDQSCPQAEVIVRDEVGKAVSANPGLAAGLVRMHFHDCFVKGCDASVLLDSA  83

Query  992   ASNT--AEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFG  819
             A++T  AEKD+P N  SLRGFEV+DSAK RLES CKGVVSCAD+LAFAARDSV +TGG  
Sbjct  84    ANSTTAAEKDAPPNK-SLRGFEVVDSAKQRLESACKGVVSCADVLAFAARDSVVLTGGSP  142

Query  818   YDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHC  639
             Y VPAGRRDG  S+AS+   +LPPP+ +VP LT +F+  G +QEEMVTLSGAHTIG +HC
Sbjct  143   YRVPAGRRDGNTSVASDAMASLPPPTADVPTLTRMFAKYGLSQEEMVTLSGAHTIGVTHC  202

Query  638   TSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTN  459
             +SF++RLY +NS+T QDP+L+   A++L + CPQG+ N    V MD  S    D SYY N
Sbjct  203   SSFSSRLYGYNSSTGQDPALNAAMASRLARVCPQGSGN---TVAMDDGSENTFDTSYYQN  259

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +LA RG+  SDQTL  D +TA  V QNA +   +  +F  AMVKMG I VLTG+ G+IR 
Sbjct  260   LLAGRGVLASDQTLTADNATAALVAQNAYNMYLFATRFGQAMVKMGAIQVLTGSNGQIRT  319

Query  278   NCRVVN  261
             NCRV N
Sbjct  320   NCRVAN  325



>ref|XP_006662005.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=334

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 228/321 (71%), Gaps = 2/321 (1%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIV-LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             M SC    A+    +   L+A+L+VGFY  SC  AE+IV+ EV KA   + G+AAGLVR+
Sbjct  14    MSSCLQVAAVSVLLMATGLQAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRL  73

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCD SVLIDST  N AEKD+   N SLRGFEV+D  KAR+E  C GVVSCAD
Sbjct  74    HFHDCFVRGCDASVLIDSTKGNQAEKDA-GPNTSLRGFEVVDRIKARVEQACFGVVSCAD  132

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDSV +TGG  Y VPAGRRDG VS AS+   NLPPP+  V QLT +F+ KG +Q
Sbjct  133   ILAFAARDSVALTGGNAYQVPAGRRDGSVSRASDTGGNLPPPTAGVSQLTQMFAAKGLSQ  192

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVV  510
              EMV LSGAHTIG SHC+SF++RLY   +T  QDP++DP Y AQL Q+CPQ       +V
Sbjct  193   REMVALSGAHTIGASHCSSFSSRLYRSGTTAGQDPTMDPAYVAQLAQQCPQSGGGGGPLV  252

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
             PMD  +P   D  ++  ++ANRGL +SDQ LL+D +TA +V   A    ++   FAAAMV
Sbjct  253   PMDAVTPNTFDEGFFKGVMANRGLLSSDQVLLSDKNTAVQVVAYANDASTFQSDFAAAMV  312

Query  329   KMGQISVLTGNAGEIRANCRV  267
             KMG + VLTG++G++R+NCRV
Sbjct  313   KMGAVGVLTGSSGKVRSNCRV  333



>ref|XP_004304932.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   370 bits (950),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 223/318 (70%), Gaps = 4/318 (1%)
 Frame = -1

Query  1205  LALLTCQLIVLKAEL---QVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             L  LT  ++V  +     +VGFY  +C  AE IV+  V KA + + G+AAGL+RMHFHDC
Sbjct  8     LIFLTMSMMVFMSSAITPRVGFYRTTCPSAEAIVRKAVNKAVMKNPGIAAGLIRMHFHDC  67

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCD SVL+DST    +EK+ PAN PSLRGFEVID AK  LE+LC   VSCADILAFA
Sbjct  68    FVRGCDASVLLDSTPGKLSEKEHPANKPSLRGFEVIDEAKRELETLCPRTVSCADILAFA  127

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARD     GG  Y VP+GRRDGRVSL  E  NNLP PS N  +L   F+ KGF+ +EMVT
Sbjct  128   ARDGALAVGGISYQVPSGRRDGRVSLFDEPSNNLPSPSLNAKELAASFARKGFSLDEMVT  187

Query  674   LSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPF  495
             LSGAH+IG SHC+SF+NRLY+FN T  QDPSLDP++A  LK +CP  +S+ N VV +D  
Sbjct  188   LSGAHSIGVSHCSSFSNRLYAFNETHTQDPSLDPKFARDLKAKCPP-SSSPNNVVQLDGV  246

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             +P   D  YYTN++ +RGLF SDQTLL+  STA  VR NA    +W  KFA+AMVKMG I
Sbjct  247   TPNRLDNKYYTNLMNHRGLFASDQTLLSSRSTAGMVRNNARLGPAWAKKFASAMVKMGSI  306

Query  314   SVLTGNAGEIRANCRVVN  261
              VLTG  GEIR  C VVN
Sbjct  307   DVLTGRQGEIRKKCGVVN  324



>ref|XP_010034487.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score =   370 bits (950),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 222/318 (70%), Gaps = 0/318 (0%)
 Frame = -1

Query  1214  YSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             +  + LLT  L    A LQVGFY  +C  AE +V+  V KA   + G  AGL+RMHFHDC
Sbjct  10    FCVIFLLTTMLNSGSATLQVGFYRSACPAAESVVRKAVNKAVARNPGTGAGLIRMHFHDC  69

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCD S+L+DST  N +EK+ PAN+PSLRG+EVID AKA LE L    VSCADILAFA
Sbjct  70    FVRGCDASILLDSTLGNPSEKEHPANDPSLRGYEVIDKAKAELEHLYPQTVSCADILAFA  129

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARDS    G   Y VPAGRRDG VSL  E   NLPPPS +  QL   F+ KG + +EMVT
Sbjct  130   ARDSTYKLGSINYAVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVT  189

Query  674   LSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPF  495
             +SGAH+IG SHC+SF+NRLYSFN+T  QDPSL+P+ A++LK +CP     ++  VP+D  
Sbjct  190   VSGAHSIGVSHCSSFSNRLYSFNATHKQDPSLEPKLASELKAKCPNNGGTSDPTVPLDFV  249

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             +    D  YYTN+  +RG+ TSDQTL   PSTA+ VR+NA    +W  KFAAAMVKMG I
Sbjct  250   TANRLDNKYYTNLKKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWASKFAAAMVKMGSI  309

Query  314   SVLTGNAGEIRANCRVVN  261
              VLTG+ GEIR NCRVVN
Sbjct  310   DVLTGSQGEIRRNCRVVN  327



>gb|KCW52187.1| hypothetical protein EUGRSUZ_J01616, partial [Eucalyptus grandis]
Length=313

 Score =   369 bits (948),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 212/301 (70%), Gaps = 0/301 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  13    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNSGIGAGLIRMHFHDCFVRGCDASILLDSTP  72

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRGFEVID AKA LESLC   VSCADILAFAARDS    G   Y V
Sbjct  73    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  132

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   +LPP  FN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  133   PAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  192

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLYSFN+T  QDPS+D + A QLK +CP     ++  VP+D  +P   D  YYTN+  
Sbjct  193   SNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDPTVPLDLVTPNRLDNKYYTNLKN  252

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
              RGL TSDQTL   PSTAN VR NA +  +W  KFAAAMVKMG I VLTGN GEIR  C 
Sbjct  253   RRGLLTSDQTLSNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRKCM  312

Query  269   V  267
             V
Sbjct  313   V  313



>ref|XP_010659743.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=314

 Score =   369 bits (947),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 220/307 (72%), Gaps = 1/307 (0%)
 Frame = -1

Query  1178  VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLID  999
             V  A L+VGFY  SC  AE IV+  V KA   + G+AAGL+RMHFHDCFVRGCDGSVL+D
Sbjct  8     VSSASLEVGFYKSSCPSAETIVRKAVNKAVSKNPGMAAGLIRMHFHDCFVRGCDGSVLLD  67

Query  998   STASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFG  819
             ST  N +EK+SP N+PSLRGFEVID AKA +E+ C   VSCAD+LAFAARDS    GG  
Sbjct  68    STPGNPSEKESPVNDPSLRGFEVIDEAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGIN  127

Query  818   YDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHC  639
             Y VP+GRRDGR+SL  E   +LPPP FN  QL   F+ KG T +EMVTLSGAH+IG SHC
Sbjct  128   YAVPSGRRDGRISLKDEPSLHLPPPFFNAKQLEENFARKGLTLDEMVTLSGAHSIGVSHC  187

Query  638   TSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYT  462
             +SF+NRLYSFN+T  QDPS++P++A  LK +C P  N+ ++  VP++  +P   D  YY 
Sbjct  188   SSFSNRLYSFNATHPQDPSIEPEFARHLKTKCPPPSNTGSDPTVPLEVQTPNRLDNKYYK  247

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             ++ + +GL TSDQTL   PST   V+ NA    +WG KFAAAMV+MG I VLTG  G IR
Sbjct  248   DLKSRKGLLTSDQTLFDSPSTVRMVKNNARYGANWGNKFAAAMVQMGAIDVLTGTQGVIR  307

Query  281   ANCRVVN  261
              NCRVVN
Sbjct  308   KNCRVVN  314



>gb|ABS44862.1| putative peroxidase [Oryza sativa Japonica Group]
Length=331

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/330 (58%), Positives = 224/330 (68%), Gaps = 4/330 (1%)
 Frame = -1

Query  1250  EMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGV  1071
             E   SR   L   S   +        +A+LQVG+Y   C  AE+IV++EV KA   + G+
Sbjct  2     EARGSRGMRLWLLSVAVMAMAMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGM  61

Query  1070  AAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCK  891
             AAGLVR+HFHDCFVRGCD SVL+DST  N A KD+P N  SLRGFEVIDSAK+RLE+ C 
Sbjct  62    AAGLVRLHFHDCFVRGCDASVLLDSTXGNRAXKDAPPNT-SLRGFEVIDSAKSRLETACF  120

Query  890   GVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLF  711
             GVVSCAD+LAFAARD++ + GG  Y VP GRRDG VS+A E   NLPPPS NV QLT +F
Sbjct  121   GVVSCADVLAFAARDALALVGGNAYXVPGGRRDGNVSVAQETNGNLPPPSANVAQLTQMF  180

Query  710   SNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP--Q  537
               KG TQ EMV LSGAHTIG  HC SF+NRLYS      QDPS+DP Y A L  +CP  Q
Sbjct  181   GAKGLTQAEMVALSGAHTIGVXHCXSFSNRLYSSGPNAGQDPSMDPXYVAALTTQCPQQQ  240

Query  536   GNSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISW  357
             G   A + VPMD  +P   D +YY  I+ANRGL +SDQ LL D +TA +V     +P S+
Sbjct  241   GQPVAGM-VPMDAVTPNAFDTNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSF  299

Query  356   GLKFAAAMVKMGQISVLTGNAGEIRANCRV  267
                FAAAMVKMG I VLTGNAG IR NCRV
Sbjct  300   QTDFAAAMVKMGSIGVLTGNAGTIRTNCRV  329



>ref|XP_009598825.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=334

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 232/332 (70%), Gaps = 6/332 (2%)
 Frame = -1

Query  1238  SRIRMLSCYSTLALL---TCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             S++   S + TL L+   +    V  A L+VGFY  +C  AE IV+  V +A   + G+ 
Sbjct  3     SKMAKWSSFLTLFLVVFTSFNFTVSFASLKVGFYQSNCPNAEAIVRKAVNRAVSRNPGLG  62

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AG++RMHFHDCFVRGCD S+L+DST  N AEK+ PANNPSLRG+EVID+AK+ LES+C  
Sbjct  63    AGIIRMHFHDCFVRGCDASILLDSTPGNPAEKEHPANNPSLRGYEVIDAAKSELESVCPQ  122

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
              VSC+DI+AFAARDS    GG  Y VPAGRRDGRVS+  E   +LPP +FN  QL   F+
Sbjct  123   TVSCSDIIAFAARDSSFKLGGIRYSVPAGRRDGRVSIKDEPNEHLPPFTFNARQLEENFA  182

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              KG + +EMVTLSGAH+IGR+HC+SF++RLYSFNST  QDPS+D + A QL++RCP  N+
Sbjct  183   KKGLSLDEMVTLSGAHSIGRTHCSSFSSRLYSFNSTHTQDPSMDTRLAKQLRKRCPPSNN  242

Query  527   NA---NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISW  357
             +    +  VP+D  +P   D  YY N+  +RGL TSDQTL   P TA  VR NA   ++W
Sbjct  243   DGSGNDPTVPLDVVTPNRLDNKYYVNLKNHRGLLTSDQTLWKSPLTAGMVRSNAIHGVNW  302

Query  356   GLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               K+AAAMVKMG I V+TG  GEIR NCRVVN
Sbjct  303   ARKYAAAMVKMGSIEVMTGMQGEIRNNCRVVN  334



>ref|XP_010069738.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=335

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 213/299 (71%), Gaps = 0/299 (0%)
 Frame = -1

Query  1157  VGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTA  978
             VGFY  +C  AE IV+  + +AF  D G+AA  +RM+FHDCFVRGCD S+L++ST  NTA
Sbjct  37    VGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTA  96

Query  977   EKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGR  798
             EKDSP NNPSL GF+VID AKARLE+ C   VSCADI+AFAARDSV   G   YDVP+GR
Sbjct  97    EKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGR  156

Query  797   RDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRL  618
             RDGR+S ASE+  NLPPP+F VPQL   F+ KGF+ +EMVTLSGAH+IG SHC+SF+NRL
Sbjct  157   RDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRL  216

Query  617   YSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANRGL  438
             YSFN+T  QDP LDP+YAA LK +CPQGNS  +  V +D  +P   D  YY  +L  RGL
Sbjct  217   YSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGL  276

Query  437   FTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             F+SD+ L T   T   V  NA     WG KF  AMVK+G + VLTG  GEIR  C  VN
Sbjct  277   FSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIRKVCGAVN  335



>ref|XP_009768802.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=343

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 226/337 (67%), Gaps = 17/337 (5%)
 Frame = -1

Query  1220  SCYSTLALLTCQLIVL--------------KAELQVGFYSGSCGRAELIVKDEVQKAFVC  1083
             S +  LALL C ++ L              K+   VGFY  SC  AE I++  V KA + 
Sbjct  7     SKFVMLALLFCLILSLSVFAEANKHKPKPKKSTFGVGFYKRSCPAAEAIIRKAVFKAVLM  66

Query  1082  DRGVAAGLVRMHFHDCFVRGCDGSVLIDST-ASNTAEKDSPANNPSLRGFEVIDSAKARL  906
             + G AAG++RMHFHDCF+RGCDGSVL+DS     TAEKDSP NNPSLRGFEVID AKA L
Sbjct  67    NPGTAAGIIRMHFHDCFIRGCDGSVLLDSVRGKETAEKDSPINNPSLRGFEVIDEAKALL  126

Query  905   ESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQ  726
             E LC   VSCADILAFAARDS    GG  Y +P GRRDGRVSL+SE+  NLPPP FN  Q
Sbjct  127   EKLCPRTVSCADILAFAARDSALFAGGISYALPGGRRDGRVSLSSEVIQNLPPPFFNAQQ  186

Query  725   LTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQR  546
             L + F  KG + +EMVTLSGAH+IGR+HC+SF+NRLY FN+T  QDPSLDP+YA+ LK +
Sbjct  187   LQDNFKRKGLSLDEMVTLSGAHSIGRTHCSSFSNRLYGFNATHPQDPSLDPRYASFLKNK  246

Query  545   CPQGNSNANL--VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAG  372
             CP+  S+  +  +V +D  +P   D  YY N+  ++GL TSDQTL   P T+  V  N  
Sbjct  247   CPRPISDTQVDPIVNLDISTPNRLDNKYYLNLKNHKGLLTSDQTLFESPLTSKLVFNNVK  306

Query  371   SPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
                +W  KFAAAMV MG I VLTGN GEIR NC  VN
Sbjct  307   YGSTWARKFAAAMVHMGSIEVLTGNKGEIRKNCHFVN  343



>emb|CBI39654.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/305 (60%), Positives = 222/305 (73%), Gaps = 1/305 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VGFY  +C  AE IV+  V KA   + G+AAGL+RMHFHDCFVRGCDGSVL+DST 
Sbjct  14    ASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDCFVRGCDGSVLLDSTP  73

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK++PANNPSLRGFEVID+AKA +E+ C   VSCAD+LAFAARDS    GG  Y V
Sbjct  74    GNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGVNYAV  133

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVSL  E   +LPPP FN  QL + F+ KG T +EMVTLSGAH+IG SHC+SF
Sbjct  134   PSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVSHCSSF  193

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYTNIL  453
             +NRLYSFN+T  QDPS+DP++A  LK +C P  N+ ++  V ++  +P   D  YY ++ 
Sbjct  194   SNRLYSFNATHPQDPSMDPEFARYLKTKCPPPSNTGSDPTVALEVQTPNRLDNKYYKDLK  253

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
              +RGL TSDQTL   PSTA  V+ NA    +WG KFAAAMV+MG I VLTG  GEIR NC
Sbjct  254   NHRGLLTSDQTLFDSPSTARMVKNNARYGENWGNKFAAAMVRMGAIDVLTGTQGEIRKNC  313

Query  272   RVVNS  258
             RV  S
Sbjct  314   RVGKS  318



>ref|NP_001048794.1| Os03g0121300 [Oryza sativa Japonica Group]
 gb|AAM52318.1|AC105363_7 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69276.1| TPA: class III peroxidase 34 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10708.1| Os03g0121300 [Oryza sativa Japonica Group]
 gb|EAY88316.1| hypothetical protein OsI_09775 [Oryza sativa Indica Group]
 gb|EAZ25393.1| hypothetical protein OsJ_09211 [Oryza sativa Japonica Group]
Length=322

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 227/305 (74%), Gaps = 4/305 (1%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             ++ +LQVGFY  SC +AE+IV+DEV KA   + G+AAGLVRMHFHDCFV+GCD SVL+DS
Sbjct  22    VQGQLQVGFYDQSCPQAEVIVRDEVGKAVSANVGLAAGLVRMHFHDCFVKGCDASVLLDS  81

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             TA++TAEKD+  N  SLRGFEV+DSAK RLES CKGVVSCADILAFAARDSV + GG  Y
Sbjct  82    TANSTAEKDAIPNK-SLRGFEVVDSAKRRLESACKGVVSCADILAFAARDSVVLAGGTPY  140

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDG  S+AS+   NLP P+ +V QLT  F+  G +Q++MV LSGAHTIG +HC+
Sbjct  141   RVPAGRRDGNTSVASDAMANLPRPTSDVAQLTQSFATHGLSQDDMVILSGAHTIGVAHCS  200

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF++RLY +NS+T QDP+L+   A++L + CPQG++N    V MD  S    D SYY N+
Sbjct  201   SFSSRLYGYNSSTGQDPALNAAMASRLSRSCPQGSAN---TVAMDDGSENTFDTSYYQNL  257

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA RG+  SDQTL  D +TA  V QNA +   +  KF  AMVKMG I VLTG+ G+IR N
Sbjct  258   LAGRGVLASDQTLTADNATAALVAQNAYNMYLFATKFGQAMVKMGAIQVLTGSDGQIRTN  317

Query  275   CRVVN  261
             CRV N
Sbjct  318   CRVAN  322



>gb|KCW52188.1| hypothetical protein EUGRSUZ_J01617, partial [Eucalyptus grandis]
Length=319

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 215/302 (71%), Gaps = 0/302 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G  AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  7     ATLQVGFYRSACPAAESVVRKAVNKAVARNPGTGAGLIRMHFHDCFVRGCDASILLDSTL  66

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PAN+PSLRG+EVID AKA LE L    VSCADILAFAARDS    G   Y V
Sbjct  67    GNPSEKEHPANDPSLRGYEVIDKAKAELEHLYPQTVSCADILAFAARDSTYKLGSINYAV  126

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   NLPPPS +  QL   F+ KG + +EMVT+SGAH+IG SHC+SF
Sbjct  127   PAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTVSGAHSIGVSHCSSF  186

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLYSFN+T  QDPSL+P+ A++LK +CP     ++  VP+D  +    D  YYTN+  
Sbjct  187   SNRLYSFNATHKQDPSLEPKLASELKAKCPNNGGTSDPTVPLDFVTANRLDNKYYTNLKK  246

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RG+ TSDQTL   PSTA+ VR+NA    +W  KFAAAMVKMG I VLTG+ GEIR NCR
Sbjct  247   HRGVLTSDQTLFNSPSTAHIVRRNANHGGAWASKFAAAMVKMGSIDVLTGSQGEIRRNCR  306

Query  269   VV  264
             V+
Sbjct  307   VL  308



>ref|XP_002465968.1| hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
 gb|EER92966.1| hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
Length=333

 Score =   365 bits (937),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 220/305 (72%), Gaps = 3/305 (1%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             +A+LQVGFY   C  AE+IV++EV KA   + GVAAGL+R+HFHDCFVRGCDGSVL+DST
Sbjct  31    RAQLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDGSVLLDST  90

Query  992   ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
             A N AEKD+ A N SLRGFEVIDSAK RLE  C GVVSCADILAFAARD++ + GG  Y 
Sbjct  91    AGNQAEKDA-APNASLRGFEVIDSAKTRLEQACFGVVSCADILAFAARDALALVGGNAYQ  149

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             VPAGRRDG VS A E   NLPPP+ +V +L  +F  KG TQ +MV LSGAHT+G + C+S
Sbjct  150   VPAGRRDGNVSSAQEAGANLPPPTASVSRLNQVFGAKGLTQADMVALSGAHTVGAARCSS  209

Query  632   FNNRLYSFN-STTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             FN RLYS+  S   QDPS+DP Y A L Q+CPQ    ++  VPMDP +P   D +YY N+
Sbjct  210   FNGRLYSYGPSGAGQDPSMDPAYLAALTQQCPQ-VQGSDPAVPMDPVTPTTFDTNYYANL  268

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             +A RGL  SDQ LL DP+TA +V     SP ++   F AAM+KMG I VLTG AG IR N
Sbjct  269   VAKRGLLASDQALLADPTTAAQVVGYTNSPATFQTDFVAAMLKMGNIEVLTGTAGTIRTN  328

Query  275   CRVVN  261
             CRV +
Sbjct  329   CRVAS  333



>ref|XP_009411413.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=324

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 228/318 (72%), Gaps = 5/318 (2%)
 Frame = -1

Query  1211  STLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCF  1032
             + +A+L    +  +A L+VGFYS SC +AE IVK+E+ KA   D+G+ + L+RMHFHDCF
Sbjct  11    AIIAVLCLSAMGTEAYLKVGFYSYSCPKAEEIVKEELDKALQEDKGIGSDLLRMHFHDCF  70

Query  1031  VRGCDGSVLIDSTASNTAEKD-SPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             VRGCDGS+LIDST  N AEKD  P       GFEVID  K RLE+ CKG VSCADILAF 
Sbjct  71    VRGCDGSLLIDSTKDNAAEKDGKPNETVEDEGFEVIDKVKERLEAECKGTVSCADILAFL  130

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARDSV   GG  Y VPAGRRDGR+S +++  + LPPP+F +  LT LF +KG ++++MV 
Sbjct  131   ARDSVAHYGGVHYPVPAGRRDGRISRSNDTID-LPPPTFKLGNLTKLFVSKGLSRDDMVA  189

Query  674   LSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPF  495
             LSGAHTIG +HC++F++RLY+F+ T   DPSL P YAAQL+ +CP G+ N    V MDP 
Sbjct  190   LSGAHTIGIAHCSAFSDRLYNFSQTVKADPSLGPNYAAQLRGQCPTGSDNE---VDMDPP  246

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             SP   D SYY N+LA+RGLFTSDQTL++   TA  V++ A  P  +  KFAAAMVKMG I
Sbjct  247   SPLTFDSSYYKNLLAHRGLFTSDQTLMSKHGTATLVKRFAKKPALFKKKFAAAMVKMGSI  306

Query  314   SVLTGNAGEIRANCRVVN  261
              VLTG  GEIR NCRVVN
Sbjct  307   GVLTGEQGEIRTNCRVVN  324



>gb|KCW58172.1| hypothetical protein EUGRSUZ_H00889, partial [Eucalyptus grandis]
Length=329

 Score =   364 bits (935),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 210/292 (72%), Gaps = 0/292 (0%)
 Frame = -1

Query  1157  VGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTA  978
             VGFY  +C  AE IV+  + +AF  D G+AA  +RM+FHDCFVRGCD S+L++ST  NTA
Sbjct  37    VGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTA  96

Query  977   EKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGR  798
             EKDSP NNPSL GF+VID AKARLE+ C   VSCADI+AFAARDSV   G   YDVP+GR
Sbjct  97    EKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGR  156

Query  797   RDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRL  618
             RDGR+S ASE+  NLPPP+F VPQL   F+ KGF+ +EMVTLSGAH+IG SHC+SF+NRL
Sbjct  157   RDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRL  216

Query  617   YSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANRGL  438
             YSFN+T  QDP LDP+YAA LK +CPQGNS  +  V +D  +P   D  YY  +L  RGL
Sbjct  217   YSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGL  276

Query  437   FTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             F+SD+ L T   T   V  NA     WG KF  AMVK+G + VLTG  GEIR
Sbjct  277   FSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIR  328



>ref|XP_010032731.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score =   364 bits (935),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 219/318 (69%), Gaps = 0/318 (0%)
 Frame = -1

Query  1214  YSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             +  + LL   L    A LQVGFY  +C   E +V+  V KA   + G+ AGL+RMHFHDC
Sbjct  10    FCVIFLLVAMLNSGSATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDC  69

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCD S+L+DST  N AEK+ PANNPSLRG+EVID AKA LE LC   VSCADILAFA
Sbjct  70    FVRGCDASILLDSTPGNPAEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFA  129

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARDS    G   Y VPAGRRDG VSL  E   NLPPPS +  QL   F+ KG + +EMVT
Sbjct  130   ARDSTYKLGSINYAVPAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVT  189

Query  674   LSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPF  495
             LSGAH++G SHC+SF+ RL SFN+T  QDPS++P+ A++LK +C      ++  VP+D  
Sbjct  190   LSGAHSVGVSHCSSFSTRLSSFNATHKQDPSMEPRMASELKAKCLNNGGASDPTVPLDFA  249

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             +P   D  YYTN+  +RG+ TSDQTL   PSTA  VR++A    +W  KFAAAMVKMG I
Sbjct  250   TPNRLDNKYYTNLKDHRGVLTSDQTLFDSPSTAYIVRKHANHGGAWANKFAAAMVKMGSI  309

Query  314   SVLTGNAGEIRANCRVVN  261
              +LTGN GEIR NCRVVN
Sbjct  310   DILTGNQGEIRRNCRVVN  327



>ref|XP_009629163.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=346

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 216/307 (70%), Gaps = 3/307 (1%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             K+   VGFY  SC  AE I++  V KA + + G AAG++RMHFHDCF+RGCDGSVL+DS 
Sbjct  40    KSTFGVGFYKRSCPAAEAIIRKAVFKAVLMNPGTAAGIIRMHFHDCFIRGCDGSVLLDSV  99

Query  992   -ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
                 TAEKDSP NNPSLRGFEVID AKA LE +C   VSCADILAFAARDS    GG  Y
Sbjct  100   RGKETAEKDSPINNPSLRGFEVIDEAKALLEKVCPRTVSCADILAFAARDSALFAGGISY  159

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              +P GRRDGR+SL+SE+  NLPPP FN  QL + F  KG + +EMVTLSGAH+IGR+HC+
Sbjct  160   ALPGGRRDGRISLSSEVIQNLPPPFFNAQQLQDNFKRKGLSLDEMVTLSGAHSIGRTHCS  219

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL--VVPMDPFSPAITDVSYYT  462
             SF+NRLY FN+T  QDPSLDP+YA+ LK +CP+  S+  +  +V +D  +P   D  YY 
Sbjct  220   SFSNRLYGFNATHPQDPSLDPRYASFLKNKCPRPISDTQVDPIVNLDISTPNRLDNKYYL  279

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+  ++GL TSDQTL   P T+  V  N     +W  KFAAAMV MG I VLTGN GEIR
Sbjct  280   NLKNHKGLLTSDQTLFESPLTSKLVFNNVKYGSTWARKFAAAMVHMGSIEVLTGNKGEIR  339

Query  281   ANCRVVN  261
              NC  VN
Sbjct  340   KNCHFVN  346



>ref|XP_004985934.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/331 (56%), Positives = 224/331 (68%), Gaps = 2/331 (1%)
 Frame = -1

Query  1250  EMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGV  1071
             E   SR R         ++       +A+LQVGFY   C  AE+IV++EV KA   + GV
Sbjct  2     EARGSRERAARLLRLWVVVMAAAAGARAQLQVGFYDMLCPAAEIIVQEEVSKAVSGNPGV  61

Query  1070  AAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCK  891
             AA LVR+HFHDCFVRGCD SVL+DST  N AEKD+  N  SLRGFEVIDSAK RLE  C 
Sbjct  62    AASLVRLHFHDCFVRGCDASVLLDSTPGNQAEKDASPNT-SLRGFEVIDSAKTRLEQACY  120

Query  890   GVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLF  711
             GVVSCAD+LAFAARD++ + GG  Y VP+GRRDG VS+A E   NLPPP+ +V QL  +F
Sbjct  121   GVVSCADVLAFAARDALALVGGNAYQVPSGRRDGNVSVAQETSGNLPPPTASVSQLNQIF  180

Query  710   SNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP-QG  534
              +KG TQ +MV LSGAHTIG +HC+SF++RLY++     QDPS+DP Y A L Q+CP Q 
Sbjct  181   GSKGLTQADMVALSGAHTIGNAHCSSFDSRLYAYGPNAGQDPSMDPSYLAALTQQCPNQS  240

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
                 +  V MDP +P   D +YY +I+A RGL  SDQ LL DP+TA +V     SP ++ 
Sbjct  241   GGGPDGTVAMDPVTPTAFDTNYYASIVAKRGLLASDQALLADPTTAAQVVAYTNSPDTFQ  300

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               FAAAMVKMG I VLTG AG IR NCRV +
Sbjct  301   ADFAAAMVKMGAIGVLTGTAGTIRTNCRVAS  331



>ref|XP_007207711.1| hypothetical protein PRUPE_ppa025326mg [Prunus persica]
 gb|EMJ08910.1| hypothetical protein PRUPE_ppa025326mg [Prunus persica]
Length=320

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 227/319 (71%), Gaps = 2/319 (1%)
 Frame = -1

Query  1211  STLALLTCQLIVLKAEL--QVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             S +  L   ++V  A    +VGFY  SC  AE IV+  V KA   + G+AAGL+RMHFHD
Sbjct  2     SLIFFLAMFMVVFMASAAPKVGFYQRSCPSAEAIVRKAVNKAVAKNPGIAAGLIRMHFHD  61

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCD S+L+DST    +EK+ PANNPSLRGFEVID AKA +E+ C   VSCADILAF
Sbjct  62    CFVRGCDASILLDSTPGQPSEKEHPANNPSLRGFEVIDEAKAEIEAKCPKTVSCADILAF  121

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARDS    GG  YDVP+GRRDGRVSL  E   +LPPPSFN  QL + F+ KG + +EMV
Sbjct  122   AARDSALKVGGINYDVPSGRRDGRVSLQDEPTQHLPPPSFNAKQLEDSFARKGLSLDEMV  181

Query  677   TLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDP  498
             TLSGAH+IG SHC+SF++RLY FN+T  QDPS+DP +A  LK++CP+ ++N  + VP+D 
Sbjct  182   TLSGAHSIGVSHCSSFSDRLYFFNATHPQDPSMDPIFARNLKKKCPRSSNNDRVTVPLDV  241

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              +P   D  YYT++  + GL TSDQTLLT  STA  VR NA    +W  KFAAAMVKMG 
Sbjct  242   LTPNRLDNKYYTDLKNHHGLLTSDQTLLTSRSTAGIVRNNARFGAAWANKFAAAMVKMGS  301

Query  317   ISVLTGNAGEIRANCRVVN  261
             I VLTG  GEIR NC+VVN
Sbjct  302   IDVLTGRQGEIRNNCKVVN  320



>ref|XP_011092685.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=335

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 215/306 (70%), Gaps = 3/306 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VG+Y  SC  AE IV+  V+KA   + G+ AGL+RMHFHDCFVRGCD SVL+DST 
Sbjct  30    ASLRVGYYQNSCPSAEAIVRKVVEKAVSRNLGLGAGLIRMHFHDCFVRGCDASVLLDSTP  89

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
                +EK  PANNPSLRGFEVID AKA LE  C   VSCADI+AFAARDS    G   Y V
Sbjct  90    GRRSEKQHPANNPSLRGFEVIDEAKAELEFACPRTVSCADIIAFAARDSAYRLGNIKYMV  149

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGR+SL  ++  NLPPPSFN  QL   F+ KG T EEMVTLSGAH++G SHC+SF
Sbjct  150   PSGRRDGRISLEDDVTANLPPPSFNAAQLEQNFARKGLTMEEMVTLSGAHSVGVSHCSSF  209

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGN---SNANLVVPMDPFSPAITDVSYYTN  459
             +NRLYSFNST  QDPSLDP  A +L++ CP+ +    N++ VV +D  +P   D  YY N
Sbjct  210   SNRLYSFNSTHPQDPSLDPDLARELRKSCPRPDGEAGNSDRVVALDFATPNRLDNRYYLN  269

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             + + R L TSDQTLL+   +   VR+NA    SW  KFA AMVKMG I VLTGN GEIR 
Sbjct  270   LKSGRVLLTSDQTLLSSARSGWMVRRNAKHGASWAGKFADAMVKMGYIDVLTGNQGEIRN  329

Query  278   NCRVVN  261
             NCR VN
Sbjct  330   NCRFVN  335



>ref|XP_002450360.1| hypothetical protein SORBIDRAFT_05g004180 [Sorghum bicolor]
 gb|EES09348.1| hypothetical protein SORBIDRAFT_05g004180 [Sorghum bicolor]
Length=340

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 218/307 (71%), Gaps = 5/307 (2%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             EL+VGFY  SC +AE IV++ V++    D GV AGL+RMHFHDCFVRGCD S+LI+ST  
Sbjct  31    ELEVGFYKHSCPKAESIVRNAVRRGIARDAGVGAGLIRMHFHDCFVRGCDASILINSTPR  90

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARD   + GG  Y VP
Sbjct  91    NKAEKDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIIAFAARDGAYLAGGLDYKVP  150

Query  806   AGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             +GRRDGRVS   E+  NN+P P  +V +L   F  KG   ++MVTLSGAHTIGRSHC+SF
Sbjct  151   SGRRDGRVSKEDEVLDNNVPAPFDDVAELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSF  210

Query  629   NNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYYT  462
               RLY+F+    + DPSLDP YA  LK RCP  +SN  +   VVP+DP +PA  D  YY 
Sbjct  211   TQRLYNFSGQLGRTDPSLDPTYAEHLKMRCPWPSSNGQMDPTVVPLDPVTPATFDNQYYK  270

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+LA++GLF SD TLL +P TA  V  NA    +W +KFA AMVKMG++ VLTG+ GEIR
Sbjct  271   NVLAHKGLFVSDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIR  330

Query  281   ANCRVVN  261
               C VVN
Sbjct  331   EKCFVVN  337



>gb|KHN30703.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 222/323 (69%), Gaps = 1/323 (0%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             ML   S+L L+     +  A L+VGFYS +C  AE IV+  V KA   + G+AAGL+RMH
Sbjct  6     MLQMVSSLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDNAGIAAGLIRMH  65

Query  1046  FHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             FHDCFVRGCDGSVL+ ST  N  AE+D  ANNPSLRGFEVI+ AK +LE+ C   VSCAD
Sbjct  66    FHDCFVRGCDGSVLLASTPGNPVAERDHFANNPSLRGFEVIEEAKTQLEAACPQTVSCAD  125

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDS    GG  YDVP+GRRDGR+S+A E+P NLP P+ +  +L + FS KG + 
Sbjct  126   ILAFAARDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSSAHELVSNFSRKGLSA  185

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVV  510
             +EMVTLSGAH+IG SHC++F+ RLYSFN T  QDPS+D  YA  LK  CP   S  +  V
Sbjct  186   DEMVTLSGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSNCPAPPSTTDSTV  245

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
              +DP +P   D  YY  ++ +RGL TSDQTL T  +T   V+ NA +  SW  KFA AMV
Sbjct  246   SLDPSTPIRLDNKYYEGLINHRGLLTSDQTLYTSQTTREMVQSNANNGASWAEKFAKAMV  305

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
             +MG I VLTG+ GEIR  C +VN
Sbjct  306   QMGSIEVLTGSDGEIRRRCSLVN  328



>ref|XP_003535856.1| PREDICTED: peroxidase 5-like [Glycine max]
 ref|XP_003535859.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=324

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 223/324 (69%), Gaps = 4/324 (1%)
 Frame = -1

Query  1232  IRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             + ML   S+LAL+   L +  A L+V FY  +C  AE IVK  V KA   + G+AAGL+R
Sbjct  5     LHMLIMLSSLALIISVLPLASASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIR  64

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHDCFVRGCDGSVL++ST  N +E++ PANNPSLRGFEVID AKA +E+ C   VSCA
Sbjct  65    MHFHDCFVRGCDGSVLLESTQGNPSEREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCA  124

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDS    GG  Y VPAGRRDGRVS   E  + LP P+FN  QL + F  KG +
Sbjct  125   DILAFAARDSSNKVGGINYVVPAGRRDGRVSNRDEA-SQLPRPTFNTQQLISNFEQKGLS  183

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
              +EMVTLSGAH+IG SHC+SF++RLYSFN+T  QDPS+D ++A  LK +CP  + N    
Sbjct  184   ADEMVTLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDTKFATSLKSKCPPRSDN---T  240

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             V +D  SP   D +YYT +  +RGL TSDQTLLT PST   V  NA    +W  KFA AM
Sbjct  241   VELDASSPNRLDNNYYTMLNNHRGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAM  300

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             V MG I VLTG+ GEIR  C VVN
Sbjct  301   VHMGSIEVLTGSQGEIRTRCSVVN  324



>gb|KHN29593.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 222/323 (69%), Gaps = 1/323 (0%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             ML   S+L L+     +  A L+VGFYS +C  AE IV+  V KA     G+AAGL+RMH
Sbjct  6     MLQMVSSLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISHKAGIAAGLIRMH  65

Query  1046  FHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             FHDCFVRGCDGSVL+ ST  N  AE+D+ ANNPSLRGFEVI+ AK +LE+ C   VSCAD
Sbjct  66    FHDCFVRGCDGSVLLASTPGNPVAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCAD  125

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDS    GG  YDVP+GRRDGR+S+A E+P NLP P+    +L + FS KG + 
Sbjct  126   ILAFAARDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSA  185

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVV  510
             +EMVTLSGAH+IG SHC++F+ RLYSFN T  QDPS+D  YA  LK  CP   S  +  V
Sbjct  186   DEMVTLSGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTV  245

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
              +DP +P   D  YY  ++ +RGL TSDQTL T  +T   V+ NA +  SW  KFA AMV
Sbjct  246   SLDPSTPIRLDNKYYEGLINHRGLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMV  305

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
             +MG I VLTG+ GEIR +C +VN
Sbjct  306   QMGSIEVLTGSDGEIRRHCSLVN  328



>ref|XP_003536264.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 222/323 (69%), Gaps = 1/323 (0%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             ML   S+L L+     +  A L+VGFYS +C  AE IV+  V KA   + G+AAGL+RMH
Sbjct  6     MLQMVSSLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDNAGIAAGLIRMH  65

Query  1046  FHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             FHDCFVRGCDGSVL+ ST  N  AE+D  ANNPSLRGFEVI+ AK +LE+ C   VSCAD
Sbjct  66    FHDCFVRGCDGSVLLASTPGNPVAERDHFANNPSLRGFEVIEEAKTQLEAACPQTVSCAD  125

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDS    GG  YDVP+GRRDGR+S+A E+P NLP P+ +  +L + FS KG + 
Sbjct  126   ILAFAARDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSSAHELVSNFSRKGLSA  185

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVV  510
             +EMVTLSGAH+IG SHC++F+ RLYSFN T  QDPS+D  YA  LK  CP   S  +  V
Sbjct  186   DEMVTLSGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSNCPAPPSTIDSTV  245

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
              +DP +P   D  YY  ++ +RGL TSDQTL T  +T   V+ NA +  SW  KFA AMV
Sbjct  246   SLDPSTPIRLDNKYYEGLINHRGLLTSDQTLYTSQTTREMVQSNANNGASWAEKFAKAMV  305

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
             +MG I VLTG+ GEIR  C +VN
Sbjct  306   QMGSIEVLTGSDGEIRRRCSLVN  328



>gb|KHN00317.1| Peroxidase 5 [Glycine soja]
 gb|KHN00320.1| Peroxidase 5 [Glycine soja]
Length=318

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 222/322 (69%), Gaps = 4/322 (1%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             ML   S+LAL+   L +  A L+V FY  +C  AE IVK  V KA   + G+AAGL+RMH
Sbjct  1     MLIMLSSLALIISVLPLASASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMH  60

Query  1046  FHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADI  867
             FHDCFVRGCDGSVL++ST  N +E++ PANNPSLRGFEVID AKA +E+ C   VSCADI
Sbjct  61    FHDCFVRGCDGSVLLESTQGNPSEREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADI  120

Query  866   LAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQE  687
             LAFAARDS    GG  Y VPAGRRDGRVS   E  + LP P+FN  QL + F  KG + +
Sbjct  121   LAFAARDSSNKVGGINYVVPAGRRDGRVSNRDEA-SQLPRPTFNTQQLISNFEQKGLSAD  179

Query  686   EMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVP  507
             EMVTLSGAH+IG SHC+SF++RLYSFN+T  QDPS+D ++A  LK +CP  + N    V 
Sbjct  180   EMVTLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDTKFATSLKSKCPPRSDN---TVE  236

Query  506   MDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVK  327
             +D  SP   D +YYT +  +RGL TSDQTLLT PST   V  NA    +W  KFA AMV 
Sbjct  237   LDASSPNRLDNNYYTMLNNHRGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVH  296

Query  326   MGQISVLTGNAGEIRANCRVVN  261
             MG I VLTG+ GEIR  C VVN
Sbjct  297   MGSIEVLTGSQGEIRTRCSVVN  318



>ref|XP_008673305.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF83711.1| unknown [Zea mays]
 tpg|DAA43003.1| TPA: peroxidase 66 [Zea mays]
Length=329

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 216/304 (71%), Gaps = 3/304 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +LQVGFY   C  AE+IV++EV KA   + GVAAGL+R+HFHDCFVRGCD SVL+DS+A 
Sbjct  27    QLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDASVLLDSSAG  86

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKD+ A N SLRGFEVIDSAK RLE  C GVVSCAD+LAFAARD++ + GG  Y VP
Sbjct  87    NQAEKDA-APNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVP  145

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             AGRRDG VS A E   NLPPP+ +  QLT  F  KG +Q EMV LSGAHT+G + C+SF 
Sbjct  146   AGRRDGNVSSAQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFA  205

Query  626   NRLYSFN-STTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYTNIL  453
              RLYS+  S   QDPS+DP Y A L Q+C PQG   A+  +PMDP +P   D +YY N++
Sbjct  206   PRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPLPMDPVTPTAFDTNYYANLV  265

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
             A RGL  SDQ LL DP+TA +V     SP ++   F AAM+KMG I VLTG AG +R NC
Sbjct  266   ARRGLLASDQALLADPATAAQVLAYTNSPATFQTDFVAAMIKMGAIQVLTGTAGTVRTNC  325

Query  272   RVVN  261
             RV +
Sbjct  326   RVAS  329



>ref|XP_002530462.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
 gb|EEF31932.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
Length=331

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 214/303 (71%), Gaps = 1/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L VGFY  SC  AE IV+  V K    + G+ AGL+RMHFHDCFVRGCD SVL+DST 
Sbjct  30    ASLSVGFYRSSCPSAEAIVRRAVNKLVSRNPGLGAGLIRMHFHDCFVRGCDASVLLDSTP  89

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +E++  ANNPSLRGFEVI+ AKA++ES+C   VSCADILAFAARDS    GG  Y V
Sbjct  90    GNPSEREHVANNPSLRGFEVINEAKAQIESICPKTVSCADILAFAARDSSFKLGGINYAV  149

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGRVS   E+  NLPP  FN  QLT+ F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  150   PAGRRDGRVSNVDEVAQNLPPFFFNAQQLTDNFARKGMSADEMVTLSGAHSIGISHCSSF  209

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             + RLYSFN+T  QDPS+DP+YAA LK +CP  ++N +  VP+DP +P   D  YY  +  
Sbjct  210   SGRLYSFNATYPQDPSMDPRYAAFLKTKCPPPSNNGDPTVPLDP-TPNRMDNKYYIELTR  268

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGL TSDQTL+  PST   V  NA +  +W  KFA AMV MG + VLTG  GEIR  C 
Sbjct  269   NRGLLTSDQTLMNSPSTQRMVVNNARNGATWAAKFAKAMVHMGSLDVLTGTQGEIRTQCS  328

Query  269   VVN  261
             VVN
Sbjct  329   VVN  331



>gb|ACN25837.1| unknown [Zea mays]
 tpg|DAA46079.1| TPA: hypothetical protein ZEAMMB73_352661 [Zea mays]
Length=319

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 226/305 (74%), Gaps = 8/305 (3%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L+A+L+VGFY  SC  AE+IV+ EV +A   + G+AAGL+R+HFHDCFV GCD SVLIDS
Sbjct  20    LRAQLRVGFYDSSCPAAEIIVQQEVSRAVAANPGLAAGLLRLHFHDCFVGGCDASVLIDS  79

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  NTAEKD+   N SLRGFEV+D  KAR+E  C GVVSCADILAFAARDSV + GG  Y
Sbjct  80    TKGNTAEKDA-GPNLSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALAGGNAY  138

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDG VS AS+  +NLPPP+ NV QLT +F  KG TQ+EMV LSGAHTIG SHC+
Sbjct  139   QVPAGRRDGSVSRASDT-SNLPPPTANVAQLTQIFGTKGLTQKEMVILSGAHTIGSSHCS  197

Query  635   SFNNRLYSFNSTTV--QDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYT  462
             SF+ RL S ++TT   QDP++DP Y AQL ++CPQG    + +VPMD  SP   D  +Y 
Sbjct  198   SFSGRL-SGSATTAGGQDPTMDPAYVAQLARQCPQGG---DPLVPMDYVSPNAFDEGFYK  253

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
              ++ANRGL +SDQ LL+D +TA +V   A  P ++   FAAAMVKMG + VLTG +G++R
Sbjct  254   GVMANRGLLSSDQALLSDKNTAVQVVTYANDPATFQADFAAAMVKMGSVGVLTGTSGKVR  313

Query  281   ANCRV  267
             ANCRV
Sbjct  314   ANCRV  318



>ref|XP_003534685.2| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 222/323 (69%), Gaps = 1/323 (0%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             ML   S+L L+     +  A L+VGFYS +C  AE IV+  V KA     G+AAGL+RMH
Sbjct  6     MLQMVSSLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDKAGIAAGLIRMH  65

Query  1046  FHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             FHDCFVRGCDGSVL+ ST  N  AE+D+ ANNPSLRGFEVI+ AK +LE+ C   VSCAD
Sbjct  66    FHDCFVRGCDGSVLLASTPGNPVAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCAD  125

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDS    GG  YDVP+GRRDGR+S+A E+P NLP P+    +L + FS KG + 
Sbjct  126   ILAFAARDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSA  185

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVV  510
             +EMVTLSGAH+IG SHC++F+ RLYSFN T  QDPS+D  YA  LK  CP   S  +  V
Sbjct  186   DEMVTLSGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTV  245

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
              +DP +P   D  YY  ++ +RGL TSDQTL T  +T   V+ NA +  SW  KFA AMV
Sbjct  246   SLDPSTPIRLDNKYYEGLINHRGLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMV  305

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
             +MG I VLTG+ GEIR +C +VN
Sbjct  306   QMGSIEVLTGSDGEIRRHCSLVN  328



>gb|ACU20445.1| unknown [Glycine max]
Length=324

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 222/324 (69%), Gaps = 4/324 (1%)
 Frame = -1

Query  1232  IRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             + ML   S+LAL+   L +  A L+V FY  +C  AE IVK  V KA   + G+AAGL+R
Sbjct  5     LHMLIMLSSLALIISVLPLASASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIR  64

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHDCFVRGCDGSVL++ST  N +E++ PANNPSLRGFEVID AKA +E+ C   VSCA
Sbjct  65    MHFHDCFVRGCDGSVLLESTQGNPSEREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCA  124

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDS    GG  Y VPAGRRDGRVS   E  + LP P+FN  QL + F  KG +
Sbjct  125   DILAFAARDSSNKVGGINYVVPAGRRDGRVSNRDEA-SQLPRPTFNTQQLISNFEQKGLS  183

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
              +EMVTLSGAH+IG SHC+SF++RLYSFN T  QDPS+D ++A  LK +CP  + N    
Sbjct  184   ADEMVTLSGAHSIGVSHCSSFSDRLYSFNVTFPQDPSMDTKFATSLKSKCPPRSDN---T  240

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             V +D  SP   D +YYT +  +RGL TSDQTLLT PST   V  NA    +W  KFA AM
Sbjct  241   VELDASSPNRLDNNYYTMLNNHRGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAM  300

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             V MG I VLTG+ GEIR  C VVN
Sbjct  301   VHMGSIEVLTGSQGEIRTRCSVVN  324



>ref|XP_010921346.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=328

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 228/326 (70%), Gaps = 3/326 (1%)
 Frame = -1

Query  1229  RMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             R  S ++ +A++     +  A LQVGFY   C  AE IV+  V +A   + G+AAGLVRM
Sbjct  3     RPSSSFAFIAVMLMMTTMSSATLQVGFYLSRCPAAESIVRRTVTEAVAKNPGIAAGLVRM  62

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCD SVL+DST  N AEK+SPANNPSLRGFEVID AKA +E+ C   VSCAD
Sbjct  63    HFHDCFVRGCDASVLLDSTPGNPAEKESPANNPSLRGFEVIDKAKAEIEAQCPQTVSCAD  122

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARD     GG  Y VPAGRRDGR+SL S++  N+P P F V QL   F+ KG + 
Sbjct  123   ILAFAARDGAFRAGGIDYTVPAGRRDGRISLESDVLQNIPAPFFTVDQLQQNFARKGLSL  182

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA---N  519
             +EMVTLSGAH+IG SHC+SF+NRLYSFN+T  QDPSL+P +AA LK +CP  +S     +
Sbjct  183   DEMVTLSGAHSIGVSHCSSFSNRLYSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGAGQD  242

Query  518   LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAA  339
               VP+D  +P   D  YY N+  N+GL TSDQ+L++DPST   VR NA     W  KFAA
Sbjct  243   ATVPLDIVTPNRLDNRYYKNLRNNKGLLTSDQSLMSDPSTKTIVRNNANRGAEWAAKFAA  302

Query  338   AMVKMGQISVLTGNAGEIRANCRVVN  261
             AMV+MG I VLTG  GEIR NCR+VN
Sbjct  303   AMVQMGSIEVLTGTQGEIRKNCRLVN  328



>gb|KCW52185.1| hypothetical protein EUGRSUZ_J01614, partial [Eucalyptus grandis]
Length=307

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/301 (58%), Positives = 212/301 (70%), Gaps = 0/301 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C   E +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  7     ATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  66

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AEK+ PANNPSLRG+EVID AKA LE LC   VSCADILAFAARDS    G   Y V
Sbjct  67    GNPAEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINYAV  126

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDG VSL  E   NLPPPS +  QL   F+ KG + +EMVTLSGAH++G SHC+SF
Sbjct  127   PAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSVGVSHCSSF  186

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             + RL SFN+T  QDPS++P+ A++LK +C      ++  VP+D  +P   D  YYTN+  
Sbjct  187   STRLSSFNATHKQDPSMEPRMASELKAKCLNNGGASDPTVPLDFATPNRLDNKYYTNLKD  246

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RG+ TSDQTL   PSTA  VR++A    +W  KFAAAMVKMG I +LTGN GEIR NCR
Sbjct  247   HRGVLTSDQTLFDSPSTAYIVRKHANHGGAWANKFAAAMVKMGSIDILTGNQGEIRRNCR  306

Query  269   V  267
             V
Sbjct  307   V  307



>ref|XP_011077203.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=463

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/304 (61%), Positives = 217/304 (71%), Gaps = 2/304 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +LQVG+Y+ +C  AE+IV+  V+KA   + G+AAGL+RMHFHDCFVRGCDGSVL+DS   
Sbjct  160   KLQVGYYAKTCPYAEIIVRQAVEKAVSKNPGIAAGLIRMHFHDCFVRGCDGSVLLDSVPG  219

Query  986   N-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
                AEK SP N PSLRGFEVID AKA +E+ C G VSCADILAFAARDS    G  GYDV
Sbjct  220   KPAAEKASPINFPSLRGFEVIDEAKALIEAKCPGTVSCADILAFAARDSALKVGWIGYDV  279

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVSL+SE+  NLPPP F   QL + F  KG + +EMVTLSGAH+IG SHC+SF
Sbjct  280   PSGRRDGRVSLSSEVVQNLPPPFFTASQLRDNFKRKGLSLDEMVTLSGAHSIGVSHCSSF  339

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ-GNSNANLVVPMDPFSPAITDVSYYTNIL  453
             +NRL  FN+T  QDPSLDP +AA LK RCP  G+SN++ VV  D  +P   D  YY N+ 
Sbjct  340   SNRLSGFNATFNQDPSLDPGFAAFLKSRCPAPGSSNSDPVVNNDVLTPNQLDNKYYVNLK  399

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
              ++GL TSDQTL   P T+  V  N      W  KFAAAMV MG I VLTG  GEIR NC
Sbjct  400   NHKGLLTSDQTLFDSPLTSKLVVNNVKYGSVWAKKFAAAMVHMGSIDVLTGKKGEIRRNC  459

Query  272   RVVN  261
             RVVN
Sbjct  460   RVVN  463



>ref|XP_006840292.1| hypothetical protein AMTR_s00045p00063130 [Amborella trichopoda]
 gb|ERN01967.1| hypothetical protein AMTR_s00045p00063130 [Amborella trichopoda]
Length=334

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 224/334 (67%), Gaps = 12/334 (4%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLK-----------AELQVGFYSGSCGRAELIVKDEVQKAFVCD  1080
             M S   TL  L C L+              + L+VGFY  SC  AE +V+  V KA   D
Sbjct  1     MRSGAGTLMALICFLVFAHIVSMGDAHGHGSSLKVGFYRRSCPSAEAVVRRTVAKAIARD  60

Query  1079  RGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLES  900
              G+AAGL+R+HFHDCFVRGCD SVL+DST  N +EK+SPAN PSLRG EVID AKA LES
Sbjct  61    PGLAAGLIRLHFHDCFVRGCDASVLLDSTPGNPSEKESPANAPSLRGDEVIDEAKAILES  120

Query  899   LCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLT  720
              C   VSCADILAFAARDS    G   Y VPAGRRDGRVS+  E+  NLP P  ++ QL 
Sbjct  121   QCPQTVSCADILAFAARDSAHQVGRINYLVPAGRRDGRVSIEREVLQNLPAPFDDLKQLQ  180

Query  719   NLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP  540
               FS+KG + E+MVTLSGAH+IGRS C SF +RLY+F+S   QDP+LD  YA+ LK +CP
Sbjct  181   ANFSSKGLSLEDMVTLSGAHSIGRSFCPSFTDRLYNFDSPDGQDPTLDQAYASYLKTKCP  240

Query  539   QGNSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPIS  360
                +  ++ V MDP SP + D  YY N+  NRGL  SDQ L+T P+TA  VRQNA  P  
Sbjct  241   -APATPDVTVAMDPLSPNVLDNKYYINLRMNRGLLASDQALMTSPATARMVRQNAHYPGL  299

Query  359   WGLKFAAAMVKMGQISVLTGNAGEIRANCRVVNS  258
             W  KF +AMV+MG I VLTG+ GEIR +CRVVN+
Sbjct  300   WAHKFGSAMVRMGFIDVLTGSKGEIRRSCRVVNT  333



>ref|XP_010671315.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 221/307 (72%), Gaps = 5/307 (2%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             +A LQVGFY   C  AE I+KDEV K+F+ D+G+A G+ R+ FHDCFVRGCDGS+LIDST
Sbjct  18    EATLQVGFYRDKCPFAEAIIKDEVTKSFLKDQGIAPGITRLQFHDCFVRGCDGSILIDST  77

Query  992   ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
              +N AEKD P N  ++RGF V+D+AKAR+E++C GVVSCADILA+A RDSV +T G  +D
Sbjct  78    PTNQAEKDGPPNGITVRGFNVLDNAKARIEAVCNGVVSCADILAYATRDSVVLTKGLYWD  137

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             VPAGRRDGR+S ASE  +++P   FN+ Q+T  F+ KG TQ +MV LSGAHTIGRSHC S
Sbjct  138   VPAGRRDGRISRASE-TSDIPTAFFNLDQITQSFAKKGLTQSDMVALSGAHTIGRSHCFS  196

Query  632   FNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ---GNSNANLVVPMDPFSPAITDVSYYT  462
             F +RLY F++  +QDP+L+P YA  LK +CP+   G  N  LVV M+  SP + D SYY 
Sbjct  197   FTDRLYRFDTKMMQDPNLNPYYAQFLKLKCPRDVHGILNQTLVVFMNQ-SPLLMDQSYYG  255

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+L + GLF SDQ LL    TA +    A + + W   F  AM+KM QI VLTG  GEIR
Sbjct  256   NLLKHAGLFMSDQVLLDSQKTAQQAAIYAANGLIWQADFVKAMIKMSQIQVLTGEQGEIR  315

Query  281   ANCRVVN  261
             ANCRV+N
Sbjct  316   ANCRVIN  322



>ref|XP_010040180.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=337

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 216/311 (69%), Gaps = 10/311 (3%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VG+Y  +C  AE I+K  V  A   + G+AAGLVR+HFHDCFVRGCD SVL+ ST  N
Sbjct  27    LKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGN  86

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVE--------MTG  828
              AE+D PANNPSLRGFE+ID AKARLE+LC G VSCADI+AFAARDS +         TG
Sbjct  87    PAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFTG  146

Query  827   GFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGR  648
             G  YDVPAGRRDGRVS   E+  NLPPPSFN  QL   F+ KG + +EMVTLSGAH+IG 
Sbjct  147   GIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSIGI  206

Query  647   SHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC--PQGNSNANLVVPMDPFSPAITDV  474
             SHC+SF++RLY+FN+T  QDP+LD  YAA LK +C  P   +  +  VP+D  +    D 
Sbjct  207   SHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQPDPTVPLDSITANTLDN  266

Query  473   SYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNA  294
              YY  +L  RGL TSD+TL T PST+  V  N  +  +W  KFA AMVKMG I VLTGN 
Sbjct  267   KYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKFAKAMVKMGSIEVLTGNQ  326

Query  293   GEIRANCRVVN  261
             GEIR  C VVN
Sbjct  327   GEIRKVCSVVN  337



>gb|KDP37026.1| hypothetical protein JCGZ_06082 [Jatropha curcas]
Length=325

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 219/318 (69%), Gaps = 6/318 (2%)
 Frame = -1

Query  1199  LLTCQLIVLK-AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRG  1023
             +L C L  L  A L+VGFY  +C  AE IV+  V K    + G+ AGL+RMHFHDCFVRG
Sbjct  9     VLLCSLATLSSASLRVGFYKSTCPLAETIVRRAVNKFVSRNPGLGAGLIRMHFHDCFVRG  68

Query  1022  CDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDS  843
             CD SVL++ST  N +E++  ANNPSLRGFEVI+ AKA++E++C   VSCADILAFAARDS
Sbjct  69    CDASVLLESTPGNPSEREHIANNPSLRGFEVINEAKAQIEAICPQTVSCADILAFAARDS  128

Query  842   VEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGA  663
                 GG  Y VPAGRRDGR S  +E+  NLPPP FN  QL+  F+ KG + +EMVTLSGA
Sbjct  129   SNKLGGINYAVPAGRRDGRTSNINEVEQNLPPPFFNAEQLSQNFARKGMSVDEMVTLSGA  188

Query  662   HTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN----ANLVVPMDPF  495
             H+IG SHC+SF+NRLYSFNST  QDPS+D  YAA LK RCP  N+N    ++  V +DP 
Sbjct  189   HSIGISHCSSFSNRLYSFNSTHAQDPSMDSAYAAFLKTRCPPSNNNGGSTSDPTVALDP-  247

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             +P   D  YY  +  NRGL TSDQTL+  PST N V  NA +   W  KFA AMV MG +
Sbjct  248   TPNQMDNRYYMELKKNRGLLTSDQTLMNSPSTQNMVVNNARNSRVWAAKFAKAMVHMGSL  307

Query  314   SVLTGNAGEIRANCRVVN  261
              VLTG  GEIR  C VVN
Sbjct  308   DVLTGTQGEIRKQCSVVN  325



>gb|KCW45421.1| hypothetical protein EUGRSUZ_L00890 [Eucalyptus grandis]
Length=316

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 216/311 (69%), Gaps = 10/311 (3%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VG+Y  +C  AE I+K  V  A   + G+AAGLVR+HFHDCFVRGCD SVL+ ST  N
Sbjct  6     LKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGN  65

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVE--------MTG  828
              AE+D PANNPSLRGFE+ID AKARLE+LC G VSCADI+AFAARDS +         TG
Sbjct  66    PAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFTG  125

Query  827   GFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGR  648
             G  YDVPAGRRDGRVS   E+  NLPPPSFN  QL   F+ KG + +EMVTLSGAH+IG 
Sbjct  126   GIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSIGI  185

Query  647   SHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC--PQGNSNANLVVPMDPFSPAITDV  474
             SHC+SF++RLY+FN+T  QDP+LD  YAA LK +C  P   +  +  VP+D  +    D 
Sbjct  186   SHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQPDPTVPLDSITANTLDN  245

Query  473   SYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNA  294
              YY  +L  RGL TSD+TL T PST+  V  N  +  +W  KFA AMVKMG I VLTGN 
Sbjct  246   KYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKFAKAMVKMGSIEVLTGNQ  305

Query  293   GEIRANCRVVN  261
             GEIR  C VVN
Sbjct  306   GEIRKVCSVVN  316



>ref|XP_006358573.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=324

 Score =   359 bits (921),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 212/303 (70%), Gaps = 1/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+ G+Y  SC  AE IV+  V KA   + G+ AG++RMHFHDCFVRGCD S+L+D T 
Sbjct  23    ASLKTGYYHSSCPNAESIVRKAVNKAVSSNPGLGAGIIRMHFHDCFVRGCDASILLDPTP  82

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AEK+ PANNPSLRG+EVID AK  LES+C   VSC+DI+AFAARDS    GG  Y V
Sbjct  83    GNPAEKEHPANNPSLRGYEVIDEAKIELESVCPQTVSCSDIVAFAARDSAFKLGGIRYSV  142

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVS+  E   +LPP + N  +L   F+ KG + +EMVTLSGAH+IGRSHC+SF
Sbjct  143   PSGRRDGRVSIKDEPTAHLPPSTLNAKELEENFAKKGLSLDEMVTLSGAHSIGRSHCSSF  202

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             ++RLYSFNST  QDP++DP+ A QL +RCP+  S  + + P+D  +P   D  YY N+  
Sbjct  203   SDRLYSFNSTHPQDPTMDPKLAQQLMKRCPRP-STTDPIAPLDVDTPNRLDNKYYLNLRN  261

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGL TSDQTL   PSTA   R NA    +W  KFA AMVKMG I V+TG  GEIR NCR
Sbjct  262   NRGLLTSDQTLWNSPSTARMARSNAIHGANWAHKFADAMVKMGSIEVMTGMQGEIRKNCR  321

Query  269   VVN  261
              VN
Sbjct  322   FVN  324



>ref|XP_010921348.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 218/306 (71%), Gaps = 2/306 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VGFY  +C  AE IV++ V +A   + G AAGL+RMHFHDCFVRGCD SVL++ST 
Sbjct  16    ASLKVGFYEETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTP  75

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK++P NNPSLRGFEVID+AKA +E+ C   VSCADI+AFAARDS  +TGG  Y+V
Sbjct  76    GNPSEKEAPPNNPSLRGFEVIDAAKAAVEAKCPCKVSCADIIAFAARDSAYITGGNDYEV  135

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGR+SLASE  +N+P P+F   +L   F  KG T +EMVTLSGAH+IGRSHC+SF
Sbjct  136   PAGRRDGRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGRSHCSSF  195

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
               RLY+F++T  QDPS++P +AA LK RCP   ++ +    V +D  +P   D  YY N+
Sbjct  196   TTRLYNFSATQPQDPSMEPAFAAYLKTRCPPSTASPSDPTTVLLDAVTPTRLDNMYYRNL  255

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L +RG+ TSDQTL     T   V  NA    +W  KFA+AMVKMG I VLTG+ GEIR  
Sbjct  256   LKHRGVLTSDQTLQDSSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQGEIREK  315

Query  275   CRVVNS  258
             C VVNS
Sbjct  316   CWVVNS  321



>ref|XP_011077202.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=429

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 217/304 (71%), Gaps = 2/304 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VG+Y+ +C  AE+IV+  V+KA   + G+AAGL+RMHFHDCFVRGCDGSVL+DS   
Sbjct  126   KLKVGYYAKTCPYAEIIVRQAVEKAVSKNPGIAAGLIRMHFHDCFVRGCDGSVLLDSVPG  185

Query  986   N-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
                AEK SP N PSLRGFEV+D AKA +E+ C G VSCADILAFAARDS    G  GYDV
Sbjct  186   KPAAEKASPINFPSLRGFEVVDEAKALIEAKCPGTVSCADILAFAARDSALKVGWIGYDV  245

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVSL+SE+  NLPPP F   QL + F  KG + +EMVTLSGAH+IG SHC+SF
Sbjct  246   PSGRRDGRVSLSSEVVQNLPPPFFTASQLRDNFKRKGLSLDEMVTLSGAHSIGVSHCSSF  305

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ-GNSNANLVVPMDPFSPAITDVSYYTNIL  453
             +NRL  FN+T  QDPSLDP +AA LK RCP  G+SN++ VV  D  +P   D  YY N+ 
Sbjct  306   SNRLSGFNATFNQDPSLDPGFAAFLKSRCPAPGSSNSDPVVNNDVLTPNQLDNKYYVNLK  365

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
              ++GL TSDQTL   P T+  V  N      W  KFAAAMV MG I VLTG  GEIR NC
Sbjct  366   NHKGLLTSDQTLFDSPLTSKLVVDNVKYGSVWAKKFAAAMVHMGSIDVLTGKKGEIRRNC  425

Query  272   RVVN  261
             RVVN
Sbjct  426   RVVN  429



>ref|XP_008662930.1| PREDICTED: peroxidase 5-like [Zea mays]
 ref|XP_008662931.1| PREDICTED: peroxidase 5-like [Zea mays]
 gb|AFW57502.1| hypothetical protein ZEAMMB73_638404 [Zea mays]
 gb|AFW57506.1| hypothetical protein ZEAMMB73_715795 [Zea mays]
Length=338

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 218/307 (71%), Gaps = 5/307 (2%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFY  SC +AE IV++ V++    + GV AGL+RMHFHDCFVRGCDGS+LI+ST  
Sbjct  29    KLEVGFYEHSCAQAEDIVRNAVRRGIAREPGVGAGLIRMHFHDCFVRGCDGSILINSTPG  88

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCADI+AFAARDS  + GG  Y VP
Sbjct  89    NLAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADIVAFAARDSTYLAGGLDYKVP  148

Query  806   AGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             +GRRDGRVS   E+  NN+P P+  V +L   F  KG   ++MVTLSGAHTIGRSHC+SF
Sbjct  149   SGRRDGRVSKEEEVLDNNVPAPTDEVDELIESFKRKGLNADDMVTLSGAHTIGRSHCSSF  208

Query  629   NNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYYT  462
               RLY+F+    Q DPSLDP YA  LK RCP  +S+  +   VVP+DP +PA  D  YY 
Sbjct  209   TQRLYNFSGQLGQTDPSLDPAYAGHLKARCPWPSSDDQMDPTVVPLDPVTPATFDNQYYK  268

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+LA++ LF SD TLL +P TA  V  NA    +W +KFA AMVKMG++ VLTG+ GEIR
Sbjct  269   NVLAHKVLFISDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIR  328

Query  281   ANCRVVN  261
               C  VN
Sbjct  329   EKCFAVN  335



>ref|XP_004231304.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=321

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 212/303 (70%), Gaps = 1/303 (0%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L++G+Y  SC  AE IV+  V KA   + G+ AG++RMHFHDCFVRGCD S+L+D T 
Sbjct  20    ASLKIGYYHSSCPNAESIVRKAVNKAVSRNPGLGAGIIRMHFHDCFVRGCDASILLDPTP  79

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N  EK+ PANNPSLRG+EVID AK  LES+C   VSC+DI+AFAARDS    GG  Y V
Sbjct  80    GNPTEKEHPANNPSLRGYEVIDEAKIELESICPETVSCSDIIAFAARDSAFKLGGIRYSV  139

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVS+  E   NLPP + N  +L   F+ KG + +EMVTLSGAH+IGRSHC+SF
Sbjct  140   PSGRRDGRVSIKDEPTANLPPSTLNAGELEENFAKKGLSLDEMVTLSGAHSIGRSHCSSF  199

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             ++RLYSFNST  QDPS+DP+ A QL +RCP+  S  + + P+D  +P   D  YY N+  
Sbjct  200   SDRLYSFNSTHPQDPSMDPKLAQQLIKRCPRP-STTDPIAPLDVDTPNRLDNKYYLNLKN  258

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
              RG+ TSDQTL   PSTA   R NA    +W  KFA AMVKMG I V+TG  GEIR NCR
Sbjct  259   KRGVLTSDQTLWNSPSTARMARSNAIHGANWAHKFADAMVKMGSIEVMTGIQGEIRKNCR  318

Query  269   VVN  261
             VVN
Sbjct  319   VVN  321



>ref|XP_004251979.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=354

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 215/307 (70%), Gaps = 3/307 (1%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             K+   +GFYS SC +AE I+K  V KA + + G+AAG++RMHFHDCF+RGCDGSVL+DS 
Sbjct  48    KSTFGIGFYSKSCPQAEGIIKKAVFKAVLMNPGIAAGIIRMHFHDCFIRGCDGSVLLDSI  107

Query  992   -ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
                 TAEKDSP NNPSLRGF VID AK  LE +C   VSCADILA+AARDS    GG  Y
Sbjct  108   PGKETAEKDSPINNPSLRGFGVIDEAKVLLEKVCPHTVSCADILAYAARDSAFFVGGIKY  167

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP GRRDGRVSL+SE+  NLPPP F+  QL + F  KG + +EMVTLSGAH+IG SHC+
Sbjct  168   AVPGGRRDGRVSLSSEVIQNLPPPFFDAKQLEDNFKAKGLSLDEMVTLSGAHSIGVSHCS  227

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA--NLVVPMDPFSPAITDVSYYT  462
             SF+NRLY FN+T  QDPSLDP+YA+ LK +CP+  S+   + +V +D  SP   D  YY 
Sbjct  228   SFSNRLYGFNTTHPQDPSLDPRYASYLKHKCPRPMSDTQNDPIVNLDVSSPIYLDNKYYL  287

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+  ++GL TSDQTL   P T+  V  N     +W  KFA AMV MG I +LTGN GEIR
Sbjct  288   NLRNHKGLLTSDQTLYQSPLTSKLVLNNIKFRSTWARKFANAMVHMGSIEILTGNKGEIR  347

Query  281   ANCRVVN  261
              NC  +N
Sbjct  348   KNCHFIN  354



>ref|XP_004960409.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=333

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 228/323 (71%), Gaps = 5/323 (2%)
 Frame = -1

Query  1214  YSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             ++  AL+   +    + L+VGFY  SC  AE IV++ V++    D GV AGL+RMHFHDC
Sbjct  8     FAMAALVLASVSAHASHLEVGFYKHSCPEAEEIVRNAVRRGLARDPGVGAGLIRMHFHDC  67

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCDGS+LI+ST  N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCAD++AFA
Sbjct  68    FVRGCDGSILINSTPGNRAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADVVAFA  127

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             ARD   + GG  Y VP+GRRDGRVS+ +E+  NN+P P+  + +L   F  KG + ++MV
Sbjct  128   ARDGAYLAGGIEYQVPSGRRDGRVSIEAEVLNNNVPAPTDRLRELIESFKRKGLSADDMV  187

Query  677   TLSGAHTIGRSHCTSFNNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VV  510
             TLSGAHTIGRSHC+SF  RLY+F+    + DPS+DP YA  LK RCP  +S+  +   VV
Sbjct  188   TLSGAHTIGRSHCSSFTQRLYNFSGQLGKTDPSIDPAYAEHLKMRCPWPSSDDQMDPTVV  247

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
             P+DP +PA  D  Y+ N+LA++ + TSDQTLL  P TA  V+ N+    +W LKFAA+M+
Sbjct  248   PLDPVTPASFDNQYFKNVLAHKVVLTSDQTLLDSPWTAGIVKFNSAVEKAWQLKFAASMI  307

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
             KMG+I VLTG+ GEIR  C VVN
Sbjct  308   KMGKIEVLTGDEGEIREKCFVVN  330



>gb|EAY79346.1| hypothetical protein OsI_34475 [Oryza sativa Indica Group]
Length=335

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 231/326 (71%), Gaps = 7/326 (2%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIV--LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             MLS Y  +A ++   +   L+A+L+VGFY  SC  AE+IV+ EV KA   + G+AAGLVR
Sbjct  10    MLSWYLQVAAVSLLAMATGLEAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVR  69

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             +HFHDCFVRGCD SVLIDST  N AEKD+   N SLRGFEV+D  KAR+E  C GVVSCA
Sbjct  70    LHFHDCFVRGCDASVLIDSTKVNQAEKDA-GPNTSLRGFEVVDRIKARVEQACFGVVSCA  128

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDSV +TGG  Y VPAGRRDG VS +S+   NLPPP+ +V QLT +F+ KG +
Sbjct  129   DILAFAARDSVALTGGNAYQVPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLS  188

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTT--VQDPSLDPQYAAQLKQRCPQG--NSN  525
             Q EMV LSGAHTIG SHC+SF++RLY   +T    QDP++DP Y AQL Q+CPQ    + 
Sbjct  189   QREMVALSGAHTIGASHCSSFSSRLYRAGTTAGGGQDPTMDPAYVAQLAQQCPQSGGAAG  248

Query  524   ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKF  345
                +VPMD  +P   D  ++  ++ NRGL +SDQ LL D +TA +V   A    ++   F
Sbjct  249   GGALVPMDAVTPNAFDEGFFKGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQSDF  308

Query  344   AAAMVKMGQISVLTGNAGEIRANCRV  267
             AAAMVKMG + VLTG++G++RANCRV
Sbjct  309   AAAMVKMGAVGVLTGSSGKVRANCRV  334



>ref|XP_010911662.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 216/306 (71%), Gaps = 2/306 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L VGFY  +C  AE IV++ V +A   + G AAGL+RMHFHDCFVRGCD SVL++ST 
Sbjct  16    ASLNVGFYEKTCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTP  75

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK++P NNPSLRGFEVI++AKA +E+ C   VSCADI+AFAARDS  +TGG  Y+V
Sbjct  76    GNPSEKEAPPNNPSLRGFEVINAAKAAVEAKCPCKVSCADIIAFAARDSAYITGGIDYEV  135

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGR+SLASE  +N+P P+F   +L   F  KG T +EMVTLSGAH+IGRSHC+SF
Sbjct  136   PAGRRDGRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGRSHCSSF  195

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
               RLY+F++T  QDPS++P +AA LK RCP   ++      V +D  +P   D  YY N+
Sbjct  196   TTRLYNFSATHPQDPSMEPAFAAYLKTRCPPSTASPTDPTTVLLDAVTPTRLDNMYYRNL  255

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L +RG+ TSDQTL     T   V  NA    +W  KFA+AMVKMG I VLTG+ GEIR  
Sbjct  256   LKHRGVLTSDQTLQESSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQGEIREK  315

Query  275   CRVVNS  258
             C VVNS
Sbjct  316   CWVVNS  321



>ref|XP_008781200.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=328

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 227/323 (70%), Gaps = 6/323 (2%)
 Frame = -1

Query  1211  STLALLTCQLI---VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             S+LA +   L+   +  A LQVGFY   C  AE IV+  V +A   + G+AAGL+RMHFH
Sbjct  6     SSLAFIAVMLMMTTISSATLQVGFYQSKCPAAESIVRRTVTEAVAKNPGIAAGLLRMHFH  65

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCD SVL+DST  N AEK+SPAN PSLRGFEVID AKA +E+ C   VSCADILA
Sbjct  66    DCFVRGCDASVLLDSTPGNPAEKESPANKPSLRGFEVIDRAKAEIEAQCPQTVSCADILA  125

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARD     GG  Y VPAGRRDGR+SL SE+  N+P P F V QL   F+ KG +++EM
Sbjct  126   FAARDGAFRAGGIDYAVPAGRRDGRISLESEVLQNIPAPFFTVDQLQQNFARKGLSRDEM  185

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA---NLVV  510
             VTLSGAH+IG SHC+SF+NRLYSFN+T  QDPSL+P +AA LK +CP  +S     +  V
Sbjct  186   VTLSGAHSIGVSHCSSFSNRLYSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGTGQDGTV  245

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
             P+D  SP   D  YY N+ +++GL TSDQ+L+ DPST   VR NA     W  KFAAAMV
Sbjct  246   PLDIVSPNRLDNWYYKNLRSSKGLLTSDQSLMDDPSTKTIVRNNANRGAEWAAKFAAAMV  305

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
             +MG I VLTG  GEIR NCR+VN
Sbjct  306   RMGSIEVLTGTQGEIRKNCRLVN  328



>ref|XP_010234947.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=303

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 224/304 (74%), Gaps = 5/304 (2%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             + A+L+VGFY  SC  AE+IV+ EV  A   + G+AAGL+R+HFHDCFV GC+ SVL+DS
Sbjct  5     VSAQLRVGFYDSSCPAAEIIVQQEVSSAVAANPGLAAGLLRLHFHDCFVGGCEASVLVDS  64

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             TASNTAEKD+   N SLRGFEVID  KAR+E  C GVVSCADILAFAARD + +TGG GY
Sbjct  65    TASNTAEKDA-GPNKSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDGIALTGGNGY  123

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDG VS AS+   NLPPP+ +VPQLT +F++KG TQ++MVTLSGAHTIG SHCT
Sbjct  124   QVPAGRRDGSVSKASDTSGNLPPPTPSVPQLTAIFASKGLTQKDMVTLSGAHTIGGSHCT  183

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF++RL +    T  DP++DP Y AQL  +C   +S    +VPMD  +P   D  Y+  +
Sbjct  184   SFSSRLQTPGPQT-PDPTMDPGYVAQLASQCSSSSSG---MVPMDAVTPNTFDEGYFKGV  239

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             +ANRGL  SDQ LL D +TA +V   A  P ++   FAAAMVKMG + VLTG++G+IRAN
Sbjct  240   MANRGLLASDQALLGDGATAGQVVAYANDPATFQSDFAAAMVKMGYVGVLTGSSGKIRAN  299

Query  275   CRVV  264
             CRVV
Sbjct  300   CRVV  303



>ref|XP_004495876.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=334

 Score =   357 bits (916),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 224/327 (69%), Gaps = 2/327 (1%)
 Frame = -1

Query  1235  RIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLV  1056
             R+  L  ++ + +L+   +     L+VGFY  +C  AE IV+  V KA   + G+AAGL+
Sbjct  6     RMHALMLFTFVLILSVSTLASSTSLKVGFYKTTCPSAEAIVRRAVNKAVSLNPGIAAGLI  65

Query  1055  RMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             RMHFHDCFVRGCDGSVL++ST  N +E+D PANNPSLRGFEVI+ AK+++E+ C   VSC
Sbjct  66    RMHFHDCFVRGCDGSVLLESTQGNPSERDHPANNPSLRGFEVINEAKSQIEAACPKTVSC  125

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADILAFAARDS    GG  Y V +GRRDGRVS+  E+  NLP PSFN  +L + F  KG 
Sbjct  126   ADILAFAARDSTHKVGGIYYTVQSGRRDGRVSIFDEVTQNLPGPSFNAKELISNFGRKGL  185

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC--PQGNSNA  522
             + +EMVTLSGAH+IG SHC+SF+NRLYSFN T  QDPS++P++A  LK +C  PQ  + +
Sbjct  186   SADEMVTLSGAHSIGVSHCSSFSNRLYSFNKTFSQDPSMNPKFAELLKSKCPPPQTQTQS  245

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             +  V  D  +P   D +YY  +  +RGL TSDQTL++   T N V +NA     WG+KFA
Sbjct  246   DPTVVFDASTPNRLDNNYYLRLQKHRGLLTSDQTLVSSGLTRNSVLRNAKHGSRWGVKFA  305

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              AMV MG + VLTG  GEIR  C VVN
Sbjct  306   KAMVHMGSLDVLTGFEGEIRERCNVVN  332



>ref|XP_008781197.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=334

 Score =   357 bits (916),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 221/323 (68%), Gaps = 2/323 (1%)
 Frame = -1

Query  1220  SCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             SC   L  +     V  A L+VGFY  +C  AE IV++ V +A V + G AAGL+RMHFH
Sbjct  12    SCMIVLMAILTMASVTSASLKVGFYEETCPSAETIVRETVSQAIVRNPGFAAGLIRMHFH  71

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCD SVL++ST+ N +EK++P NNPSLRGFEVID+AKA +E+ C   VSCADI+A
Sbjct  72    DCFVRGCDASVLLNSTSGNPSEKEAPPNNPSLRGFEVIDAAKAAVEAKCPRKVSCADIIA  131

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARDS  + GG  Y VPAGRRDGR+SL+SE  +N+P PSF   +L   F  KG +  EM
Sbjct  132   FAARDSAYLAGGIDYQVPAGRRDGRISLSSEALDNIPFPSFTADKLKENFERKGLSLNEM  191

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN--LVVP  507
             VTLSGAH+IGRSHC+SF  RLY+F++T  QDPS++P  AA LK RCP   ++ +    V 
Sbjct  192   VTLSGAHSIGRSHCSSFTTRLYNFSATHPQDPSMEPALAAYLKARCPPSTASLSDPTTVL  251

Query  506   MDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVK  327
             +D  +P   D  YY N+L +RG+ TSDQTL     T   V  NA    +W  KFA+AMVK
Sbjct  252   LDSVTPTCLDNLYYRNLLKHRGVLTSDQTLQDSSETTKLVWYNAKHQSAWAAKFASAMVK  311

Query  326   MGQISVLTGNAGEIRANCRVVNS  258
             MG I VLTG+ GEIR  C VVNS
Sbjct  312   MGSIEVLTGSQGEIREKCWVVNS  334



>ref|XP_010921347.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/308 (57%), Positives = 219/308 (71%), Gaps = 6/308 (2%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VGFY  +C  AE IV++ V +A   + G AAGL+RMHFHDCFVRGCD SVL++ST 
Sbjct  16    ASLKVGFYGETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTP  75

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK++P NNP+LRGFEVID+AKA +E+ C   VSCADI+AFAARDS  +TGG  Y+V
Sbjct  76    GNPSEKEAPPNNPTLRGFEVIDAAKAAVEAKCPRKVSCADIIAFAARDSAYITGGMDYEV  135

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGR+SLASE  +N+P P+F   +L   F  KG + +EMVTLSGAH+IGRSHC+SF
Sbjct  136   PAGRRDGRISLASEALDNIPFPTFTADKLKENFERKGLSLDEMVTLSGAHSIGRSHCSSF  195

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVP----MDPFSPAITDVSYYT  462
               RLY+F++T  QDPS++P +AA LK RCP   S A+L  P    +D  +P   D  YY 
Sbjct  196   TTRLYNFSATHPQDPSMEPAFAAYLKARCPP--STASLSDPTTVLLDAVTPTRLDNIYYR  253

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+L +RG+ TSDQTL     TA  V  NA    +W  KFA+AMVKMG I VLTG+ G+IR
Sbjct  254   NLLKHRGVLTSDQTLQESSETAKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQGKIR  313

Query  281   ANCRVVNS  258
               C V NS
Sbjct  314   EKCWVANS  321



>dbj|BAK03531.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 225/304 (74%), Gaps = 3/304 (1%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             ++A+L+VGFY  SC  AE+IV+ EV KA   + G+AAGL+R+HFHDCFV GC+ SVL+DS
Sbjct  34    VRAQLRVGFYDSSCPAAEIIVQQEVSKAVTANPGLAAGLLRLHFHDCFVGGCEASVLVDS  93

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  NTAEKD+   N SLRGFEVID  KAR+E  C GVVSCADILAFAARDSV +TGG  Y
Sbjct  94    TKGNTAEKDA-GPNTSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAY  152

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDG VS A +   NLPPPS NV QLT +F++KG  Q+++VTLSGAHTIG SHC+
Sbjct  153   QVPAGRRDGGVSRAQDTGGNLPPPSPNVNQLTKIFASKGLNQKDLVTLSGAHTIGGSHCS  212

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF++RL +  S T QDP++DP Y AQL Q+C   +S   L VPMD  +P   D  +Y  I
Sbjct  213   SFSSRLQT-PSPTAQDPTMDPGYVAQLAQQCGASSSPGPL-VPMDAVTPNSFDEGFYKGI  270

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             ++NRGL  SDQ LL+D +TA +V   A  P ++   FAAAMVKMG + VLTG++G+IRAN
Sbjct  271   MSNRGLLASDQALLSDGNTAVQVVSYANDPATFQSDFAAAMVKMGYVGVLTGSSGKIRAN  330

Query  275   CRVV  264
             CRVV
Sbjct  331   CRVV  334



>ref|NP_001065172.1| Os10g0536700 [Oryza sativa Japonica Group]
 gb|AAL58122.1|AC092697_10 putative peroxidase [Oryza sativa Japonica Group]
 gb|AAM76351.1|AC074196_9 putative peroxidase [Oryza sativa Japonica Group]
 gb|AAP54814.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 tpe|CAH69370.1| TPA: class III peroxidase 128 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27086.1| Os10g0536700 [Oryza sativa Japonica Group]
Length=338

 Score =   355 bits (912),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 231/329 (70%), Gaps = 10/329 (3%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIV--LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             MLS Y  +A ++   +   L+A+L+VGFY  SC  AE+IV+ EV KA   + G+AAGLVR
Sbjct  10    MLSWYLQVAAVSLLAMATGLEAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVR  69

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             +HFHDCFVRGCD SVLIDST  N AEKD+   N SLRGFEV+D  KAR+E  C GVVSCA
Sbjct  70    LHFHDCFVRGCDASVLIDSTKGNQAEKDA-GPNTSLRGFEVVDRIKARVEQACFGVVSCA  128

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDSV +TGG  Y VPAGRRDG VS +S+   NLPPP+ +V QLT +F+ KG +
Sbjct  129   DILAFAARDSVALTGGNAYQVPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLS  188

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLY-----SFNSTTVQDPSLDPQYAAQLKQRCPQG--  534
             Q EMV LSGAHTIG SHC+SF++RLY     +  +   QDP++DP Y AQL Q+CPQ   
Sbjct  189   QREMVALSGAHTIGASHCSSFSSRLYRAGTTAGGAGGGQDPTMDPAYVAQLAQQCPQSGG  248

Query  533   NSNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
              +    +VPMD  +P   D  ++  ++ NRGL +SDQ LL D +TA +V   A    ++ 
Sbjct  249   AAGGGALVPMDAVTPNAFDEGFFKGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQ  308

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRV  267
               FAAAMVKMG + VLTG++G++RANCRV
Sbjct  309   SDFAAAMVKMGAVGVLTGSSGKVRANCRV  337



>ref|XP_010069737.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW58171.1| hypothetical protein EUGRSUZ_H00888 [Eucalyptus grandis]
Length=338

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 215/305 (70%), Gaps = 2/305 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++  V FY  +C  AE I+K  V  A   + G+AAGL+R+HFHDCFVRGCD SVL+ ST 
Sbjct  34    SKFTVRFYKYTCPAAESIIKQTVYGAIAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTP  93

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AE+D PANNPSLRGFE+ID AKARLE++C   VSCADI+AFAARDS+  TGG  YDV
Sbjct  94    KNPAERDHPANNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSIFKTGGIYYDV  153

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGR+S   E+  NLPPP+FN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  154   PAGRRDGRISRLPEVTQNLPPPNFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSF  213

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRC--PQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             ++RLY+FN+T  QDP+LDP +A+ LK +C  P   + A+  VP+D  +P   D  YY  +
Sbjct  214   SSRLYAFNTTLAQDPTLDPAFASLLKTKCPPPSNATRADPTVPLDSITPNALDNKYYLQL  273

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
                RG+  +D+TL   PST+  V  NA +  +W +KFA AMVKMG + VLTG  GEIR  
Sbjct  274   QKLRGVLATDETLYKSPSTSRMVVSNAVNGAAWRVKFAKAMVKMGSLDVLTGKQGEIRKV  333

Query  275   CRVVN  261
             C VVN
Sbjct  334   CSVVN  338



>ref|XP_010026045.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=330

 Score =   355 bits (911),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/305 (58%), Positives = 215/305 (70%), Gaps = 2/305 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++ +VGFY  +C  A  IVK  V +A   + G+AAGL+R+HFHDCFVRGCD SVL+ ST 
Sbjct  26    SKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTP  85

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AE+D P NNPSLRGFE+ID AKARLE++C   VSCADI+AFAARDSV  TGG  Y+V
Sbjct  86    ENPAERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIYYNV  145

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGRVS  SE+  NLP P+FN  QL   F+ KG +  EMVTL GAH+IG SHC+SF
Sbjct  146   PAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHCSSF  205

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGN-SNANLVVPMDPFSPAITDVSYYTNI  456
             ++RLY+FN+T  QDPSLDP +AA LK +C PQ N +  +  VP+D  +P   D  YY  +
Sbjct  206   SSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKYYLQL  265

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L  RG+   D+TL T PST+  V  NA +  +W  KFA AMVKMG + VLTG  GEIR  
Sbjct  266   LKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGEIREL  325

Query  275   CRVVN  261
             C VVN
Sbjct  326   CSVVN  330



>ref|XP_007153060.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
 gb|ESW25054.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
Length=331

 Score =   355 bits (911),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 220/325 (68%), Gaps = 2/325 (1%)
 Frame = -1

Query  1229  RMLSCYSTLAL-LTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             R L   S L L L     +  A L+VGFY+ +C  AE IV+  V K    + G+AAGL+R
Sbjct  7     RFLQMISALVLILLSGSSMASASLKVGFYASTCPSAEEIVRTAVNKGVSQNPGIAAGLIR  66

Query  1052  MHFHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             MHFHDCFVRGC+GSVL+ ST  N  AE+D  ANNPSLRGFEVI+ AK +LE+ C   VSC
Sbjct  67    MHFHDCFVRGCEGSVLLASTPGNPIAERDHFANNPSLRGFEVIEEAKIQLEAACPETVSC  126

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADILAFAARDS    GG  YDVP+GRRDGRVS+A E+  NLP P+ NV +L N F+ KG 
Sbjct  127   ADILAFAARDSALKVGGITYDVPSGRRDGRVSVADEVGQNLPGPTSNVDELVNRFAQKGL  186

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL  516
             + +EMVTLSGAH+IG SHC++F+ RLYSFN T  QDPS+D  YA  LK +CP   + ++ 
Sbjct  187   SADEMVTLSGAHSIGVSHCSAFSKRLYSFNDTFKQDPSMDSSYAETLKTQCPAPPATSDP  246

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
              V  DP +P   D  YY  ++ +RGL TSDQTL    ST   V  NA +  SW  KFA A
Sbjct  247   TVSFDPSTPLRLDSKYYEGLIGHRGLLTSDQTLFATQSTREMVVSNANNGASWSEKFARA  306

Query  335   MVKMGQISVLTGNAGEIRANCRVVN  261
             MVKMG I VLTGN+GEIR +C  VN
Sbjct  307   MVKMGSIEVLTGNSGEIRKHCSFVN  331



>gb|KDP34818.1| hypothetical protein JCGZ_11180 [Jatropha curcas]
Length=322

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 221/323 (68%), Gaps = 3/323 (1%)
 Frame = -1

Query  1223  LSCYSTLALLTCQLIVLK-AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             +S +    +L C L  L  A L+VGFY  +C  AE IV+  V K    +  + AGL+RMH
Sbjct  1     MSSWIIFLVLLCSLATLSSASLRVGFYKSTCPLAETIVRRAVNKFVSRNPELGAGLIRMH  60

Query  1046  FHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADI  867
             FHDCF+RGCD SVL++ST    +E++  ANNPSLRGFEVI+ AKA++E++C   VSCADI
Sbjct  61    FHDCFIRGCDASVLLESTPGKPSEREHRANNPSLRGFEVINEAKAQIEAICPQTVSCADI  120

Query  866   LAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQE  687
             LAFAARDS +  GG  Y VPAGRRDGR+S   E+  NLPPP+FN  QL+  F+ KG + +
Sbjct  121   LAFAARDSSKKLGGINYAVPAGRRDGRISNVDEVAQNLPPPTFNAEQLSQNFARKGMSVD  180

Query  686   EMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ-GNSNANLVV  510
             EMVTLSGAH+IG SHC+SF+NRLYSFN+T  QD S+D  YAA LK RCP  G S+++  V
Sbjct  181   EMVTLSGAHSIGISHCSSFSNRLYSFNATHAQDLSMDSTYAAFLKTRCPNDGGSSSDPTV  240

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
              +DP +P   D  YY  +  NRGL TSDQTL+  PST N V  NA +   W  KFA AMV
Sbjct  241   ALDP-TPNQMDNRYYMELKKNRGLLTSDQTLMNSPSTQNIVMNNARNSRLWAAKFAKAMV  299

Query  329   KMGQISVLTGNAGEIRANCRVVN  261
              MG + VLTG  GEIR  C V+N
Sbjct  300   HMGSLDVLTGTQGEIRKQCNVIN  322



>ref|XP_010024692.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   354 bits (909),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 217/321 (68%), Gaps = 3/321 (1%)
 Frame = -1

Query  1220  SCYSTLALLTCQLI-VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHF  1044
             S Y +  L+ C +   +   L+VGFY   C  AE +V++ VQKA   D G  A L+R+HF
Sbjct  5     SAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHF  64

Query  1043  HDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADIL  864
             HDCFVRGCDGS+L++ST  NTAEKDS   N  + GFEVID AKA++E+ C   VSCADI+
Sbjct  65    HDCFVRGCDGSILLNSTKGNTAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIV  123

Query  863   AFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEE  684
             AFAARD V   GG  Y VP+GRRDGRVSLASE+  NLP   F+  QL   F+ KG +   
Sbjct  124   AFAARDGVRAAGGLHYAVPSGRRDGRVSLASEVIQNLPGAFFDAAQLKANFAKKGLSLRN  183

Query  683   MVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPM  504
             MVTLSGAH+IG SHC+ F  RLYSFNST  QDPSL+P YA  LK +CP+ NS  + +VP 
Sbjct  184   MVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPR-NSPTDPIVPF  242

Query  503   DPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKM  324
             DP +P + D +YY N+ +++GL  SDQ L   P T   V+ NA  P +W  +F AAMV+M
Sbjct  243   DPVTPNVLDNAYYRNLKSDKGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRM  302

Query  323   GQISVLTGNAGEIRANCRVVN  261
             G I VLTG  GEIR NCRV+N
Sbjct  303   GSIEVLTGTQGEIRKNCRVIN  323



>ref|XP_010024694.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   354 bits (908),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 218/321 (68%), Gaps = 3/321 (1%)
 Frame = -1

Query  1220  SCYSTLALLTCQLI-VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHF  1044
             S Y +  L+ C +   +   L+VGFY   C  AE +V++ VQKA   D G  A L+R+HF
Sbjct  5     SAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHF  64

Query  1043  HDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADIL  864
             HDCFVRGCDGS+L++ST  NTAEKDS   N  + GFEVID AKA++E+ C   VSCADI+
Sbjct  65    HDCFVRGCDGSILLNSTKGNTAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIV  123

Query  863   AFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEE  684
             AFAARD V   GGF Y VP+GRRDGRVSLASE+  NLP P F+  QL   F+ KG +  +
Sbjct  124   AFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGPFFDAVQLEANFAKKGLSLRD  183

Query  683   MVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPM  504
             MVTLSGAH+IG SHC+ F  RLYSFNST  QDPSL+P YA  LK +CP+ N   + +VP 
Sbjct  184   MVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPR-NGPTDPIVPF  242

Query  503   DPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKM  324
             DP +P + D +YY N+ +++GL  SDQ L     T   V+ NA  P +W  +F AAMV+M
Sbjct  243   DPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDASLTRGLVKDNANHPSAWARRFTAAMVRM  302

Query  323   GQISVLTGNAGEIRANCRVVN  261
             G I VLTG  GEIR NCRV+N
Sbjct  303   GLIEVLTGTQGEIRKNCRVIN  323



>ref|XP_002467585.1| hypothetical protein SORBIDRAFT_01g030530 [Sorghum bicolor]
 gb|EER94583.1| hypothetical protein SORBIDRAFT_01g030530 [Sorghum bicolor]
Length=325

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 186/327 (57%), Positives = 228/327 (70%), Gaps = 3/327 (1%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             M+  R+ +L               L+A+L+VGFY  SC  AE+IV+ EV  A   + G+A
Sbjct  1     MAVQRMEVLYLQVAAVAALLMATELRAQLRVGFYDNSCPAAEIIVQQEVSTAVAANPGIA  60

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGL+R+HFHDCFV GCD SVLIDST  NTAEKD+   N SLRGFEVID  KAR+E  C G
Sbjct  61    AGLLRLHFHDCFVGGCDASVLIDSTKGNTAEKDA-GPNTSLRGFEVIDRIKARVEQACFG  119

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             VVSCADILAFAARDSV + GG  Y VPAGRRDG  S AS+   NLPPP+ NV QLT +F 
Sbjct  120   VVSCADILAFAARDSVALAGGNAYQVPAGRRDGSTSRASDTNGNLPPPTANVAQLTKIFG  179

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
             NKG TQ+EMV LSGAHTIG SHC+SF+ RL S ++T  QDP++DP Y AQL ++CPQ  +
Sbjct  180   NKGLTQKEMVILSGAHTIGSSHCSSFSGRLSSSSTTAGQDPTMDPAYVAQLARQCPQ--A  237

Query  527   NANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLK  348
               + +V MD  SP   D  +Y  ++ANRGL +SDQ LL+D +TA +V   A  P ++   
Sbjct  238   GGDPLVAMDYVSPNAFDEGFYKGVMANRGLLSSDQALLSDKNTAVQVVTYANDPATFQSD  297

Query  347   FAAAMVKMGQISVLTGNAGEIRANCRV  267
             FAAAMVKMG + VLTG +G+IRANCRV
Sbjct  298   FAAAMVKMGTVGVLTGASGKIRANCRV  324



>ref|XP_004960411.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=336

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 223/308 (72%), Gaps = 5/308 (2%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A+L+VGFY  SC  AE IV++ V++    D GV AGL+RMHFHDCFVRGCD S+LI+ST 
Sbjct  26    AKLKVGFYKHSCPEAEEIVRNAVRRGLARDPGVGAGLIRMHFHDCFVRGCDSSILINSTP  85

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCAD++AFAARD   + GG  Y V
Sbjct  86    GNRAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADVVAFAARDGAYLAGGIEYQV  145

Query  809   PAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             P+GRRDGRVS+ +E+  NN+P P+  + +L   F  KG + ++MVTLSGAHTIGRSHC+S
Sbjct  146   PSGRRDGRVSIEAEVLNNNVPAPTDRLRELIESFKRKGLSADDMVTLSGAHTIGRSHCSS  205

Query  632   FNNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYY  465
             F  RLY+F+    + DPS+DP YA  LK+RCP  +S+  +   VVP+DP +PA  D  Y+
Sbjct  206   FTQRLYNFSGQLGKTDPSIDPAYAEHLKKRCPWPSSDDQMDPTVVPLDPVTPASFDNQYF  265

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
              N+L+++ + TSDQTLL  P TA  V+ N+    +W LKFAA+M+KMG+I VLTG+ GEI
Sbjct  266   KNVLSHKVVLTSDQTLLDSPWTAGIVKFNSAVEKAWQLKFAASMIKMGKIEVLTGDEGEI  325

Query  284   RANCRVVN  261
             R  C VVN
Sbjct  326   REKCFVVN  333



>ref|XP_002530464.1| Peroxidase 3 precursor, putative [Ricinus communis]
 gb|EEF31934.1| Peroxidase 3 precursor, putative [Ricinus communis]
Length=329

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 222/327 (68%), Gaps = 8/327 (2%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLK-AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             M SC   + +L C L  L  A L+VGFY  SC  AE IV+  V+K    + G+AAGL+RM
Sbjct  6     MSSC--VVLVLFCSLATLSSASLRVGFYKSSCPSAEAIVRKTVKKFVSINPGLAAGLIRM  63

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCD SVL+ ST  N +E++  ANNPSLRGFEVID AKA+LE++C   VSCAD
Sbjct  64    HFHDCFVRGCDASVLLQSTPGNPSEREHIANNPSLRGFEVIDEAKAKLEAVCPKTVSCAD  123

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             ILAFAARDS    GG  Y VPAGRRDG VS  +E+  NLPPPS N  +L + FS KG ++
Sbjct  124   ILAFAARDSSYKLGGVNYAVPAGRRDGLVSNMAEVAQNLPPPSSNAEKLADSFSRKGLSE  183

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGN----SNA  522
             +E+VTLSGAH++G S C+SF+NRLYSFN+T  QDPS+DP+YAA LK +CP  N    +  
Sbjct  184   DELVTLSGAHSVGISRCSSFSNRLYSFNATHAQDPSMDPKYAAFLKTKCPPPNPIYEAKV  243

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             +  V +DP +P   D  YY  +  +RGL  SDQTL+  P T   V  NA S  +W  KFA
Sbjct  244   DPTVGLDP-TPNRLDNKYYVQLSNDRGLLNSDQTLMKSPFTQKMVLDNAKSGAAWTAKFA  302

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              AMV MG I VLTG  GEIR  C VVN
Sbjct  303   KAMVHMGSIDVLTGPQGEIRTQCSVVN  329



>ref|XP_007145114.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
 gb|ESW17108.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
Length=324

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 219/320 (68%), Gaps = 10/320 (3%)
 Frame = -1

Query  1202  ALLTCQLIVLK------AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             A+L+  L++L       A L+  FY  +C  AE IV+  V+KA   + G+AAGL+RMHFH
Sbjct  9     AMLSSFLLILSIFPLASASLKADFYKTTCPSAESIVRSAVEKAVSLNPGIAAGLIRMHFH  68

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCDGSVL++ST  N +E+D PANNPSLRGF+VID AKA++E+ C   VSCADILA
Sbjct  69    DCFVRGCDGSVLLESTPGNPSERDHPANNPSLRGFQVIDEAKAQIEAECPHTVSCADILA  128

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARDS    GG  Y VPAGRRDGRVS+  E  + LP P+ N  QL   F  KG + +EM
Sbjct  129   FAARDSANKVGGINYAVPAGRRDGRVSIRDEA-SQLPLPTSNADQLIANFRRKGLSADEM  187

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD  501
             VTLSGAH+IG SHC+SF++RLYSFN+T  QDPS+D +YA  LK +CP G+ N    VP+D
Sbjct  188   VTLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDSKYATSLKSKCPAGSDN---TVPLD  244

Query  500   PFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMG  321
               +P   D  YYT +  +RGL TSDQTLL  PST   +  NA     W  KFA AMV MG
Sbjct  245   ASTPNRLDNKYYTELKKHRGLLTSDQTLLGSPSTRPMLLTNAKHSSVWARKFAKAMVHMG  304

Query  320   QISVLTGNAGEIRANCRVVN  261
              I VLTG+ GEIR  C +VN
Sbjct  305   SIDVLTGSQGEIRTRCALVN  324



>ref|XP_006654965.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=337

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 222/306 (73%), Gaps = 4/306 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFY  SC +AE IV++ V++A   D G+AAGL+RMHFHDCFVRGCDGS+LI+ST  
Sbjct  29    KLKVGFYQHSCPQAEEIVRNAVRRAVARDAGLAAGLIRMHFHDCFVRGCDGSILINSTPG  88

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKDS ANNPS+RGF+V+D AKA +E+ C   VSCAD+LAFAARD+  + GG  Y VP
Sbjct  89    NKAEKDSVANNPSMRGFDVVDDAKAVVEAHCPRTVSCADVLAFAARDAAYLAGGIEYPVP  148

Query  806   AGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             +GRRDGRVSL+ E+  NN+P P+FNV  L   F+ KG T ++MVTLSGAHTIGRSHC+SF
Sbjct  149   SGRRDGRVSLSDEVLVNNVPGPTFNVSDLIESFARKGLTADDMVTLSGAHTIGRSHCSSF  208

Query  629   NNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTN  459
               RLY+F+    + DP++DP YA QLK RCP    + N    VP+DP +P   D  YY N
Sbjct  209   TQRLYNFSGEAGRTDPAIDPAYAEQLKYRCPPATDDQNDPTTVPLDPVTPTAFDNQYYKN  268

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +LA++ +  SDQTLL +P TA  V+ ++     + +KFAAAMVKMG + VLTG+ GEIR 
Sbjct  269   VLAHKVVLHSDQTLLDNPWTAGLVKFHSAVDKVFKVKFAAAMVKMGNVEVLTGDEGEIRE  328

Query  278   NCRVVN  261
              C  VN
Sbjct  329   KCFAVN  334



>ref|XP_010069739.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=333

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 218/305 (71%), Gaps = 2/305 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             + L+VG+Y  +C   E IV+  V +A   + G+AAGL+RMHFHDCFVRGCD SVL+ STA
Sbjct  29    SSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVLLKSTA  88

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AE+D PANNPSLRGFE+ID AKA+LE+LC   VSCADI+AFAARDS     G  YDV
Sbjct  89    GNPAERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYDV  148

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
              AGRRDGR+S   E+  NLPPPSFN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  149   AAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSF  208

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGN--SNANLVVPMDPFSPAITDVSYYTNI  456
             ++RLY+FN+T  QDPSLDP YAA LK++CP  +  + A+  VP+D  +    D  YY  +
Sbjct  209   SSRLYTFNATLAQDPSLDPAYAAFLKRKCPPPSNVTQADPTVPLDSITANTLDNKYYLQL  268

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L  RGL TSD+TL T PST+  V  NA +  +W +KFA AMVKMG I VLTG  GEIR  
Sbjct  269   LKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGEIRKL  328

Query  275   CRVVN  261
             C +VN
Sbjct  329   CSIVN  333



>gb|KCW58173.1| hypothetical protein EUGRSUZ_H00890, partial [Eucalyptus grandis]
Length=309

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 218/305 (71%), Gaps = 2/305 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             + L+VG+Y  +C   E IV+  V +A   + G+AAGL+RMHFHDCFVRGCD SVL+ STA
Sbjct  5     SSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVLLKSTA  64

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AE+D PANNPSLRGFE+ID AKA+LE+LC   VSCADI+AFAARDS     G  YDV
Sbjct  65    GNPAERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYDV  124

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
              AGRRDGR+S   E+  NLPPPSFN  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  125   AAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSF  184

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGN--SNANLVVPMDPFSPAITDVSYYTNI  456
             ++RLY+FN+T  QDPSLDP YAA LK++CP  +  + A+  VP+D  +    D  YY  +
Sbjct  185   SSRLYTFNATLAQDPSLDPAYAAFLKRKCPPPSNVTQADPTVPLDSITANTLDNKYYLQL  244

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L  RGL TSD+TL T PST+  V  NA +  +W +KFA AMVKMG I VLTG  GEIR  
Sbjct  245   LKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGEIRKL  304

Query  275   CRVVN  261
             C +VN
Sbjct  305   CSIVN  309



>ref|NP_001141025.1| uncharacterized protein LOC100273104 precursor [Zea mays]
 gb|ACF85208.1| unknown [Zea mays]
 gb|AFW57507.1| hypothetical protein ZEAMMB73_610484 [Zea mays]
Length=340

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFY  SC +AE IV++ V++    + GV AGL+RMHFHDCFVRGCDGS+LI+ST  
Sbjct  31    KLEVGFYEHSCPQAEDIVRNAVRRGIAREPGVGAGLIRMHFHDCFVRGCDGSILINSTPD  90

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARDS  + GG  Y VP
Sbjct  91    NKAEKDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIVAFAARDSAYLAGGLDYKVP  150

Query  806   AGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             +GRRDGRVS   E+  NN+P P+  V +L   F  KG   ++MVTLSGAHTIGRSHC+SF
Sbjct  151   SGRRDGRVSKEDEVLDNNVPAPTDEVDELIESFKRKGLNADDMVTLSGAHTIGRSHCSSF  210

Query  629   NNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYYT  462
               RLY+F+    + DPSLDP YA  LK RCP  +SN  +   VVP+DP + A  D  YY 
Sbjct  211   TERLYNFSGQLGRTDPSLDPAYAEHLKMRCPWPSSNDQMDPTVVPLDPVTSATFDNQYYK  270

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+LA++ LF SD TLL +P TA  V  NA    +W +KFA AMVKMG++ VLTG+ GEIR
Sbjct  271   NVLAHKVLFISDNTLLENPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIR  330

Query  281   ANCRVVN  261
               C  VN
Sbjct  331   EKCFAVN  337



>ref|XP_008461392.1| PREDICTED: peroxidase 5-like [Cucumis melo]
Length=338

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 214/306 (70%), Gaps = 6/306 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  SC RAE I+K+ V +A   + G+AAGL+RMHFHDCFVRGC+GSVL+ ST +N
Sbjct  34    LKVGFYKSSCPRAETIIKNAVNQAISQNPGIAAGLIRMHFHDCFVRGCEGSVLLQSTPNN  93

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +E++  AN PSLR FEVID AKA++E++C   VSCADILAFAARDS    GG  Y VPA
Sbjct  94    PSEREHRANFPSLRAFEVIDEAKAKIEAICPNTVSCADILAFAARDSAYRVGGINYAVPA  153

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDGR+S+  E  N+LP PSFN  QLT  F+ +GF+ EEMVTLSGAH+IG +HC +F+N
Sbjct  154   GRRDGRISIKEEA-NSLPGPSFNAEQLTESFAKRGFSSEEMVTLSGAHSIGVAHCPTFSN  212

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCP-----QGNSNANLVVPMDPFSPAITDVSYYTN  459
             RLYSFN+T  QDPS+DP YAA LK +CP      GN +      ++ FSP   D  YY  
Sbjct  213   RLYSFNTTHPQDPSMDPLYAAYLKTKCPPPSGNNGNGSEEPTAALEFFSPYRLDNWYYIE  272

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  +RGL +SDQTLL+  ST   V  NA     W  KF  AMVKMG + VLTG+ GEIR 
Sbjct  273   LKNHRGLLSSDQTLLSSSSTKEMVLHNAKHGHQWAAKFGKAMVKMGFLDVLTGSQGEIRR  332

Query  278   NCRVVN  261
             +C  VN
Sbjct  333   HCSFVN  338



>gb|AFW57508.1| peroxidase 1 [Zea mays]
Length=339

 Score =   352 bits (903),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 219/308 (71%), Gaps = 5/308 (2%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             + LQVGFY  SC +AE IV++ V++  V D GV AGL+RMHFHDCFVRGCD S+LI+ST 
Sbjct  29    SSLQVGFYKHSCPQAEDIVRNAVRRGLVRDPGVGAGLIRMHFHDCFVRGCDASILINSTP  88

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCADI+AFAARDS    GG  Y+V
Sbjct  89    GNLAEKDSVANNPSMRGFDVIDDAKAALEAHCPRTVSCADIVAFAARDSACSAGGLEYEV  148

Query  809   PAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             P+GRRDGRVS   E+  NN+P P+  V +L   F  KG + ++MVTLSGAHTIGRSHC+S
Sbjct  149   PSGRRDGRVSRQDEVLDNNVPTPTDVVAELIESFKRKGLSADDMVTLSGAHTIGRSHCSS  208

Query  632   FNNRLYSFNSTT-VQDPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYY  465
             F  RLY+F+      DPSLDP YA  LK RCP  +S+  +   VVP DP +PA  D  Y+
Sbjct  209   FTQRLYNFSGQLGWTDPSLDPAYAGHLKARCPWPSSDDQMDPTVVPQDPVTPATFDNQYF  268

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
              N+LA++ LF SD TLL +P TA  V+ NA    +W ++FA AMVKMG++ VLTG+ GEI
Sbjct  269   KNVLAHKVLFVSDNTLLDNPWTAGIVQFNAAVEKAWQVRFAKAMVKMGKVQVLTGDEGEI  328

Query  284   RANCRVVN  261
             R  C VVN
Sbjct  329   REKCFVVN  336



>gb|KCW61137.1| hypothetical protein EUGRSUZ_H03910, partial [Eucalyptus grandis]
Length=300

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 209/301 (69%), Gaps = 2/301 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY   C  AE +V++ VQKA   D G  A L+R+HFHDCFVRGCDGS+L++ST  N
Sbjct  2     LKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGN  61

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             TAEKDS   N  + GFEVID AKA++E+ C   VSCADI+AFAARD V   GG  Y VP+
Sbjct  62    TAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGLHYAVPS  120

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDGRVSLASE+  NLP   F+  QL   F+ KG +   MVTLSGAH+IG SHC+ F  
Sbjct  121   GRRDGRVSLASEVIQNLPGAFFDAAQLKANFAKKGLSLRNMVTLSGAHSIGDSHCSQFTK  180

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANR  444
             RLYSFNST  QDPSL+P YA  LK +CP+ NS  + +VP DP +P + D +YY N+ +++
Sbjct  181   RLYSFNSTYSQDPSLNPNYAHLLKTKCPR-NSPTDPIVPFDPVTPNVLDNAYYRNLKSDK  239

Query  443   GLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVV  264
             GL  SDQ L   P T   V+ NA  P +W  +F AAMV+MG I VLTG  GEIR NCRV+
Sbjct  240   GLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRMGSIEVLTGTQGEIRKNCRVI  299

Query  263   N  261
             N
Sbjct  300   N  300



>gb|KCW61140.1| hypothetical protein EUGRSUZ_H03915, partial [Eucalyptus grandis]
Length=300

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 210/301 (70%), Gaps = 2/301 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY   C  AE +V++ VQKA   D G  A L+R+HFHDCFVRGCDGS+L++ST  N
Sbjct  2     LKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGN  61

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             TAEKDS   N  + GFEVID AKA++E+ C   VSCADI+AFAARD V   GGF Y VP+
Sbjct  62    TAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPS  120

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDGRVSLASE+  NLP P F+  QL   F+ KG +  +MVTLSGAH+IG SHC+ F  
Sbjct  121   GRRDGRVSLASEVIKNLPGPFFDAVQLEANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTK  180

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANR  444
             RLYSFNST  QDPSL+P YA  LK +CP+ N   + +VP DP +P + D +YY N+ +++
Sbjct  181   RLYSFNSTYSQDPSLNPNYAHLLKTKCPR-NGPTDPIVPFDPVTPNVLDNAYYHNLKSDK  239

Query  443   GLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVV  264
             GL  SDQ L     T   V+ NA  P +W  +F AAMV+MG I VLTG  GEIR NCRV+
Sbjct  240   GLLYSDQVLWDASLTRGLVKDNANHPSAWARRFTAAMVRMGLIEVLTGTQGEIRKNCRVI  299

Query  263   N  261
             N
Sbjct  300   N  300



>ref|XP_010938174.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=329

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 214/306 (70%), Gaps = 7/306 (2%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VGFY  SC  AE IV++ V +A   + G+AAGL+RMHFHDCFVRGCD SVL++ST 
Sbjct  29    ASLEVGFYKESCPSAEDIVRNTVSQAVAQNPGIAAGLIRMHFHDCFVRGCDASVLLNSTP  88

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              NTAEKD+P NNPSLRGF+VID+AKA +E+ C   VSCADILAFAARD   +TGG  Y V
Sbjct  89    GNTAEKDAPPNNPSLRGFQVIDAAKAAVEACCPRKVSCADILAFAARDGAYLTGGIDYQV  148

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGR+S  SE   N+P P+ N  QL   F+NKG + +EMVTLSGAH+IGRSHC+SF
Sbjct  149   PAGRRDGRISRESEALANIPSPNSNAEQLKENFTNKGLSLDEMVTLSGAHSIGRSHCSSF  208

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
              NRLY      VQDPS+DP +AAQLK  CP   ++ +    V +D  +P   D  YY N+
Sbjct  209   TNRLYG-----VQDPSMDPAFAAQLKATCPPSTASPSDPTTVVLDAVTPDRLDNMYYWNL  263

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L +RG+ TSDQTL     TA  V   A    +W  KFAAAMVKMG I VLTG+ GEIR  
Sbjct  264   LKHRGVLTSDQTLEESSETAKLVWYYAEDQSTWAAKFAAAMVKMGSIEVLTGSQGEIREK  323

Query  275   CRVVNS  258
             C VVN+
Sbjct  324   CWVVNA  329



>ref|XP_009335532.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=311

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 214/312 (69%), Gaps = 1/312 (0%)
 Frame = -1

Query  1196  LTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCD  1017
             ++  + V  A   VGFY  SC  AE IV+  V KA   + G+AAGL+RMHFHDCFVRGCD
Sbjct  1     MSMMVFVSSAAPTVGFYRSSCPSAEAIVRKAVTKAVARNPGIAAGLIRMHFHDCFVRGCD  60

Query  1016  GSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVE  837
              SVL+DST  N +EK+ PAN PSLRGFEVID AK  LE+ C   VSCADILAFAARD   
Sbjct  61    ASVLLDSTPENPSEKEHPANFPSLRGFEVIDEAKVELEAKCPNTVSCADILAFAARDGAL  120

Query  836   MTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHT  657
               GG  Y VP+GRRDGR+SL  E  ++LPPPSF   QL   F+ KG + +EMVTLSGAH+
Sbjct  121   QVGGINYAVPSGRRDGRISLRDEPNDHLPPPSFGANQLEENFARKGLSLDEMVTLSGAHS  180

Query  656   IGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITD  477
             IG + C++  +RLYSFN+T   DPS+DP +A  LK++CP+ + +    VP+D  +P   D
Sbjct  181   IGVTRCSTILDRLYSFNATHPTDPSMDPIFARNLKKKCPRSSDDLK-TVPLDVLTPNELD  239

Query  476   VSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGN  297
               YYT++  ++G+  SDQTLLT  STA  VR NA    +W  KF AAMVKMG I VLTG 
Sbjct  240   NKYYTDLKNHQGMLASDQTLLTSQSTAGFVRNNARFGAAWANKFGAAMVKMGSIDVLTGR  299

Query  296   AGEIRANCRVVN  261
              GEIR NCRVVN
Sbjct  300   QGEIRKNCRVVN  311



>ref|XP_008388923.1| PREDICTED: peroxidase 5-like [Malus domestica]
Length=327

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 215/319 (67%), Gaps = 1/319 (0%)
 Frame = -1

Query  1217  CYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             C      ++  + V  A   VG Y  SC  AE IV+  V KA   + G+AAGL+RMHFHD
Sbjct  10    CLIFFLAMSMMVFVSSAAPTVGXYGSSCPSAEAIVRKAVTKAVARNPGIAAGLIRMHFHD  69

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCD SVL+DST  N +EK+ PAN PSLRGFEVID AKA LE+ C   VSCADILAF
Sbjct  70    CFVRGCDASVLLDSTPENPSEKEHPANFPSLRGFEVIDEAKAELEAKCPNTVSCADILAF  129

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARD     GG  Y VP+GRRDGR+SL  E  ++LPPP F+  QL   F+ KG + +EMV
Sbjct  130   AARDGALQVGGINYAVPSGRRDGRISLRDEPNDHLPPPXFDAKQLEENFARKGLSLDEMV  189

Query  677   TLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDP  498
             TLSGAH+IG + C++  +RLYSFN+T   DPS+DP +A  LK++CP+ + N    VP+D 
Sbjct  190   TLSGAHSIGVTRCSTILDRLYSFNATHPTDPSMDPIFARNLKKKCPRSSDNPK-TVPLDV  248

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              +P   D  YYT++  ++G+  SDQTLLT  STA  VR NA    +W  KF AAMVKMG 
Sbjct  249   LTPNKLDNKYYTDLKNHQGMLASDQTLLTSRSTAGFVRNNARFGAAWANKFGAAMVKMGS  308

Query  317   ISVLTGNAGEIRANCRVVN  261
             I VLTG  GEIR NCRVVN
Sbjct  309   IDVLTGRQGEIRKNCRVVN  327



>gb|KCW58170.1| hypothetical protein EUGRSUZ_H00887, partial [Eucalyptus grandis]
Length=337

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 213/303 (70%), Gaps = 2/303 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             ++ +VGFY  +C  A  IVK  V +A   + G+AAGL+R+HFHDCFVRGCD SVL+ ST 
Sbjct  35    SKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTP  94

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AE+D P NNPSLRGFE+ID AKARLE++C   VSCADI+AFAARDSV  TGG  Y+V
Sbjct  95    ENPAERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIYYNV  154

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGRRDGRVS  SE+  NLP P+FN  QL   F+ KG +  EMVTL GAH+IG SHC+SF
Sbjct  155   PAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHCSSF  214

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGN-SNANLVVPMDPFSPAITDVSYYTNI  456
             ++RLY+FN+T  QDPSLDP +AA LK +C PQ N +  +  VP+D  +P   D  YY  +
Sbjct  215   SSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKYYLQL  274

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             L  RG+   D+TL T PST+  V  NA +  +W  KFA AMVKMG + VLTG  GEIR  
Sbjct  275   LKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGEIREL  334

Query  275   CRV  267
             C V
Sbjct  335   CSV  337



>ref|XP_009365500.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=327

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 215/319 (67%), Gaps = 1/319 (0%)
 Frame = -1

Query  1217  CYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             C      ++  + V  A   VGFY  SC  AE IV+  V KA   + G+AAGL+RMHFHD
Sbjct  10    CLIFFLAMSMMVFVSSAAPTVGFYRSSCPSAEAIVRKAVTKAVARNPGIAAGLIRMHFHD  69

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCD SVL+DST  N +EK+ PAN PSLRGFEVID AK  LE+ C   VSCADILAF
Sbjct  70    CFVRGCDASVLLDSTPENPSEKEHPANFPSLRGFEVIDEAKVELEAKCPNTVSCADILAF  129

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARD     GG  Y VP+GRRDGR+SL  E  ++LPPPSF   QL   F+ KG + +EMV
Sbjct  130   AARDGALQVGGINYAVPSGRRDGRISLRDEPNDHLPPPSFGANQLEENFARKGLSLDEMV  189

Query  677   TLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDP  498
             TLSGAH+IG + C++  +RLYSFN+T   DPS+DP +A  LK++CP+ + +    VP+D 
Sbjct  190   TLSGAHSIGVTRCSTILDRLYSFNATHPTDPSMDPIFARNLKKKCPRSSDDLK-TVPLDV  248

Query  497   FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQ  318
              +P   D  YYT++  ++G+  SDQTLLT  STA  VR NA    +W  KF AAMVKMG 
Sbjct  249   LTPNELDNKYYTDLKNHQGMLASDQTLLTSQSTAGFVRNNARFGAAWANKFGAAMVKMGS  308

Query  317   ISVLTGNAGEIRANCRVVN  261
             I VLTG  GEIR NCRVVN
Sbjct  309   IDVLTGRQGEIRKNCRVVN  327



>ref|XP_007161518.1| hypothetical protein PHAVU_001G076000g [Phaseolus vulgaris]
 gb|ESW33512.1| hypothetical protein PHAVU_001G076000g [Phaseolus vulgaris]
Length=331

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 222/325 (68%), Gaps = 2/325 (1%)
 Frame = -1

Query  1229  RMLSCYSTLALLTCQLIVLKAEL-QVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             R L   S+L L+   +  L +   +VGFY+ +C  AE IV+  V K    + G+AAGL+R
Sbjct  7     RFLQTISSLVLILVSVSSLASASLKVGFYTSTCPSAEEIVRSAVNKGISENSGIAAGLIR  66

Query  1052  MHFHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             MHFHDCFVRGC+GSVL+ ST  N  AE+D  ANNPSLRGFEVI+ AK +LE+ C G VSC
Sbjct  67    MHFHDCFVRGCEGSVLLASTPGNPIAERDHFANNPSLRGFEVIEEAKIQLEAACPGTVSC  126

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADILAFAARDS    GG  YDVP+GRRDGRVS+A E+  NLP P+ NV +L + F  KG 
Sbjct  127   ADILAFAARDSALKVGGINYDVPSGRRDGRVSIADEVAQNLPAPTSNVDELVSRFEQKGL  186

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL  516
             + +EMVTLSGAH+IG SHC++F+ RLYSFN T  QDPS+D  YA  LK +CP     ++ 
Sbjct  187   SADEMVTLSGAHSIGVSHCSTFSKRLYSFNDTFKQDPSMDSSYAETLKTKCPAPPPTSDP  246

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
              + +DP +P   D  YY  ++ +RGL TSDQTL T  ST   V  NA +  +W  KFA A
Sbjct  247   TLSLDPSTPVRLDNKYYEGLINHRGLLTSDQTLFTTQSTREMVVSNADNGANWSEKFAKA  306

Query  335   MVKMGQISVLTGNAGEIRANCRVVN  261
             MV+MG I VLTG++GEIR +C  VN
Sbjct  307   MVQMGSIEVLTGSSGEIRKHCSFVN  331



>gb|EMT07621.1| Peroxidase 5 [Aegilops tauschii]
Length=325

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 225/306 (74%), Gaps = 6/306 (2%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             +A+LQVGFY+ SC +AE+IV+DEV +A     G AAGLVR+HFHDCFV+GCD SVL+DST
Sbjct  24    QAQLQVGFYAHSCPQAEVIVRDEVGRAVSAYPGFAAGLVRLHFHDCFVKGCDASVLLDST  83

Query  992   ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
             A++TAEKD+P N  SLRGFEVID+AK RLE+ C G VSCADILAFAARDSV + GG  Y 
Sbjct  84    ANSTAEKDAPPNK-SLRGFEVIDAAKKRLEAACAGTVSCADILAFAARDSVVLAGGSPYG  142

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             VPAGRRDG VS AS+   +LPPP+ NV  LT  F+  G +QE+MVTLSGAHTIG +HC+S
Sbjct  143   VPAGRRDGNVSAASDAQASLPPPTANVAHLTEAFAKNGLSQEDMVTLSGAHTIGVTHCSS  202

Query  632   FNNRLYSFNST--TVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTN  459
             F+ RL+ +N+T  T QDP++D   AA+L ++C  G+ NA   VPMD  SP   D  Y+  
Sbjct  203   FSARLHGYNATTGTGQDPAMDGAKAAELARQCSPGSPNA---VPMDAGSPDTFDTGYFRA  259

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +LAN G+  SDQTL +D +TA    QNAG+   +  +F  A+V+MG I VLTG  G+IR 
Sbjct  260   LLANPGVLASDQTLPSDNATAALGAQNAGNGYLFVTRFGDALVRMGGIRVLTGGDGQIRT  319

Query  278   NCRVVN  261
             NCRVVN
Sbjct  320   NCRVVN  325



>ref|XP_004983811.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=323

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 233/324 (72%), Gaps = 6/324 (2%)
 Frame = -1

Query  1232  IRMLSCYSTLALLTCQLIV--LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGL  1059
             ++ ++ Y  +A +   L    L+A+L+VGFY  SC  AE+IV+ EV KA   + G+AAGL
Sbjct  3     VQRMALYFQVAAVVVLLTATGLRAQLRVGFYDNSCPAAEIIVQQEVSKAVGANPGLAAGL  62

Query  1058  VRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVS  879
             +R+HFHDCFV+GCD SVLIDST  NTAEKD+   N SLRGFEV+D  KAR+E  C GVVS
Sbjct  63    LRLHFHDCFVKGCDASVLIDSTPGNTAEKDA-GPNTSLRGFEVVDRIKARVEQACSGVVS  121

Query  878   CADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKG  699
             CADILAFAARDSV + GG  Y VPAGRRDG VS AS+   NLPPP+ NV QLT +F  KG
Sbjct  122   CADILAFAARDSVALAGGNAYQVPAGRRDGAVSRASDTGGNLPPPTANVAQLTQIFGTKG  181

Query  698   FTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN  519
              TQ++MV LSGAHTIG SHC+SF++RL    +T  QDP++DP Y AQL ++CPQG    +
Sbjct  182   LTQKDMVVLSGAHTIGSSHCSSFSSRLSRSGTTAGQDPTMDPAYVAQLARQCPQGG---D  238

Query  518   LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAA  339
              +VPMD  SP   D  +Y  ++ANRGL +SDQ LL+D +TA +V   A  P ++   FAA
Sbjct  239   PLVPMDYVSPNAFDEGFYKGVMANRGLLSSDQALLSDKNTAVQVVTYANDPATFQSDFAA  298

Query  338   AMVKMGQISVLTGNAGEIRANCRV  267
             AMVKMG + VLTG++G+IR NCRV
Sbjct  299   AMVKMGSVGVLTGSSGKIRGNCRV  322



>ref|XP_002440543.1| hypothetical protein SORBIDRAFT_09g002810 [Sorghum bicolor]
 gb|EES18973.1| hypothetical protein SORBIDRAFT_09g002810 [Sorghum bicolor]
Length=333

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 212/303 (70%), Gaps = 5/303 (2%)
 Frame = -1

Query  1154  GFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAE  975
             GFY  SC +AE IV++ V++    D GV AGL+RM FHDCFVRGCD S+LI+ST  N AE
Sbjct  28    GFYKHSCPKAEEIVRNAVRRGIARDAGVGAGLIRMQFHDCFVRGCDASILINSTPGNKAE  87

Query  974   KDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRR  795
             KDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARD   + GG  Y VP+GRR
Sbjct  88    KDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIIAFAARDGAYLAGGLDYKVPSGRR  147

Query  794   DGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRL  618
             DGRVS   E+  NN+P P  +V +L   F  KG   ++MVTLSGAHTIGRSHC+SF  RL
Sbjct  148   DGRVSKEDEVLDNNVPAPFDDVAELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSFTQRL  207

Query  617   YSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYYTNILA  450
             Y+F+    + DPSLDP YA  LK RCP  +SN  +   VVP+DP +PA  D  YY N+LA
Sbjct  208   YNFSGQLGRTDPSLDPTYAEHLKMRCPWPSSNGQMDTTVVPLDPVTPATFDNQYYKNVLA  267

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             ++ LF SD TLL +P TA  V  NA    +W +KFA AMVKMG++ VLTG+ GEIR  C 
Sbjct  268   HKVLFVSDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIREKCF  327

Query  269   VVN  261
             VVN
Sbjct  328   VVN  330



>gb|KCW52186.1| hypothetical protein EUGRSUZ_J01615 [Eucalyptus grandis]
Length=300

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 210/303 (69%), Gaps = 10/303 (3%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A LQVGFY  +C  AE +V+  V KA   + G+ AGL+RMHFHDCFVRGCD S+L+DST 
Sbjct  7     ATLQVGFYRSTCPAAESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  66

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N +EK+ PANNPSLRG+EVID AKA LE LC   VSCADILAFAARDS    G   Y V
Sbjct  67    GNPSEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINYAV  126

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PA           E   NLPPPS +  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  127   PA----------DEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  176

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLYSFN+T  +DPS++P+ A++LK +CP     ++  VP+D  +    D  YYTN+  
Sbjct  177   SNRLYSFNATHKRDPSMEPKLASELKAKCPNNGGTSDPTVPLDFVTANGLDNKYYTNLKK  236

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RG+ TSDQTL   PSTA+ VR+NA    +W  KFAAAMVKMG I VLTG+ GEIR NCR
Sbjct  237   HRGVLTSDQTLFNSPSTAHIVRRNANHGGAWANKFAAAMVKMGSIDVLTGSQGEIRRNCR  296

Query  269   VVN  261
             VVN
Sbjct  297   VVN  299



>ref|XP_007051236.1| Class III peroxidase 70 [Theobroma cacao]
 gb|EOX95393.1| Class III peroxidase 70 [Theobroma cacao]
Length=338

 Score =   349 bits (896),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 214/318 (67%), Gaps = 4/318 (1%)
 Frame = -1

Query  1202  ALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRG  1023
             +L + +     A L+VGFY GSC  AE IV+  V KA   + G+AAGL+RM+FHDCFVRG
Sbjct  21    SLFSTKASASAASLKVGFYKGSCPSAETIVRKAVNKAVSRNPGIAAGLIRMYFHDCFVRG  80

Query  1022  CDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDS  843
             CD SVL+ ST  N AE D PANNPSLRGFEVID AKA++E+LC G VSCADILAFAARDS
Sbjct  81    CDASVLLKSTPGNLAEMDHPANNPSLRGFEVIDEAKAQIEALCPGTVSCADILAFAARDS  140

Query  842   VEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGA  663
                TGG  Y +PAGRRDGRVS++ E+  NLP PS N  Q +  F+ KG + +EMVTLSGA
Sbjct  141   TYKTGGIYYAIPAGRRDGRVSISDEVTQNLPSPSSNAEQNSQRFARKGMSVDEMVTLSGA  200

Query  662   HTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCP----QGNSNANLVVPMDPF  495
             H+IG SHC+SF+NRLYSFN+T  QDPSLDP YAA LK +CP     G       V +D  
Sbjct  201   HSIGVSHCSSFSNRLYSFNATHAQDPSLDPNYAAFLKTKCPPPPTAGAGRDPTTVALDMV  260

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             +P   D +YY+ +   RGL TSDQTL+    T+  V  N      W  KFA AMV +G +
Sbjct  261   TPNRLDNNYYSELRRRRGLLTSDQTLMDSSLTSRMVLNNKRDGALWAKKFAKAMVHLGSL  320

Query  314   SVLTGNAGEIRANCRVVN  261
              VLTG  GEIR  C V N
Sbjct  321   DVLTGAQGEIRRICCVAN  338



>dbj|BAJ95224.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   349 bits (896),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 219/305 (72%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  +C +AE IV+D V++A   + G+A G++RMHFHDCFVRGCDGS+LI+ST  N
Sbjct  35    LKVGFYKHTCPQAEDIVRDAVRRAVARNPGLAPGIIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             TAEKDS ANNPS+RGFEVID AKA LE+ C   VSCAD+LAFAARD   + GG  Y VP+
Sbjct  95    TAEKDSVANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVS+A E+  NN+PPP+  V +L   F  KG + ++MVTLSGAHTIGRSHC+SF 
Sbjct  155   GRRDGRVSIADEVLNNNVPPPTDEVAELVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
              R+++F+    + DPS+D  YAA+L+++CP    N +    VP+DP +P   D  Y+ N+
Sbjct  215   QRIHNFSGEIGRTDPSIDKSYAAELRRQCPPSTDNPSDLTTVPLDPVTPREFDNQYFKNV  274

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA +   TSDQTLLT P TA  V  +A    +W  KFAAAMVKMG + VLTG+ GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPHTAGIVALHAAVEKAWQAKFAAAMVKMGNVEVLTGHEGEIREK  334

Query  275   CRVVN  261
             C VVN
Sbjct  335   CFVVN  339



>ref|NP_001148340.1| peroxidase 1 precursor [Zea mays]
 gb|ACG30856.1| peroxidase 1 precursor [Zea mays]
Length=339

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 219/308 (71%), Gaps = 5/308 (2%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             + LQVGFY  SC +AE IV++ V++    D G+ AGL+RMHFHDCFVRGCD S+LI+ST 
Sbjct  29    SSLQVGFYKHSCPQAEDIVRNAVRRGLARDPGIGAGLIRMHFHDCFVRGCDASILINSTP  88

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCADI+AFAARDS    GG  Y+V
Sbjct  89    GNLAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADIVAFAARDSACSAGGLEYEV  148

Query  809   PAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             P+GRRDGRVS   E+  NN+P P+ +V +L   F  KG + ++MVTLSGAHT+GRSHC+S
Sbjct  149   PSGRRDGRVSRQDEVLDNNVPTPTDDVAELIESFKRKGLSADDMVTLSGAHTVGRSHCSS  208

Query  632   FNNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL---VVPMDPFSPAITDVSYY  465
             F  RLY+F+    + DPS+DP YA  LK RCP  +S+  +   VVP DP +PA  D  Y+
Sbjct  209   FTQRLYNFSGQLGRTDPSVDPAYAGHLKARCPWPSSDDQMDPTVVPQDPVTPATFDNQYF  268

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
              N+LA++ LF SD TLL +P TA  V+ NA    +W ++F  AMVKMG++ VLTG+ GEI
Sbjct  269   KNVLAHKVLFVSDNTLLDNPWTAGIVQFNAAVEKAWQVRFVKAMVKMGKVQVLTGDEGEI  328

Query  284   RANCRVVN  261
             R  C VVN
Sbjct  329   REKCFVVN  336



>ref|XP_010674523.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 221/336 (66%), Gaps = 7/336 (2%)
 Frame = -1

Query  1247  MSSSRIRMLSCY--STLALLTCQLIVLKAEL----QVGFYSGSCGRAELIVKDEVQKAFV  1086
             MSSS   ML  +   TLA +    I L +       VGFY  +C  AE IV++ V  A  
Sbjct  1     MSSSFFSMLFLFLAMTLACMCTSTISLSSSSSSSLMVGFYQQTCPSAEEIVRNVVNNAVT  60

Query  1085  CDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARL  906
              + G+ AGL+RMHFHDCFVRGCD S+L+DST  N +EK++ ANNPS+RG+EVID AK +L
Sbjct  61    RNPGLGAGLIRMHFHDCFVRGCDASILLDSTLENPSEKENIANNPSMRGYEVIDEAKKQL  120

Query  905   ESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQ  726
             E+ C  VVSCADI+AFAARDS    GG  Y V +GRRDGRVSL  +   NLPPP FN+ Q
Sbjct  121   EAQCPQVVSCADIIAFAARDSASKLGGINYGVESGRRDGRVSLKDDPTQNLPPPFFNLNQ  180

Query  725   LTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQR  546
             L   F  KG + EEMV LSGAH+IG SHC+SF  RLYSFN+T  QDPS+DP++A+ LK +
Sbjct  181   LKENFERKGLSLEEMVILSGAHSIGVSHCSSFTQRLYSFNATHPQDPSMDPRFASMLKSK  240

Query  545   CPQGN-SNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGS  369
             C   + +N +  V  D  +P   D  YY N+   RGL TSDQTL+T P TAN VR   G 
Sbjct  241   CLNNSPNNVDPTVLQDFVTPNRLDNKYYQNLQNKRGLLTSDQTLVTSPETANMVRNYGGR  300

Query  368   PISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
                W  KFA AMV MG I VLTG  GEIR NCR+VN
Sbjct  301   SSDWANKFAKAMVHMGSIEVLTGIEGEIRKNCRIVN  336



>gb|EMT10333.1| Peroxidase 5 [Aegilops tauschii]
Length=341

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 217/305 (71%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  +C +AE IV+D V++A   + G A GL+RMHFHDCFVRGCDGS+LI+ST  N
Sbjct  35    LKVGFYKHTCPQAEDIVRDAVRRAVARNPGFAPGLIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             TAEKDS ANNPS+RGFEVID AKA LE+ C   VSCAD+LAFAARD   + GG  Y VP+
Sbjct  95    TAEKDSVANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVS+A E+  NN+PPP+  V QL   F  KG + ++MVTLSGAHTIGRSHC+SF 
Sbjct  155   GRRDGRVSIADEVLNNNVPPPTDEVAQLVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
              R+++F+    + DPS+D  YAA+L+++CP    N +    VP+DP +P   D  Y+ N+
Sbjct  215   QRIHNFSGEVGRTDPSIDKSYAAELRRQCPPSTDNPSDLTTVPLDPITPREFDNQYFKNV  274

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA +   TSDQTLLT P TA  V  +A    +W  KFAAAMVKMG + VLTG+ GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVAFHAAVEKAWRAKFAAAMVKMGNVEVLTGHEGEIREK  334

Query  275   CRVVN  261
             C  VN
Sbjct  335   CFAVN  339



>gb|KDP37024.1| hypothetical protein JCGZ_06080 [Jatropha curcas]
Length=318

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 214/318 (67%), Gaps = 13/318 (4%)
 Frame = -1

Query  1199  LLTCQLIVLK-AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRG  1023
             +L C L+ L  A L+VGFY  +C  AE IV+  V K    + G+ AGL+RMHFHDCFVRG
Sbjct  9     VLLCSLVTLSSASLKVGFYKSTCPLAETIVRRAVNKFVSRNPGLGAGLIRMHFHDCFVRG  68

Query  1022  CDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDS  843
             CDGSVL++ST  N +E++  ANNPSLRGFEVI+ AKA++E++C   VSCADILAFA+RDS
Sbjct  69    CDGSVLLESTPGNPSEREHIANNPSLRGFEVINEAKAQIEAICPQTVSCADILAFASRDS  128

Query  842   VEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGA  663
                 GG  Y VPAGRRDG       +  NLPPP FN  QL+  F+ KG + +EMVTLSGA
Sbjct  129   SSKLGGINYAVPAGRRDG-------LEQNLPPPFFNAEQLSQNFARKGMSVDEMVTLSGA  181

Query  662   HTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA----NLVVPMDPF  495
             H+IG SHC+SF+NRLYSFNST  QDPS+D  YAA LK RCP  N+N     +  V  DP 
Sbjct  182   HSIGISHCSSFSNRLYSFNSTHAQDPSMDSAYAAVLKTRCPPSNNNGGSTNDPTVARDP-  240

Query  494   SPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQI  315
             +P   D  YY  +  NRGL TSDQTLL  PST   V  NA +   W  KFA AMV MG +
Sbjct  241   TPNRMDNRYYMELKKNRGLLTSDQTLLNSPSTQKMVVNNARNSRVWAAKFAKAMVHMGSL  300

Query  314   SVLTGNAGEIRANCRVVN  261
              VLTG  GE+R  C VVN
Sbjct  301   DVLTGTQGEVRKQCSVVN  318



>ref|XP_003555769.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 222/324 (69%), Gaps = 1/324 (0%)
 Frame = -1

Query  1229  RMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             R++   S+L L+     +  A L+VGFYS +C  AE IVK  V+KA   + G+AAGL+RM
Sbjct  6     RLIQTVSSLVLILSISSLASASLKVGFYSSTCPSAEAIVKSTVEKAISANPGIAAGLIRM  65

Query  1049  HFHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             HFHDCFVRGCDGSVL+ ST  N  +E+D+  NNPSLRGFEVI+ AK ++E+ C   VSCA
Sbjct  66    HFHDCFVRGCDGSVLLASTPGNPISERDNFVNNPSLRGFEVIEDAKNQIEAACPETVSCA  125

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDSV   GG  YDVP+GRRDGRVS+  E+ +NLP PS +   L + F  KG +
Sbjct  126   DILAFAARDSVSKVGGISYDVPSGRRDGRVSIGDEVLDNLPRPSLSADDLISNFERKGLS  185

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
              +EMVTLSGAH+IG SHC +F+NRLYSF+ T  QDPSLD  YA  LK +CP     ++  
Sbjct  186   ADEMVTLSGAHSIGVSHCGAFSNRLYSFSDTVTQDPSLDSSYAETLKTQCPPPPPTSDPT  245

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             V ++P +P   D  YY  ++ +RGL TSDQTL T  ST   V+ NA +  SW  KFA AM
Sbjct  246   VSLEPSTPIRLDSKYYEGLINHRGLLTSDQTLYTSQSTRGMVQSNANNGASWADKFALAM  305

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             ++MG I VLTG+ GEIR  C  VN
Sbjct  306   LRMGSIEVLTGSDGEIRKQCSFVN  329



>ref|XP_004968663.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=362

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 222/324 (69%), Gaps = 5/324 (2%)
 Frame = -1

Query  1220  SCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             S  + LALL   ++ + A L+VGFY+ SC  AE +V+  V  AF  + G+AAGL+R+HFH
Sbjct  11    SALAILALL--PVVAIGAGLKVGFYNKSCPSAESLVQQAVAAAFKNNSGIAAGLIRLHFH  68

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCDGSVLID+T++NTAEKD+P NNPSLRGFEVID+AK  +E+ C  VVSCADILA
Sbjct  69    DCFVRGCDGSVLIDTTSNNTAEKDAPPNNPSLRGFEVIDAAKKAIEARCPKVVSCADILA  128

Query  860   FAARDSVEMTG-GFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEE  684
             FAARD+V ++G    Y VPAGRRDGR+S  ++  NNLP P  N  +L   F+ K  T E+
Sbjct  129   FAARDAVALSGNNLTYKVPAGRRDGRISRDTDASNNLPSPLSNATELVGNFTVKNLTAED  188

Query  683   MVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--ANLVV  510
             MV LSGAHT+GRSHC+SF NRLY F++ +  DP++   YA  L+  CP  +S    N   
Sbjct  189   MVVLSGAHTVGRSHCSSFTNRLYGFSNASDVDPTISSAYAFLLRGICPSNSSQFFPNTTT  248

Query  509   PMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMV  330
              MD  +PA+ D  YY  +  N GLFTSDQ LLT+ +    V +   S   W  KFA AMV
Sbjct  249   EMDLMTPAVLDNKYYLGLANNLGLFTSDQALLTNATLKKSVDEFVKSENRWRSKFAKAMV  308

Query  329   KMGQISVLTGNAGEIRANCRVVNS  258
             KMG I VLTG  GEIR NCRV+NS
Sbjct  309   KMGNIEVLTGTQGEIRLNCRVINS  332



>ref|XP_006353128.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=353

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 213/307 (69%), Gaps = 3/307 (1%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             K+   +GFYS SC +AE I++  V KA + + G AAG++RMHFHDCF+RGCDGSVL+DS 
Sbjct  47    KSTFGIGFYSKSCPQAEGIIRKAVFKAVLMNPGFAAGIIRMHFHDCFIRGCDGSVLLDSV  106

Query  992   -ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
                 TAEKDSP NNPSLRGF VID AKA LE +C   VSCADILA+AARDS    GG  Y
Sbjct  107   PGKETAEKDSPINNPSLRGFGVIDEAKALLEKVCPHTVSCADILAYAARDSAFFVGGIKY  166

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP GRRDGRVSL+SE+  NLPPP F+  QL + F  KG + +EMVTLSGAH+IG SHC+
Sbjct  167   AVPGGRRDGRVSLSSEVIQNLPPPFFDAKQLEDNFKAKGLSLDEMVTLSGAHSIGVSHCS  226

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA--NLVVPMDPFSPAITDVSYYT  462
             +F+NRLY FN+T  QDPSLD +YA+ LK +CP+  S+   + +V +D  SP   D  YY 
Sbjct  227   AFSNRLYGFNTTHPQDPSLDTRYASFLKNKCPRPMSDTQDDPIVNLDVSSPIHLDNKYYL  286

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+  ++GL TSDQTL   P T+  V  N     +W  KFA AMV MG I +LT N GEIR
Sbjct  287   NLRNHKGLLTSDQTLYESPLTSKLVLNNVKFRSTWTRKFANAMVHMGSIEILTDNKGEIR  346

Query  281   ANCRVVN  261
              NC  +N
Sbjct  347   KNCHFIN  353



>pdb|3HDL|A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase 
From Royal Palm Tree
Length=304

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 216/304 (71%), Gaps = 1/304 (0%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +LQ+GFY+ SC  AE +V+  V  AF  + G+A GL+RMHFHDCFVRGCD SVL+DSTA+
Sbjct  1     DLQIGFYNTSCPTAESLVQQAVAAAFANNSGIAPGLIRMHFHDCFVRGCDASVLLDSTAN  60

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             NTAEKD+  NNPSLRGFEVI +AK+ +E+ C   VSCADILAFAARDS  + G   Y VP
Sbjct  61    NTAEKDAIPNNPSLRGFEVITAAKSAVEAACPQTVSCADILAFAARDSANLAGNITYQVP  120

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             +GRRDG VSLASE    +P P FN  QL N F+NK  T +EMVTLSGAH+IG +HC+SF 
Sbjct  121   SGRRDGTVSLASEANAQIPSPLFNATQLINSFANKTLTADEMVTLSGAHSIGVAHCSSFT  180

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-LVVPMDPFSPAITDVSYYTNILA  450
             NRLY+FNS +  DP+L P YAA L+  CP  ++    + V +D  +P++ D  YYT +  
Sbjct  181   NRLYNFNSGSGIDPTLSPSYAALLRNTCPANSTRFTPITVSLDIITPSVLDNMYYTGVQL  240

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
               GL TSDQ L+T+ + +  V+ NA +  +W  KFA AMVKMGQI VLTG  GEIR NC 
Sbjct  241   TLGLLTSDQALVTEANLSAAVKANAMNLTAWASKFAQAMVKMGQIEVLTGTQGEIRTNCS  300

Query  269   VVNS  258
             VVNS
Sbjct  301   VVNS  304



>ref|XP_009401741.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=325

 Score =   347 bits (889),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 218/302 (72%), Gaps = 5/302 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L VGFYS SC +AE IVK+ +  A   D G+ A L+RMHFHDCFVRGCDGSVLIDST  N
Sbjct  28    LNVGFYSYSCPQAEAIVKEALNDALEEDSGIGADLLRMHFHDCFVRGCDGSVLIDSTNGN  87

Query  983   TAEKDSPANNP-SLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             TAEKD+  N       F+VID AK +LE++CKGVVSCADILAF ARDSV   GG  Y VP
Sbjct  88    TAEKDAEINQTIEDEAFQVIDKAKKKLEAVCKGVVSCADILAFVARDSVAHYGGIFYQVP  147

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             AGRRDGR+S + +  + LP    N+ +LTN F+ KG +Q +M+ LSGAHTIG +HC SF+
Sbjct  148   AGRRDGRISRSVDTAD-LPTADLNLARLTNSFARKGLSQNDMIILSGAHTIGVAHCPSFS  206

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILAN  447
             NRLY+F+ ++  DP+LD  YAA+LK+ CP G++N    V MDP SP + D SYY  IL +
Sbjct  207   NRLYNFSRSSSSDPTLDASYAAELKEECPPGSNNE---VNMDPPSPLVFDTSYYQGILKH  263

Query  446   RGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRV  267
             RGLF+SDQTL++  S+A +V   A + + +  +FAAAMVKMG I VLTG AGEIR NCRV
Sbjct  264   RGLFSSDQTLVSTASSAAKVTLLATNSVVFKSEFAAAMVKMGGIGVLTGRAGEIRGNCRV  323

Query  266   VN  261
             VN
Sbjct  324   VN  325



>ref|XP_002272800.1| PREDICTED: peroxidase 5 [Vitis vinifera]
 emb|CBI37010.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   347 bits (890),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 209/306 (68%), Gaps = 2/306 (1%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L + L+VGFY  +C  AE +V+  V KA   + G+AAGL+RMHFHDCFVRGCD SVL+DS
Sbjct  35    LSSSLKVGFYGSTCPSAEAVVRKTVDKAVSRNLGIAAGLIRMHFHDCFVRGCDASVLLDS  94

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  N +EK+ PANNPSLRGF+VI+ AKA+LE+LC   VSCADI+AFAARD     GG  Y
Sbjct  95    TPGNLSEKEHPANNPSLRGFQVINKAKAKLEALCPETVSCADIIAFAARDGALKVGGINY  154

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP GRRDGRVS   E+  +LPPP FN  QL   F+ KG + +EMVTLSGAH+IG SHC+
Sbjct  155   TVPGGRRDGRVSRKDEVAESLPPPHFNAEQLELRFARKGLSLDEMVTLSGAHSIGMSHCS  214

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYTN  459
             SF+ RLYS N T   DPS+  +Y + L+ +C PQ N   N  VP++  +P   D  YY  
Sbjct  215   SFSKRLYS-NGTHAHDPSMRRKYVSFLRTKCHPQRNGGQNPTVPLEAKTPGRLDNKYYKE  273

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  +RGL  SDQTL++  STA  VR NA    +W  KFAAAMV MG I VLT   GEIR 
Sbjct  274   LEKHRGLLNSDQTLMSSQSTAWMVRNNARHGSTWAAKFAAAMVHMGSIDVLTETQGEIRR  333

Query  278   NCRVVN  261
             +C VVN
Sbjct  334   SCHVVN  339



>emb|CBI39655.3| unnamed protein product [Vitis vinifera]
Length=856

 Score =   363 bits (932),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 218/305 (71%), Gaps = 1/305 (0%)
 Frame = -1

Query  1178  VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLID  999
             V  A L+VGFY  SC  AE IV+  V KA   + G+AAGL+RMHFHDCFVRGCDGSVL+D
Sbjct  254   VSSASLEVGFYKSSCPSAETIVRKAVNKAVSKNPGMAAGLIRMHFHDCFVRGCDGSVLLD  313

Query  998   STASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFG  819
             ST  N +EK+SP N+PSLRGFEVID AKA +E+ C   VSCAD+LAFAARDS    GG  
Sbjct  314   STPGNPSEKESPVNDPSLRGFEVIDEAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGIN  373

Query  818   YDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHC  639
             Y VP+GRRDGR+SL  E   +LPPP FN  QL   F+ KG T +EMVTLSGAH+IG SHC
Sbjct  374   YAVPSGRRDGRISLKDEPSLHLPPPFFNAKQLEENFARKGLTLDEMVTLSGAHSIGVSHC  433

Query  638   TSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYT  462
             +SF+NRLYSFN+T  QDPS++P++A  LK +C P  N+ ++  VP++  +P   D  YY 
Sbjct  434   SSFSNRLYSFNATHPQDPSIEPEFARHLKTKCPPPSNTGSDPTVPLEVQTPNRLDNKYYK  493

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             ++ + +GL TSDQTL   PST   V+ NA    +WG KFAAAMV+MG I VLTG  G IR
Sbjct  494   DLKSRKGLLTSDQTLFDSPSTVRMVKNNARYGANWGNKFAAAMVQMGAIDVLTGTQGVIR  553

Query  281   ANCRV  267
              NCRV
Sbjct  554   KNCRV  558


 Score =   231 bits (590),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  1199  LLTCQLIVL-----KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDC  1035
             LL C +  L      A L+VGFY  +C  AE IV+  V KA   + G+AAGL+RMHFHDC
Sbjct  4     LLFCIMFFLTVSVSSASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDC  63

Query  1034  FVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFA  855
             FVRGCDGSVL+DST  N +EK++PANNPSLRGFEVID+AKA +E+ C   VSCAD+LAFA
Sbjct  64    FVRGCDGSVLLDSTPGNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFA  123

Query  854   ARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVT  675
             ARDS    GG  Y VP+GRRDGRVSL  E   +LPPP FN  QL + F+ KG T +EMVT
Sbjct  124   ARDSAYKVGGINYAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVT  183

Query  674   LSGAHTIG  651
             LSGAH+IG
Sbjct  184   LSGAHSIG  191



>ref|XP_004136139.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
 ref|XP_004158219.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
 gb|KGN45061.1| hypothetical protein Csa_7G419570 [Cucumis sativus]
Length=337

 Score =   347 bits (890),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 214/305 (70%), Gaps = 5/305 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  SC  AE I+K+ V +A   + G+AAGL+RMHFHDCFVRGC+ SVL+ ST +N
Sbjct  34    LKVGFYKSSCPHAETIIKNAVNQAISQNPGIAAGLIRMHFHDCFVRGCEASVLLKSTPNN  93

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +E++  AN PSLRGFEVID AKA++E++C   VSCADILAFAARDS    GG  Y VPA
Sbjct  94    PSEREHIANFPSLRGFEVIDEAKAKIEAICPNTVSCADILAFAARDSACRVGGINYAVPA  153

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDGR+S+  E  N+LP PSFN  QLT  F  +GF+ EEMVTLSGAH+IG +HC +F+N
Sbjct  154   GRRDGRISIKEEA-NSLPGPSFNAEQLTESFGKRGFSSEEMVTLSGAHSIGVAHCPTFSN  212

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRC--PQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
             RLYSFN+T  QDPS+DP YAA LK +C  P GN++ +      ++ FSP   D  YY  +
Sbjct  213   RLYSFNTTHPQDPSMDPLYAAYLKTKCPPPSGNNDGSDEPTAALEFFSPHRLDNWYYIEL  272

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
               +RGL +SDQTLL+  ST   V  NA     W  KF  AMVKMG + VLTG+ GEIR +
Sbjct  273   KNHRGLLSSDQTLLSSSSTKEMVLHNAKHGHQWAAKFGKAMVKMGFVDVLTGSQGEIRRH  332

Query  275   CRVVN  261
             C  VN
Sbjct  333   CSFVN  337



>gb|EYU39444.1| hypothetical protein MIMGU_mgv1a009735mg [Erythranthe guttata]
Length=333

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 214/303 (71%), Gaps = 2/303 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFY+  C  AE+IV+  V KA   + G+AAG++R+HFHDCFVRGCDGS+L+D+ A 
Sbjct  32    KLKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAG  91

Query  986   N-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
                AEK++ AN PSLRGFEVID AKA +E++C G VSCADILAFAARDS    G  GY+V
Sbjct  92    KPAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYEV  151

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVSL+SE+  NLPPP F+  +L   F  KG + +EMVTLSGAH+IG SHC++F
Sbjct  152   PSGRRDGRVSLSSEVLQNLPPPFFSAAELKENFKRKGLSLDEMVTLSGAHSIGVSHCSAF  211

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRL  FN+T  +DPSLD  YAA LK +CP   +N +  V  D  +P + D  YY N+  
Sbjct  212   SNRLSGFNATFDKDPSLDSGYAAFLKTKCPVP-ANGDPAVNNDFQTPTVLDNKYYVNLKN  270

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             ++GL TSDQTL   P T N V  N      W  KFAAAMV MG I VLTG  GEIR NCR
Sbjct  271   HKGLLTSDQTLFDSPLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIEVLTGKQGEIRKNCR  330

Query  269   VVN  261
             +VN
Sbjct  331   LVN  333



>ref|XP_004953531.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 215/305 (70%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             LQVGFY  SC +AE IV++ V++A   D G+AAGL+RMHFHDCFVRGCD S+L++ST   
Sbjct  25    LQVGFYEHSCPQAEDIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDASILLESTPWQ  84

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AE+DS ANNPSLRGFEVID AKA +E+ C   VSCADI+AFAARD   + GG  Y VP+
Sbjct  85    KAERDSTANNPSLRGFEVIDEAKAIVEAHCPRTVSCADIVAFAARDGAALAGGIDYRVPS  144

Query  803   GRRDGRVSLASEIPN-NLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVS+  E+ + N+P P+F V +L   F  KG + ++MVTLSGAH+IGRSHC+S  
Sbjct  145   GRRDGRVSVEGEVLDGNVPFPTFTVGELVENFRRKGLSADDMVTLSGAHSIGRSHCSSVT  204

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNANL--VVPMDPFSPAITDVSYYTNI  456
             +RLY+F     + DP LDP YAA LK+RCP   SN +    VP+DP +PA  D  Y+ N+
Sbjct  205   DRLYNFQGEPGRTDPELDPAYAADLKRRCPPSMSNMDYPTTVPLDPVTPAGLDNQYFKNV  264

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA++  FTSDQ LL  P TA  V  +A    +W  KFAAAMVKMG I VLTG  GEIR  
Sbjct  265   LAHKVPFTSDQALLDSPWTAGLVAFHAAVGQAWEAKFAAAMVKMGAIEVLTGQEGEIREK  324

Query  275   CRVVN  261
             C VVN
Sbjct  325   CSVVN  329



>gb|EMT13671.1| Peroxidase 5 [Aegilops tauschii]
Length=341

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 217/305 (71%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  +C +AE IV+D V++A   + G+A G++RMHFHDCFVRGCDGS+LI+ST  N
Sbjct  35    LKVGFYKHTCPQAEYIVRDAVRRAVARNPGLAGGIIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             +AEKDS ANNPS+RGFEVID AKA LE+ C   +SCAD+LAFAARD   + GG  Y VP+
Sbjct  95    SAEKDSQANNPSMRGFEVIDEAKAALEASCPRTISCADVLAFAARDGAYLAGGINYRVPS  154

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVS+A E+  NN+P P+  V +L   F  KG + ++MVTLSGAHTIGRSHC+SF 
Sbjct  155   GRRDGRVSIADEVLNNNVPFPTDEVAELVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
              R+++F+    + DPS+D  YAA+LK +CP    N +    VP+DP +P   D  Y+ N+
Sbjct  215   QRIHNFSGEVGRTDPSIDRSYAAELKHQCPPSTDNPSDPTTVPLDPVTPGEFDNQYFKNV  274

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA +   TSDQTLLT P TA  V  +A    +W  KFAAAMVKMG++ VLTG  GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVAFHAAVEKAWQAKFAAAMVKMGKVEVLTGEEGEIREK  334

Query  275   CRVVN  261
             C VVN
Sbjct  335   CFVVN  339



>ref|XP_003533700.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 209/301 (69%), Gaps = 1/301 (0%)
 Frame = -1

Query  1160  QVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN-  984
             +VGFYS +C  AE IV+  V+KA   + G+AAGL+RMHFHDCFVRGCDGSVL+ S   N 
Sbjct  29    KVGFYSSTCPSAEAIVRSAVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASRPGNP  88

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +E+D+  NNPSLRGFEVI+ AK ++E  C   VSCADILAFAARDSV   GG  YDVP+
Sbjct  89    ISERDNLVNNPSLRGFEVIEEAKNQIEDACPQTVSCADILAFAARDSVSKVGGINYDVPS  148

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG VS+  E+  NLP PSF+  +L + FS KG + +EMVTLSGAH+IG SHC SF+N
Sbjct  149   GRRDGGVSIGGEVIGNLPGPSFSADELVSSFSRKGLSADEMVTLSGAHSIGVSHCGSFSN  208

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANR  444
             RLYSF+ T  QDPSLD  YA  LK +CP     ++  V ++P +P   D  YY  ++ +R
Sbjct  209   RLYSFSDTATQDPSLDSSYAETLKGKCPPPPPTSDPTVSLEPSTPIRLDSKYYEALINHR  268

Query  443   GLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVV  264
             GL TSDQTL T  ST   V  NA +  SW  KFA AMV+MG I VLTG+ GEIR  C  V
Sbjct  269   GLLTSDQTLYTSQSTRAMVESNAYNAASWAEKFALAMVRMGSIEVLTGSDGEIRKQCSFV  328

Query  263   N  261
             N
Sbjct  329   N  329



>ref|XP_006574525.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=331

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 210/300 (70%), Gaps = 4/300 (1%)
 Frame = -1

Query  1160  QVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNT  981
             +V FY  +C  AE IV+  V KA   + G+AAGL+RMHFHDCFVRGCDGSVL++STA N 
Sbjct  36    KVDFYKTTCPSAEAIVRRAVNKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLESTAGNP  95

Query  980   AEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAG  801
             +E++ PANNPSLRGFEVID AKA++E+ C   VSC+DILAFAARDS    GG  Y VPAG
Sbjct  96    SEREHPANNPSLRGFEVIDEAKAQIEAECPHTVSCSDILAFAARDSTNRVGGINYVVPAG  155

Query  800   RRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNR  621
             RRDGRVS+  E  + LP P+FN  QL + F  KG + +EMVTLSGAH+IG SHC+SF++R
Sbjct  156   RRDGRVSIRDEA-SQLPRPTFNTQQLISNFEQKGLSADEMVTLSGAHSIGVSHCSSFSDR  214

Query  620   LYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANRG  441
             LYSFN+T  QDPS+DP++A  LK +C   + N    V +D  +P   D +YY  +   RG
Sbjct  215   LYSFNATFPQDPSMDPKFATSLKTKCLPRSDN---TVVLDASTPNRLDNNYYALLKNQRG  271

Query  440   LFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             L TSDQTLLT PST   V  NA     W  KFA AMV MG I VLTG+ GEIR  C VVN
Sbjct  272   LLTSDQTLLTSPSTRPMVLTNAKHGSKWARKFAKAMVHMGSIQVLTGSQGEIRTRCSVVN  331



>ref|XP_009382469.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=334

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 213/324 (66%), Gaps = 4/324 (1%)
 Frame = -1

Query  1220  SCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             SC+     +        A L +GFY  +C  AE IV+  V +A   + G+AAGL+RMHFH
Sbjct  8     SCWIVFIAVLAMASSTSASLHLGFYRKTCPSAEAIVRRTVSEAVANNPGLAAGLIRMHFH  67

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCD S+L++S+  NTAEKD+P NNPS+RGFEVID+AKA +E+ C   VSCADI+A
Sbjct  68    DCFVRGCDASLLLNSSPGNTAEKDAPPNNPSMRGFEVIDAAKAAVEARCPSTVSCADIIA  127

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARDS  + GG  Y VPAGRRDGRVSL SE   N+P P+     L + F+ KG + +EM
Sbjct  128   FAARDSAYLAGGIDYPVPAGRRDGRVSLDSEALTNIPLPNLTAAGLRDSFAKKGLSVDEM  187

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG----NSNANLV  513
             VTLSGAH+IGR+HCT+F  RLY+FN+T  QDPS+DP +AA LK RC        S     
Sbjct  188   VTLSGAHSIGRAHCTAFAPRLYNFNATHTQDPSMDPAFAAYLKSRCSPSTVDFTSKDPTT  247

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             VP+D  +P   D  YY N+   RGL  SDQTL     TA  VR +A     W  KFAAAM
Sbjct  248   VPLDAVTPRRLDNQYYKNLAKRRGLLFSDQTLQASRLTARLVRLDAKLGSVWAAKFAAAM  307

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             V+MG I VLTG+ GEIR  C VVN
Sbjct  308   VRMGHIEVLTGSQGEIRKMCGVVN  331



>ref|XP_003568991.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=336

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 219/307 (71%), Gaps = 8/307 (3%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  SC +AE IV+D V++    + G A GL+RMHFHDCFVRGCDGSVLI+ST  N
Sbjct  30    LKVGFYEHSCPQAEAIVRDAVRRGIARNPGFAPGLIRMHFHDCFVRGCDGSVLINSTPGN  89

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AEKDS AN PSLRGFEVID AKA LES+C   VSCAD+LAFAARDS ++ GG  Y +P+
Sbjct  90    RAEKDSVANTPSLRGFEVIDDAKAILESVCPRTVSCADVLAFAARDSADLAGGISYPLPS  149

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVSL SE+  NN+PPP+ +V  L   F+ KG + ++MVTLSGAHTIGRSHC+SF 
Sbjct  150   GRRDGRVSLESEVLDNNVPPPTDDVAALIASFARKGLSADDMVTLSGAHTIGRSHCSSFT  209

Query  626   NRLYSFNSTTVQ---DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYT  462
              R+++F  T VQ   DPS++P YA+ LK+RCP    + N   VVP+D  +PA  D  YY 
Sbjct  210   QRIHNF--TGVQGRTDPSIEPAYASDLKRRCPPATDDPNDPTVVPLDVVTPAEFDNQYYK  267

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+LA++   TSDQTL+T   TA  V  +A    +W  KFA +MV+MG + VLTG+ GEIR
Sbjct  268   NVLAHKVPLTSDQTLITSKRTAAIVVFHAAVEKAWRAKFAVSMVRMGNVGVLTGHQGEIR  327

Query  281   ANCRVVN  261
               C  +N
Sbjct  328   EKCFAIN  334



>gb|EMS60334.1| Peroxidase 5 [Triticum urartu]
Length=341

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/305 (56%), Positives = 218/305 (71%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  +C +AE IV+D V++A   + G+A G++RMHFHDCFVRGCDGS+LI+ST  N
Sbjct  35    LKVGFYEHTCPQAEYIVRDVVRRAVARNPGLAGGIIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
             +AEKDS ANNPS+RGFEVID AKA LE+ C   VSCAD+LAFAARD   + GG  Y VP+
Sbjct  95    SAEKDSQANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVS+A E+  NN+P P+  V +L   F  KG + ++MVTLSGAHTIGRSHC+SF 
Sbjct  155   GRRDGRVSIADEVLNNNVPFPTDEVAELVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
              R+++F+    + DPS+D  YAA+LK +CP   +N +    V +DP +P   D  Y+ N+
Sbjct  215   QRIHNFSGEAGRTDPSIDRSYAAELKHQCPLSTNNPSDPTTVALDPVTPGKFDNQYFKNV  274

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA +   TSDQTLLT P TA  V  +A    +W +KFAAAMVKMG++ VLTG  GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVASHAAVEKAWQVKFAAAMVKMGKVEVLTGEEGEIREK  334

Query  275   CRVVN  261
             C VVN
Sbjct  335   CFVVN  339



>gb|KDP27791.1| hypothetical protein JCGZ_18871 [Jatropha curcas]
Length=328

 Score =   344 bits (883),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 222/325 (68%), Gaps = 2/325 (1%)
 Frame = -1

Query  1229  RMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             +++S +  L L+     VL   L+ GFY  SC  AE IV+  V+ AF  D G+   L+R+
Sbjct  3     KLISYFGILLLIFLISPVLSVPLKKGFYKKSCPLAETIVRSTVKNAFANDTGIPPALIRL  62

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCD S+L+DST  + AEK+S   N  + GFEVID AKA++E+ C   VSCAD
Sbjct  63    HFHDCFVRGCDASILLDSTPGSKAEKES-MGNKGVGGFEVIDEAKAKMETYCPNTVSCAD  121

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             I+AFAARDSV + GG  Y+VP+GRRDG  SL  E+  NLP   FNV QL + F+NKG + 
Sbjct  122   IIAFAARDSVLLAGGIYYEVPSGRRDGTKSLIHEVSKNLPDSFFNVIQLKDNFANKGLSL  181

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG-NSNANLV  513
             EEMVTLSGAH+IG SHC+SF+ RLYSFN+T  QDPS+D  YA+ LK +CP+  N+  + +
Sbjct  182   EEMVTLSGAHSIGDSHCSSFSKRLYSFNATHGQDPSMDSAYASFLKTKCPKPVNNGIDPL  241

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             V  DP +P   D +YY N+  N+GL  SDQ L ++  T + V+ N   P SW  KFA+AM
Sbjct  242   VSFDPSTPTRLDNNYYRNLKMNKGLLFSDQVLWSNSLTKSMVKSNINHPGSWASKFASAM  301

Query  332   VKMGQISVLTGNAGEIRANCRVVNS  258
             V MG I V+TG+ GE+R NCRV+NS
Sbjct  302   VHMGSIEVITGSNGEVRKNCRVLNS  326



>ref|XP_010941488.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=315

 Score =   343 bits (881),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 212/307 (69%), Gaps = 4/307 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VG+Y   C  AE IV+  V KA   D G+AAGL+R++FHDCFVRGCD SVL+D   
Sbjct  8     ASLEVGYYESKCPMAEKIVRRTVVKAAARDHGLAAGLIRLYFHDCFVRGCDASVLLDPLP  67

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
             +N +EK SPANN SLRG+EVID AKA LE+ C   VSCADI+AFAARDS  +TGG  Y V
Sbjct  68    NNPSEKLSPANNASLRGYEVIDDAKAELEAFCPETVSCADIIAFAARDSTFITGGLDYSV  127

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDG VS+ SE+  NLP P+FN  QL   F+ KG + ++MVTLSGAH+IG SHC+SF
Sbjct  128   PSGRRDGMVSIDSEVVQNLPFPTFNAEQLIKSFAGKGLSVKDMVTLSGAHSIGVSHCSSF  187

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGN---SNANLVVPMDPFSPAITDVSYYT  462
             ++RLY FN+T  QDPSL+   A  LK RC P      +     VP+D  +P   DV YY 
Sbjct  188   DSRLYRFNATHPQDPSLNHHLANFLKARCLPSSKTVRTQTEPTVPLDIKAPNHLDVKYYK  247

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+L  +GL TSDQTL    ST   V  +A +P  W  +FAAAMV+MG I VLTGN GEIR
Sbjct  248   NLLKGKGLLTSDQTLAGSRSTLGLVIDHARNPSKWKEEFAAAMVRMGNIDVLTGNKGEIR  307

Query  281   ANCRVVN  261
              NCRVVN
Sbjct  308   KNCRVVN  314



>ref|XP_003591332.1| Peroxidase [Medicago truncatula]
 gb|AES61583.1| cationic peroxidase [Medicago truncatula]
Length=333

 Score =   344 bits (883),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 218/333 (65%), Gaps = 11/333 (3%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAE--------LQVGFYSGSCGRAELIVKDEVQKAFVCDRGV  1071
             M+  +S L++ T  +++L           L+ GFY  +C   E IV+  V KA   + G+
Sbjct  1     MVRMHSILSIATLVIVILSVSTTLASSTSLKYGFYKTTCSSVEAIVRRAVNKAVSLNPGI  60

Query  1070  AAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCK  891
             AAGL+RMHFHDCFVRGCDGSVL+DS     +E+D PANNPSLRGFEVI+ AKA++E+ C 
Sbjct  61    AAGLIRMHFHDCFVRGCDGSVLLDSIPGIQSERDHPANNPSLRGFEVINEAKAQIEAACP  120

Query  890   GVVSCADILAFAARDSVEMTGG--FGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTN  717
               VSCADILAFAARDS     G    Y VP+GRRDGRVS+  E+  NLPPP+F+  QL +
Sbjct  121   KTVSCADILAFAARDSARKVSGGRIDYSVPSGRRDGRVSIFDEVTQNLPPPTFSAEQLID  180

Query  716   LFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ  537
              F  KG + +EMVTLSGAH+IG SHC+SF+ RLYSFN T  QDPS+DP +A  LK +CP 
Sbjct  181   NFDRKGLSVDEMVTLSGAHSIGVSHCSSFSKRLYSFNLTFPQDPSMDPNFARLLKSKCPP  240

Query  536   GNSNA-NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPIS  360
               S + N  V +D  +P   D  YY  +  NRGL TSDQTLL    T   V +NA     
Sbjct  241   PQSQSINPTVVLDGSTPNDLDNMYYKRLKNNRGLLTSDQTLLNSGLTRRMVLKNARHAAI  300

Query  359   WGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             W +KFA AMV MG + VLTG+ GEIR  C VVN
Sbjct  301   WNVKFAKAMVHMGSLDVLTGSEGEIRERCSVVN  333



>tpe|CAH69312.1| TPA: class III peroxidase 70 precursor [Oryza sativa Japonica 
Group]
Length=335

 Score =   344 bits (883),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 222/308 (72%), Gaps = 5/308 (2%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFY  SC +AE IV++ V++A   D G+AAGL+RMHFHDCFVRGCDGS+LI+ST  
Sbjct  26    KLKVGFYEHSCPQAEEIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDGSILINSTPG  85

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGG-FGYDV  810
             + AEKDS ANNPS+RGFEV+D AKA +E+ C   VSCADILAFAARDS  + G    Y V
Sbjct  86    HVAEKDSVANNPSMRGFEVVDDAKAIVEAHCPRTVSCADILAFAARDSAHLAGATVDYPV  145

Query  809   PAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             P+GRRDGRVS++ E+  +N+P P+F++ QL   F  KG T ++MVTLSGAHTIGRSHC+S
Sbjct  146   PSGRRDGRVSVSDEVLADNVPAPTFSLAQLVASFERKGLTADDMVTLSGAHTIGRSHCSS  205

Query  632   FNNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNA--NLVVPMDPFSPAITDVSYYT  462
             F  RLY+F+    + DP++DP YAA+LK+RCP    +      VP+DP +PA  D  YY 
Sbjct  206   FTARLYNFSGEAGRTDPAIDPAYAAELKRRCPPATDDQMDPTTVPLDPVTPASFDNQYYK  265

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+L +R +  SDQ LL  P TA  V+ ++     + +KFAAAMVKMG I VLTG+ GEIR
Sbjct  266   NVLKHRVVLNSDQALLDSPWTAGVVKLHSAVEKVFQVKFAAAMVKMGNIDVLTGDEGEIR  325

Query  281   ANCRVVNS  258
               C +VN+
Sbjct  326   EKCFMVNN  333



>ref|XP_010093296.1| Peroxidase 5 [Morus notabilis]
 gb|EXB53829.1| Peroxidase 5 [Morus notabilis]
Length=310

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 214/301 (71%), Gaps = 1/301 (0%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+V FY  SC  AE ++K  V +    + G+ AGL+R+HFHDCFVRGCD SVL+DST  N
Sbjct  11    LKVDFYRFSCPLAESVIKKVVNREVSRNPGIGAGLIRLHFHDCFVRGCDASVLLDSTPEN  70

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AEK+ PANNPSLRGFEVIDSAK  LESLC   VSCADILAFAARDS    GG  Y VPA
Sbjct  71    PAEKEHPANNPSLRGFEVIDSAKTELESLCPQTVSCADILAFAARDSAFKLGGIKYSVPA  130

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG VSL ++   NLP PSF+  QL   F++K  T EEMVTLSGAH+IG S C+SF+N
Sbjct  131   GRRDGTVSLKADPNGNLPAPSFSTAQLQESFASKSLTLEEMVTLSGAHSIGVSRCSSFSN  190

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANR  444
             RLYSFNST  QDPS+DP +A  LK++CP   S+ + VV +D  +P   D  YY N+   R
Sbjct  191   RLYSFNSTHPQDPSMDPNFATFLKKKCPASTSD-DPVVNLDSVTPNRLDNRYYVNLKNRR  249

Query  443   GLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVV  264
             G+  SDQ LL+  STA+ V  NA +  +W  KFA AMVKMG I VLTG++G+IR NCR+V
Sbjct  250   GVLASDQILLSSSSTASSVSYNARNNGAWAEKFADAMVKMGSIDVLTGSSGQIRKNCRLV  309

Query  263   N  261
             N
Sbjct  310   N  310



>ref|XP_002439234.1| hypothetical protein SORBIDRAFT_09g002830 [Sorghum bicolor]
 gb|EES17664.1| hypothetical protein SORBIDRAFT_09g002830 [Sorghum bicolor]
Length=343

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/306 (57%), Positives = 212/306 (69%), Gaps = 5/306 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  SC  AE IV+D V++    D GV AGL+RM FHDCFVRGCD S+LI+ST  N
Sbjct  36    LEVGFYKHSCPEAESIVRDAVRRGVARDAGVGAGLIRMQFHDCFVRGCDASILINSTPGN  95

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AEKDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARD   + GG  Y VP+
Sbjct  96    KAEKDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIVAFAARDGAYLAGGLDYKVPS  155

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDGRVS   E+  +N+P P  +V +L   F  KG T ++MVTLSGAHTIGRSHC+SF 
Sbjct  156   GRRDGRVSREDEVLDSNVPAPFDDVAELIQSFKRKGLTADDMVTLSGAHTIGRSHCSSFT  215

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN---LVVPMDPFSPAITDVSYYTN  459
              RLY+F+    + DPSLD  YA  LK RCP  +S+      VVP DP +PA  D  Y+ N
Sbjct  216   QRLYNFSGQLGRTDPSLDVAYADHLKMRCPWPSSDGKRHPAVVPQDPVTPATFDNQYFKN  275

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             ++A++GLF SD+TLL    TA  V  NA    +W +KFA AMVKMG+I VLTG+ GEIR 
Sbjct  276   VVAHKGLFVSDKTLLDSTCTAGIVHFNAAVDKAWQVKFAKAMVKMGKIQVLTGDEGEIRE  335

Query  278   NCRVVN  261
              C VVN
Sbjct  336   KCFVVN  341



>ref|XP_003589739.1| Peroxidase [Medicago truncatula]
 gb|AES59990.1| cationic peroxidase [Medicago truncatula]
Length=332

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 211/303 (70%), Gaps = 3/303 (1%)
 Frame = -1

Query  1160  QVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN-  984
             QVGFYS SC  AE IV+  + KA   + G+ AGL+RMHFHDCFVRGCD SVL+ ST  N 
Sbjct  30    QVGFYSYSCPSAEAIVRSAIDKAVSLNPGIGAGLIRMHFHDCFVRGCDASVLLASTPGNP  89

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSV-EMTGG-FGYDV  810
              AEKD+  NNPSL GFEVID AKA+LE +C   VSCADIL FA RDS+ +++GG   YDV
Sbjct  90    IAEKDNFINNPSLHGFEVIDEAKAQLEVVCPQTVSCADILTFATRDSILKLSGGTINYDV  149

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVS++ E+P N+P P  N  QL   F+ KG + +EMVTLSGAH+IG SHC+SF
Sbjct  150   PSGRRDGRVSISDEVPKNIPSPFLNADQLIANFAQKGLSIDEMVTLSGAHSIGVSHCSSF  209

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             +NRLYSF+ T  QDPS+DP +A  LK +CP   SN N +V +D  +P   D  YY  ++ 
Sbjct  210   SNRLYSFSDTISQDPSMDPSFAESLKTKCPPPPSNTNPIVMLDVATPNRLDNLYYEGLIN  269

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             +RGL TSDQTLL+  ST   V  NA    +W  KFA AMV MG I VL+G  GEIR +C 
Sbjct  270   HRGLLTSDQTLLSSQSTQESVLSNANYGSNWATKFAQAMVHMGSIDVLSGYDGEIRKHCS  329

Query  269   VVN  261
              VN
Sbjct  330   FVN  332



>ref|XP_007145112.1| hypothetical protein PHAVU_007G210900g [Phaseolus vulgaris]
 gb|ESW17106.1| hypothetical protein PHAVU_007G210900g [Phaseolus vulgaris]
Length=325

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 214/316 (68%), Gaps = 4/316 (1%)
 Frame = -1

Query  1232  IRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVR  1053
             + + +  ST  L+     +  A L+V FY  +C  AE IV+  V+KA   + G+AAGL+R
Sbjct  5     VHVHAMLSTFLLILSIFPLASASLKVDFYKTTCPSAESIVRSAVEKAVSLNPGIAAGLIR  64

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHDCFVRGCDGSVL++ST  N +E+D PANNPSLRGF+V+D AKA++E+ C   VSCA
Sbjct  65    MHFHDCFVRGCDGSVLLESTPGNPSERDHPANNPSLRGFQVVDEAKAQIEAECPHTVSCA  124

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDS    GG  Y VPAGRRDGRVS+  E P+ LP P+ N  QL   F  KG +
Sbjct  125   DILAFAARDSANKVGGINYAVPAGRRDGRVSIRDE-PSQLPLPTSNADQLIADFRRKGLS  183

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLV  513
              +EMVTLSGAH+IG SHC+SF++RLYSFN+T  QDPS+D +YA  LK +CP G+ N    
Sbjct  184   ADEMVTLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDSKYATSLKSKCPAGSDN---T  240

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
             VP+D  +P   D  YYT +  +RGL TSDQTLL  PST   +  NA     W  K A AM
Sbjct  241   VPLDASTPNRLDNKYYTELKKHRGLLTSDQTLLGSPSTRPMLLTNAKHSSVWARKVAKAM  300

Query  332   VKMGQISVLTGNAGEI  285
             V MG I VLTG+ G +
Sbjct  301   VHMGSIDVLTGSQGVV  316



>gb|EEE58234.1| hypothetical protein OsJ_09210 [Oryza sativa Japonica Group]
Length=271

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 197/272 (72%), Gaps = 2/272 (1%)
 Frame = -1

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLC  894
             +AAGLVR+HFHDCFVRGCD SVL+DST  N AEKD+P N  SLRGFEVIDSAK+RLE+ C
Sbjct  1     MAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEKDAPPNT-SLRGFEVIDSAKSRLETAC  59

Query  893   KGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNL  714
              GVVSCAD+LAFAARD++ + GG  Y VP GRRDG VS+A E   NLPPPS NV QL  +
Sbjct  60    FGVVSCADVLAFAARDALALVGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQM  119

Query  713   FSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG  534
             F  KG TQ EMV LSGAHTIG SHC+SF+NRLYS      QDPS+DP Y A L  +CPQ 
Sbjct  120   FGAKGLTQAEMVALSGAHTIGVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQ  179

Query  533   NSN-ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISW  357
                 A  +VPMD  +P   D +YY  I+ANRGL +SDQ LL D +TA +V     +P S+
Sbjct  180   QGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSF  239

Query  356   GLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
                FAAAMVKMG I VLTGNAG IR NCRV +
Sbjct  240   QTDFAAAMVKMGSIGVLTGNAGTIRTNCRVAS  271



>ref|XP_007153059.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
 gb|ESW25053.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
Length=330

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/300 (57%), Positives = 206/300 (69%), Gaps = 1/300 (0%)
 Frame = -1

Query  1157  VGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN-T  981
             VGFYS +C  AE IVK  V+KA   + G+AAGL+RMHFHDCFVRGCDGSVL+ S   N  
Sbjct  31    VGFYSFTCPSAEAIVKSTVEKAISANPGLAAGLIRMHFHDCFVRGCDGSVLLASIPGNPI  90

Query  980   AEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAG  801
             AE+DS  NNPSLRGFEVI+ AK ++E+ C   VSCADILAFAARDS    G   YDVP+G
Sbjct  91    AERDSFINNPSLRGFEVIEEAKKQVEAACPNTVSCADILAFAARDSASKVGAINYDVPSG  150

Query  800   RRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNR  621
             RRDGRVS+  E+  NLP P F V +L   F+ KG + +EMVTLSGAH+IG +HC +F+NR
Sbjct  151   RRDGRVSIGDEVIQNLPGPGFVVDELIGNFAQKGLSVDEMVTLSGAHSIGVAHCGAFSNR  210

Query  620   LYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILANRG  441
             LYSF+ T  QDPSLDP YA  LK  CP      + +V ++P +P   D  YY  ++ +RG
Sbjct  211   LYSFSDTLRQDPSLDPSYAETLKAMCPPPPPITDAIVSLEPSTPIRLDSKYYEGLINHRG  270

Query  440   LFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             L TSDQTL   PST   V  NA +  +W  KFA AMV+MG I VLTG+ GEIR  C  VN
Sbjct  271   LLTSDQTLFDTPSTKEIVESNAYNGANWAQKFALAMVRMGSIQVLTGSDGEIRKQCSFVN  330



>ref|XP_004498110.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   342 bits (876),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 206/302 (68%), Gaps = 1/302 (0%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFYS +C  AE IV+  V KA   + G+ AGL+RMHFHDCFVRGCD SVL+ S   N
Sbjct  26    LEVGFYSYTCPSAETIVRSIVNKAVSDNPGIGAGLIRMHFHDCFVRGCDASVLLASIPGN  85

Query  983   -TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
              TAE+DS  NNPSLRGFEVID AKA LE+ C   VSCADIL FAARDS    G   Y+VP
Sbjct  86    PTAERDSFVNNPSLRGFEVIDEAKAELEAKCPQTVSCADILTFAARDSALKLGNINYNVP  145

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             +GRRDGRVS+A E+P N+P PSFN  +L   F+ KG +++EMVTLSGAH+IG SHC+SF+
Sbjct  146   SGRRDGRVSIADEVPQNVPGPSFNADRLITTFAKKGLSKDEMVTLSGAHSIGVSHCSSFS  205

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILAN  447
             NRLYSF+     DPS+DP +   LK +CP+  SN + +V +D  +P   D  YY  ++ +
Sbjct  206   NRLYSFDDANAIDPSMDPSFVELLKTKCPKPPSNIDPIVVLDAITPIRLDNVYYEGLINH  265

Query  446   RGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRV  267
             +GL  SDQTLL+  ST   V  NA     W  KFA AMV MG I VLTG  GEIR  C  
Sbjct  266   QGLLGSDQTLLSSESTKEIVLSNANYGAHWATKFAEAMVHMGSIDVLTGYDGEIRKYCNF  325

Query  266   VN  261
             VN
Sbjct  326   VN  327



>ref|XP_002440652.1| hypothetical protein SORBIDRAFT_09g004650 [Sorghum bicolor]
 gb|EES19082.1| hypothetical protein SORBIDRAFT_09g004650 [Sorghum bicolor]
Length=357

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 213/314 (68%), Gaps = 9/314 (3%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             + A L VGFY+ +C  AE IV+  V  AF    GVA  L+RMHFHDCFVRGCDGSVLIDS
Sbjct  21    VTARLDVGFYNKTCPSAESIVQQTVAAAFGNSSGVAPALIRMHFHDCFVRGCDGSVLIDS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             TA+NTAEKDSPANNPSLR F+V+D AKA LE+ C GVVSCADILAFAARDSV +TGG GY
Sbjct  81    TANNTAEKDSPANNPSLRFFDVVDRAKASLEAQCPGVVSCADILAFAARDSVVLTGGLGY  140

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP+GRRDGRVS A++  NNLPPP FN  QL + F++K  T E+MV LSGAHT+G SHC+
Sbjct  141   QVPSGRRDGRVSNATQATNNLPPPFFNATQLVDRFASKNLTLEDMVVLSGAHTLGVSHCS  200

Query  635   SF------NNRLYSFN-STTVQDPSLDPQYAAQLKQRCPQGNSN--ANLVVPMDPFSPAI  483
             SF       +RLY+F+ S    DP+L   YA  LK  CP  +S    N    MD  +P  
Sbjct  201   SFAGPANLGDRLYNFSGSADGIDPALSKAYAFLLKSICPSNSSQFFPNTTTFMDIITPDK  260

Query  482   TDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLT  303
              D  YY  +  N GLF SD  LLT+ +    V     +  +W  KFA +MVKMG+I VLT
Sbjct  261   FDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRNETTWKRKFAKSMVKMGKIEVLT  320

Query  302   GNAGEIRANCRVVN  261
             G  GEIR NCRV+N
Sbjct  321   GTQGEIRRNCRVIN  334



>gb|EYU39450.1| hypothetical protein MIMGU_mgv1a009721mg [Erythranthe guttata]
Length=333

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 211/303 (70%), Gaps = 2/303 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFY+  C  AE+IV+  V KA   + G+AAG++R+HFHDCFVRGCDGS+L+D+ A 
Sbjct  32    KLKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAG  91

Query  986   N-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
                AEK++ AN PSLRGFEVID AKA +E++C G VSCADILAFAARDS    G  GYDV
Sbjct  92    KPAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYDV  151

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             P+GRRDGRVSL+SE+  NLPPP F+  QL   F  KG + +EMVTLSGAH+IG SHC++F
Sbjct  152   PSGRRDGRVSLSSEVLANLPPPFFSAAQLKENFKRKGLSLDEMVTLSGAHSIGVSHCSAF  211

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
             + RL  FN+T  +DPSLD  YAA LK +CP   +  +  V  D  +P + D  YY N+  
Sbjct  212   STRLSGFNATFDKDPSLDSGYAAFLKTKCPV-PAKGDPAVNNDFQTPTVLDNKYYVNLKN  270

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             ++GL TSDQTL     T N V  N      W  KFAAAMV MG I VLTG  GEIR NCR
Sbjct  271   HKGLLTSDQTLFDSSLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIDVLTGKQGEIRKNCR  330

Query  269   VVN  261
             +VN
Sbjct  331   LVN  333



>ref|XP_003565723.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=355

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 219/331 (66%), Gaps = 5/331 (2%)
 Frame = -1

Query  1238  SRIRMLSCYSTLALLTCQLI---VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             S + M S  +TLA+    L     + A L+VGFYS +C  AE +V+  V  +F  + GVA
Sbjct  2     SSLAMNSLLATLAVAVLALFPIAAVGAGLKVGFYSKTCPSAETLVQQAVAASFKNNGGVA  61

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGL+R+HFHDCFV+GCDGSVLIDSTA+NTAEKD+  NNPSLRGFEVID+AK  +E+ C  
Sbjct  62    AGLIRLHFHDCFVKGCDGSVLIDSTANNTAEKDAIPNNPSLRGFEVIDAAKKAIEAKCPK  121

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
             +VSCADILAFAARDS+ + G   Y VPAGRRDGR+S      NNLP P     +L   F+
Sbjct  122   IVSCADILAFAARDSIALAGNVTYKVPAGRRDGRISSDQNALNNLPSPLSTASELVGNFT  181

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              K  T E+MV LSGAHTIG S C+SF NRLY F++T+  DP++   YA  LK  CP  +S
Sbjct  182   LKNLTAEDMVVLSGAHTIGVSRCSSFTNRLYGFSNTSQVDPTMSSAYAFLLKNICPANSS  241

Query  527   N--ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
                 N  + MD  +PA+ D  YY +++ N GLFTSDQ LLT+ +    V +   +   W 
Sbjct  242   QFFPNTTMDMDIITPAVLDNKYYVSLINNLGLFTSDQALLTNSTLKASVDEFVKNENRWK  301

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
              KF  +MVKMG I VLTG  GEIR NCRV+N
Sbjct  302   SKFVKSMVKMGNIEVLTGTQGEIRLNCRVIN  332



>ref|XP_002978679.1| hypothetical protein SELMODRAFT_177154 [Selaginella moellendorffii]
 gb|EFJ20126.1| hypothetical protein SELMODRAFT_177154 [Selaginella moellendorffii]
Length=326

 Score =   339 bits (869),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 215/325 (66%), Gaps = 5/325 (2%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             M  C+  +  L    I  + EL++GFY+ SC  AE +V+  V +A   + G+AAGL+R+H
Sbjct  4     MSFCFVVVVFLALAEIS-RCELRLGFYADSCPEAESVVQFTVAQAVATNPGIAAGLLRLH  62

Query  1046  FHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADI  867
             FHDCFVRGCDGSVLIDST +N AEKD+  N   LRGFEVID+AKARLE  C G VSCADI
Sbjct  63    FHDCFVRGCDGSVLIDSTGNNKAEKDAIPNF-GLRGFEVIDNAKARLEDRCPGTVSCADI  121

Query  866   LAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQE  687
             L +AARD+V   GG  +DV  GRRDG VS A ++  NLP P FNV QLT  F  KG TQE
Sbjct  122   LTYAARDAVSQVGGPRWDVLGGRRDGTVSRADQVGANLPSPLFNVDQLTKSFVRKGMTQE  181

Query  686   EMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN---L  516
             EM+TLSGAHTIG +HC SF NRLY+F++T+VQDP LDP  A  LK  CP+G+   +    
Sbjct  182   EMITLSGAHTIGIAHCLSFVNRLYNFSTTSVQDPDLDPNMARLLKSLCPKGSDFLDPKSK  241

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
              + +DP SP + D  YYT++   R + TSDQ L  D  T + V     +   W  KF  A
Sbjct  242   SIALDPLSPNLFDNGYYTSLSLRRSILTSDQILFADLDTRDSVEDKQANEAVWRFKFVNA  301

Query  335   MVKMGQISVLTGNAGEIRANCRVVN  261
             MVKM  I VL+GN G IR NCRVV+
Sbjct  302   MVKMSTIGVLSGNQGRIRTNCRVVS  326



>ref|XP_008776272.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=339

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 225/338 (67%), Gaps = 9/338 (3%)
 Frame = -1

Query  1247  MSSSRIRMLSCYSTLALL----TCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCD  1080
             M + R++  +    LA++    +  L+   A L+VG+Y  +C  AE IV+  V KA   D
Sbjct  1     MGNYRVQGFASLHKLAIVAFFVSMLLMPSLASLEVGYYRSTCPMAEKIVRRTVVKAVAGD  60

Query  1079  RGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLES  900
              G+AAGL+R++FHDCFVRGCD SVL+D   +N +EK SP NN SLRG+EVID AKA LE+
Sbjct  61    HGLAAGLIRLYFHDCFVRGCDASVLLDPLPNNPSEKLSPVNNGSLRGYEVIDDAKAELEA  120

Query  899   LCKGVVSCADILAF-AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQL  723
              C   VSCADI+AF AARDS  +TGGF Y VP+GRRDG VS+ SE+  NLP P+FN  QL
Sbjct  121   YCSETVSCADIIAFAAARDSTFITGGFDYSVPSGRRDGVVSIDSEVVQNLPFPTFNAKQL  180

Query  722   TNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC  543
                F+ KG + ++MVTLSGAH+IG SHC+SF++RLY FN+T  QDPSL+   A  LK RC
Sbjct  181   IRNFARKGLSAKDMVTLSGAHSIGVSHCSSFDSRLYRFNATHPQDPSLNHHLATFLKARC  240

Query  542   PQGNSNANL----VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNA  375
                +          VP+D  +P   DV YY N+L  +GL TSDQTL +  ST   V  +A
Sbjct  241   LPPSKTVRTQPAPTVPLDIKAPNHLDVKYYKNLLKGKGLLTSDQTLASSRSTLRLVIDHA  300

Query  374   GSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
              +P  W  +FAAAMV+MG + VL GN GEIR NCRVVN
Sbjct  301   RNPSKWNEEFAAAMVRMGNVDVLAGNEGEIRKNCRVVN  338



>ref|XP_002984610.1| hypothetical protein SELMODRAFT_181167 [Selaginella moellendorffii]
 gb|EFJ14255.1| hypothetical protein SELMODRAFT_181167 [Selaginella moellendorffii]
Length=326

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 214/325 (66%), Gaps = 5/325 (2%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             M  C+  +  L    I  + EL++GFY+ SC  AE +V+  V +A   + G+AAGL+R+H
Sbjct  4     MSFCFVVVVFLALAEIS-RCELRLGFYADSCPEAESVVQFTVAQAVATNPGIAAGLLRLH  62

Query  1046  FHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADI  867
             FHDCFVRGCDGSVL+DST +N AEKD+  N   LRGFEVID+AKARLE  C G VSCADI
Sbjct  63    FHDCFVRGCDGSVLVDSTGNNKAEKDAIPNF-GLRGFEVIDNAKARLEDRCPGTVSCADI  121

Query  866   LAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQE  687
             L +AARD+V   GG  +DV  GRRDG VS A ++  NLP P FNV QLT  F  KG TQE
Sbjct  122   LTYAARDAVSQVGGPRWDVLGGRRDGTVSRADQVGANLPSPLFNVDQLTKSFVRKGMTQE  181

Query  686   EMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN---L  516
             EM+TLSGAHTIG +HC SF NRLY+F++T+VQDP LDP  A  LK  CP+G+   +    
Sbjct  182   EMITLSGAHTIGIAHCLSFVNRLYNFSTTSVQDPDLDPNMAKLLKSLCPKGSDFLDPKSK  241

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
              + +DP SP   D  YYT++   R + TSDQ L  D  T + V     +   W  KF  A
Sbjct  242   SIALDPLSPNFFDNGYYTSLSLRRSILTSDQILFADLDTRDSVEDKQANEAVWRFKFVNA  301

Query  335   MVKMGQISVLTGNAGEIRANCRVVN  261
             MVKM  I VL+GN G IR NCRVV+
Sbjct  302   MVKMSTIGVLSGNQGRIRTNCRVVS  326



>ref|NP_001140982.1| uncharacterized protein LOC100273061 precursor [Zea mays]
 gb|ACF85102.1| unknown [Zea mays]
 gb|ACG36710.1| peroxidase 1 precursor [Zea mays]
Length=362

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 208/307 (68%), Gaps = 3/307 (1%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A L+VGFYS +C  AE +V+  V  AF  + G+AAGL+R+HFHDCFVRGCDGSVLIDSTA
Sbjct  30    AGLKVGFYSKTCPSAESLVQQAVAAAFKNNSGIAAGLIRLHFHDCFVRGCDGSVLIDSTA  89

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTG-GFGYD  813
             +NTAEKD+  NNPSLRGFEVID+AK  +E+ C   VSCADILAFAARDS+ + G    Y 
Sbjct  90    NNTAEKDAVPNNPSLRGFEVIDAAKKAVEARCPKTVSCADILAFAARDSIALAGNNLTYK  149

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTS  633
             VPAGRRDGRVS  ++  +NLP P     +L   F+ K  T E+MV LSGAHT+GRSHC+S
Sbjct  150   VPAGRRDGRVSRDTDANSNLPSPLSTAAELVGNFTRKNLTAEDMVVLSGAHTVGRSHCSS  209

Query  632   FNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--ANLVVPMDPFSPAITDVSYYTN  459
             F NRLY F++ +  DP++   YA  L+  CP   S    N    MD  +PA+ D  YY  
Sbjct  210   FTNRLYGFSNASDVDPTISSAYALLLRAICPSNTSQFFPNTTTDMDLITPALLDNRYYVG  269

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  N GLFTSDQ LLT+ +    V     S  +W  KFA +MVKMG I VLTG  GEIR 
Sbjct  270   LANNLGLFTSDQALLTNATLKKSVDAFVKSESAWKTKFAKSMVKMGNIDVLTGTKGEIRL  329

Query  278   NCRVVNS  258
             NCRV+NS
Sbjct  330   NCRVINS  336



>ref|XP_009411414.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 219/303 (72%), Gaps = 11/303 (4%)
 Frame = -1

Query  1169  AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA  990
             A+L+VG+YS  C  AELIVK+EV+KA + D GV A L+RMHFHDCFVRGCDGSVLIDST 
Sbjct  25    AQLKVGYYSYGCPAAELIVKEEVEKALIDDPGVGADLLRMHFHDCFVRGCDGSVLIDSTE  84

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              NTAEKD+   N +L GFE+ID+ K +LE+ CKGVVSCAD+LAFAARDSV   GG  Y V
Sbjct  85    DNTAEKDAQI-NLTLEGFEIIDAIKEKLEAACKGVVSCADLLAFAARDSVVHYGGIHYRV  143

Query  809   PAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSF  630
             PAGR+DG VS   +  + LP P+ ++ +LT LF +KG +Q +M+TLSGAHT+G +HC +F
Sbjct  144   PAGRKDGTVSKEGD-TSILPSPALDLTELTKLFISKGLSQNDMITLSGAHTVGIAHCDAF  202

Query  629   NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILA  450
              +RLY        D +LD +YA  L+++CP G++N    V MDP SP   D  YY ++L 
Sbjct  203   TDRLYD------TDETLDQKYAKALRKQCPPGSNN---TVSMDPKSPRRFDNHYYRSLLK  253

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGLF SDQTLL+   T  +V++ A +   +  KFAAA+VKMG+I +LTG+ GE+RANCR
Sbjct  254   NRGLFISDQTLLSTQGTTTQVKRLASNYKRFQRKFAAAIVKMGEIGILTGSEGEVRANCR  313

Query  269   VVN  261
              +N
Sbjct  314   KIN  316



>ref|XP_009387798.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=261

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 203/265 (77%), Gaps = 5/265 (2%)
 Frame = -1

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDS-PANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             MHFHDCFVRGCDGS+L+DST  NTAEKD+ P        F+VID AK +LE +CKG VSC
Sbjct  1     MHFHDCFVRGCDGSILLDSTKKNTAEKDAIPNRTLEDEAFQVIDKAKKKLEKVCKGTVSC  60

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADILAFAARDSV   GG  Y VPAGRRDG++S +S+  + LPPP+FN+ QLTN F++KG 
Sbjct  61    ADILAFAARDSVAHYGGTFYAVPAGRRDGKISRSSDTID-LPPPTFNLIQLTNSFASKGM  119

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL  516
             +Q++M+TLSGAHTIG +HC + +NRLY+F+     DP+L+P+YA QLK+ CP G++N   
Sbjct  120   SQDDMITLSGAHTIGEAHCPTVSNRLYNFSRKASTDPTLNPKYAYQLKRECPPGSNNE--  177

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
              V MDP SP   D SYY+N+L NRGLFTSDQTL++ P+TA +VRQ AGS + +  KFAAA
Sbjct  178   -VDMDPPSPLTFDTSYYSNLLDNRGLFTSDQTLMSTPATAGKVRQLAGSSVLFKQKFAAA  236

Query  335   MVKMGQISVLTGNAGEIRANCRVVN  261
             MVKMG+I VLTG  GEIR  CRVVN
Sbjct  237   MVKMGKIGVLTGEQGEIRNYCRVVN  261



>ref|NP_001141388.1| uncharacterized protein LOC100273479 precursor [Zea mays]
 gb|ACF86224.1| unknown [Zea mays]
 gb|AFW77216.1| hypothetical protein ZEAMMB73_709802 [Zea mays]
Length=357

 Score =   337 bits (864),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 217/328 (66%), Gaps = 9/328 (3%)
 Frame = -1

Query  1217  CYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             C   +A L   L+ + A L+ GFY+ +C  AE IV+  V  AF  + GVA  L+RMHFHD
Sbjct  5     CCLVVATLLAALLSVSASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRMHFHD  64

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCDGSVLIDSTA+N AEKDS  N+PSLR F+V+D AKA LE+ C GVVSCADILAF
Sbjct  65    CFVRGCDGSVLIDSTANNKAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCADILAF  124

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARDSV +TGG GY VP+GRRDGR+S A++  N LPPP FN  QL + F++K  + E+MV
Sbjct  125   AARDSVVLTGGLGYKVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSLEDMV  184

Query  677   TLSGAHTIGRSHCTSF------NNRLYSFN-STTVQDPSLDPQYAAQLKQRCP--QGNSN  525
              LSGAHTIG SHC+SF       +RLY+F+ S+   DP+L   YA  LK  CP   G   
Sbjct  185   VLSGAHTIGVSHCSSFAGINNTGDRLYNFSGSSDGIDPALSKAYAFLLKSICPSNSGRFF  244

Query  524   ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKF  345
              N    MD  +PA  D  YY  +  N GLF SD  LLT+ +    V     S  +W  KF
Sbjct  245   PNTTTFMDLITPAKFDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRSEATWKTKF  304

Query  344   AAAMVKMGQISVLTGNAGEIRANCRVVN  261
             A +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  305   AKSMLKMGQIEVLTGTQGEIRRNCRVIN  332



>ref|XP_010906360.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=311

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 216/313 (69%), Gaps = 5/313 (2%)
 Frame = -1

Query  1199  LLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGC  1020
             ++   L V  A L+VG+Y+  C  AE IV+  V+KA + + G+ AGL+RMHFHDCFVRGC
Sbjct  2     VIQAMLHVSLASLKVGYYNHKCPSAEAIVRQTVRKAMIHNIGIGAGLIRMHFHDCFVRGC  61

Query  1019  DGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSV  840
             D SVL+DST  N +EK+SPANNPSLRGFEVID AKAR+ES+C   VSCADIL FAARD+ 
Sbjct  62    DASVLLDSTPDNRSEKESPANNPSLRGFEVIDEAKARIESVCPSTVSCADILTFAARDAA  121

Query  839   EMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAH  660
                GG  Y VPAGRRDGRVS+ SE+ +NLP  SFN  QL + F+ KG T +EMVTLSGAH
Sbjct  122   YFAGGIKYAVPAGRRDGRVSIESEVLSNLPGFSFNAVQLEDSFARKGLTLDEMVTLSGAH  181

Query  659   TIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAIT  480
             + G SHCTSF +RL   N+T  QDP +D ++AA LK +C    S+    V +D  +P   
Sbjct  182   SFGVSHCTSFADRL---NATGPQDPKMDRKFAAFLKSKCSPAGSDP--TVNLDVVTPNRL  236

Query  479   DVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTG  300
             D  YY N+   RGL TSDQTL T   T+  V  NA  P +W   FAAAMVKMG I VLTG
Sbjct  237   DNQYYKNLRKGRGLLTSDQTLQTSALTSRLVDANAKRPRAWAANFAAAMVKMGSIEVLTG  296

Query  299   NAGEIRANCRVVN  261
             + GEIR  CRVVN
Sbjct  297   DQGEIRRTCRVVN  309



>ref|XP_010906352.1| PREDICTED: peroxidase 5-like, partial [Elaeis guineensis]
Length=322

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 218/320 (68%), Gaps = 8/320 (3%)
 Frame = -1

Query  1211  STLALLTCQLIVLK---AELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             + L +L  Q +  +   A L+VG+Y   C  AE IV+  V+KA + + G+ AGL+RMHFH
Sbjct  6     AILFILVIQAMTFQVSLASLKVGYYKHKCPSAETIVRQTVRKAMIHNPGIGAGLIRMHFH  65

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCD SVL+DST  N +EK+SPANNPSLRGFEVID AKAR+ES+C   VSCADIL 
Sbjct  66    DCFVRGCDASVLLDSTPGNPSEKESPANNPSLRGFEVIDEAKARIESVCPSTVSCADILT  125

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FA+RD+    GG  Y VPAGRRDGRVS+ SE+ +N+PP  FN  QL N F+ KGFT +EM
Sbjct  126   FASRDAAYFAGGIQYAVPAGRRDGRVSIESEVLDNVPPFFFNAVQLENSFARKGFTLDEM  185

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD  501
             VTLSGAH+ G SHC+SF +RL   N+T  QDP +D ++AA LK +C +  S+    V +D
Sbjct  186   VTLSGAHSFGVSHCSSFADRL---NTTAPQDPKMDRKFAAFLKSKCSRAGSDP--TVNLD  240

Query  500   PFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMG  321
               +P   D  YY N+   RGL TSDQTL     T+  V  NA  P +W   FAAAMVKMG
Sbjct  241   VVTPNRLDNQYYKNLQKGRGLLTSDQTLQASALTSRLVDTNAKRPQAWAANFAAAMVKMG  300

Query  320   QISVLTGNAGEIRANCRVVN  261
              I VLTG+ GEIR  CR VN
Sbjct  301   SIEVLTGDQGEIRRTCRAVN  320



>gb|ACG35820.1| peroxidase 66 precursor [Zea mays]
Length=328

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 203/289 (70%), Gaps = 3/289 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +LQVGFY   C  AE+IV++EV KA   + GVAAGL+R+HFHDCFVRGCD SVL+DS+A 
Sbjct  27    QLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDASVLLDSSAG  86

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N AEKD+ A N SLRGFEVIDSAK RLE  C GVVSCAD+LAFAARD++ + GG  Y VP
Sbjct  87    NQAEKDA-APNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVP  145

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             AGRRDG VS   E   NLPPP+ +  QLT  F  KG +Q EMV LSGAHT+G + C+SF 
Sbjct  146   AGRRDGNVSSXQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFA  205

Query  626   NRLYSFN-STTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYTNIL  453
              RLYS+  S   QDPS+DP Y A L Q+C PQG   A+  +PMDP +P   D +YY N++
Sbjct  206   PRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPLPMDPVTPTAFDTNYYANLV  265

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVL  306
             A RGL  SDQ LL DP+TA +V     SP ++   F  AM+KMG I VL
Sbjct  266   ARRGLLASDQALLADPATAAQVLAYTNSPATFQTXFVXAMIKMGAIQVL  314



>ref|XP_010553703.1| PREDICTED: peroxidase 5-like [Tarenaya hassleriana]
Length=329

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 212/316 (67%), Gaps = 4/316 (1%)
 Frame = -1

Query  1205  LALLTCQLIVL-KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             LA+  C +  +  A L+VG+Y   C  AE IV+  V++A   D GVAA L+RMHFHDCFV
Sbjct  14    LAIGVCGVTAIASASLRVGYYRTRCPNAEAIVRKAVKRAMSRDPGVAAALIRMHFHDCFV  73

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCD S+L+D+T  N +EK++ AN PSLRGFEVID AK RLES C   VSCADIL FAAR
Sbjct  74    RGCDASILLDTTPENASEKENAANTPSLRGFEVIDDAKRRLESRCSQTVSCADILTFAAR  133

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV  TGG  Y VP+GRRDGRVSL  E   +LP PS +  QL   F+ KG T +EMVTLS
Sbjct  134   DSVCETGGSHYRVPSGRRDGRVSLKDEPSLHLPSPSLDAKQLEESFAKKGLTLDEMVTLS  193

Query  668   GAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSP  489
             GAH+IG S C+SF+ RL+SFNST  QDPSL+P  A  L+ +C    S+ +  V +D  +P
Sbjct  194   GAHSIGVSRCSSFSGRLFSFNSTHEQDPSLNPGLAKVLRSKC---RSDMDSTVDLDVKTP  250

Query  488   AITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISV  309
                D  YY N++    + TSDQ+L+    TA  VR NA +   W  +FA AMVKMG I V
Sbjct  251   NRLDNEYYLNLMNRNVVLTSDQSLMNSSETARMVRFNAENGRVWARRFARAMVKMGSIEV  310

Query  308   LTGNAGEIRANCRVVN  261
             LTG  GE+R NCRVVN
Sbjct  311   LTGFEGEVRKNCRVVN  326



>ref|XP_003558949.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=333

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 220/320 (69%), Gaps = 8/320 (3%)
 Frame = -1

Query  1205  LALLTCQLIVLKA-----ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFH  1041
             + LL   L+++ A     +L VG+Y   C  AE+IV++EV K      G AAGL+R+HFH
Sbjct  17    MRLLVVMLVLMAARPAMAQLAVGYYDTLCPAAEIIVQEEVSKGVSGSPGTAAGLLRLHFH  76

Query  1040  DCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILA  861
             DCFVRGCD SVL+DST  N AEKD+P N+ SLRGF+VID AK RLE  C  VVSCADILA
Sbjct  77    DCFVRGCDASVLLDSTPGNKAEKDAPPNS-SLRGFDVIDKAKTRLEQACYRVVSCADILA  135

Query  860   FAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEM  681
             FAARD++ + GG  Y VPAGRRDG VS A E   NLPPP+ NV QLT +F +KG ++ +M
Sbjct  136   FAARDALALVGGSAYQVPAGRRDGNVSSAGETNGNLPPPTANVNQLTQIFGSKGLSKAQM  195

Query  680   VTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD  501
             VTLSGAHT+G + C+SF++RLYS      QDP++DP+Y   L  +CPQ    A   VPMD
Sbjct  196   VTLSGAHTVGAAQCSSFSSRLYSSGPNGGQDPTMDPKYLTALTAQCPQ--KGAQQAVPMD  253

Query  500   PFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMG  321
             P +P   D +YY N++ANRGL +SDQ LL DP+ + +V     SP ++   FA AM+ MG
Sbjct  254   PVTPNAFDTNYYANLVANRGLLSSDQALLADPNASAQVVAYTSSPDTFQTDFANAMIAMG  313

Query  320   QISVLTGNAGEIRANCRVVN  261
              + VLTGNAG IR NCRV +
Sbjct  314   NVGVLTGNAGNIRTNCRVAS  333



>ref|XP_003568990.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=337

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 214/305 (70%), Gaps = 4/305 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFY  SC +AE IV+D V++A   + G A GL+RMHFHDCFVRGCDGSVLI+ST  N
Sbjct  30    LKVGFYEHSCPQAEAIVRDAVRRAIARNPGFAPGLIRMHFHDCFVRGCDGSVLINSTPGN  89

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AEKDS AN PSLRGFEVID AKA LES+C   VSCADILAFAARDS  + G   Y VP+
Sbjct  90    RAEKDSVANTPSLRGFEVIDDAKAILESVCPRTVSCADILAFAARDSTLLAGDIAYAVPS  149

Query  803   GRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             GRRDG VS  SE+  NN+PPP+  V  L   F+ KG + ++MVTLSGAHTIGRSHC+SF 
Sbjct  150   GRRDGLVSRESEVLDNNVPPPTDEVGALIASFARKGLSADDMVTLSGAHTIGRSHCSSFT  209

Query  626   NRLYSFNSTTVQ-DPSLDPQYAAQLKQRCPQGNSNAN--LVVPMDPFSPAITDVSYYTNI  456
              RL++F     + DPS++P YAA+LK+RCP   ++ N   VVP+D  +P   D  Y+ N+
Sbjct  210   QRLHNFTGVRGRTDPSIEPYYAAELKRRCPPETNDMNNPTVVPLDVVTPVQFDNQYFKNV  269

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
             LA++   TSDQTLLT   TA  V  +A    +W  KFA +MV+MG + VLTG+ GEIR  
Sbjct  270   LAHKVPLTSDQTLLTCKRTAGIVVFHAAVEKAWRAKFAVSMVRMGNVGVLTGDQGEIREK  329

Query  275   CRVVN  261
             C  VN
Sbjct  330   CFAVN  334



>ref|XP_002440653.1| hypothetical protein SORBIDRAFT_09g004660 [Sorghum bicolor]
 gb|EES19083.1| hypothetical protein SORBIDRAFT_09g004660 [Sorghum bicolor]
Length=363

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 215/324 (66%), Gaps = 9/324 (3%)
 Frame = -1

Query  1205  LALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVR  1026
              A +   L+   A L VGFY  +C  AE +V+  V  AF  + GVA  L+RMHFHDCFVR
Sbjct  16    FATVLASLLSATACLDVGFYDQTCPTAETVVQQTVAAAFTNNSGVAPALIRMHFHDCFVR  75

Query  1025  GCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARD  846
             GCDGSVLIDSTA+NTAEKD+P NNPSLR F+V+DSAKA LE+ C GVVSCAD+LAFAARD
Sbjct  76    GCDGSVLIDSTANNTAEKDAPPNNPSLRFFDVVDSAKAALEAQCPGVVSCADVLAFAARD  135

Query  845   SVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSG  666
             SV ++GG GY VPAGRRDG +S A+E  NNLPPP FN  QL   F++K  T E++V LSG
Sbjct  136   SVVLSGGLGYQVPAGRRDGLISTATEALNNLPPPFFNATQLAASFASKNLTVEDLVVLSG  195

Query  665   AHTIGRSHCTSF------NNRLYSFN-STTVQDPSLDPQYAAQLKQRCPQGNSN--ANLV  513
             AHT+G SHC+SF       +RLY+F+ S+   DP+L   YA  LK  CP  +S    N  
Sbjct  196   AHTLGVSHCSSFAGVGNLGDRLYNFSGSSDGTDPALSKAYAFLLKSICPSNSSQFFPNTT  255

Query  512   VPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAM  333
               MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA +M
Sbjct  256   TFMDLITPEKFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSM  315

Query  332   VKMGQISVLTGNAGEIRANCRVVN  261
             +KMGQI VLTG  GEIR NCRV+N
Sbjct  316   LKMGQIEVLTGTQGEIRLNCRVIN  339



>ref|XP_008461391.1| PREDICTED: peroxidase 5-like [Cucumis melo]
Length=340

 Score =   334 bits (857),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 213/331 (64%), Gaps = 7/331 (2%)
 Frame = -1

Query  1235  RIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLV  1056
             + ++ S +ST+           A L+VGFY  SC  AE IVK  V KA   + G AAGL+
Sbjct  11    KFKIFSKHSTIIFFLYLFTFASATLKVGFYRSSCPNAEAIVKKVVNKAISLNPGAAAGLI  70

Query  1055  RMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             R+HFHDCF+RGC+GSVL+ ST  + AE+D P+N PSL+GFE+ID AK  LE+ C   VSC
Sbjct  71    RLHFHDCFIRGCEGSVLLKSTPGHPAERDHPSNFPSLQGFEIIDEAKTYLEAACPNTVSC  130

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADILAFAARDS    GG  Y VPAGRRDGR+S+  E  + LP P+FN+ QLT  F+ +G 
Sbjct  131   ADILAFAARDSARKVGGINYAVPAGRRDGRISIKEEA-SRLPSPTFNIEQLTQNFAERGL  189

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-  519
             ++ +MVTLSGAH+IG + C +F+ RLYSFN+T  QDPS++P+Y A LK +CP   SN   
Sbjct  190   SKTDMVTLSGAHSIGAARCVTFSKRLYSFNTTHNQDPSMNPKYVAYLKTKCPPPTSNVGG  249

Query  518   -----LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWG  354
                  L V +D  +P   D  YY  +  + GL +SDQ LL+ PST+  V   A     W 
Sbjct  250   QNAQPLEVALDFTTPNRLDKQYYVGLTKHEGLLSSDQILLSSPSTSKLVLAYAKYGSIWA  309

Query  353   LKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               F  +MVKMG I VLTG+ GEIR +C  VN
Sbjct  310   SNFGKSMVKMGSIGVLTGSQGEIRRHCSFVN  340



>ref|XP_009382231.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 219/302 (73%), Gaps = 11/302 (4%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L+VGFYS SC  AEL+VK+EV+KA   D GV A L+RMHFHDCFVRGCDGS+L++ST  
Sbjct  26    QLEVGFYSYSCPAAELLVKEEVEKALQDDPGVGADLLRMHFHDCFVRGCDGSILLNSTKG  85

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             NTAEKD+  N   L GF+VID+ K +LE+ CKGVVSCADILAFA+RDS+   GG  Y VP
Sbjct  86    NTAEKDARVNT-DLEGFDVIDTIKEKLEAACKGVVSCADILAFASRDSIVHYGGVPYKVP  144

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             +GRRDGRVS+A++  + LP P   + +LT LF +KG +Q +M+TLSGAHT+G +HC +F+
Sbjct  145   SGRRDGRVSIAADT-SILPSPKLGLSELTKLFISKGLSQNDMITLSGAHTVGIAHCDAFS  203

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNILAN  447
             NRLY+       D +LD  YAA LK +CP G++N    V MDP +P   D  YY  IL N
Sbjct  204   NRLYN------GDATLDQNYAAYLKTQCPPGSNN---TVSMDPKTPRKFDNLYYRLILKN  254

Query  446   RGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRV  267
             + LFTSDQTL++   TA +V++ A S   +  KFA A+VKMG I VLTG+ GEIRA+C+V
Sbjct  255   QALFTSDQTLVSTQGTATQVKRLAESYKRFQKKFADAIVKMGAIEVLTGSEGEIRADCKV  314

Query  266   VN  261
             VN
Sbjct  315   VN  316



>ref|XP_006444582.1| hypothetical protein CICLE_v10021010mg [Citrus clementina]
 ref|XP_006492388.1| PREDICTED: peroxidase 5-like [Citrus sinensis]
 gb|ESR57822.1| hypothetical protein CICLE_v10021010mg [Citrus clementina]
 gb|KDO86854.1| hypothetical protein CISIN_1g019585mg [Citrus sinensis]
Length=338

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/342 (51%), Positives = 220/342 (64%), Gaps = 21/342 (6%)
 Frame = -1

Query  1238  SRIRMLSCYSTLALLTCQLIVL---------KAELQVGFYSGSCGRAELIVKDEVQKAFV  1086
             S  +M SC     ++ C LI++          A+L+VGFY  +C  AE IV+  V KA  
Sbjct  2     SYAKMDSC-----MIMCILILVSTMPLGTSANAKLKVGFYKSTCPSAESIVRKAVNKAVS  56

Query  1085  CDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASNT-AEKDSPANNPSLRGFEVIDSAKAR  909
             C+ G+AAGL+RMHFHDCFVRGCD SVL+++   N  +E+D   NNPSLRGFEVID AKA+
Sbjct  57    CNPGIAAGLIRMHFHDCFVRGCDASVLLETIPGNPPSERDDHVNNPSLRGFEVIDEAKAQ  116

Query  908   LESLCKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVP  729
             +E++C   VSCADIL FAARDS    GG  Y VPAGRRDGRVSL++EI  NLP P+FN  
Sbjct  117   IEAVCPNTVSCADILTFAARDSTSKVGGINYAVPAGRRDGRVSLSNEIAENLPSPTFNAE  176

Query  728   QLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQ  549
             QL   F+ KG + +EMVTL GAH+IG SHC+SF+ RLY+FN+T  QDPS+D ++A  LK 
Sbjct  177   QLAARFARKGISVDEMVTLVGAHSIGVSHCSSFSKRLYAFNTTHPQDPSMDHRFANFLKN  236

Query  548   RCPQGNSNANLVVPMDP------FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEV  387
             +CP       L    DP       +P   D  YY  +  +RGL TSDQTL+    T+  V
Sbjct  237   KCPPPPPTDGLGCTRDPTVTQEFVTPNRLDNKYYRELRNHRGLLTSDQTLMDSRLTSKMV  296

Query  386   RQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               N  +   WG KFA AMV +G + VLTG+ GEIR +C  VN
Sbjct  297   LDNERNGAMWGTKFAKAMVHVGSLDVLTGSQGEIRKHCSFVN  338



>ref|XP_004977108.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=351

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 215/326 (66%), Gaps = 4/326 (1%)
 Frame = -1

Query  1229  RMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRM  1050
             R LS  S LA L     V  A L+VGFY  +C  AE +V+  V  AF  + GVA  L+R+
Sbjct  4     RSLSLASVLAALLSATAVC-ACLEVGFYDRTCPSAETVVQQTVAAAFRNNSGVAPALIRL  62

Query  1049  HFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCAD  870
             HFHDCFVRGCD SVLIDSTA+NTAEKDSP NNPSLR F+V+D AKA +E+ C GVVSCAD
Sbjct  63    HFHDCFVRGCDCSVLIDSTANNTAEKDSPPNNPSLRFFDVVDRAKAAVEARCPGVVSCAD  122

Query  869   ILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQ  690
             +LAFAARD V + GG GY VPAGRRDGRVSLA+E  N LPPPSFN  +L + F++K  T 
Sbjct  123   VLAFAARDGVALAGGLGYQVPAGRRDGRVSLAAEAFNELPPPSFNATELLDSFASKNLTL  182

Query  689   EEMVTLSGAHTIGRSHCTSFNNRLYSF-NSTTVQDPSLDPQYAAQLKQRCPQ--GNSNAN  519
             E+MV LSGAH+IG SHC  F +RLY+  N+T   DP+L   YA  L+  CP+  G    N
Sbjct  183   EDMVVLSGAHSIGVSHCIHFFDRLYNVTNTTDGIDPALSKAYAFLLQCICPRNTGQFFPN  242

Query  518   LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAA  339
                 MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  +W  KFA 
Sbjct  243   TTTFMDLITPTKLDNKYYVGLTNNLGLFQSDAALLTNATMKALVDSFIRSEATWKSKFAR  302

Query  338   AMVKMGQISVLTGNAGEIRANCRVVN  261
             +MVKMGQI VL+G  GEIR NCR +N
Sbjct  303   SMVKMGQIGVLSGTQGEIRRNCRAIN  328



>ref|XP_010674524.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=335

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 215/308 (70%), Gaps = 1/308 (0%)
 Frame = -1

Query  1181  IVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLI  1002
             I+  A L +G+Y  +C  AE IV+  V +A   D G+ AGL+RMHFHDCFVRGCD S+L+
Sbjct  27    IISTATLDIGYYQSTCPSAEAIVRRAVNRAITQDPGLGAGLIRMHFHDCFVRGCDASILL  86

Query  1001  DSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGG  825
             DST SN ++EK+SPAN PSLRGFEVID AKA LE +C   VSCADILAFAARDSV+  GG
Sbjct  87    DSTLSNPSSEKESPANGPSLRGFEVIDEAKAELEIICPRTVSCADILAFAARDSVQELGG  146

Query  824   FGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRS  645
               Y+VP+GR+DG +S+  E   N+P P+  V QL  +FSNKG   +++V LSGAH+IG +
Sbjct  147   ISYNVPSGRKDGTISIKDEATTNIPSPNSTVEQLQQMFSNKGLNLQDIVALSGAHSIGMT  206

Query  644   HCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYY  465
              C+ F++RL++FN+T +QDPS++ ++A+++K +CP   ++  + VP+D  +P+  D  YY
Sbjct  207   RCSLFSHRLHTFNATHLQDPSMEVKFASEMKDKCPSLAASEQVKVPLDGLTPSRLDNKYY  266

Query  464   TNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEI  285
              N++  RGL  SDQ L+  P T+  V++ A     W   F  AM +MG I VLT + GE+
Sbjct  267   RNLVKGRGLLASDQALMDSPLTSKMVKRFAKYGRVWMPTFVDAMTRMGSIEVLTSSQGEV  326

Query  284   RANCRVVN  261
             R +CR+VN
Sbjct  327   RRHCRIVN  334



>emb|CAN71282.1| hypothetical protein VITISV_027092 [Vitis vinifera]
Length=329

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 202/296 (68%), Gaps = 2/296 (1%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L + L+VGFY  +C  AE +V+  V KA   + G+AAGL+RMHFHDCFVRGCD SVL+DS
Sbjct  35    LSSSLKVGFYGSTCPSAEAVVRKTVDKAVSRNLGIAAGLIRMHFHDCFVRGCDASVLLDS  94

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  N +EK+ PANNPSLRGF+VI+ AKA+LE+LC   VSCADI+AFAARDS    GG  Y
Sbjct  95    TPGNLSEKEHPANNPSLRGFQVINKAKAKLEALCPETVSCADIIAFAARDSALKVGGINY  154

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP GRRDGRVS   E+  +LPPP FN  QL   F+ KG + +EMV LSGAH+IG SHC+
Sbjct  155   TVPGGRRDGRVSRKDEVAESLPPPHFNAEQLELRFARKGLSLDEMVXLSGAHSIGMSHCS  214

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRC-PQGNSNANLVVPMDPFSPAITDVSYYTN  459
             SF+ RLYS N T   DPS+  +Y + L+ +C PQ N   N  VP++  +P   D  YY  
Sbjct  215   SFSKRLYS-NGTHAHDPSMRRKYVSFLRTKCHPQRNGGQNPTVPLEAKTPGRLDNKYYKE  273

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAG  291
             +  +RGL  SDQTL++  STA  VR NA    +W  KFAAAMV MG I VLT + G
Sbjct  274   LEKHRGLLNSDQTLMSSQSTAWMVRNNARHGSTWAAKFAAAMVHMGSIDVLTEDTG  329



>ref|XP_004298124.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 198/306 (65%), Gaps = 0/306 (0%)
 Frame = -1

Query  1178  VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLID  999
             V    L+VG Y  SC  AE+IV+D V+KA   D G+AA L+R+HFHDCFV GCD S+L+D
Sbjct  24    VASVPLEVGSYRKSCPSAEMIVRDTVKKAAATDPGIAAALIRLHFHDCFVMGCDASILLD  83

Query  998   STASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFG  819
             S     A +     N  ++GFEVID AKA +E+ C   VSCADI+ FAARDSV +TGG  
Sbjct  84    SKPGKPAAEKESMGNKGVQGFEVIDEAKANIEAQCPNTVSCADIITFAARDSVFITGGTY  143

Query  818   YDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHC  639
             Y  P GRRDG VSL SE+  NLP    N  QL   F+ KG + ++MVTLSGAH+IG SHC
Sbjct  144   YSAPGGRRDGTVSLVSEVTKNLPDAFLNATQLKTNFARKGLSLKDMVTLSGAHSIGDSHC  203

Query  638   TSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTN  459
             +SF+ RLYSFN T  QDP LD  Y   LK +CP   +  + VV  DP +P + D +YY N
Sbjct  204   SSFSKRLYSFNKTHAQDPELDAAYGEYLKSKCPNVKNGVDPVVAFDPLTPTLLDNNYYKN  263

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             ++ ++GL  +DQ L +   T   V+ N   P  WGL+FAAAMVKMG I VL G  GEIR 
Sbjct  264   LVGHKGLLATDQELWSSDLTRKMVKYNRNHPGRWGLEFAAAMVKMGSIDVLVGKQGEIRK  323

Query  278   NCRVVN  261
             NCR VN
Sbjct  324   NCRAVN  329



>ref|XP_002516915.1| Cationic peroxidase 2 precursor, putative [Ricinus communis]
 gb|EEF45529.1| Cationic peroxidase 2 precursor, putative [Ricinus communis]
Length=326

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 205/307 (67%), Gaps = 3/307 (1%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             L A+L+ GFY  +C  AE +V+  V+ A   D G+ A L+R+HFHDCFVRGCD S+L++S
Sbjct  21    LSAQLKKGFYQKTCPLAETLVRSTVKNALASDAGIPAALIRLHFHDCFVRGCDASILLNS  80

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             T  N AEK+S   N  + GFEVID AKA++ES C   VSCADI+AFAARDSV ++GG  Y
Sbjct  81    TPGNKAEKES-MGNKGVGGFEVIDEAKAKIESYCPNTVSCADIIAFAARDSVLLSGGTYY  139

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             DVP GRRDG  SL SE+  NLP   FN  QL   F+NKG + EEMVTLSGAH+IG SHC+
Sbjct  140   DVPGGRRDGTTSLISEVTGNLPDSFFNATQLKQNFANKGLSLEEMVTLSGAHSIGDSHCS  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNA--NLVVPMDPFSPAITDVSYYT  462
             SF+ RLYSFN+T  QDPSLDP YA+ LK +CP+       + VVP DP +P   D +YY 
Sbjct  200   SFSKRLYSFNATYSQDPSLDPVYASYLKIKCPRHVKPGLPDPVVPFDPLTPTRLDSNYYK  259

Query  461   NILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIR  282
             N+  ++GL  SDQ L     T   V +N   P  W  KFAAAM  MG I V+TG+ GEIR
Sbjct  260   NLKNDKGLLFSDQVLWNSELTKKIVNRNIRHPNKWASKFAAAMGHMGSIEVITGSQGEIR  319

Query  281   ANCRVVN  261
               C  +N
Sbjct  320   KYCWRMN  326



>ref|XP_010271091.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=345

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 209/303 (69%), Gaps = 2/303 (1%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +L++GFY  SC  AE  V+  V  A+  +R +A GL+RMHFHDCFVRGCDGSVL+DST  
Sbjct  24    DLEIGFYDKSCPSAEETVRQVVAGAYANNRRIAPGLIRMHFHDCFVRGCDGSVLLDSTLG  83

Query  986   NTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVP  807
             N++EK++  N  SL GF+VID AKA +E+ C GVVSCADILAFAARDS  + G   Y VP
Sbjct  84    NSSEKEAEPNR-SLHGFQVIDDAKAMVEAQCPGVVSCADILAFAARDSASLAGKIHYRVP  142

Query  806   AGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFN  627
             AGRRDG VS+ SE+  N+P P  N  +L   F+ K  T  +MVTLSGAH++G +HC+SF 
Sbjct  143   AGRRDGLVSIESEVITNIPSPLLNATELVGSFAAKNLTTADMVTLSGAHSVGVAHCSSFI  202

Query  626   NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-LVVPMDPFSPAITDVSYYTNILA  450
             NRLY+F+ T   DP+LDP YA+ L+ +CP   ++ +  VV +D  +PA+ D  YY  +  
Sbjct  203   NRLYNFSDTDDIDPTLDPIYASILRSKCPSNVTSTDPTVVSLDSLTPAVLDNMYYVGLQL  262

Query  449   NRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCR  270
             NRGL TSDQ LLT+ S  + V  NA     W  KFA AMVKMG I VLTG+ GEIR NCR
Sbjct  263   NRGLLTSDQALLTETSLKDLVDLNAYYGKVWDWKFAKAMVKMGGIEVLTGSDGEIRKNCR  322

Query  269   VVN  261
             VVN
Sbjct  323   VVN  325



>ref|XP_010914719.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=345

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 217/307 (71%), Gaps = 1/307 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             +  +LQ+GFY+ SC  AE +V+  V  AF  + G+AAGL+R+HFHDCFVRGCD SVL+DS
Sbjct  20    VHGDLQIGFYNTSCPTAESLVQQAVAAAFANNSGIAAGLIRLHFHDCFVRGCDASVLLDS  79

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             TA+NTAEKD+P NNPSLRGFEVI +AK+ +E+ C   VSCADI+AFAARDS  + G   Y
Sbjct  80    TANNTAEKDAPPNNPSLRGFEVIAAAKSAVEAACPKTVSCADIVAFAARDSATLAGNISY  139

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP+GRRDG VSLASE   N+P P FN  QL N F+ K  T +EMVTLSGAH+IG +HC+
Sbjct  140   QVPSGRRDGNVSLASEANANIPSPLFNATQLINSFAGKNLTTDEMVTLSGAHSIGVAHCS  199

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-LVVPMDPFSPAITDVSYYTN  459
             SF NR+Y+F++T+  DP+L   YA  LK +CP  ++    + V +D  +P + D  YYT 
Sbjct  200   SFLNRIYNFSNTSDVDPTLSSAYADLLKNKCPSNSTRFTPITVSLDIITPTVLDNRYYTG  259

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +    GL TSDQ L+T+ + +  V+ NA +  +W  KFA AMVKMG I VLTG  GEIR 
Sbjct  260   VELTLGLLTSDQALVTEANLSAAVQDNANNSATWASKFAQAMVKMGLIEVLTGTQGEIRT  319

Query  278   NCRVVNS  258
             NC VVNS
Sbjct  320   NCSVVNS  326



>ref|XP_002452710.1| hypothetical protein SORBIDRAFT_04g031120 [Sorghum bicolor]
 gb|EES05686.1| hypothetical protein SORBIDRAFT_04g031120 [Sorghum bicolor]
Length=336

 Score =   332 bits (850),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 209/306 (68%), Gaps = 6/306 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTA--  990
             LQVGFY  SC +AE +V++ V++A   D GVAAGL+RMHFHDCFVRGCD S+L+DST   
Sbjct  30    LQVGFYKHSCPQAEDMVRNAVRRAVARDPGVAAGLIRMHFHDCFVRGCDASILLDSTPGQ  89

Query  989   -SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
                 AEK SPAN PSLRGFEVID AKA +E+ C   VSCADI+AFAARD   + GG  Y 
Sbjct  90    PQQEAEKHSPANFPSLRGFEVIDEAKAIVEAHCPRTVSCADIVAFAARDGAYLAGGIDYR  149

Query  812   VPAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             VPAGRRDGRVS+  E+  +NLP P   V +L   F  KG + ++MVTLSGAH+IGRSHC+
Sbjct  150   VPAGRRDGRVSVKDEVLKDNLPFPDSTVAKLIESFRRKGLSADDMVTLSGAHSIGRSHCS  209

Query  635   SFNNRLYSF-NSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTN  459
             S   RLYSF   T   DP+L+P YAA LK+RCP    +    VP+D  +P   D  Y+ N
Sbjct  210   SVTARLYSFLGETGRTDPALNPAYAADLKRRCPPSTED-RTTVPLDMVTPNTFDNQYFKN  268

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +LA++  FTSDQTLL  P TA  V  +A    +W  KFA AMVKMG I VLTG+ GEIR 
Sbjct  269   VLAHKVPFTSDQTLLDSPWTAGLVAFHAAVGQAWEAKFAKAMVKMGAIEVLTGHEGEIRQ  328

Query  278   NCRVVN  261
              C +VN
Sbjct  329   KCSMVN  334



>ref|XP_003591355.1| Peroxidase [Medicago truncatula]
 gb|AES61606.1| cationic peroxidase [Medicago truncatula]
Length=342

 Score =   332 bits (850),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 216/340 (64%), Gaps = 18/340 (5%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAE--------LQVGFYSGSCGRAELIVKDEVQKAFVCDRGV  1071
             M+  ++ L++ T  +++L           L+ GFY  +C  AE IV+  V KA   + G+
Sbjct  1     MVKMHAILSIATLVIVILSVSTTLASSTSLKYGFYKTTCPSAEAIVRRAVNKAVSLNPGI  60

Query  1070  AAGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCK  891
              AGL+RMHFHDCFVRGCDGSVL+DS     +E+D PANNPSLRGFEVI+ AKA++E+ C 
Sbjct  61    TAGLIRMHFHDCFVRGCDGSVLLDSIPGIRSERDHPANNPSLRGFEVINEAKAQIEAACP  120

Query  890   GVVSCADILAFAARDSVEMTGG--FGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTN  717
               VSCADILAFAARDS     G    Y VP+GRRDGRVS+  E+  NLPPP+F+  QL +
Sbjct  121   KTVSCADILAFAARDSARKVSGGRIDYSVPSGRRDGRVSIFDEVTQNLPPPTFSAEQLID  180

Query  716   LFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ  537
              F  KG + +EMVTLSGAH+IG SHC+SF+ RLYSFN+T  QDPS+DP +A  L+ +CP 
Sbjct  181   NFDRKGLSVDEMVTLSGAHSIGVSHCSSFSKRLYSFNATFPQDPSMDPDFARLLRSKCPP  240

Query  536   GN--------SNANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQ  381
                        N +  V  D  +P   D  YY  +  NRGL TSDQ L+    T   V +
Sbjct  241   PQSQQSQSQIQNLDSTVAFDGSTPNDLDNMYYKRLKNNRGLLTSDQILVNSGLTKRMVLK  300

Query  380   NAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             NA     W +KFA AMV MG + VLTG+ GEIR  C VVN
Sbjct  301   NARHAAIWNVKFAKAMVHMGNLDVLTGSQGEIREYCSVVN  340



>ref|XP_002987767.1| hypothetical protein SELMODRAFT_126670 [Selaginella moellendorffii]
 gb|EFJ11070.1| hypothetical protein SELMODRAFT_126670 [Selaginella moellendorffii]
Length=334

 Score =   331 bits (849),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 217/310 (70%), Gaps = 10/310 (3%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             ++QVGFYS +C +AE IVK+ V  A   +RG+AAGL+R+ FHDCFV+GCD SVLID+T S
Sbjct  27    KIQVGFYSTTCPQAESIVKNVVSSAVSANRGLAAGLLRLQFHDCFVQGCDASVLIDTTPS  86

Query  986   NT--AEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
                 AEKD+P N  +LRGFEVID+AKA+LE+ C G VSCADILAFA RD+V   GG  +D
Sbjct  87    TKGGAEKDAPPNK-TLRGFEVIDAAKAQLEAKCPGTVSCADILAFATRDAVVQVGGPRWD  145

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSG------AHTIG  651
             VPAGRRDGR+S A+E  ++LP PSF++ QLT  F+ KG +Q+ M+TLSG      +HTIG
Sbjct  146   VPAGRRDGRISSAAEATSSLPDPSFSINQLTQRFAAKGLSQDNMITLSGKTHHLSSHTIG  205

Query  650   RSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVS  471
              +HC +F NRLY F+S+   DPSLDP +A  LK +CP+ N N N VV +DP +P   D S
Sbjct  206   VAHCKTFINRLYGFSSSADTDPSLDPTFAQSLKAQCPRENPNPNTVVSLDP-TPNTFDNS  264

Query  470   YYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAG  291
             YY+N+   RGL  SD+ L TD ST   V  N+    +W  KF  AMVKM  I V TG+ G
Sbjct  265   YYSNLALGRGLLASDELLFTDGSTTLNVALNSFFGSTWLQKFPDAMVKMSLIEVKTGSQG  324

Query  290   EIRANCRVVN  261
             EIR NCR +N
Sbjct  325   EIRKNCRRIN  334



>ref|XP_004135971.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=338

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 215/335 (64%), Gaps = 8/335 (2%)
 Frame = -1

Query  1244  SSSRIRMLSCYST-LALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             SS +  +LS  ST +  L        A L+VGFY  SC  AE IVK  V KA   + G A
Sbjct  5     SSQKFNILSKLSTVIFFLYLSTFASAATLKVGFYRSSCPNAEAIVKKVVNKAISLNPGAA  64

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGL+R+HFHDCF+RGC+GSVL+ ST  +  E+D P+N PSL+GFE+ID AKA LES C  
Sbjct  65    AGLIRLHFHDCFIRGCEGSVLLKSTPGHPTERDHPSNFPSLQGFEIIDEAKAYLESACPN  124

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
              VSCADILAFAARDS    GG  Y VPAGRRDGR+S+  E  + LP P+FN+ QLT  F+
Sbjct  125   TVSCADILAFAARDSARKVGGINYAVPAGRRDGRISIKEEA-SRLPSPTFNIEQLTQNFA  183

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              +G ++ +MVTLSGAH+IG + C +F+NRLYSFN+T  QDPS++P+YAA LK +CP   S
Sbjct  184   ERGLSKTDMVTLSGAHSIGAARCLTFSNRLYSFNATHNQDPSMNPKYAAYLKTKCPPLTS  243

Query  527   NAN------LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSP  366
             N        L   +D  +P   D  YY  +  ++GL +SDQ LL+ PST+      A   
Sbjct  244   NVGGQNAQPLEAALDFTTPNRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYG  303

Query  365   ISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               W   F  +MVKMG I VLTG+ GEIR  C  VN
Sbjct  304   SIWASNFKKSMVKMGSIGVLTGSQGEIRRQCSFVN  338



>gb|AIX03725.1| peroxidase [Trachycarpus fortunei]
Length=344

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 216/307 (70%), Gaps = 1/307 (0%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             +  +LQ+GFY+ SC  AE +V+  V  AF  + G+A GL+RMHFHDCFVRGCD SVL+DS
Sbjct  19    VHGDLQIGFYNQSCPSAESLVQQAVAAAFANNSGIAPGLIRMHFHDCFVRGCDASVLLDS  78

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             TA+NTAEKD+  NNPSLRGFEVI +AK+ +E+ C   VSCADILAFAARDS  + G   Y
Sbjct  79    TANNTAEKDAAPNNPSLRGFEVIAAAKSAVEAACPKTVSCADILAFAARDSAALAGNITY  138

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VP+GRRDG VSLASE   N+P P+FN  QL N F+ K  T +EMVTLSGAH+IG SHC 
Sbjct  139   QVPSGRRDGNVSLASEALTNIPAPTFNATQLINSFAGKNLTADEMVTLSGAHSIGVSHCF  198

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-LVVPMDPFSPAITDVSYYTN  459
             SF NR+Y+F++T+  DP+L   YA  L+ +CP  ++    + V +D  +P + D  YYT 
Sbjct  199   SFLNRIYNFSNTSQVDPTLSSSYADLLRTKCPSNSTRFTPITVSLDIITPTVLDNRYYTG  258

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +    GL TSDQ L+T+ + +  V+ NA +  +W  KFA A+VKMGQI VLTG  GEIR 
Sbjct  259   VQLTLGLLTSDQALVTEANLSAAVKNNADNLTAWVAKFAQAIVKMGQIQVLTGTQGEIRT  318

Query  278   NCRVVNS  258
             NC VVNS
Sbjct  319   NCSVVNS  325



>ref|XP_003558948.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=338

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 222/315 (70%), Gaps = 17/315 (5%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             +LQ+GFY+ SC +AE+IV+DEV +A   D G+AAGL+R+HFHDCFV+GCD SVL+D+ A 
Sbjct  28    QLQLGFYAQSCPQAEVIVRDEVGRAVSGDPGLAAGLLRLHFHDCFVKGCDASVLLDTIAG  87

Query  986   N---TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGY  816
             N    AEKD+ A N +LRGFEVID AK RLES C G VSCADILAFAARDSV +TGG  Y
Sbjct  88    NGSTAAEKDA-APNRTLRGFEVIDGAKKRLESACAGTVSCADILAFAARDSVVLTGGSPY  146

Query  815   DVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
              VPAGRRDG  S AS+   +LPPP+ NV QLT +F+  G +QE+MVTLSGAHTIG +HC+
Sbjct  147   GVPAGRRDGNESSASDAQASLPPPTANVAQLTQIFARNGLSQEDMVTLSGAHTIGVTHCS  206

Query  635   SFNNRLYSFNS----TTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMD------PFSPA  486
             SF+ RLYS ++     T  DP++D   A +L +RCP G+++    VPMD      P    
Sbjct  207   SFSARLYSGDNNNSDNTGHDPAMDDATATELARRCPPGSAD---TVPMDLGGGGGPVDEN  263

Query  485   ITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVL  306
               D  Y+  +LA+RGL  SDQ L  D +TA  V QNAG+   +  +FA AMV+MG + VL
Sbjct  264   AFDTGYFQALLAHRGLLGSDQALTADNATAALVAQNAGNLYLFVTRFADAMVRMGAVRVL  323

Query  305   TGNAGEIRANCRVVN  261
             TG+ G+IR +CRVVN
Sbjct  324   TGSDGQIRTSCRVVN  338



>ref|XP_002993742.1| hypothetical protein SELMODRAFT_137572 [Selaginella moellendorffii]
 gb|EFJ05161.1| hypothetical protein SELMODRAFT_137572 [Selaginella moellendorffii]
Length=337

 Score =   330 bits (845),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 217/313 (69%), Gaps = 13/313 (4%)
 Frame = -1

Query  1166  ELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTAS  987
             ++QVGFYS +C +AE IVK+ V  A   +RG+AAGL+R+ FHDCFV+GCD SVLIDST S
Sbjct  27    KIQVGFYSTTCPQAESIVKNVVSSAVSANRGLAAGLLRLQFHDCFVQGCDASVLIDSTPS  86

Query  986   NT--AEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
                 AEKD+P N  +LRGFEVID+AKA++E+ C G VSCADILAFA RD+V   GG  +D
Sbjct  87    TKGGAEKDAPPNK-TLRGFEVIDAAKAQVEAKCPGTVSCADILAFATRDAVVQVGGPRWD  145

Query  812   VPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSG---------AH  660
             VPAGRRDGR+S A+E  ++LP PSF++ QLT  F+ KG +Q+ M+TLSG         +H
Sbjct  146   VPAGRRDGRISSAAEATSSLPDPSFSINQLTQRFAAKGLSQDNMITLSGKTHHLSSFQSH  205

Query  659   TIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAIT  480
             TIG +HC +F NRLY F+S+   DPSLDP +A  LK +CP+ N N N VV +DP +P   
Sbjct  206   TIGVAHCKTFINRLYGFSSSADTDPSLDPTFAQSLKAQCPRENPNPNTVVSLDP-TPNTF  264

Query  479   DVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTG  300
             D SYY+N+   RGL  SD+ L TD ST   V  N+    +W  KF  AMVKM  I V TG
Sbjct  265   DNSYYSNLALGRGLLASDELLFTDGSTTLNVALNSFFGSTWLQKFPDAMVKMSLIEVKTG  324

Query  299   NAGEIRANCRVVN  261
             + GEIR NCR +N
Sbjct  325   SQGEIRKNCRRIN  337



>ref|XP_008793597.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=338

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 212/305 (70%), Gaps = 6/305 (2%)
 Frame = -1

Query  1172  KAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST  993
             +A L+VG+Y+  C  AE IV+  V++A V +  + AGLVRMHFHDCFVRGCD SVL+DST
Sbjct  37    RASLKVGYYNHKCRSAEAIVRQTVRQAMVRNLAIGAGLVRMHFHDCFVRGCDASVLLDST  96

Query  992   ASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYD  813
               N +EK+SPANNPSLRGFEVID AK+R+ES+C   VSCADIL+FAARD+    GG  Y 
Sbjct  97    PGNPSEKESPANNPSLRGFEVIDEAKSRIESVCPSTVSCADILSFAARDAAYFAGGIKYA  156

Query  812   VPAGRRDGRVSLASEI-PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             VPAGRRDGRVSL SE+  NNLPPP FN  QL   F+ KG T +EMVTLSGAH+ G SHC+
Sbjct  157   VPAGRRDGRVSLESEVLSNNLPPPVFNAVQLEESFARKGLTLDEMVTLSGAHSFGVSHCS  216

Query  635   SFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTNI  456
             SF +R+   N+T  +DP++D ++ A LK +C    S+    V +D  +P   D  YY N+
Sbjct  217   SFADRV---NATGPRDPTMDRRFNAFLKSKCSPAGSDP--TVNLDVVTPKRLDNQYYKNL  271

Query  455   LANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRAN  276
                RGL TSDQTL T   TA  V  NA  P +W   FAAAMVKMG I VLTG+ GEIR  
Sbjct  272   RKGRGLLTSDQTLQTSALTARLVAANAERPRAWAANFAAAMVKMGSIEVLTGDQGEIRRT  331

Query  275   CRVVN  261
             CR VN
Sbjct  332   CRFVN  336



>ref|XP_007035579.1| Cationic peroxidase 2 precursor [Theobroma cacao]
 gb|EOY06505.1| Cationic peroxidase 2 precursor [Theobroma cacao]
Length=362

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 210/304 (69%), Gaps = 4/304 (1%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L++GFY  +C  AE IV   V+ A   D G+ A L+R+HFHDCFVRGCD S+L+DST SN
Sbjct  60    LKIGFYQKTCPSAEAIVMSTVKAALASDPGIPAALIRLHFHDCFVRGCDASILLDSTPSN  119

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              AEKDS   N  ++GF+VID AKA++E+ C   VSC+DILAFAARDSV + GG  Y VP+
Sbjct  120   RAEKDS-MGNKGVQGFQVIDEAKAKIEAQCPNTVSCSDILAFAARDSVTLAGGLHYGVPS  178

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GR DGRVS A+E+  NLP   FNV QL   F+ KG + EEMVTLSGAH+IG SHC+SF+ 
Sbjct  179   GRGDGRVSSAAEVTQNLPDAFFNVTQLKQNFARKGLSMEEMVTLSGAHSIGDSHCSSFSK  238

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQ---GNSNANLVVPMDPFSPAITDVSYYTNIL  453
             RLYSF+ T+ QDPS+DP YA  LK +CP+     +  + +VP DP +P   D +YY N+ 
Sbjct  239   RLYSFDKTSTQDPSMDPSYARLLKAKCPRPLNTRTGPDPLVPFDPVTPNRLDNNYYKNLK  298

Query  452   ANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRANC  273
             +++GL  SDQ L     T   V++N   P +W  KFAAAMV MG I VLTG  GEIR NC
Sbjct  299   SSKGLLASDQVLWNSMLTRKFVKENVNHPSAWAAKFAAAMVHMGSIDVLTGKQGEIRRNC  358

Query  272   RVVN  261
             RVVN
Sbjct  359   RVVN  362



>emb|CDP04200.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 224/334 (67%), Gaps = 6/334 (2%)
 Frame = -1

Query  1253  SEMSSSRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRG  1074
             S   S+ + MLSC   L  +  +  +    L+VGFY+  C  AE IV+  V KA   +  
Sbjct  4     STSKSALLLMLSC---LIFIEFEFSLASPLLKVGFYNKYCPPAEAIVRKAVYKAVASNPR  60

Query  1073  VAAGLVRMHFHDCFVRGCDGSVLIDSTASN-TAEKDSPANNPSLRGFEVIDSAKARLESL  897
              AAGL+RMHFHDCFVRGCDGSVL+D+      AEKDS  NNPSL GFEVID+AKA +E+ 
Sbjct  61    TAAGLIRMHFHDCFVRGCDGSVLLDTAPGGPAAEKDSIVNNPSLHGFEVIDAAKAEIEAT  120

Query  896   CKGVVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTN  717
             C   VSCADI+AFAARDS  + GG  Y VPAGRRDG VSL+ E+  NLP P FNV QL  
Sbjct  121   CPKTVSCADIIAFAARDSALIAGGISYQVPAGRRDGSVSLSDEVIQNLPAPFFNVTQLEE  180

Query  716   LFSNKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQ  537
              F  KG + +EMVTLSGAH+IG +HC+SF+NRLY+F++T  QDP+LDP++AA LK  CP 
Sbjct  181   NFEAKGLSLDEMVTLSGAHSIGVAHCSSFSNRLYNFSATHPQDPALDPEHAAFLKTICPP  240

Query  536   GNSNANLVVP--MDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPI  363
              +S+ +      +D  +P   D  YY N+  +RGL TSDQTLL+ PSTA +V  NA    
Sbjct  241   PSSSGSSNPTANLDVSTPFRLDNKYYVNLKYHRGLLTSDQTLLSSPSTAKQVWYNAVYGS  300

Query  362   SWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
             +W  K+AAAMV MG I VLTG  GEIR NC  VN
Sbjct  301   AWAAKYAAAMVHMGSIDVLTGKVGEIRRNCHFVN  334



>ref|XP_010674605.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=324

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 211/327 (65%), Gaps = 10/327 (3%)
 Frame = -1

Query  1232  IRMLSCYSTLALL-TCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLV  1056
             + +LS +  LA+L T   + L + L+VGFY  +C  AE IV + V KA   + G+ AGL+
Sbjct  4     LAILSFFFFLAILSTISTVSLASNLKVGFYHKTCPSAETIVNNVVNKAISQNPGLGAGLI  63

Query  1055  RMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSC  876
             RMHFHDCFVRGCD S+L+D T  N  EK  PANNPSLRG+EVID  KA LE+ C GVVSC
Sbjct  64    RMHFHDCFVRGCDASILLDPTPGNQVEKQHPANNPSLRGYEVIDDVKAELEAQCPGVVSC  123

Query  875   ADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGF  696
             ADI+ FAARDS    GG  Y+V +GRRDGR+S  ++   N+P PSFN+ QL + F+ K  
Sbjct  124   ADIITFAARDSASKLGGIKYEVQSGRRDGRISNLNDPRGNIPLPSFNLQQLEDSFNRKSL  183

Query  695   TQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQG--NSNA  522
             + EEMV LSGAH+IG SHC+       +FN T  Q P+LDP  A  L+  CP    N+N 
Sbjct  184   SLEEMVVLSGAHSIGVSHCS-------AFNETHPQYPTLDPSLANVLRNTCPNPPFNANN  236

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             +  VP+D  +P   D  YY ++  NRG+  SDQ L+T P+T + VR        W  KFA
Sbjct  237   DPTVPLDFVTPNKLDNRYYQDLQHNRGILNSDQALMTRPTTVHMVRSFGSKGGDWAKKFA  296

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              AMV MG I VLTGN GEIR NCRVVN
Sbjct  297   KAMVHMGSIEVLTGNQGEIRRNCRVVN  323



>ref|XP_011077167.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
 ref|XP_011077168.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
 ref|XP_011069438.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=327

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 209/328 (64%), Gaps = 17/328 (5%)
 Frame = -1

Query  1226  MLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMH  1047
             +LSC+     LT         L+VGFY  SC  AE IV+  V K    +RG+ AGLVR+H
Sbjct  11    ILSCFILFVSLTS---AANPPLKVGFYKYSCPPAEAIVRKYVNKFVSLNRGLGAGLVRLH  67

Query  1046  FHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADI  867
             FHDCFVRGCD SVL+D    NT EK S  N  SLRGFEVID+AKA LE  C G+VSCADI
Sbjct  68    FHDCFVRGCDASVLLD--GPNT-EKQSIPNKGSLRGFEVIDAAKAELELRCPGIVSCADI  124

Query  866   LAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQE  687
             +AFAARDS    G   YDVP+GRRDG VSL +E   NLP P FN   L + F+ KG + +
Sbjct  125   IAFAARDSSCKLGNINYDVPSGRRDGNVSLINEPLLNLPAPFFNATTLRDNFARKGLSLD  184

Query  686   EMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVP  507
             EMVTLSGAH+IG SHC+SF +RLY       QDP+LDP YAA LK  CP   +NA     
Sbjct  185   EMVTLSGAHSIGISHCSSFASRLYP-----TQDPTLDPSYAAFLKTICPPPVANATAAPT  239

Query  506   MDP------FSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKF  345
             +DP       +P   D  YY  + ANRGL TSDQ LL+ P TA +V  NA     W  KF
Sbjct  240   VDPTVNLDSITPTRLDSKYYVGLKANRGLLTSDQVLLSSPMTAKKVVYNAKYGNVWAKKF  299

Query  344   AAAMVKMGQISVLTGNAGEIRANCRVVN  261
             AAAMV+MG I VLTG  GEIR NCRVVN
Sbjct  300   AAAMVRMGNIEVLTGKQGEIRRNCRVVN  327



>ref|XP_004136140.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=339

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 206/306 (67%), Gaps = 6/306 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFYS SC  AE IV+D V KA   + G+AAGL+RMHFHDCFVRGCD SVL++ST  N
Sbjct  35    LRVGFYSSSCPDAETIVEDAVDKAVSRNPGIAAGLIRMHFHDCFVRGCDASVLLESTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +EK   AN P+LRGFEVID AKA++E++C   VSCAD+LAFAARDS    GG  Y VPA
Sbjct  95    PSEKYHVANFPTLRGFEVIDEAKAKIEAVCPNTVSCADVLAFAARDSANKVGGINYAVPA  154

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG +S   E  N LP  +F+  +L + F  +G + EEMVTLSGAH+IG +HC +F  
Sbjct  155   GRRDGFIS-RKEDANALPGFTFHAERLASEFGKRGLSVEEMVTLSGAHSIGIAHCPTFVG  213

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-----LVVPMDPFSPAITDVSYYTN  459
             RLYSFN+T  QDPSLDP YA  LK +CPQ +S+ +       V +D  +P   D  YY  
Sbjct  214   RLYSFNTTHAQDPSLDPSYADYLKSKCPQPSSSGDDGSQQPDVDLDFSTPHRLDNRYYIE  273

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  +RGL  SDQTLL+   T+  V +NA     W  KF  AMVKMG+I VLTG+ GEIR 
Sbjct  274   LKNHRGLLISDQTLLSSSLTSKMVLRNAHHGSKWATKFGKAMVKMGKIDVLTGSKGEIRR  333

Query  278   NCRVVN  261
              C  VN
Sbjct  334   QCSFVN  339



>ref|XP_008649365.1| PREDICTED: peroxidase 5 [Zea mays]
 gb|AFW77214.1| peroxidase [Zea mays]
Length=360

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  12    TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  71

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  72    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAAR  131

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VPAGRRDGR+S  +E  NNLPPP FN  +L + F++K  T E++V LS
Sbjct  132   DSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLS  191

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  192   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  251

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  V MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  252   NTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  311

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  312   RSMIKMGQIEVLTGTQGEIRRNCRVIN  338



>gb|AAS75401.1| peroxidase [Zea mays]
 gb|AAS75404.1| peroxidase [Zea mays]
 gb|AAS75406.1| peroxidase [Zea mays]
 gb|AAS75408.1| peroxidase [Zea mays]
 gb|AAS75409.1| peroxidase [Zea mays]
 gb|AAS75412.1| peroxidase [Zea mays]
 gb|AAS75416.1| peroxidase [Zea mays]
 gb|AAS75417.1| peroxidase [Zea mays]
 gb|AAS75420.1| peroxidase [Zea mays]
 gb|AAS75421.1| peroxidase [Zea mays]
 gb|AAS75424.1| peroxidase [Zea mays]
Length=357

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  9     TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  68

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  69    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAAR  128

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VPAGRRDGR+S  +E  NNLPPP FN  +L + F++K  T E++V LS
Sbjct  129   DSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLS  188

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  189   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  248

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  V MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  249   NTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  308

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  309   RSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>ref|XP_002963661.1| hypothetical protein SELMODRAFT_266691 [Selaginella moellendorffii]
 gb|EFJ35532.1| hypothetical protein SELMODRAFT_266691 [Selaginella moellendorffii]
Length=325

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 219/326 (67%), Gaps = 4/326 (1%)
 Frame = -1

Query  1238  SRIRMLSCYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGL  1059
             +++ +   + T+ +L     V  ++L VGFY   C + E +V+  VQ A     GV AGL
Sbjct  2     AKLWIAVVFGTIGILAS---VASSQLSVGFYEKQCPQVEAVVQSFVQDAITRKPGVGAGL  58

Query  1058  VRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVS  879
             +R+ FHDCFV+GCD SVLIDST +N+AEKD+P N  SLRGFEVID+AKA LE+ C GVVS
Sbjct  59    LRLQFHDCFVQGCDASVLIDSTKNNSAEKDAPPN-ISLRGFEVIDAAKAALETQCPGVVS  117

Query  878   CADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKG  699
             CADI+A+AARDSV   GG  ++VP GRRDG +S   E   +LP P FNV QLT  F+ +G
Sbjct  118   CADIVAYAARDSVFKLGGPFWEVPVGRRDGTISRMKEANASLPAPFFNVAQLTQNFAAQG  177

Query  698   FTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN  519
              +Q++M+ LSGAHTIG +HC +F+ RLY+F++    DP+LDP +A  LK++CP G + A 
Sbjct  178   LSQDDMIVLSGAHTIGIAHCFTFSPRLYNFSANASTDPTLDPNFATALKKQCPPGKAAAF  237

Query  518   LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAA  339
               V +D  +P   D SYY N+   +G+  SDQ L +D +T+  ++ ++    SW  KFAA
Sbjct  238   NSVVLDSHTPIHFDNSYYVNLALQKGVLGSDQVLFSDAATSKAIKTSSVDEESWRAKFAA  297

Query  338   AMVKMGQISVLTGNAGEIRANCRVVN  261
             AM+KMG + V TG  GEIR +CR VN
Sbjct  298   AMIKMGSVKVKTGQQGEIRKSCRAVN  323



>ref|XP_004135967.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=339

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 206/306 (67%), Gaps = 6/306 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFYS SC  AE IV+D V KA   + G+AAGL+RMHFHDCFVRGCD SVL++ST  N
Sbjct  35    LRVGFYSSSCPDAETIVEDAVDKAVSRNPGIAAGLIRMHFHDCFVRGCDASVLLESTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +EK   AN P+LRGFEVID AKA++E++C   VSCAD+LAFAARDS    GG  Y VPA
Sbjct  95    PSEKYHVANFPTLRGFEVIDEAKAKIEAVCPNTVSCADVLAFAARDSANKVGGINYAVPA  154

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG +S   E  N LP  +F+  +L + F  +G + EEMVTLSGAH+IG +HC +F  
Sbjct  155   GRRDGFIS-RKEDANALPGFTFHAERLASEFGKRGLSVEEMVTLSGAHSIGIAHCPTFVG  213

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-----LVVPMDPFSPAITDVSYYTN  459
             RLYSFN+T  QDPSLDP YA  LK +CPQ +S+ +       V +D  +P   D  YY  
Sbjct  214   RLYSFNTTHAQDPSLDPSYADYLKSKCPQPSSSGDDGSQQPDVDLDFSTPHRLDNRYYIE  273

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  +RGL  SDQTLL+   T+  V +NA     W  KF  AMVKMG+I VLTG+ GEIR 
Sbjct  274   LKNHRGLLISDQTLLSSSLTSKMVLRNAHYGSKWATKFGKAMVKMGKIDVLTGSKGEIRR  333

Query  278   NCRVVN  261
              C  VN
Sbjct  334   QCSFVN  339



>gb|AAS75393.1| peroxidase [Zea mays]
 gb|AAS75407.1| peroxidase [Zea mays]
 gb|AAS75414.1| peroxidase [Zea mays]
 gb|AAS75415.1| peroxidase [Zea mays]
Length=357

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  9     TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  68

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  69    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKAALEAQCPGVVSCADVLAFAAR  128

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VPAGRRDGR+S  +E  NNLPPP FN  +L + F++K  T E++V LS
Sbjct  129   DSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLS  188

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  189   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  248

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  V MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  249   NTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  308

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  309   RSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>emb|CDM82175.1| unnamed protein product [Triticum aestivum]
 emb|CDM82278.1| unnamed protein product [Triticum aestivum]
Length=352

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 205/306 (67%), Gaps = 3/306 (1%)
 Frame = -1

Query  1178  VLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLID  999
             V + +LQVGFY+ SC  AE +V+  V  AF  D G+AAGL+R+HFHDCFVRGCD SVL+ 
Sbjct  20    VARGQLQVGFYNTSCPNAESLVQQAVASAFANDSGIAAGLIRLHFHDCFVRGCDASVLLV  79

Query  998   STASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFG  819
             S A+ TAE+D+  N PSLRGFEVID+AKA +E  C   VSCADI+AFAARDS+ +TG   
Sbjct  80    S-ANGTAERDAAPNKPSLRGFEVIDAAKAAVEKSCARTVSCADIVAFAARDSINLTGQAA  138

Query  818   YDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHC  639
             Y VP+GRRDG  SL  +  NNLPPP+F   QL + F+NK  T EEMV LSGAHT+GRS C
Sbjct  139   YQVPSGRRDGNFSLDQDALNNLPPPTFTAQQLVDRFANKTLTAEEMVILSGAHTVGRSFC  198

Query  638   TSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANLVVPMDPFSPAITDVSYYTN  459
             +SF  R+++ N+T   D  L P YAA L+  CP  + NA     +DP +PA+ D +YY  
Sbjct  199   SSFLARIWN-NTTATVDTGLSPAYAALLQALCP-SSPNAATTTAVDPTTPAVLDNNYYKL  256

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  N GLF SD  L T+ +    V   A +   W  KF AAMVKMG I VLTG  GEIR 
Sbjct  257   LSLNLGLFFSDNQLRTNATLNTSVNSFAANETLWKQKFVAAMVKMGNIEVLTGTQGEIRL  316

Query  278   NCRVVN  261
             NC VVN
Sbjct  317   NCSVVN  322



>ref|XP_004158168.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
 gb|KGN45060.1| hypothetical protein Csa_7G419560 [Cucumis sativus]
Length=339

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 206/306 (67%), Gaps = 6/306 (2%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTASN  984
             L+VGFYS SC  AE IV+D V KA   + G+AAGL+RMHFHDCFVRGCD SVL++ST  N
Sbjct  35    LRVGFYSSSCPDAEAIVEDAVDKAVSRNPGIAAGLIRMHFHDCFVRGCDASVLLESTPGN  94

Query  983   TAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDVPA  804
              +EK   AN P+LRGFEVID AKA++E++C   VSCAD+LAFAARDS    GG  Y VPA
Sbjct  95    PSEKYHVANFPTLRGFEVIDEAKAKIEAVCPNTVSCADVLAFAARDSANKVGGINYAVPA  154

Query  803   GRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCTSFNN  624
             GRRDG +S   E  N LP  +F+  +L + F  +G + EEMVTLSGAH+IG +HC +F  
Sbjct  155   GRRDGFIS-RKEDANALPGFTFHAERLASEFGKRGLSVEEMVTLSGAHSIGIAHCPTFVG  213

Query  623   RLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNAN-----LVVPMDPFSPAITDVSYYTN  459
             RLYSFN+T  QDPSLDP YA  LK +CPQ +S+ +       V +D  +P   D  YY  
Sbjct  214   RLYSFNTTHAQDPSLDPSYADYLKSKCPQPSSSGDDGSQQPDVDLDFSTPHRLDNRYYIE  273

Query  458   ILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGEIRA  279
             +  +RGL  SDQTLL+   T+  V +NA     W  KF  AMVKMG+I VLTG+ GEIR 
Sbjct  274   LKNHRGLLISDQTLLSSSLTSKMVLRNAHYGSKWATKFGKAMVKMGKIDVLTGSKGEIRR  333

Query  278   NCRVVN  261
              C  VN
Sbjct  334   QCSFVN  339



>gb|AAS75400.1| peroxidase [Zea mays]
 gb|AAS75402.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  9     TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  68

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  69    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAAR  128

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VPAGRRDGR+S  +E  NNLPPP FN  +L + F++K  T E++V LS
Sbjct  129   DSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLS  188

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  189   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  248

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  + MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  249   NTTLFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  308

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  309   RSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>gb|AAS75394.1| peroxidase [Zea mays]
 gb|AAS75396.1| peroxidase [Zea mays]
 gb|AAS75410.1| peroxidase [Zea mays]
 gb|AAS75413.1| peroxidase [Zea mays]
 gb|AAS75419.1| peroxidase [Zea mays]
 gb|AAS75422.1| peroxidase [Zea mays]
 gb|AAS75423.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (833),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  9     TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  68

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  69    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAAR  128

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VPAGRRDGR+S  +E  NNLPPP FN  +L + F++K  + E++V LS
Sbjct  129   DSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLSIEDLVVLS  188

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  189   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  248

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  V MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  249   NTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  308

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  309   RSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>gb|AAS75395.1| peroxidase [Zea mays]
 gb|AAS75397.1| peroxidase [Zea mays]
 gb|AAS75398.1| peroxidase [Zea mays]
 gb|AAS75399.1| peroxidase [Zea mays]
 gb|AAS75403.1| peroxidase [Zea mays]
 gb|AAS75405.1| peroxidase [Zea mays]
 gb|AAS75411.1| peroxidase [Zea mays]
 gb|AAS75418.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 210/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  9     TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  68

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  69    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKAALEAQCPGVVSCADVLAFAAR  128

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VPAGRRDGR+S  +E  NNLPPP FN  +L + F++K  + E++V LS
Sbjct  129   DSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLSIEDLVVLS  188

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  189   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  248

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  V MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  249   NTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  308

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  309   RSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>ref|NP_001136740.1| uncharacterized protein LOC100216881 precursor [Zea mays]
 gb|ACF82515.1| unknown [Zea mays]
 gb|AFW72903.1| hypothetical protein ZEAMMB73_932177 [Zea mays]
Length=337

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 205/309 (66%), Gaps = 8/309 (3%)
 Frame = -1

Query  1163  LQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDST--A  990
             LQVGFY  SC +AE IV++ V++A   D G+AAGL+RMHFHDCFVRGCD S+L+DS    
Sbjct  27    LQVGFYEHSCPQAEDIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDASILLDSAPGQ  86

Query  989   SNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARDSVEMTGGFGYDV  810
              +  EK SPAN  SLRGFEVID AKA +E  C   VSCADI+AFAARD   + GG  Y V
Sbjct  87    QHDTEKYSPANFQSLRGFEVIDEAKAVVEEHCPRTVSCADIVAFAARDGAYLAGGIDYRV  146

Query  809   PAGRRDGRVSLASEI--PNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAHTIGRSHCT  636
             PAGRRDGRVS+  E+    NLP P F V +L   F  KG + ++MVTLSGAH+IGRSHC+
Sbjct  147   PAGRRDGRVSVKDEVLEDGNLPFPEFTVAELIENFRRKGLSADDMVTLSGAHSIGRSHCS  206

Query  635   SFNNRLYSFNSTTVQ-DPSLDPQYAAQLKQRCP---QGNSNANLVVPMDPFSPAITDVSY  468
             S  +RLYSF     + DP+L P YAA LK+RCP    G+      VP+D  +P   D  Y
Sbjct  207   SITDRLYSFQGEPGRTDPALHPAYAADLKRRCPPSTDGDMEDRTTVPLDTVTPNAFDNQY  266

Query  467   YTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISVLTGNAGE  288
             + N+L ++  FTSDQTLL  P TA  V  +A    +W  KFA AMVKMG I VLTG  GE
Sbjct  267   FKNVLEHKVPFTSDQTLLDSPWTAGLVAFHAAVGQAWEAKFAKAMVKMGAIEVLTGYEGE  326

Query  287   IRANCRVVN  261
             IR  C +VN
Sbjct  327   IRQKCSMVN  335



>emb|CAC21393.1| peroxidase [Zea mays]
Length=357

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 209/327 (64%), Gaps = 11/327 (3%)
 Frame = -1

Query  1208  TLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFV  1029
             T  L T  L    A L VGFY  +C  AE IV+  V  AF  + GVA  L+RMHFHDCFV
Sbjct  9     TTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHDCFV  68

Query  1028  RGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAAR  849
             RGCDGSVLID+  + TAEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAAR
Sbjct  69    RGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAFAAR  128

Query  848   DSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLS  669
             DSV ++GG GY VP GRRDGR+S  +E  NNLPPP FN  +L + F++K  T E++V LS
Sbjct  129   DSVVLSGGLGYQVPGGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLVVLS  188

Query  668   GAHTIGRSHCTSFN---------NRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN--A  522
             GAHTIG SHC+ F          +RLY+F+S    DP+L   YA  LK  CP   S    
Sbjct  189   GAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQFFP  248

Query  521   NLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFA  342
             N  V MD  +P   D  YY  +  N GLF SD  LLT+ +    V     S  ++  KFA
Sbjct  249   NTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFA  308

Query  341   AAMVKMGQISVLTGNAGEIRANCRVVN  261
              +M+KMGQI VLTG  GEIR NCRV+N
Sbjct  309   RSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>ref|XP_004167191.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Cucumis sativus]
Length=338

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 213/335 (64%), Gaps = 8/335 (2%)
 Frame = -1

Query  1244  SSSRIRMLSCYST-LALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVA  1068
             SS +  +LS  ST +  L        A L+VGFY  SC  AE IVK  V KA   + G A
Sbjct  5     SSQKFNILSKLSTVIFFLYLSTFASAATLKVGFYRSSCPNAEAIVKKVVNKAISLNPGAA  64

Query  1067  AGLVRMHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKG  888
             AGL+R+HFHDCF+RGC+GSVL+ ST  +  E+D P+N PSL+GFE+ID AKA LES C  
Sbjct  65    AGLIRLHFHDCFIRGCEGSVLLKSTPGHPTERDHPSNFPSLQGFEIIDEAKAYLESACPN  124

Query  887   VVSCADILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFS  708
              VSCADILAFAARDS    GG  Y VPAGRRDGR+S+  E  + LP P+FN+ QLT  F+
Sbjct  125   TVSCADILAFAARDSARKVGGINYAVPAGRRDGRISIKEE-ASRLPSPTFNIEQLTQNFA  183

Query  707   NKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNS  528
              +G +++ MVTLSGAH+IG + C +F+NRLYSFN+T  QDPS++P+YA  L+ + P   S
Sbjct  184   ERGLSKQYMVTLSGAHSIGAARCLTFSNRLYSFNATHNQDPSMNPKYAVLLEDQMPPLTS  243

Query  527   NAN------LVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSP  366
             N        L   +D  +P   D  YY  +  ++GL +SDQ LL+ PST+      A   
Sbjct  244   NVGGQNAQPLEAALDFTTPNRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYG  303

Query  365   ISWGLKFAAAMVKMGQISVLTGNAGEIRANCRVVN  261
               W   F  +MVKMG I VLTG+ GEIR  C  VN
Sbjct  304   SIWASNFKKSMVKMGSIGVLTGSQGEIRRQCSFVN  338



>ref|XP_002455568.1| hypothetical protein SORBIDRAFT_03g013220 [Sorghum bicolor]
 gb|EES00688.1| hypothetical protein SORBIDRAFT_03g013220 [Sorghum bicolor]
Length=371

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 208/317 (66%), Gaps = 11/317 (3%)
 Frame = -1

Query  1175  LKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHDCFVRGCDGSVLIDS  996
             + A L+VGFY+ SC  AE +V+  V  AF  D G+AAGL+R+HFHDCFVRGCDGSVLIDS
Sbjct  26    IAAGLKVGFYNKSCPSAEALVQQAVAAAFKNDSGIAAGLIRLHFHDCFVRGCDGSVLIDS  85

Query  995   TASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAFAARD--------SV  840
             TA+NTAEKD+P NNPSLRGFEVID+AKA +E+ C   VSCADILAFAARD        + 
Sbjct  86    TANNTAEKDAPPNNPSLRGFEVIDAAKAAIEAQCPKTVSCADILAFAARDSVALSSSSAS  145

Query  839   EMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMVTLSGAH  660
                    Y VPAGRRDGRVS  ++  +NLP P     +L   F+ K  T E+MV LSGAH
Sbjct  146   GSGKNLTYKVPAGRRDGRVSRDTDANSNLPSPLSTAAELVGNFTRKNLTAEDMVVLSGAH  205

Query  659   TIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN---ANLVVPMDPFSP  489
             T+GRSHC+SF NRLY F++ +  DP++   YA  L+  CP   +     N    MD  +P
Sbjct  206   TVGRSHCSSFTNRLYGFSNGSDVDPAISSAYAFLLRSICPSNTTRFFPPNTTTDMDLITP  265

Query  488   AITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAAMVKMGQISV  309
             A+ D  YY  +  N GLFTSDQ LLT+ +    V +   S   W  KFA +MVKMG I V
Sbjct  266   AVLDNKYYVGLTNNLGLFTSDQALLTNATLKKSVDEFVKSDSKWKSKFAKSMVKMGNIEV  325

Query  308   LTGNAGEIRANCRVVNS  258
             LTG  GEIR +CRV+N+
Sbjct  326   LTGTQGEIRLSCRVINN  342



>ref|XP_008647554.1| PREDICTED: uncharacterized protein LOC100273479 isoform X1 [Zea 
mays]
 gb|AFW77217.1| hypothetical protein ZEAMMB73_709802 [Zea mays]
Length=343

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 212/325 (65%), Gaps = 17/325 (5%)
 Frame = -1

Query  1217  CYSTLALLTCQLIVLKAELQVGFYSGSCGRAELIVKDEVQKAFVCDRGVAAGLVRMHFHD  1038
             C   +A L   L+ + A L+ GFY+ +C  AE IV+  V  AF  + GVA  L+RMHFHD
Sbjct  5     CCLVVATLLAALLSVSASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRMHFHD  64

Query  1037  CFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCADILAF  858
             CFVRGCDGSVLIDSTA+N AEKDS  N+PSLR F+V+D AKA LE+ C GVVSCADILAF
Sbjct  65    CFVRGCDGSVLIDSTANNKAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCADILAF  124

Query  857   AARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFTQEEMV  678
             AARDSV +TGG GY VP+GRRDGR+S A++  N LPPP FN  QL + F++K  + E+MV
Sbjct  125   AARDSVVLTGGLGYKVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSLEDMV  184

Query  677   TLSGAHTIGRSHCTSF------NNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSNANL  516
              LSGAHTIG SHC+SF       +RLY+F+ ++  D S+ P  + +            N 
Sbjct  185   VLSGAHTIGVSHCSSFAGINNTGDRLYNFSGSS--DGSICPSNSGRFFP---------NT  233

Query  515   VVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKFAAA  336
                MD  +PA  D  YY  +  N GLF SD  LLT+ +    V     S  +W  KFA +
Sbjct  234   TTFMDLITPAKFDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRSEATWKTKFAKS  293

Query  335   MVKMGQISVLTGNAGEIRANCRVVN  261
             M+KMGQI VLTG  GEIR NCRV+N
Sbjct  294   MLKMGQIEVLTGTQGEIRRNCRVIN  318



>gb|KDP37025.1| hypothetical protein JCGZ_06081 [Jatropha curcas]
Length=268

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 192/269 (71%), Gaps = 6/269 (2%)
 Frame = -1

Query  1052  MHFHDCFVRGCDGSVLIDSTASNTAEKDSPANNPSLRGFEVIDSAKARLESLCKGVVSCA  873
             MHFHD F+RGCDGSVL++ST  N +E++  ANNPSLRGFEVI+ AKA++E++C   VSCA
Sbjct  1     MHFHDFFIRGCDGSVLLESTPGNPSEREHVANNPSLRGFEVINEAKAQIEAICPQTVSCA  60

Query  872   DILAFAARDSVEMTGGFGYDVPAGRRDGRVSLASEIPNNLPPPSFNVPQLTNLFSNKGFT  693
             DILAFAARDS +  GG  Y VPAGRRDGR+S  +E+  NLPPP F V QL+  F  KG +
Sbjct  61    DILAFAARDSSKKLGGRNYAVPAGRRDGRISKINEVEQNLPPPFFKVEQLSQNFGRKGMS  120

Query  692   QEEMVTLSGAHTIGRSHCTSFNNRLYSFNSTTVQDPSLDPQYAAQLKQRCPQGNSN----  525
              +EMVTLSGAH+IG SHC+SF+NRLYSFNST  QDPS+D  YAA LK RCP  N+N    
Sbjct  121   VDEMVTLSGAHSIGTSHCSSFSNRLYSFNSTHAQDPSMDSAYAAFLKTRCPPSNNNGAST  180

Query  524   ANLVVPMDPFSPAITDVSYYTNILANRGLFTSDQTLLTDPSTANEVRQNAGSPISWGLKF  345
             ++  V +DP +P   D  YY  +  NRGL TSDQTL+  PST N V  NA +   W +KF
Sbjct  181   SDPTVALDP-TPNRMDNRYYMELKKNRGLLTSDQTLMNSPSTQNMVANNAINSGVWAVKF  239

Query  344   AAAMVKMGQISVLTGNA-GEIRANCRVVN  261
             A AMV MG + VLTG   GEIR  C VVN
Sbjct  240   AKAMVHMGSLDVLTGGTQGEIRKQCSVVN  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3368954703288