BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21064_g1_i2 len=2218 path=[1982:0-1546 3529:1547-1562
3545:1563-1606 6295:1607-1621 6310:1622-1739 6428:1740-1748
6437:1749-2217]

Length=2218
                                                                      Score     E

ref|XP_010045225.1|  PREDICTED: peroxidase 5-like                       505   1e-170   
ref|XP_009605400.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    503   1e-169   
ref|XP_008234631.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    502   3e-169   
ref|XP_004307916.1|  PREDICTED: peroxidase 5-like                       497   2e-167   
ref|XP_009769971.1|  PREDICTED: peroxidase 5-like                       497   2e-167   
ref|XP_006347525.1|  PREDICTED: peroxidase 5-like                       494   2e-166   
ref|XP_010048379.1|  PREDICTED: peroxidase 5-like                       493   4e-166   
ref|XP_009361266.1|  PREDICTED: peroxidase 5-like                       493   5e-166   
ref|XP_006470493.1|  PREDICTED: peroxidase 5-like                       493   6e-166   
ref|XP_003634164.2|  PREDICTED: peroxidase 5                            494   9e-166   
gb|KDO66295.1|  hypothetical protein CISIN_1g041695mg                   490   4e-165   
ref|XP_011075883.1|  PREDICTED: peroxidase 5-like                       491   5e-165   
sp|A7QEU4.2|PER5_VITVI  RecName: Full=Peroxidase 5; Flags: Precursor    490   1e-164   Vitis vinifera
ref|XP_007039219.1|  Peroxidase 5                                       489   2e-164   
gb|KDP30908.1|  hypothetical protein JCGZ_15520                         489   3e-164   
ref|XP_006374082.1|  hypothetical protein POPTR_0015s00590g             486   6e-163   
gb|AHL39183.1|  class III peroxidase                                    485   1e-162   
ref|XP_011003280.1|  PREDICTED: peroxidase 5-like                       483   7e-162   
ref|XP_004235031.1|  PREDICTED: peroxidase 5                            481   2e-161   
gb|EYU45326.1|  hypothetical protein MIMGU_mgv1a009971mg                479   2e-160   
ref|XP_008377046.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    478   7e-160   
gb|KHG13653.1|  Peroxidase 5                                            477   2e-159   
ref|XP_007136358.1|  hypothetical protein PHAVU_009G038500g             468   4e-156   
dbj|BAA77387.1|  peroxidase 1                                           465   4e-155   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010103062.1|  Peroxidase 5                                       465   1e-154   
ref|XP_004502775.1|  PREDICTED: peroxidase 5-like                       463   4e-154   
ref|XP_003602405.1|  Peroxidase                                         463   4e-154   
emb|CDP12791.1|  unnamed protein product                                475   8e-154   
gb|KHN19575.1|  Peroxidase 5                                            461   3e-153   
gb|AHL39182.1|  class III peroxidase                                    461   3e-153   
ref|XP_002321949.2|  hypothetical protein POPTR_0015s00580g             460   5e-153   Populus trichocarpa [western balsam poplar]
ref|XP_011003281.1|  PREDICTED: peroxidase 5-like                       459   2e-152   
ref|NP_001241968.1|  uncharacterized protein LOC100779031 precursor     459   2e-152   
ref|XP_011043754.1|  PREDICTED: peroxidase 5-like                       457   8e-152   
ref|XP_010671317.1|  PREDICTED: peroxidase 5-like                       454   1e-150   
gb|AFK42142.1|  unknown                                                 450   5e-149   
ref|XP_011043751.1|  PREDICTED: peroxidase 5-like                       446   2e-147   
ref|XP_010919027.1|  PREDICTED: peroxidase 5-like                       443   3e-146   
ref|XP_010919026.1|  PREDICTED: peroxidase 5-like                       442   4e-146   
ref|XP_006446429.1|  hypothetical protein CICLE_v10017508mg             442   1e-145   
gb|AAF63024.1|AF244921_1  peroxidase prx12 precursor                    441   2e-145   Spinacia oleracea
ref|XP_010671316.1|  PREDICTED: peroxidase 5-like                       438   2e-144   
ref|XP_010671321.1|  PREDICTED: peroxidase 5-like                       435   2e-143   
ref|XP_008808268.1|  PREDICTED: peroxidase 5-like                       434   6e-143   
ref|XP_008808296.1|  PREDICTED: peroxidase 5-like                       431   6e-142   
ref|XP_003602406.1|  Peroxidase                                         430   2e-141   
ref|XP_006846424.1|  hypothetical protein AMTR_s00018p00028320          428   1e-140   
ref|XP_009400935.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    429   1e-140   
gb|AHL39170.1|  class III peroxidase                                    422   2e-138   
gb|EPS60748.1|  hypothetical protein M569_14053                         415   1e-135   
ref|XP_008808270.1|  PREDICTED: peroxidase 5-like                       412   2e-134   
ref|XP_008808267.1|  PREDICTED: peroxidase 5-like                       408   7e-133   
ref|XP_006650985.1|  PREDICTED: peroxidase 5-like                       397   2e-128   
ref|XP_004985933.1|  PREDICTED: peroxidase 5-like                       396   2e-128   
gb|EPS67213.1|  hypothetical protein M569_07559                         412   3e-128   
emb|CBI23099.3|  unnamed protein product                                405   3e-128   
ref|XP_002317837.2|  hypothetical protein POPTR_0012s00700g             391   4e-127   Populus trichocarpa [western balsam poplar]
ref|XP_010671314.1|  PREDICTED: peroxidase 5-like                       392   8e-127   
gb|AAM52320.1|AC105363_9  Putative peroxidase                           387   9e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662005.1|  PREDICTED: peroxidase 5-like                       387   2e-124   
gb|AAM52317.1|AC105363_6  Putative peroxidase                           377   3e-121   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74412.1|  hypothetical protein OsI_09774                          377   4e-121   Oryza sativa Indica Group [Indian rice]
ref|NP_001048793.1|  Os03g0121200                                       377   1e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985934.1|  PREDICTED: peroxidase 5-like                       376   2e-120   
ref|XP_006840300.1|  hypothetical protein AMTR_s00045p00066730          377   3e-120   
ref|XP_006840299.1|  hypothetical protein AMTR_s00045p00065690          375   1e-119   
gb|ABS44862.1|  putative peroxidase                                     374   2e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008246297.1|  PREDICTED: peroxidase 5-like                       374   2e-119   
ref|XP_006840292.1|  hypothetical protein AMTR_s00045p00063130          372   9e-119   
gb|EAY79346.1|  hypothetical protein OsI_34475                          372   1e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_004304932.1|  PREDICTED: peroxidase 5-like                       371   1e-118   
emb|CAN68183.1|  hypothetical protein VITISV_028562                     370   4e-118   Vitis vinifera
ref|XP_010659811.1|  PREDICTED: peroxidase 5-like                       370   5e-118   
gb|KCW44165.1|  hypothetical protein EUGRSUZ_L02416                     368   1e-117   
ref|XP_010671315.1|  PREDICTED: peroxidase 5-like                       369   1e-117   
ref|XP_010032734.1|  PREDICTED: peroxidase 5-like                       369   1e-117   
ref|XP_010041692.1|  PREDICTED: peroxidase 5-like                       368   2e-117   
ref|XP_010032732.1|  PREDICTED: peroxidase 5-like                       368   3e-117   
ref|XP_010659743.1|  PREDICTED: peroxidase 5-like                       367   4e-117   
ref|XP_002530462.1|  Cationic peroxidase 1 precursor, putative          367   5e-117   Ricinus communis
ref|XP_010921348.1|  PREDICTED: peroxidase 5-like                       366   1e-116   
ref|XP_002467585.1|  hypothetical protein SORBIDRAFT_01g030530          366   1e-116   Sorghum bicolor [broomcorn]
gb|KCW52190.1|  hypothetical protein EUGRSUZ_J01619                     365   2e-116   
ref|XP_010032733.1|  PREDICTED: peroxidase 5-like                       366   2e-116   
ref|XP_010911662.1|  PREDICTED: peroxidase 5-like                       365   4e-116   
gb|KCW52189.1|  hypothetical protein EUGRSUZ_J01618                     364   6e-116   
ref|XP_002450360.1|  hypothetical protein SORBIDRAFT_05g004180          364   1e-115   Sorghum bicolor [broomcorn]
ref|XP_009629163.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    364   2e-115   
gb|ACN25837.1|  unknown                                                 363   2e-115   Zea mays [maize]
emb|CBI39654.3|  unnamed protein product                                365   2e-115   
ref|XP_008662930.1|  PREDICTED: peroxidase 5-like                       363   2e-115   
ref|NP_001065172.1|  Os10g0536700                                       363   3e-115   Oryza sativa Japonica Group [Japonica rice]
gb|KCW52187.1|  hypothetical protein EUGRSUZ_J01616                     362   3e-115   
ref|XP_010040180.1|  PREDICTED: peroxidase 5-like                       363   4e-115   
gb|KDP37026.1|  hypothetical protein JCGZ_06082                         362   5e-115   
ref|XP_004983811.1|  PREDICTED: peroxidase 5-like                       362   6e-115   
ref|XP_009768802.1|  PREDICTED: peroxidase 5-like                       362   7e-115   
ref|XP_010921347.1|  PREDICTED: peroxidase 5-like                       361   9e-115   
ref|XP_006654965.1|  PREDICTED: peroxidase 5-like                       362   9e-115   
ref|XP_002465968.1|  hypothetical protein SORBIDRAFT_01g049140          362   1e-114   Sorghum bicolor [broomcorn]
ref|XP_010921346.1|  PREDICTED: peroxidase 5-like                       361   1e-114   
ref|XP_004960409.1|  PREDICTED: peroxidase 5-like                       361   1e-114   
gb|EMT13671.1|  Peroxidase 5                                            361   2e-114   
gb|EMS60334.1|  Peroxidase 5                                            361   3e-114   
gb|KCW45421.1|  hypothetical protein EUGRSUZ_L00890                     359   4e-114   
dbj|BAK03531.1|  predicted protein                                      360   4e-114   
ref|NP_001048794.1|  Os03g0121300                                       359   5e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011092685.1|  PREDICTED: peroxidase 5-like                       360   6e-114   
ref|XP_004960411.1|  PREDICTED: peroxidase 5-like                       360   6e-114   
ref|XP_007153060.1|  hypothetical protein PHAVU_003G003200g             359   7e-114   
ref|XP_008781200.1|  PREDICTED: peroxidase 5-like                       359   8e-114   
ref|XP_011077203.1|  PREDICTED: peroxidase 5-like                       364   8e-114   
ref|XP_010270944.1|  PREDICTED: peroxidase 5-like                       359   1e-113   
ref|XP_007031236.1|  Class III peroxidase 70                            358   1e-113   
ref|XP_010034487.1|  PREDICTED: peroxidase 5-like                       358   1e-113   
ref|XP_008673305.1|  PREDICTED: hypothetical protein isoform X1         358   1e-113   
dbj|BAJ95224.1|  predicted protein                                      359   1e-113   
gb|KDP34818.1|  hypothetical protein JCGZ_11180                         358   2e-113   
ref|XP_008781197.1|  PREDICTED: peroxidase 5-like                       358   3e-113   
ref|XP_010026045.1|  PREDICTED: peroxidase 5-like                       358   3e-113   
ref|XP_003568991.1|  PREDICTED: peroxidase 5-like                       358   3e-113   
ref|XP_011077202.1|  PREDICTED: peroxidase 5-like                       361   4e-113   
ref|XP_010069737.1|  PREDICTED: peroxidase 5-like                       357   4e-113   
ref|XP_009411413.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    357   4e-113   
ref|XP_006649294.1|  PREDICTED: peroxidase 5-like                       357   5e-113   
gb|KCW52188.1|  hypothetical protein EUGRSUZ_J01617                     357   5e-113   
ref|XP_008461392.1|  PREDICTED: peroxidase 5-like                       357   5e-113   
gb|EMT10333.1|  Peroxidase 5                                            357   9e-113   
ref|XP_010032731.1|  PREDICTED: peroxidase 5-like                       356   1e-112   
ref|NP_001141025.1|  uncharacterized protein LOC100273104 precursor     356   1e-112   Zea mays [maize]
ref|XP_010234947.1|  PREDICTED: peroxidase 5-like                       354   2e-112   
gb|KCW58170.1|  hypothetical protein EUGRSUZ_H00887                     355   6e-112   
gb|KDP37024.1|  hypothetical protein JCGZ_06080                         353   9e-112   
ref|XP_007207711.1|  hypothetical protein PRUPE_ppa025326mg             353   1e-111   
ref|XP_010938174.1|  PREDICTED: peroxidase 5-like                       353   1e-111   
ref|XP_007145114.1|  hypothetical protein PHAVU_007G211100g             353   1e-111   
ref|XP_007161518.1|  hypothetical protein PHAVU_001G076000g             353   1e-111   
gb|AFW57508.1|  peroxidase 1                                            353   1e-111   
gb|KCW52185.1|  hypothetical protein EUGRSUZ_J01614                     352   2e-111   
ref|XP_004136139.1|  PREDICTED: peroxidase 5-like                       353   2e-111   
ref|XP_004251979.1|  PREDICTED: peroxidase 5-like                       353   3e-111   
ref|XP_010941488.1|  PREDICTED: peroxidase 5-like                       352   3e-111   
ref|XP_002440543.1|  hypothetical protein SORBIDRAFT_09g002810          352   4e-111   Sorghum bicolor [broomcorn]
ref|XP_009799014.1|  PREDICTED: peroxidase 5-like                       352   4e-111   
ref|XP_003558949.1|  PREDICTED: peroxidase 5-like                       352   4e-111   
ref|XP_007051236.1|  Class III peroxidase 70                            352   7e-111   
ref|XP_002530464.1|  Peroxidase 3 precursor, putative                   351   7e-111   Ricinus communis
ref|XP_004968663.1|  PREDICTED: peroxidase 1-like                       352   9e-111   
ref|NP_001148340.1|  peroxidase 1 precursor                             351   1e-110   Zea mays [maize]
gb|KDP27791.1|  hypothetical protein JCGZ_18871                         349   5e-110   
tpe|CAH69312.1|  TPA: class III peroxidase 70 precursor                 349   5e-110   
ref|XP_002439234.1|  hypothetical protein SORBIDRAFT_09g002830          349   7e-110   Sorghum bicolor [broomcorn]
gb|KHN29593.1|  Peroxidase 5                                            348   9e-110   
ref|XP_002516915.1|  Cationic peroxidase 2 precursor, putative          348   9e-110   Ricinus communis
ref|XP_009598825.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    348   1e-109   
ref|XP_004953531.1|  PREDICTED: peroxidase 5-like                       348   1e-109   
gb|ACU20445.1|  unknown                                                 348   1e-109   Glycine max [soybeans]
gb|KHN00317.1|  Peroxidase 5                                            348   1e-109   
ref|XP_003534685.2|  PREDICTED: peroxidase 5-like                       348   1e-109   
ref|XP_004495876.1|  PREDICTED: peroxidase 5-like                       348   2e-109   
ref|XP_003535856.1|  PREDICTED: peroxidase 5-like                       348   2e-109   
ref|XP_009365500.1|  PREDICTED: peroxidase 5-like                       348   2e-109   
ref|XP_009401741.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    347   2e-109   
ref|XP_003589739.1|  Peroxidase                                         347   2e-109   
ref|XP_009335532.1|  PREDICTED: peroxidase 5-like                       346   4e-109   
gb|KHN30703.1|  Peroxidase 5                                            347   5e-109   
ref|XP_010093296.1|  Peroxidase 5                                       346   5e-109   
gb|KCW58173.1|  hypothetical protein EUGRSUZ_H00890                     346   5e-109   
ref|XP_003568990.1|  PREDICTED: peroxidase 5-like                       347   5e-109   
ref|XP_004231304.1|  PREDICTED: peroxidase 5-like                       346   8e-109   
ref|XP_010069739.1|  PREDICTED: peroxidase 5-like                       346   9e-109   
ref|XP_008388923.1|  PREDICTED: peroxidase 5-like                       346   9e-109   
ref|XP_003536264.1|  PREDICTED: peroxidase 5-like                       346   9e-109   
gb|KCW52186.1|  hypothetical protein EUGRSUZ_J01615                     344   2e-108   
emb|CBI39655.3|  unnamed protein product                                362   2e-108   
ref|XP_010069738.1|  PREDICTED: peroxidase 5-like                       345   2e-108   
gb|EEE58234.1|  hypothetical protein OsJ_09210                          342   3e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440652.1|  hypothetical protein SORBIDRAFT_09g004650          345   3e-108   Sorghum bicolor [broomcorn]
ref|XP_010024692.1|  PREDICTED: peroxidase 5-like                       343   9e-108   
ref|XP_006358573.1|  PREDICTED: peroxidase 5-like                       342   2e-107   
ref|XP_006353128.1|  PREDICTED: peroxidase 5-like                       343   2e-107   
ref|XP_003591332.1|  Peroxidase                                         343   2e-107   
ref|XP_010906352.1|  PREDICTED: peroxidase 5-like                       342   2e-107   
ref|XP_004135971.1|  PREDICTED: peroxidase 5-like                       343   2e-107   
ref|XP_008776272.1|  PREDICTED: peroxidase 5-like                       343   2e-107   
ref|XP_007153059.1|  hypothetical protein PHAVU_003G003100g             342   3e-107   
ref|XP_003533700.1|  PREDICTED: peroxidase 5-like                       342   3e-107   
ref|XP_010024694.1|  PREDICTED: peroxidase 5-like                       341   4e-107   
pdb|3HDL|A  Chain A, Crystal Structure Of Highly Glycosylated Per...    340   5e-107   
gb|KCW61137.1|  hypothetical protein EUGRSUZ_H03910                     340   9e-107   
ref|XP_003555769.1|  PREDICTED: peroxidase 5-like                       341   1e-106   
gb|KCW58172.1|  hypothetical protein EUGRSUZ_H00889                     340   1e-106   
ref|XP_006574525.1|  PREDICTED: peroxidase 5-like                       340   1e-106   
ref|XP_002978679.1|  hypothetical protein SELMODRAFT_177154             340   2e-106   
ref|XP_002272800.1|  PREDICTED: peroxidase 5                            340   2e-106   Vitis vinifera
ref|XP_009382469.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    340   3e-106   
ref|XP_003565723.1|  PREDICTED: peroxidase 5-like                       340   3e-106   
ref|XP_010906360.1|  PREDICTED: peroxidase 5-like                       338   3e-106   
gb|KCW61140.1|  hypothetical protein EUGRSUZ_H03915                     338   4e-106   
ref|XP_002984610.1|  hypothetical protein SELMODRAFT_181167             338   5e-106   
ref|XP_008461391.1|  PREDICTED: peroxidase 5-like                       339   5e-106   
ref|XP_004298124.1|  PREDICTED: peroxidase 5-like                       338   5e-106   
ref|XP_006444582.1|  hypothetical protein CICLE_v10021010mg             339   7e-106   
gb|EMT07621.1|  Peroxidase 5                                            338   7e-106   
ref|XP_008793597.1|  PREDICTED: peroxidase 5-like                       338   7e-106   
ref|XP_007145112.1|  hypothetical protein PHAVU_007G210900g             338   1e-105   
ref|NP_001141388.1|  uncharacterized protein LOC100273479 precursor     339   1e-105   Zea mays [maize]
ref|XP_004136140.1|  PREDICTED: peroxidase 5-like                       338   2e-105   
ref|XP_004135967.1|  PREDICTED: peroxidase 5-like                       338   2e-105   
ref|XP_009382231.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    337   2e-105   
ref|XP_004167191.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    338   2e-105   
gb|EYU39444.1|  hypothetical protein MIMGU_mgv1a009735mg                337   3e-105   
ref|XP_004158168.1|  PREDICTED: peroxidase 5-like                       337   4e-105   
ref|XP_009411414.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    335   9e-105   
ref|XP_010271091.1|  PREDICTED: peroxidase 5-like                       336   1e-104   
ref|XP_002440653.1|  hypothetical protein SORBIDRAFT_09g004660          336   2e-104   Sorghum bicolor [broomcorn]
ref|XP_004977108.1|  PREDICTED: peroxidase 1-like                       335   2e-104   
emb|CDP04200.1|  unnamed protein product                                335   2e-104   
ref|XP_010674523.1|  PREDICTED: peroxidase 5-like                       335   2e-104   
gb|EYU39450.1|  hypothetical protein MIMGU_mgv1a009721mg                334   3e-104   
gb|ACG35820.1|  peroxidase 66 precursor                                 333   5e-104   Zea mays [maize]
ref|XP_002987767.1|  hypothetical protein SELMODRAFT_126670             333   6e-104   
ref|XP_002452710.1|  hypothetical protein SORBIDRAFT_04g031120          333   7e-104   Sorghum bicolor [broomcorn]
ref|XP_004498110.1|  PREDICTED: peroxidase 5-like                       333   1e-103   
ref|XP_002993742.1|  hypothetical protein SELMODRAFT_137572             332   2e-103   
ref|XP_002963661.1|  hypothetical protein SELMODRAFT_266691             331   4e-103   
ref|NP_001140982.1|  uncharacterized protein LOC100273061 precursor     331   2e-102   Zea mays [maize]
ref|XP_010553703.1|  PREDICTED: peroxidase 5-like                       330   2e-102   
ref|XP_007035579.1|  Cationic peroxidase 2 precursor                    329   5e-102   
ref|XP_010914719.1|  PREDICTED: peroxidase 5-like                       328   1e-101   
ref|XP_003591355.1|  Peroxidase                                         328   1e-101   
ref|XP_010674524.1|  PREDICTED: peroxidase 5-like                       327   3e-101   
ref|XP_004977105.1|  PREDICTED: peroxidase 1-like                       327   4e-101   
emb|CAN71282.1|  hypothetical protein VITISV_027092                     325   6e-101   Vitis vinifera
ref|XP_008649365.1|  PREDICTED: peroxidase 5                            327   6e-101   
gb|AAS75401.1|  peroxidase                                              326   7e-101   Zea mays [maize]
gb|AAS75393.1|  peroxidase                                              326   9e-101   Zea mays [maize]
ref|XP_008664057.1|  PREDICTED: peroxidase 5-like                       327   9e-101   
ref|XP_011077167.1|  PREDICTED: peroxidase 5-like                       325   1e-100   
ref|XP_008647554.1|  PREDICTED: uncharacterized protein LOC100273...    325   2e-100   
gb|ACN36789.1|  unknown                                                 325   2e-100   Zea mays [maize]
gb|AAS75400.1|  peroxidase                                              325   2e-100   Zea mays [maize]
gb|AAS75395.1|  peroxidase                                              325   3e-100   Zea mays [maize]
gb|AAS75394.1|  peroxidase                                              325   3e-100   Zea mays [maize]
emb|CAC21393.1|  peroxidase                                             325   3e-100   Zea mays [maize]
gb|EMS47566.1|  Peroxidase 5                                            328   1e-99    
ref|XP_002455568.1|  hypothetical protein SORBIDRAFT_03g013220          324   1e-99    Sorghum bicolor [broomcorn]
ref|NP_001136740.1|  uncharacterized protein LOC100216881 precursor     322   1e-99    Zea mays [maize]
ref|XP_009387798.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    319   1e-99    
ref|XP_003558948.1|  PREDICTED: peroxidase 5-like                       322   2e-99    
ref|XP_009411603.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    321   3e-99    
ref|NP_001054728.1|  Os05g0162000                                       322   3e-99    Oryza sativa Japonica Group [Japonica rice]
tpe|CAH69314.1|  TPA: class III peroxidase 72 precursor                 322   4e-99    
ref|XP_004977106.1|  PREDICTED: peroxidase 1-like                       321   8e-99    
gb|EAY96656.1|  hypothetical protein OsI_18569                          321   1e-98    Oryza sativa Indica Group [Indian rice]
gb|EMS57163.1|  Peroxidase 5                                            325   2e-98    
ref|NP_001042908.1|  Os01g0327400                                       320   2e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968662.1|  PREDICTED: peroxidase 1-like                       320   2e-98    
gb|AIX03725.1|  peroxidase                                              318   1e-97    
ref|XP_008793417.1|  PREDICTED: peroxidase 5-like                       315   1e-97    
emb|CDM82175.1|  unnamed protein product                                317   1e-97    
gb|EMT06835.1|  hypothetical protein F775_43196                         315   2e-97    
ref|XP_008458688.1|  PREDICTED: peroxidase 5-like                       315   3e-97    
ref|XP_002455566.1|  hypothetical protein SORBIDRAFT_03g013200          317   4e-97    Sorghum bicolor [broomcorn]
ref|XP_002527239.1|  Peroxidase 27 precursor, putative                  315   5e-97    Ricinus communis
tpe|CAH69257.1|  TPA: class III peroxidase 14 precursor                 316   5e-97    
ref|XP_009342265.1|  PREDICTED: peroxidase 3-like                       315   6e-97    
gb|KDP37025.1|  hypothetical protein JCGZ_06081                         312   1e-96    
ref|NP_001141196.1|  hypothetical protein                               315   2e-96    Zea mays [maize]
ref|XP_009628416.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    313   4e-96    
ref|XP_010674605.1|  PREDICTED: peroxidase 5-like                       313   4e-96    
gb|EAY73798.1|  hypothetical protein OsI_01677                          313   5e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_006654966.1|  PREDICTED: peroxidase 5-like                       313   5e-96    
ref|XP_006645835.1|  PREDICTED: peroxidase 1-like                       313   7e-96    
ref|XP_004239722.1|  PREDICTED: peroxidase 5-like                       311   2e-95    
gb|EMT28015.1|  Peroxidase 5                                            310   2e-95    
ref|XP_006645837.1|  PREDICTED: peroxidase 1-like                       311   7e-95    
gb|KHN00230.1|  Peroxidase 5                                            306   1e-94    
ref|NP_001050187.1|  Os03g0368300                                       308   1e-94    Oryza sativa Japonica Group [Japonica rice]
gb|AAG46141.1|AC082644_23  putative peroxidase                          308   2e-94    
ref|NP_001050186.2|  Os03g0368000                                       308   2e-94    
gb|AFW57500.1|  hypothetical protein ZEAMMB73_740114                    306   2e-94    
ref|XP_008673330.1|  PREDICTED: hypothetical protein isoform X2         307   2e-94    
ref|XP_002280216.1|  PREDICTED: peroxidase 27                           308   2e-94    
gb|EMS51265.1|  Peroxidase 5                                            308   2e-94    
ref|XP_009781189.1|  PREDICTED: peroxidase 5-like                       308   2e-94    
ref|XP_004984274.1|  PREDICTED: peroxidase 2-like                       308   3e-94    
ref|XP_008341973.1|  PREDICTED: peroxidase 3-like                       308   3e-94    
gb|EEC75333.1|  hypothetical protein OsI_11725                          308   3e-94    
ref|XP_007224113.1|  hypothetical protein PRUPE_ppa015674mg             308   4e-94    
ref|XP_006346000.1|  PREDICTED: peroxidase 5-like                       308   5e-94    
ref|XP_003567633.1|  PREDICTED: peroxidase 1-like                       308   5e-94    
gb|KHN46511.1|  Peroxidase 5                                            305   7e-94    
ref|XP_009780196.1|  PREDICTED: peroxidase 5-like                       307   7e-94    
ref|XP_003567635.1|  PREDICTED: peroxidase 1-like                       308   8e-94    
dbj|BAJ88342.1|  predicted protein                                      308   8e-94    
gb|EMT10332.1|  Peroxidase 5                                            307   8e-94    
gb|EMS48378.1|  Peroxidase 2                                            306   1e-93    
gb|EAY90161.1|  hypothetical protein OsI_11726                          306   1e-93    
ref|XP_009353255.1|  PREDICTED: peroxidase 3                            306   1e-93    
ref|XP_009619824.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    306   1e-93    
dbj|BAJ95147.1|  predicted protein                                      306   1e-93    
ref|XP_010254706.1|  PREDICTED: peroxidase 5-like                       305   5e-93    
gb|AHH91639.1|  POD4 protein                                            302   6e-93    
gb|KHM99076.1|  Peroxidase 5                                            302   6e-93    
ref|XP_009342252.1|  PREDICTED: peroxidase 3                            304   8e-93    
gb|KCW58174.1|  hypothetical protein EUGRSUZ_H00891                     302   8e-93    
ref|XP_004971523.1|  PREDICTED: peroxidase 5-like                       303   2e-92    
ref|XP_001762477.1|  predicted protein                                  303   3e-92    
ref|XP_010275557.1|  PREDICTED: peroxidase 5-like                       303   3e-92    
tpe|CAH69313.1|  TPA: class III peroxidase 71 precursor                 303   3e-92    
ref|XP_007215666.1|  hypothetical protein PRUPE_ppa008540mg             302   3e-92    
ref|XP_002461102.1|  hypothetical protein SORBIDRAFT_02g040770          303   4e-92    
ref|NP_001054574.1|  Os05g0135500                                       303   5e-92    
ref|XP_010908222.1|  PREDICTED: peroxidase 3-like                       302   6e-92    
dbj|BAA96643.1|  putative peroxidase 1                                  302   7e-92    
ref|XP_003568989.1|  PREDICTED: peroxidase 5-like                       302   7e-92    
gb|KFK42864.1|  hypothetical protein AALP_AA1G049000                    301   7e-92    
gb|EMT01151.1|  Peroxidase 1                                            303   8e-92    
ref|XP_008379618.1|  PREDICTED: peroxidase 3                            301   8e-92    
ref|XP_008230094.1|  PREDICTED: peroxidase 3                            301   9e-92    
ref|XP_010240935.1|  PREDICTED: peroxidase 27-like                      301   1e-91    
ref|XP_010035573.1|  PREDICTED: peroxidase 27-like                      301   2e-91    
ref|XP_002309830.2|  hypothetical protein POPTR_0007s02570g             300   2e-91    
ref|XP_010251114.1|  PREDICTED: peroxidase 5-like                       301   2e-91    
ref|XP_002280274.1|  PREDICTED: peroxidase 3                            300   2e-91    
ref|XP_002467805.1|  hypothetical protein SORBIDRAFT_01g034420          300   3e-91    
gb|KDP41154.1|  hypothetical protein JCGZ_03648                         300   3e-91    
ref|XP_004144487.1|  PREDICTED: peroxidase 56-like                      300   3e-91    
gb|EAY73611.1|  hypothetical protein OsI_01497                          300   3e-91    
ref|XP_004159200.1|  PREDICTED: peroxidase 56-like                      300   4e-91    
emb|CDO98877.1|  unnamed protein product                                299   4e-91    
gb|EMT01340.1|  Peroxidase 2                                            300   4e-91    
ref|XP_002457708.1|  hypothetical protein SORBIDRAFT_03g011960          300   4e-91    
gb|EAY73797.1|  hypothetical protein OsI_01676                          301   5e-91    
ref|XP_002991681.1|  hypothetical protein SELMODRAFT_186230             299   6e-91    
gb|EYU24799.1|  hypothetical protein MIMGU_mgv1a019406mg                299   6e-91    
ref|XP_006387149.1|  hypothetical protein POPTR_1693s00200g             299   6e-91    
ref|XP_006855827.1|  hypothetical protein AMTR_s00037p00025630          299   8e-91    
ref|XP_004167193.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    299   9e-91    
ref|XP_008656073.1|  PREDICTED: peroxidase 2-like                       299   1e-90    
ref|XP_011003205.1|  PREDICTED: peroxidase 56-like                      298   1e-90    
ref|XP_010931180.1|  PREDICTED: peroxidase 3-like isoform X1            298   1e-90    
ref|XP_008804375.1|  PREDICTED: peroxidase 3-like                       298   1e-90    
gb|EMS59037.1|  Peroxidase 5                                            298   1e-90    
gb|AAG46133.1|AC082644_15  putative peroxidase                          298   2e-90    
ref|NP_001050188.1|  Os03g0368600                                       300   2e-90    
ref|XP_008656069.1|  PREDICTED: peroxidase 2-like                       298   2e-90    
ref|XP_004136142.1|  PREDICTED: peroxidase 5-like                       298   3e-90    
ref|XP_002274157.2|  PREDICTED: peroxidase 27-like                      297   3e-90    
ref|XP_008455840.1|  PREDICTED: peroxidase 39-like                      297   3e-90    
ref|XP_004958468.1|  PREDICTED: peroxidase 2-like                       298   4e-90    
ref|XP_008341978.1|  PREDICTED: peroxidase 3-like                       297   4e-90    
ref|NP_001130801.1|  hypothetical protein precursor                     295   4e-90    
ref|XP_002991057.1|  hypothetical protein SELMODRAFT_132865             296   4e-90    
ref|NP_001050193.1|  Os03g0369400                                       297   4e-90    
ref|XP_010908221.1|  PREDICTED: peroxidase 1-like                       297   4e-90    
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      297   5e-90    
ref|XP_011003204.1|  PREDICTED: peroxidase 27-like                      297   5e-90    
gb|EYU24792.1|  hypothetical protein MIMGU_mgv1a009974mg                296   6e-90    
ref|XP_006380314.1|  hypothetical protein POPTR_0007s02560g             296   6e-90    
ref|XP_010680021.1|  PREDICTED: peroxidase 16-like                      297   7e-90    
ref|XP_008461441.1|  PREDICTED: peroxidase 5-like                       296   8e-90    
gb|EAY90172.1|  hypothetical protein OsI_11737                          296   8e-90    
ref|XP_007219585.1|  hypothetical protein PRUPE_ppa023401mg             294   9e-90    
gb|EYU24798.1|  hypothetical protein MIMGU_mgv1a009213mg                297   9e-90    
gb|KGN63270.1|  hypothetical protein Csa_2G421020                       296   9e-90    
ref|XP_004151878.1|  PREDICTED: peroxidase 39-like                      296   9e-90    
ref|NP_001068411.1|  Os11g0661600                                       296   1e-89    
ref|XP_007217744.1|  hypothetical protein PRUPE_ppa008516mg             296   1e-89    
ref|XP_008777796.1|  PREDICTED: peroxidase 3-like                       296   1e-89    
ref|XP_004986969.1|  PREDICTED: peroxidase 2-like                       296   1e-89    
emb|CDY46845.1|  BnaA10g03290D                                          296   1e-89    
ref|XP_002889542.1|  CBRCI35                                            296   1e-89    
ref|XP_006652863.1|  PREDICTED: peroxidase 1-like                       296   2e-89    
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      295   2e-89    
ref|XP_006654017.1|  PREDICTED: peroxidase 5-like                       295   2e-89    
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       295   2e-89    
gb|AHL39150.1|  class III peroxidase                                    295   3e-89    
ref|XP_010109530.1|  Peroxidase 3                                       303   3e-89    
ref|XP_004487389.1|  PREDICTED: peroxidase 3-like                       295   3e-89    
ref|XP_004287925.1|  PREDICTED: peroxidase 3-like                       295   4e-89    
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       294   4e-89    
ref|XP_004249984.1|  PREDICTED: peroxidase 5-like                       295   4e-89    
gb|EYU24791.1|  hypothetical protein MIMGU_mgv1a010031mg                294   5e-89    
ref|XP_010271617.1|  PREDICTED: peroxidase 27-like                      294   5e-89    
gb|EYU24795.1|  hypothetical protein MIMGU_mgv1a021569mg                293   5e-89    
ref|XP_004287926.1|  PREDICTED: peroxidase 27-like                      294   5e-89    
ref|NP_001050192.1|  Os03g0369200                                       294   7e-89    
ref|XP_002967215.1|  hypothetical protein SELMODRAFT_168621             293   8e-89    
emb|CBI28956.3|  unnamed protein product                                304   8e-89    
ref|XP_009118603.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    293   1e-88    
gb|AAM61240.1|  putative peroxidase                                     293   1e-88    
emb|CBI28955.3|  unnamed protein product                                295   1e-88    
ref|XP_002521298.1|  Peroxidase 3 precursor, putative                   288   1e-88    
ref|XP_002309832.1|  peroxidase precursor family protein                293   1e-88    
gb|EMT23927.1|  Peroxidase 2                                            293   1e-88    
ref|NP_172018.1|  peroxidase 3                                          293   1e-88    
emb|CAJ86371.1|  OSIGBa0117N13.15                                       293   1e-88    
ref|XP_008801590.1|  PREDICTED: peroxidase 5-like                       293   1e-88    
gb|EYU39442.1|  hypothetical protein MIMGU_mgv1a009821mg                293   1e-88    
ref|XP_004249985.1|  PREDICTED: peroxidase 5-like                       293   1e-88    
ref|XP_002991860.1|  hypothetical protein SELMODRAFT_134234             293   1e-88    
ref|XP_002274131.2|  PREDICTED: peroxidase 55-like                      293   2e-88    
emb|CDY10037.1|  BnaC08g44140D                                          293   2e-88    
gb|AAT72298.1|  CBRCI35                                                 293   2e-88    
emb|CAA67337.1|  peroxidase                                             293   2e-88    
gb|EYU39443.1|  hypothetical protein MIMGU_mgv1a009818mg                293   2e-88    
ref|XP_006305430.1|  hypothetical protein CARUB_v10009829mg             292   2e-88    
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             292   3e-88    
ref|XP_006594891.1|  PREDICTED: peroxidase 39-like                      292   3e-88    
gb|EYU24797.1|  hypothetical protein MIMGU_mgv1a010025mg                292   3e-88    
gb|KHN36550.1|  Peroxidase 39                                           292   3e-88    
ref|XP_004515086.1|  PREDICTED: peroxidase 3-like                       292   3e-88    
ref|XP_010931166.1|  PREDICTED: peroxidase 56-like                      292   4e-88    
ref|XP_010033422.1|  PREDICTED: peroxidase 51-like                      291   4e-88    
ref|NP_192868.1|  peroxidase 39                                         291   4e-88    
ref|XP_010240936.1|  PREDICTED: peroxidase 27-like                      292   5e-88    
ref|XP_003557883.1|  PREDICTED: peroxidase 2-like                       291   5e-88    
ref|XP_002872571.1|  peroxidase ATP19a                                  291   5e-88    
emb|CAE04245.3|  OSJNBa0089N06.6                                        291   6e-88    
ref|XP_009631264.1|  PREDICTED: peroxidase 27-like                      291   6e-88    
ref|XP_010931832.1|  PREDICTED: peroxidase 3-like                       291   7e-88    
ref|XP_008804400.1|  PREDICTED: peroxidase 56-like                      291   8e-88    
ref|XP_008673964.1|  PREDICTED: peroxidase 5-like                       291   8e-88    
gb|EMT07518.1|  Peroxidase 2                                            294   8e-88    
ref|XP_010267773.1|  PREDICTED: peroxidase 3                            291   9e-88    
ref|XP_003567628.1|  PREDICTED: peroxidase 1-like                       292   1e-87    
ref|XP_011100418.1|  PREDICTED: peroxidase 27-like                      291   1e-87    
ref|XP_010522326.1|  PREDICTED: peroxidase 3                            291   1e-87    
ref|XP_006418047.1|  hypothetical protein EUTSA_v10008189mg             290   1e-87    
ref|XP_010267770.1|  PREDICTED: peroxidase 27-like                      290   1e-87    
ref|XP_002529736.1|  Peroxidase 27 precursor, putative                  290   1e-87    
ref|NP_001054572.1|  Os05g0135200                                       290   2e-87    
ref|XP_010267772.1|  PREDICTED: peroxidase 56-like                      290   2e-87    
ref|XP_004245974.1|  PREDICTED: peroxidase 27-like                      290   2e-87    
ref|XP_010435105.1|  PREDICTED: peroxidase 39                           290   2e-87    
ref|XP_002457707.1|  hypothetical protein SORBIDRAFT_03g011950          290   2e-87    
ref|XP_008784560.1|  PREDICTED: peroxidase 3-like                       290   2e-87    
ref|XP_001776111.1|  predicted protein                                  289   3e-87    
tpe|CAH69255.1|  TPA: class III peroxidase 12 precursor                 290   3e-87    
ref|XP_010484852.1|  PREDICTED: peroxidase 3-like                       289   4e-87    
gb|KHG20863.1|  Peroxidase 27 -like protein                             289   4e-87    
ref|XP_011097275.1|  PREDICTED: peroxidase 51                           289   4e-87    
ref|NP_001042903.1|  Os01g0326000                                       290   5e-87    
ref|XP_006650122.1|  PREDICTED: peroxidase 2-like                       290   5e-87    
gb|EAY90171.1|  hypothetical protein OsI_11736                          289   5e-87    
ref|XP_010475209.1|  PREDICTED: peroxidase 3                            288   7e-87    
gb|EEC70539.1|  hypothetical protein OsI_01672                          290   7e-87    
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         288   7e-87    
ref|XP_003540317.1|  PREDICTED: peroxidase 39-like                      288   8e-87    
gb|EYU39445.1|  hypothetical protein MIMGU_mgv11b018535mg               288   8e-87    
ref|XP_008230092.1|  PREDICTED: peroxidase 27-like                      288   9e-87    
ref|XP_006372959.1|  hypothetical protein POPTR_0017s06570g             288   9e-87    
ref|XP_011037007.1|  PREDICTED: peroxidase 3-like                       288   1e-86    
ref|XP_010457608.1|  PREDICTED: peroxidase 3-like                       288   1e-86    
gb|EYU39447.1|  hypothetical protein MIMGU_mgv1a022629mg                288   1e-86    
ref|XP_006372960.1|  hypothetical protein POPTR_0017s06570g             288   1e-86    
ref|XP_004984276.1|  PREDICTED: peroxidase 2-like                       288   1e-86    
ref|XP_002993021.1|  hypothetical protein SELMODRAFT_236655             288   1e-86    
ref|XP_004167192.1|  PREDICTED: cationic peroxidase 2-like              288   1e-86    
gb|ABM66586.1|  putative peroxidase                                     288   2e-86    
ref|XP_004136141.1|  PREDICTED: cationic peroxidase 2-like              288   2e-86    
ref|XP_002883319.1|  peroxidase 30                                      288   2e-86    
gb|EYU39448.1|  hypothetical protein MIMGU_mgv1a009726mg                287   2e-86    
ref|XP_008461438.1|  PREDICTED: peroxidase 5-like                       288   2e-86    
ref|XP_009382695.1|  PREDICTED: peroxidase 1-like                       287   2e-86    
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             287   3e-86    
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   286   4e-86    
gb|EMS55662.1|  Peroxidase 1                                            287   4e-86    
gb|ABK93918.1|  unknown                                                 286   5e-86    
ref|XP_009630374.1|  PREDICTED: peroxidase 27-like                      286   5e-86    
ref|XP_004968760.1|  PREDICTED: peroxidase 2-like                       286   5e-86    
gb|ABQ23446.1|  putative peroxidase                                     286   6e-86    
emb|CCJ34832.1|  horseradish peroxidase isoenzyme HRP_2021              286   6e-86    
ref|XP_009353257.1|  PREDICTED: peroxidase 27-like                      286   7e-86    
ref|XP_008390085.1|  PREDICTED: peroxidase 5-like                       286   7e-86    
ref|XP_007226228.1|  hypothetical protein PRUPE_ppa016743mg             286   7e-86    
ref|XP_009796690.1|  PREDICTED: peroxidase 27-like                      286   7e-86    
emb|CDP16702.1|  unnamed protein product                                285   9e-86    
gb|KFK31897.1|  hypothetical protein AALP_AA6G173300                    285   9e-86    
ref|XP_008379619.1|  PREDICTED: peroxidase 27-like                      285   1e-85    
ref|XP_002455648.1|  hypothetical protein SORBIDRAFT_03g016510          285   1e-85    
ref|XP_006470079.1|  PREDICTED: peroxidase 55-like                      285   1e-85    
ref|XP_006644127.1|  PREDICTED: peroxidase 1-like                       286   1e-85    
gb|KDO63914.1|  hypothetical protein CISIN_1g020449mg                   285   1e-85    
ref|XP_002979285.1|  hypothetical protein SELMODRAFT_233271             286   1e-85    
ref|XP_006361446.1|  PREDICTED: peroxidase 5-like                       285   1e-85    
emb|CDY13252.1|  BnaC09g24040D                                          285   1e-85    
ref|XP_006447048.1|  hypothetical protein CICLE_v10016043mg             284   1e-85    
gb|EAY81751.1|  hypothetical protein OsI_36925                          284   1e-85    
emb|CDY49518.1|  BnaC05g03300D                                          285   2e-85    
ref|XP_008455410.1|  PREDICTED: peroxidase 27-like                      285   2e-85    
ref|XP_003565689.1|  PREDICTED: peroxidase 5-like                       285   2e-85    
gb|AAD11482.1|  peroxidase precursor                                    286   2e-85    
gb|AHJ86268.1|  peroxidase                                              285   2e-85    
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           285   2e-85    
ref|XP_006447517.1|  hypothetical protein CICLE_v10017908mg             285   2e-85    
ref|XP_006352038.1|  PREDICTED: peroxidase 27-like                      284   2e-85    
ref|XP_006367289.1|  PREDICTED: peroxidase 3-like                       287   2e-85    



>ref|XP_010045225.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW88589.1| hypothetical protein EUGRSUZ_A00966 [Eucalyptus grandis]
Length=322

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 243/320 (76%), Positives = 273/320 (85%), Gaps = 9/320 (3%)
 Frame = -3

Query  1913  LLSCHPIVL-------EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFH  1755
             LL C  +VL       E++LQVGFY++SCR AE +VKDEVRKAF +D+G+AAGLVR+HFH
Sbjct  4     LLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFH  63

Query  1754  DCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILA  1575
             DCFVRGC+GSVLIDSTP+N AEKDSPANNPSLRGFEVID AKARLE++CKGVVSCADILA
Sbjct  64    DCFVRGCEGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAMCKGVVSCADILA  123

Query  1574  FAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEM  1395
             FAARDSVE  GG GYDVPAGRRDG +SLASE   NLP P FNVDQLT LF NKGFTQ+EM
Sbjct  124   FAARDSVEKAGGFGYDVPAGRRDGRVSLASETT-NLPPPSFNVDQLTQLFANKGFTQEEM  182

Query  1394  VTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMD  1215
             VTLSGAHTIGRSHCTSF+NRLY+FNTT  QD SLDP YA+ LKQQCPQG+ DP LVV MD
Sbjct  183   VTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQQCPQGN-DPTLVVPMD  241

Query  1214  PATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMG  1035
             P +P + D +YY  +LANRGL TSDQTLLT+ +TA QV+QNAR P  WKS FAAAMVKMG
Sbjct  242   PPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARIPSIWKSNFAAAMVKMG  301

Query  1034  KLGVLTGNAGEIRANCRVVN  975
             K+GVLTG+AGEIRANCRV+N
Sbjct  302   KIGVLTGSAGEIRANCRVIN  321



>ref|XP_009605400.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=329

 Score =   503 bits (1294),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 276/330 (84%), Gaps = 2/330 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MS+R L      AL  ++L C  I+LEA+LQVGFY +SC   E +VK EV KAF +DRGV
Sbjct  1     MSARMLMSGVWAALIFVVL-CECIMLEAQLQVGFYGSSCSMVEFIVKQEVTKAFIKDRGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCDGSVLIDSTP+N AEKDSPANNPSLRGFEVID AKARLES+C+
Sbjct  60    AAGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLESVCR  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADI+AFAARDSVEIT G GY VPAGRRDG ISLASE   NLP+P  NVDQLT  F
Sbjct  120   GVVSCADIVAFAARDSVEITRGFGYAVPAGRRDGRISLASET-RNLPSPALNVDQLTQNF  178

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              N G TQ+EMVTLSGAHTIGRSHC SF++RLYNFN+TT QD SLDP YAA+LKQQCPQGS
Sbjct  179   KNMGLTQEEMVTLSGAHTIGRSHCGSFTSRLYNFNSTTSQDPSLDPGYAAQLKQQCPQGS  238

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              D +LVV M+PA+P I DV YYT++LANRGL TSDQTLLT+P+TA QV+QNAR+   WKS
Sbjct  239   TDTSLVVPMNPASPDITDVGYYTDILANRGLFTSDQTLLTNPTTAIQVTQNARSSLLWKS  298

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA AMVKMG++GVLT  AGEIRANCRV+N
Sbjct  299   KFAFAMVKMGQIGVLTSTAGEIRANCRVIN  328



>ref|XP_008234631.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Prunus mume]
Length=327

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 239/330 (72%), Positives = 278/330 (84%), Gaps = 4/330 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             M  +NL+C S + +   L  CH +   ++LQVGFY  SC  AEL+VKDEVRK FF++ GV
Sbjct  1     MRPQNLNCVSIVLIAASL--CHSV--HSQLQVGFYTTSCTLAELIVKDEVRKGFFKNPGV  56

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCD SVLIDST +NKAEKDSPANNPSLRGFEVID AKARLE++C+
Sbjct  57    AAGLVRLHFHDCFVRGCDASVLIDSTSSNKAEKDSPANNPSLRGFEVIDSAKARLEAVCR  116

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADI+AFAARDS+EIT GLGY VPAGRRDG IS AS+   NLP P FNVDQL+ LF
Sbjct  117   GVVSCADIVAFAARDSIEITRGLGYIVPAGRRDGRISQASDTFTNLPPPSFNVDQLSKLF  176

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              NKGFTQ+EMVTLSGAHTIGRSH T+FSNRLYNFN T+ QD SLDP YAA+LKQQCPQG+
Sbjct  177   ANKGFTQEEMVTLSGAHTIGRSHSTAFSNRLYNFNRTSRQDPSLDPQYAAQLKQQCPQGN  236

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PNLVV M+PA+PA+ D +YY ++LANRGL TSDQTLLT+ +TA QV+QNA+ PF W++
Sbjct  237   TSPNLVVLMNPASPAVTDTSYYADILANRGLFTSDQTLLTNSATANQVNQNAKMPFLWRT  296

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA AMVKMG+L VLTGNAGEI+ANCRV+N
Sbjct  297   KFATAMVKMGRLEVLTGNAGEIQANCRVIN  326



>ref|XP_004307916.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 276/330 (84%), Gaps = 3/330 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS+NL   S   +   +L C   V +++LQVGFY  SC  AE +VK+EVRK F  +RGV
Sbjct  1     MSSQNLK--SVYIVLFCVLLCRRGV-DSQLQVGFYGGSCNIAEFIVKEEVRKGFIGNRGV  57

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCD SVLIDST +N AEKD+PANNPSLRGFEVID AKARLESICK
Sbjct  58    AAGLVRLHFHDCFVRGCDASVLIDSTTSNTAEKDAPANNPSLRGFEVIDNAKARLESICK  117

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADI+AFAARDSVE+TGGLGYDVPAGRRDG +S+AS+   NLP P  NV+QLT LF
Sbjct  118   GVVSCADIVAFAARDSVELTGGLGYDVPAGRRDGRVSVASDTFTNLPPPTANVNQLTQLF  177

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              NKGFTQ EMVTLSGAHTIGRSHC SFSNRLY+FN TT QD SLDP YAA+LKQQCPQG+
Sbjct  178   ANKGFTQDEMVTLSGAHTIGRSHCGSFSNRLYSFNATTNQDPSLDPRYAAQLKQQCPQGN  237

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              +PNLVV M+P++P   DVAYY ++LANRGL TSDQTL+++ +TA QV+QNAR PF W  
Sbjct  238   TNPNLVVAMNPSSPFTNDVAYYADILANRGLFTSDQTLISNSATANQVNQNARNPFLWNY  297

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFAAAMVKMG+LGVLTGNAGEIRANCRV+N
Sbjct  298   KFAAAMVKMGRLGVLTGNAGEIRANCRVIN  327



>ref|XP_009769971.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=329

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/330 (74%), Positives = 276/330 (84%), Gaps = 2/330 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MS+R L      AL +++L C  ++LEA+LQVGFY +SC  AE +VK EV KAF +D GV
Sbjct  1     MSARMLMNGVWAALILLVL-CECMMLEAQLQVGFYSSSCSMAEFIVKQEVAKAFIKDIGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCDGSVLIDSTP+N AEKDSPANNPSLRGFEVID AKARLES+C+
Sbjct  60    AAGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLESVCQ  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADI+AFAARDSVEIT G GY VPAGRRDG ISLASE   NLP+P FNVDQLT  F
Sbjct  120   GVVSCADIVAFAARDSVEITRGFGYAVPAGRRDGRISLASET-RNLPSPAFNVDQLTQNF  178

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              N G TQ+EMVTLSGAHTIGRSHC SFS+RLY+FN+TT QD SLDP YAA+LKQQCPQGS
Sbjct  179   KNMGLTQEEMVTLSGAHTIGRSHCGSFSSRLYSFNSTTSQDPSLDPGYAAQLKQQCPQGS  238

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              D +L V M+PA+PAI DV YYT++LANRGL TSDQTLLT+P+T  QV QNAR+   WKS
Sbjct  239   TDTSLGVPMNPASPAITDVGYYTDILANRGLFTSDQTLLTNPATVIQVIQNARSSLLWKS  298

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA AMVKMG++G+LT  AGEIRANCRV+N
Sbjct  299   KFAFAMVKMGQIGILTSTAGEIRANCRVIN  328



>ref|XP_006347525.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=325

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 239/330 (72%), Positives = 274/330 (83%), Gaps = 6/330 (2%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MS+R L     ++  + L+ C  ++LEA+LQVGFY NSC  AE +V+ EV  AFF ++GV
Sbjct  1     MSARIL-----ISALIFLVLCECMMLEAQLQVGFYDNSCSMAEFIVRQEVTNAFFINKGV  55

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCDGSVLIDST  N AEKDSPANNPSLRGFEVID AKARLES+C+
Sbjct  56    AAGLVRMHFHDCFVRGCDGSVLIDSTSTNSAEKDSPANNPSLRGFEVIDSAKARLESVCQ  115

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADI+AFAARDSV ITGG GY+VPAGRRDG ISLASE   +LP P  NVDQLT  F
Sbjct  116   GVVSCADIVAFAARDSVAITGGFGYEVPAGRRDGRISLASET-TSLPPPTLNVDQLTQNF  174

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              N G TQ+EMVTLSGAHTIGRSHC +F NRLY+FN+TT QD SLDP YAA+LKQQCP+GS
Sbjct  175   KNMGLTQEEMVTLSGAHTIGRSHCLAFRNRLYSFNSTTSQDPSLDPSYAAQLKQQCPEGS  234

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              D +LVV M+P +PAI D  YYT++LANRGL TSDQTLLT+P+TA QV QNAR PF WKS
Sbjct  235   TDASLVVPMNPVSPAITDECYYTDILANRGLFTSDQTLLTNPTTAIQVIQNARYPFLWKS  294

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA+AMVKMG++GVLTG AGEIRANCRV+N
Sbjct  295   KFASAMVKMGQIGVLTGTAGEIRANCRVIN  324



>ref|XP_010048379.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW89059.1| hypothetical protein EUGRSUZ_A01385 [Eucalyptus grandis]
Length=322

 Score =   493 bits (1270),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 238/320 (74%), Positives = 271/320 (85%), Gaps = 9/320 (3%)
 Frame = -3

Query  1913  LLSCHPIVL-------EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFH  1755
             LL C  +VL       E++LQVGFY++SCR AE +VKDEVRKAF +D+G+AAGLVR+HFH
Sbjct  4     LLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFH  63

Query  1754  DCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILA  1575
             DCFVRGC+GSVLIDST +N AEKDSPANNPSLRGFEVID AKARLE++CKGVVSCADILA
Sbjct  64    DCFVRGCEGSVLIDSTLSNTAEKDSPANNPSLRGFEVIDSAKARLETMCKGVVSCADILA  123

Query  1574  FAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEM  1395
             FAARDSVEITGG GY+VPAGRRDG +SLA E   NLP P FNV+QLT LF NKGFTQ+EM
Sbjct  124   FAARDSVEITGGFGYNVPAGRRDGRVSLAPETI-NLPLPSFNVNQLTQLFANKGFTQEEM  182

Query  1394  VTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMD  1215
             VTLSGAHTIGRSHCTSF+NRLY+FNTT  QD SLDP YA+ LKQ+CPQ + D  LVV MD
Sbjct  183   VTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQRCPQ-NNDSTLVVPMD  241

Query  1214  PATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMG  1035
             P +P + D +YY  +LANRGL TSDQTLLT+ +TA QV+QNAR PF WK  FAAAMVKMG
Sbjct  242   PPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARNPFIWKKIFAAAMVKMG  301

Query  1034  KLGVLTGNAGEIRANCRVVN  975
             K+GVLTG+AGEIRANCRV+N
Sbjct  302   KIGVLTGSAGEIRANCRVIN  321



>ref|XP_009361266.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=328

 Score =   493 bits (1270),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 231/305 (76%), Positives = 261/305 (86%), Gaps = 0/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             + ++LQVGFY  SC  AE +VKDEV+KAFFRD GV AGLVR+HFHDCFVRGCD SVLIDS
Sbjct  23    VHSQLQVGFYTTSCTLAETIVKDEVQKAFFRDPGVTAGLVRMHFHDCFVRGCDASVLIDS  82

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T +N AEKDSPANNPSLRGFEVIDKAKARLE+ C+GVVSCADI+AFAARDS+ +T GLGY
Sbjct  83    TSSNTAEKDSPANNPSLRGFEVIDKAKARLEAACRGVVSCADIVAFAARDSIVLTRGLGY  142

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVPAGRRDG +S AS++  NLP P FNV+ LT  F NKGFTQ+EMVTLSGAHTIGRSHCT
Sbjct  143   DVPAGRRDGRVSKASDIPGNLPLPTFNVNNLTQHFANKGFTQQEMVTLSGAHTIGRSHCT  202

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFSNRLYNFN TT QD SLDP YAA+LKQQCPQG+ + NLVV MDPA+P + D +YY  +
Sbjct  203   SFSNRLYNFNATTNQDPSLDPAYAAQLKQQCPQGNTNANLVVPMDPASPTVTDASYYAGI  262

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             L NRGL TSDQTLLT+ +TA QV QNAR PF WK+KF+AAMVKMG+L VLTGNAGEIRAN
Sbjct  263   LKNRGLFTSDQTLLTNSATANQVKQNARIPFLWKNKFSAAMVKMGQLEVLTGNAGEIRAN  322

Query  989   CRVVN  975
             CRV+N
Sbjct  323   CRVIN  327



>ref|XP_006470493.1| PREDICTED: peroxidase 5-like [Citrus sinensis]
Length=328

 Score =   493 bits (1270),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 269/319 (84%), Gaps = 2/319 (1%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
               + +++L C  +   ++LQVGFYRNSC +AEL+VKDEVRK+  +D+GVAAGLVR+HFHD
Sbjct  12    FVILIVVLLCTSV--NSQLQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHD  69

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD SVLIDST +N AEKDSP NNPSLRGFEVID AKA LES+CKG+VSCADI+AF
Sbjct  70    CFVRGCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAF  129

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSVEI+GGLGYDVP+GRRDG ISLASE   NLP P F V+QLT  F NKGFTQ+EMV
Sbjct  130   AARDSVEISGGLGYDVPSGRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMV  189

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAHTIGRSHCTSFSNRLYNF+ T  QD SL+P+YAA+LKQQC Q   +PNLVV M+P
Sbjct  190   TLSGAHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNP  249

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              +P+I D  YY ++L NRGL TSDQTLL+DP+TA QV+QNA+ P  WK+ FAAAMVKMG+
Sbjct  250   GSPSIADTGYYIDILRNRGLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQ  309

Query  1031  LGVLTGNAGEIRANCRVVN  975
             +GVLT +AGEIRANCRVVN
Sbjct  310   IGVLTASAGEIRANCRVVN  328



>ref|XP_003634164.2| PREDICTED: peroxidase 5 [Vitis vinifera]
Length=368

 Score =   494 bits (1273),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 250/341 (73%), Positives = 284/341 (83%), Gaps = 4/341 (1%)
 Frame = -3

Query  1994  DMINKQMKKEMSSRNLSCCSSLALTMILLS-CHPIVLEAKLQVGFYRNSCRAAELVVKDE  1818
             ++I  + K+ MSS+ ++    L+LT +L+  C  + LEA+LQVGFYR SC  AE +VKDE
Sbjct  30    NVIAYKHKEVMSSKRVTW---LSLTWVLVFLCLSVELEAQLQVGFYRTSCGLAEFIVKDE  86

Query  1817  VRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVID  1638
             VRK F RD GVA GLVR+HFHDCFVRGCDGSVLIDSTP+N AEKDSPANNPSLRGFEVID
Sbjct  87    VRKGFIRDSGVAPGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVID  146

Query  1637  KAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTP  1458
              AKARLE++CKGVVSCADI+AFAARDSVEITGGLGYDVPAGRRDG ISLASE + NLP P
Sbjct  147   SAKARLEAVCKGVVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPP  206

Query  1457  FFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYA  1278
              F VDQLT  F NKG TQ EMVTLSGAHTIGRSHC+SFSNRLYNFN T+GQD +LDP YA
Sbjct  207   TFTVDQLTQFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYA  266

Query  1277  AKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVS  1098
             A LK QCPQGS + NLVV M+P++P+I DV YY +VL NRGL TSDQTLLTD +TA QV 
Sbjct  267   ASLKTQCPQGSTNTNLVVPMNPSSPSITDVGYYVDVLRNRGLFTSDQTLLTDTTTATQVR  326

Query  1097  QNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             QNA  PF WK+KFA+AMVKMG+LGVL G AG+IRANCRV+N
Sbjct  327   QNAGNPFLWKNKFASAMVKMGQLGVLIGEAGQIRANCRVIN  367



>gb|KDO66295.1| hypothetical protein CISIN_1g041695mg, partial [Citrus sinensis]
Length=301

 Score =   490 bits (1261),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 228/301 (76%), Positives = 260/301 (86%), Gaps = 0/301 (0%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQVGFYRNSC +AEL+VKDEVRK+  +D+GVAAGLVR+HFHDCFVRGCD SVLIDST +N
Sbjct  1     LQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHDCFVRGCDASVLIDSTSSN  60

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDSP NNPSLRGFEVID AKA LES+CKG+VSCADI+AFAARDSVEI+GGLGYDVP+
Sbjct  61    TAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAFAARDSVEISGGLGYDVPS  120

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG ISLASE   NLP P F V+QLT  F NKGFTQ+EMVTLSGAHTIGRSHCTSFSN
Sbjct  121   GRRDGRISLASEALTNLPPPTFTVNQLTQSFANKGFTQEEMVTLSGAHTIGRSHCTSFSN  180

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANR  1158
             RLYNF+ T  QD SL+P+YAA+LKQQC Q   +PNLVV M+P +P+I D  YY ++L NR
Sbjct  181   RLYNFSGTMSQDPSLNPMYAAQLKQQCLQDGTNPNLVVPMNPGSPSIADTGYYIDILRNR  240

Query  1157  GLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVV  978
             GL TSDQTLL+DP+TA QV+QNA+ P  WK+ FAAAMVKMG++GVLT +AGEIRANCRVV
Sbjct  241   GLFTSDQTLLSDPATASQVNQNAKTPKLWKTNFAAAMVKMGQIGVLTASAGEIRANCRVV  300

Query  977   N  975
             N
Sbjct  301   N  301



>ref|XP_011075883.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=325

 Score =   491 bits (1263),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 230/318 (72%), Positives = 270/318 (85%), Gaps = 1/318 (0%)
 Frame = -3

Query  1928  ALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDC  1749
             A  ++L+  + +  EA+LQVGFY++SC  AEL+VK EVR  F +D+GVAAGLVR+HFHDC
Sbjct  8     AFILLLVCLYIVESEAQLQVGFYQSSCGLAELIVKQEVRIGFIKDKGVAAGLVRLHFHDC  67

Query  1748  FVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFA  1569
             FVRGCDGSVLIDSTP+N AEKD+P NNPSLRGFEVID AK+RLE+ICKGVVSCADILAFA
Sbjct  68    FVRGCDGSVLIDSTPSNTAEKDAPPNNPSLRGFEVIDNAKSRLEAICKGVVSCADILAFA  127

Query  1568  ARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVT  1389
             ARDS+EITGGLGYDVPAGRRDG +S+ASE  +NLP P F+V+QLT +F  KG TQ+EMVT
Sbjct  128   ARDSIEITGGLGYDVPAGRRDGRVSVASEALSNLPPPTFDVNQLTKMFATKGLTQEEMVT  187

Query  1388  LSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPA  1209
             LSGAHT+GRSHCTSF NRLYNFN+ + QD +LD  YAA+L+Q+CPQ S + NLVV MDP+
Sbjct  188   LSGAHTLGRSHCTSFINRLYNFNSNSSQDPTLDTTYAAQLRQKCPQNS-NANLVVPMDPS  246

Query  1208  TPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKL  1029
             +PA  DV YY  VLANRGLLTSDQTLLT P T  QV QN + PF W++KFAAAMVKMGK+
Sbjct  247   SPAFTDVGYYKGVLANRGLLTSDQTLLTSPQTQFQVVQNVQNPFLWRNKFAAAMVKMGKI  306

Query  1028  GVLTGNAGEIRANCRVVN  975
             GVLTGNAGE+RANCRV+N
Sbjct  307   GVLTGNAGEVRANCRVIN  324



>sp|A7QEU4.2|PER5_VITVI RecName: Full=Peroxidase 5; Flags: Precursor [Vitis vinifera]
Length=329

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 248/331 (75%), Positives = 278/331 (84%), Gaps = 4/331 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLS-CHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRG  1788
             MSS+ ++    L+LT +L+  C  + LEA+LQVGFYR SC  AE +VKDEVRK F RD G
Sbjct  1     MSSKRVTW---LSLTWVLVFLCLSVELEAQLQVGFYRTSCGLAEFIVKDEVRKGFIRDSG  57

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             VA GLVR+HFHDCFVRGCDGSVLIDSTP+N AEKDSPANNPSLRGFEVID AKARLE++C
Sbjct  58    VAPGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAVC  117

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
             KGVVSCADI+AFAARDSVEITGGLGYDVPAGRRDG ISLASE + NLP P F VDQLT  
Sbjct  118   KGVVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPPTFTVDQLTQF  177

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG  1248
             F NKG TQ EMVTLSGAHTIGRSHC+SFSNRLYNFN T+GQD +LDP YAA LK QCPQG
Sbjct  178   FSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYAASLKTQCPQG  237

Query  1247  SKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWK  1068
             S + NLVV M+P++P+I DV YY +VL NRGL TSDQTLLTD +TA QV QNA  PF WK
Sbjct  238   STNTNLVVPMNPSSPSITDVGYYVDVLRNRGLFTSDQTLLTDTTTATQVRQNAGNPFLWK  297

Query  1067  SKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             +KFA+AMVKMG+LGVL G AG+IRANCRV+N
Sbjct  298   NKFASAMVKMGQLGVLIGEAGQIRANCRVIN  328



>ref|XP_007039219.1| Peroxidase 5 [Theobroma cacao]
 gb|EOY23720.1| Peroxidase 5 [Theobroma cacao]
Length=330

 Score =   489 bits (1260),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/331 (69%), Positives = 273/331 (82%), Gaps = 4/331 (1%)
 Frame = -3

Query  1967  EMSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRG  1788
             +MS R L+      +  ++L C  +   ++LQ+GFYR++C   E +VK+EV KAF ++ G
Sbjct  3     KMSPRKLT--RVFTILAVVLFCQSV--HSQLQIGFYRDTCSLVEFIVKEEVTKAFIKENG  58

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             V AGL+R+HFHDCFVRGCDGSVL+DSTP++ AEKDS ANNPSLRG+EVID AKARLE++C
Sbjct  59    VVAGLMRMHFHDCFVRGCDGSVLLDSTPSSTAEKDSFANNPSLRGYEVIDNAKARLEAVC  118

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
             KGVVSCADI+AFAARDS+EITGGLGYDVPAGRRDG  SLASE+  NLP P FNV QLT +
Sbjct  119   KGVVSCADIVAFAARDSIEITGGLGYDVPAGRRDGRTSLASEIIGNLPPPTFNVSQLTQM  178

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG  1248
             F  KGFTQ+EMVTLSG HTIGRSHCTSFSNRLYNF+ T  QD SLDP YAA LKQQCPQG
Sbjct  179   FAKKGFTQEEMVTLSGGHTIGRSHCTSFSNRLYNFSGTGMQDPSLDPRYAAMLKQQCPQG  238

Query  1247  SKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWK  1068
             +KD NLVV M+P++P+I D  YY ++LANRGL TSD TLLT+P+TA QV+QNAR P +W+
Sbjct  239   NKDTNLVVPMNPSSPSITDAGYYVDILANRGLFTSDHTLLTNPATANQVTQNARNPMQWR  298

Query  1067  SKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             +KF AAMVKMG+L VLTG AGEIRANCRV+N
Sbjct  299   AKFGAAMVKMGQLEVLTGTAGEIRANCRVIN  329



>gb|KDP30908.1| hypothetical protein JCGZ_15520 [Jatropha curcas]
Length=328

 Score =   489 bits (1259),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/317 (71%), Positives = 265/317 (84%), Gaps = 0/317 (0%)
 Frame = -3

Query  1925  LTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCF  1746
             +T+++L C   V   +LQVG+Y +SC  AE +VKD VR  F +D+GV A L+R+HFHDCF
Sbjct  12    ITLLILFCQFGVRNCQLQVGYYSSSCSVAEFIVKDAVRDGFSKDKGVPAALLRMHFHDCF  71

Query  1745  VRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             VRGCDGSVLIDS+ +N AEKD+PANNPSLRGFEVID AK+RLE++CKG+VSCADILAFAA
Sbjct  72    VRGCDGSVLIDSSSSNTAEKDNPANNPSLRGFEVIDNAKSRLEAVCKGIVSCADILAFAA  131

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDS+E++GGLGYDVPAGRRDG ISL+S+V+ NLP P FNV+QLT LF NKGF+Q EMVTL
Sbjct  132   RDSIELSGGLGYDVPAGRRDGRISLSSDVSTNLPAPTFNVNQLTQLFANKGFSQAEMVTL  191

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPAT  1206
             SG HTIGRSHCTSFSNRLYNFN T+  D SLD +YAAKLKQQCPQ S D  LVV M+P++
Sbjct  192   SGGHTIGRSHCTSFSNRLYNFNQTSSSDPSLDGMYAAKLKQQCPQSSTDNGLVVPMNPSS  251

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   D  YY ++LANRGL  SDQTLLT+P+TA QVSQNAR P  W++KFAAAMVKMG L 
Sbjct  252   PGTIDAGYYIDILANRGLFISDQTLLTNPATATQVSQNARNPLLWQTKFAAAMVKMGGLD  311

Query  1025  VLTGNAGEIRANCRVVN  975
             VLTGNAGEIRANCRV+N
Sbjct  312   VLTGNAGEIRANCRVIN  328



>ref|XP_006374082.1| hypothetical protein POPTR_0015s00590g [Populus trichocarpa]
 gb|ERP51879.1| hypothetical protein POPTR_0015s00590g [Populus trichocarpa]
Length=330

 Score =   486 bits (1250),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 267/330 (81%), Gaps = 1/330 (0%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS+ LS    +   ++ L C+  V  ++L+VGFYR+SC+ AE +VK  VR  F +DRGV
Sbjct  1     MSSKKLSRPCLVCWVVVFLFCNQSV-HSQLEVGFYRSSCKMAEFIVKSAVRDGFNKDRGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCD SVL+DST +NKAEKDSPANNPSLRGFEVID AKARLE+ CK
Sbjct  60    AAGLVRMHFHDCFVRGCDASVLLDSTTSNKAEKDSPANNPSLRGFEVIDNAKARLETECK  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             G+VSCADILAFAARDS+EITGG GYDVPAGRRDG +SLASEV  NLP P FNVDQLT  F
Sbjct  120   GIVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVLTNLPPPTFNVDQLTQNF  179

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              NKGF+Q+EMVTLSG HTIGRSHCTSFSNRLYNFN TT QD  LD  YA  LKQ CPQGS
Sbjct  180   ANKGFSQEEMVTLSGGHTIGRSHCTSFSNRLYNFNGTTSQDPILDATYATSLKQMCPQGS  239

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              DP+LVV M+P +PA  D  YY ++LANRGL TSDQTLLT+ +TA QV+ NAR    WK 
Sbjct  240   TDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATATQVNINARNSMLWKR  299

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFAAAM KMGKL VLTGNAGEIRA+CRV+N
Sbjct  300   KFAAAMQKMGKLDVLTGNAGEIRADCRVIN  329



>gb|AHL39183.1| class III peroxidase [Populus trichocarpa]
Length=330

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 236/330 (72%), Positives = 266/330 (81%), Gaps = 1/330 (0%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS+ LS    +   ++ L C   V  ++L+VGFYR+SC+ AE +VK  VR  F +DRGV
Sbjct  1     MSSKKLSRPCLVCWVVVFLFCTQSV-HSQLEVGFYRSSCKMAEFIVKSAVRDGFNKDRGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGCD SVL+DST +NKAEKDSPANNPSLRGFEVID AKARLE+ CK
Sbjct  60    AAGLVRMHFHDCFVRGCDASVLLDSTTSNKAEKDSPANNPSLRGFEVIDNAKARLETECK  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             G+VSCADILAFAARDS+EITGG GYDVPAGRRDG +SLASEV  NLP P FNVDQLT  F
Sbjct  120   GIVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVLTNLPPPTFNVDQLTQNF  179

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              NKGF+Q+EMVTLSG HTIGRSHCTSFSNRLYNFN TT QD  LD  YA  LKQ CPQGS
Sbjct  180   ANKGFSQEEMVTLSGGHTIGRSHCTSFSNRLYNFNGTTSQDPILDATYATSLKQMCPQGS  239

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              DP+LVV M+P +PA  D  YY ++LANRGL TSDQTLLT+ +TA QV+ NAR    WK 
Sbjct  240   TDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATANQVNINARNSMLWKR  299

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFAAAM KMGKL VLTGNAGEIRA+CRV+N
Sbjct  300   KFAAAMQKMGKLDVLTGNAGEIRADCRVIN  329



>ref|XP_011003280.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=330

 Score =   483 bits (1243),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 234/330 (71%), Positives = 267/330 (81%), Gaps = 1/330 (0%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS+ LS    +   ++ L C   V  ++L+VGFYR+SC+ AE +VK  VR  F +DRGV
Sbjct  1     MSSKKLSQPCLVCWVVVFLFCTQSV-HSQLEVGFYRSSCKMAEFIVKGAVRDGFNKDRGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFV GCD SVL+DSTP+NKAEKDS ANNPSLRGFEVID AKARLE+ CK
Sbjct  60    AAGLVRMHFHDCFVGGCDASVLLDSTPSNKAEKDSTANNPSLRGFEVIDNAKARLETECK  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             G VSCADILAFAARDS+EITGG GYDVPAGRRDG +SLASEV+ NLPTP FNVDQLT  F
Sbjct  120   GTVSCADILAFAARDSIEITGGFGYDVPAGRRDGTVSLASEVSTNLPTPKFNVDQLTQNF  179

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
              NKGF+Q+EMVTLSG HTIGRSHCTSF  RLYNF+ TT QD +LD  YA  LKQ CPQGS
Sbjct  180   ANKGFSQEEMVTLSGGHTIGRSHCTSFRKRLYNFSGTTSQDPTLDATYATSLKQMCPQGS  239

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              DP+LVV M+P +PA  D  YY ++LANRGL TSDQTLLT+ +TA QV+ NAR    WKS
Sbjct  240   TDPSLVVPMNPGSPATTDAGYYLDILANRGLFTSDQTLLTNAATATQVNINARNSMLWKS  299

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFAAAM+KMGKL VLTGNAGEIRA+CRV+N
Sbjct  300   KFAAAMLKMGKLDVLTGNAGEIRADCRVIN  329



>ref|XP_004235031.1| PREDICTED: peroxidase 5 [Solanum lycopersicum]
Length=325

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 264/315 (84%), Gaps = 1/315 (0%)
 Frame = -3

Query  1919  MILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVR  1740
             + L+ C  ++LEA+LQVGFY NSC  AE +V+ EV  AF R++GVAAGLVR+HFHDCFVR
Sbjct  11    IFLVLCECMMLEAQLQVGFYDNSCSMAEFIVRQEVTNAFLRNKGVAAGLVRMHFHDCFVR  70

Query  1739  GCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARD  1560
             GCDGSVLIDST  N AEKDSPANNPSLRGF+VID AKARLES+C+GVVSCADI+AFAARD
Sbjct  71    GCDGSVLIDSTATNSAEKDSPANNPSLRGFKVIDSAKARLESVCEGVVSCADIVAFAARD  130

Query  1559  SVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSG  1380
             SV ITGGLGY+VPAGRRDG ISLASE   +LP P  +VDQLT  F + G TQ+EMVTLSG
Sbjct  131   SVVITGGLGYEVPAGRRDGRISLASET-RSLPPPTLDVDQLTQNFRSMGLTQEEMVTLSG  189

Query  1379  AHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPA  1200
             AHTIGRSHC +F NRLY+FN+TT QD SLD  YAA+LKQQCP+GS D +LVV M+P +P 
Sbjct  190   AHTIGRSHCLAFRNRLYSFNSTTSQDPSLDLSYAAQLKQQCPEGSTDASLVVPMNPVSPG  249

Query  1199  IFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVL  1020
               D  YYT++LANRGL TSDQTLLTDP+TA QV QNAR PF WKSKFA+AM KMG++GVL
Sbjct  250   TTDEYYYTDILANRGLFTSDQTLLTDPTTAIQVLQNARFPFLWKSKFASAMAKMGQIGVL  309

Query  1019  TGNAGEIRANCRVVN  975
             TG AGEIRANCRV+N
Sbjct  310   TGTAGEIRANCRVIN  324



>gb|EYU45326.1| hypothetical protein MIMGU_mgv1a009971mg [Erythranthe guttata]
Length=325

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 227/325 (70%), Positives = 264/325 (81%), Gaps = 1/325 (0%)
 Frame = -3

Query  1949  LSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLV  1770
             +SC        +LL    +  EA+LQ GFYR+SC  AE +VK EVR  FF+D G+AAGLV
Sbjct  1     MSCKQFQTFVSVLLFLCIVESEAQLQTGFYRSSCGIAEFIVKQEVRNGFFKDNGIAAGLV  60

Query  1769  RVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSC  1590
             R+HFHDCFVRGCDGSVLIDST +NKAEKDSPANNPSLRGFEVID AKAR+E+ CKGVVSC
Sbjct  61    RLHFHDCFVRGCDGSVLIDSTASNKAEKDSPANNPSLRGFEVIDNAKARIEAFCKGVVSC  120

Query  1589  ADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGF  1410
             ADILAFAARDS+EITGG GYDVP+GR+DG +SL +E + NLP P FNV+QLT  F NKG 
Sbjct  121   ADILAFAARDSIEITGGFGYDVPSGRKDGRVSLDTEASQNLPPPSFNVNQLTQAFANKGL  180

Query  1409  TQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL  1230
             TQ+EMVTLSGAHT+GRSHCTSFSNRLY+F+T T QD SLD  YA++L+QQCP+G+  PN 
Sbjct  181   TQEEMVTLSGAHTLGRSHCTSFSNRLYSFSTNTSQDPSLDAFYASQLRQQCPRGT-GPNP  239

Query  1229  VVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAA  1050
             VV MDP +PA  DV YY  VL+NRGL TSDQTL+T P T  QV QNA+ PF W +KFAAA
Sbjct  240   VVPMDPFSPAQTDVGYYRGVLSNRGLFTSDQTLMTSPITQAQVFQNAQNPFLWANKFAAA  299

Query  1049  MVKMGKLGVLTGNAGEIRANCRVVN  975
             MV MGK+GVLTGN+GEIRA+CRV+N
Sbjct  300   MVNMGKIGVLTGNSGEIRASCRVIN  324



>ref|XP_008377046.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Malus domestica]
Length=333

 Score =   478 bits (1230),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 229/328 (70%), Positives = 260/328 (79%), Gaps = 13/328 (4%)
 Frame = -3

Query  1919  MILLSCHPI-------------VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAA  1779
             ++LL+ +PI              + ++LQVGFY  SC  AE +VKDEV+KAFFRD GV A
Sbjct  5     IVLLTANPIDYRVYYNVSNFERSVHSQLQVGFYTTSCTLAETIVKDEVQKAFFRDPGVTA  64

Query  1778  GLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGV  1599
             GLVR+HFHDCFVRGCD SVLIDST +N AEKDSPANNPSLRGFEVIDKAKARLE+ C+GV
Sbjct  65    GLVRMHFHDCFVRGCDASVLIDSTSSNTAEKDSPANNPSLRGFEVIDKAKARLEAACRGV  124

Query  1598  VSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCN  1419
             +SCADI+AFAARDS+ +T GLGYDVPAGRRD   S AS+    LP P FNVD LT LF N
Sbjct  125   ISCADIVAFAARDSIVLTRGLGYDVPAGRRDSRSSKASDXTRKLPFPTFNVDNLTQLFAN  184

Query  1418  KGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
             KGFTQ+EMVTLSGAHTIGRSHCTSFSNRL NF  TT QD SLDP YAA+LKQQCPQG+ +
Sbjct  185   KGFTQEEMVTLSGAHTIGRSHCTSFSNRLTNFXATTNQDPSLDPAYAAQLKQQCPQGNTN  244

Query  1238  PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKF  1059
              NLVV MDPA+P + D +YY  +L NRGL TSDQTLLT+P+TA QV  NAR P  WK KF
Sbjct  245   ANLVVPMDPASPIVTDASYYAGILKNRGLFTSDQTLLTNPATANQVKHNARIPLLWKKKF  304

Query  1058  AAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             +AAMVKMG+L VL GNAGEIRANCR +N
Sbjct  305   SAAMVKMGQLEVLMGNAGEIRANCRAIN  332



>gb|KHG13653.1| Peroxidase 5 [Gossypium arboreum]
Length=329

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 270/330 (82%), Gaps = 5/330 (2%)
 Frame = -3

Query  1967  EMSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRG  1788
             +M    LS  S +   ++   C    + ++LQVGFY+++CR  E +VK+EV KA  +DRG
Sbjct  3     KMRPSKLSLVSVILSVLLFSQC----VLSQLQVGFYKDTCRLVEFIVKEEVVKAIIKDRG  58

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             +AA L+R+HFHDCFVRGCD S+L+DSTP++ AEKDS ANNPSLRG+EVID AKARLE +C
Sbjct  59    LAAALMRMHFHDCFVRGCDASILLDSTPSSIAEKDSFANNPSLRGYEVIDNAKARLEVVC  118

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
             KGVVSCADI+AFAARDS+E+ GGLGYDVPAGRRDG  SLASE+  NLP P FNVDQLT +
Sbjct  119   KGVVSCADIVAFAARDSIEMAGGLGYDVPAGRRDGRTSLASEIIGNLPPPTFNVDQLTQM  178

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG  1248
             F NKGFTQ+EMVTLSG HT+GRSHC+SFS+RLYNF+ T  QD+SLDP YAAKLKQQCPQG
Sbjct  179   FANKGFTQEEMVTLSGGHTLGRSHCSSFSDRLYNFSGTLKQDASLDPTYAAKLKQQCPQG  238

Query  1247  SKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWK  1068
             S DPN+VV M  +TP+I D  YY ++LANRGL TSD TLLT P+TA QV++NA+ P +WK
Sbjct  239   STDPNVVVPMT-STPSIADAGYYIDILANRGLFTSDHTLLTSPATANQVAENAKNPIQWK  297

Query  1067  SKFAAAMVKMGKLGVLTGNAGEIRANCRVV  978
             +KFAAAMVKMG+L VLTG+ GEIRANCRV+
Sbjct  298   AKFAAAMVKMGQLDVLTGSEGEIRANCRVI  327



>ref|XP_007136358.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
 gb|ESW08352.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
Length=327

 Score =   468 bits (1204),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 259/322 (80%), Gaps = 9/322 (3%)
 Frame = -3

Query  1913  LLSCHPIVL---------EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVH  1761
             +L C  IVL           +LQVGFY  SC  AE +VKDEVRKA   + G+AAGLVR+H
Sbjct  5     MLKCITIVLVVYLMNQNAHCELQVGFYSYSCGMAEFIVKDEVRKAVSNNPGIAAGLVRMH  64

Query  1760  FHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADI  1581
             FHDCF+RGCD SVL+DSTP+N AEKDSPAN PSLRG+EVID AKA+LE++C G+VSCADI
Sbjct  65    FHDCFIRGCDASVLLDSTPSNTAEKDSPANKPSLRGYEVIDHAKAQLEAVCPGIVSCADI  124

Query  1580  LAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQK  1401
             +AFAARDSVE+ GGLGYDVPAGRRDG ISLAS+    LP P FNV+QLT LF  KG TQ 
Sbjct  125   VAFAARDSVELAGGLGYDVPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQD  184

Query  1400  EMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQ  1221
             EMVTLSGAHTIGRSHC+SFSNRLYNF+ T+ +D SLDP YAA LK+QCPQGS +PNLVV 
Sbjct  185   EMVTLSGAHTIGRSHCSSFSNRLYNFSGTSSKDPSLDPSYAALLKRQCPQGSTNPNLVVP  244

Query  1220  MDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVK  1041
             M+P++P I DV YY ++L+NRGL TSDQTLLT+  TA QV QNAR  ++W SKFA AMVK
Sbjct  245   MNPSSPGIADVGYYVDILSNRGLFTSDQTLLTNAETASQVKQNARDGYQWASKFADAMVK  304

Query  1040  MGKLGVLTGNAGEIRANCRVVN  975
             MG++ VLTGNAGEIR NCRVV+
Sbjct  305   MGQISVLTGNAGEIRTNCRVVS  326



>dbj|BAA77387.1| peroxidase 1 [Scutellaria baicalensis]
Length=322

 Score =   465 bits (1197),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 254/311 (82%), Gaps = 1/311 (0%)
 Frame = -3

Query  1904  CHPIVL-EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDG  1728
             C+ IVL EA+LQ GFY+ SC  AE +VK EVR AFFRD G+AAGL+R+HFHDCFVRGCDG
Sbjct  11    CYYIVLSEAQLQKGFYQLSCGFAETIVKQEVRNAFFRDSGIAAGLIRLHFHDCFVRGCDG  70

Query  1727  SVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEI  1548
             SVLIDST +N AEKDSP NNPSLRGFEV+D  K RLE  C GVVSCADILA+AARDSVEI
Sbjct  71    SVLIDSTGSNTAEKDSPPNNPSLRGFEVVDAIKRRLEVSCPGVVSCADILAYAARDSVEI  130

Query  1547  TGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTI  1368
             T GLGYDV AGRRDG +SLASE  +NLP P FNVDQLT  F NKG +Q EMVTLSGAHT+
Sbjct  131   TRGLGYDVLAGRRDGRVSLASEALSNLPPPSFNVDQLTRAFANKGLSQDEMVTLSGAHTL  190

Query  1367  GRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDV  1188
             GRSHCTSF+NRLYNF+T++ QD +LD  YA++LKQQCPQGS +PNLVV MDP TPA+ DV
Sbjct  191   GRSHCTSFNNRLYNFSTSSMQDPTLDLAYASQLKQQCPQGSANPNLVVPMDPPTPAVSDV  250

Query  1187  AYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNA  1008
             +YY  VLANRGL TSDQTLLT P T  QV QNA+  F W  KFA AMV MG +GV+TG A
Sbjct  251   SYYRGVLANRGLFTSDQTLLTSPQTRAQVLQNAQNQFLWWRKFAGAMVSMGNIGVITGGA  310

Query  1007  GEIRANCRVVN  975
             GEIR +CRV+N
Sbjct  311   GEIRRDCRVIN  321



>ref|XP_010103062.1| Peroxidase 5 [Morus notabilis]
 gb|EXB94711.1| Peroxidase 5 [Morus notabilis]
Length=332

 Score =   465 bits (1196),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 229/334 (69%), Positives = 269/334 (81%), Gaps = 14/334 (4%)
 Frame = -3

Query  1952  NLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGL  1773
             +++C S++ L  ++LSC  +   ++L+VGFY  SC  AE +VKDEVRK   +D GVAAGL
Sbjct  6     HITCLSTVLL--VILSCQSV--HSELRVGFYSLSCPFAEYIVKDEVRKGLIKDPGVAAGL  61

Query  1772  VRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVS  1593
             VR+HFHDCFVRGCD SVLIDSTP+N AEKDSPANNPSLRGFEVID AKARLE++CKGVVS
Sbjct  62    VRLHFHDCFVRGCDASVLIDSTPSNTAEKDSPANNPSLRGFEVIDNAKARLEAVCKGVVS  121

Query  1592  CADILAFAARDSVEI-------TGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLT  1434
             CADI+AFAARDS E        TGGL YDVPAGRRDG ISL+SE + NLP P FNVDQLT
Sbjct  122   CADIVAFAARDSTEFVRGTIFQTGGLIYDVPAGRRDGRISLSSETS-NLPPPTFNVDQLT  180

Query  1433  TLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP  1254
              LF  KG TQ+EMVTLSGAHTIGRSHC+SFS+RLYNFN  + QD S DP YA++LKQQCP
Sbjct  181   QLFVKKGLTQEEMVTLSGAHTIGRSHCSSFSDRLYNFNGKSSQDPSWDPTYASRLKQQCP  240

Query  1253  QGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFR  1074
             QG  + N VV M+P++PAI DV YY ++LANRGL TSDQT L+  +TA QV+Q A+ P  
Sbjct  241   QG--NANTVVPMNPSSPAISDVGYYVDILANRGLFTSDQTFLSTSATANQVNQYAKYPIL  298

Query  1073  WKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVNH  972
             W SKFAAAMVKMG+L VLTG+AGEIRANCRV+N+
Sbjct  299   WMSKFAAAMVKMGQLDVLTGSAGEIRANCRVINN  332



>ref|XP_004502775.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   463 bits (1191),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 261/317 (82%), Gaps = 0/317 (0%)
 Frame = -3

Query  1925  LTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCF  1746
             +T++++    +   ++L+VGFY  SC  AEL+VKDEVRK+F ++ G+AAGLVR+HFHDCF
Sbjct  10    ITILVIYFLNVSAHSQLEVGFYSYSCGMAELIVKDEVRKSFNKNPGIAAGLVRMHFHDCF  69

Query  1745  VRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             +RGCD SVL+DSTP+N AEKDSPAN PSLRGFEVID AKA+LE++C G VSCADI+AFAA
Sbjct  70    IRGCDASVLLDSTPSNTAEKDSPANKPSLRGFEVIDNAKAKLEAVCNGTVSCADIIAFAA  129

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDSVE+ GG+GYDVPAGRRDG ISLAS+   +LP P FNV+QLT LF  KG TQ+EMVTL
Sbjct  130   RDSVELAGGIGYDVPAGRRDGKISLASDTRTDLPPPTFNVNQLTQLFAKKGLTQEEMVTL  189

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPAT  1206
             SGAHTIGR+HC++FSNRLYNF++T  QD +LD  Y   LK+QCPQG+ +PNL V MDP++
Sbjct  190   SGAHTIGRAHCSAFSNRLYNFSSTLKQDPNLDSSYVPLLKRQCPQGNTNPNLAVPMDPSS  249

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   DV YY N+L +RGL TSDQTLLT+  TA+QV++NAR P+ W  KFA AMVKMG++G
Sbjct  250   PGTADVGYYINILEDRGLFTSDQTLLTNTGTARQVNKNARNPYLWADKFADAMVKMGQIG  309

Query  1025  VLTGNAGEIRANCRVVN  975
             VLTGNAGEIR NCR+VN
Sbjct  310   VLTGNAGEIRTNCRMVN  326



>ref|XP_003602405.1| Peroxidase [Medicago truncatula]
 gb|AES72656.1| peroxidase family protein [Medicago truncatula]
Length=327

 Score =   463 bits (1191),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 217/304 (71%), Positives = 254/304 (84%), Gaps = 0/304 (0%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
              ++L+VGFY  SC  AE +VKDEVRK+F ++ G+AAGLVR+HFHDCF+RGCD SVL+DST
Sbjct  23    HSQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDST  82

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
              +N AEKDSPAN PSLRGFEVID AKA+LE  CKG+VSCADI+AFAARDSVE+ GGLGYD
Sbjct  83    LSNIAEKDSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYD  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG ISLAS+    LP P FNV+QLT LF  KG TQ EMVTLSGAHTIGRSHC++
Sbjct  143   VPAGRRDGKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSA  202

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             FS RLYNF++T+ QD SLDP YAA LK+QCPQG+ + NLVV MDP++P   DV YY ++L
Sbjct  203   FSKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDIL  262

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
             ANRGL TSDQTLLT+  TA++V QNAR P+ W +KFA AMVKMG++GVLTGNAGEIR NC
Sbjct  263   ANRGLFTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNC  322

Query  986   RVVN  975
             RVVN
Sbjct  323   RVVN  326



>emb|CDP12791.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   475 bits (1222),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 271/340 (80%), Gaps = 3/340 (1%)
 Frame = -3

Query  1988  INKQMKKEMSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRK  1809
             I ++ +  M+S  LS   S    +++  C  I L A+LQVGFY   C   E ++K+EVR 
Sbjct  340   IARRRRSIMASNKLSFILS-TFILVVYQCV-IPLNAQLQVGFYNGVCDFVESMIKEEVRD  397

Query  1808  AFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAK  1629
             AF  DRGVAAGLVR+HFHDCFVRGCDGSVLIDSTP+N+AEKD+PANNPSLRGFEVID AK
Sbjct  398   AFILDRGVAAGLVRMHFHDCFVRGCDGSVLIDSTPSNQAEKDAPANNPSLRGFEVIDDAK  457

Query  1628  ARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFN  1449
             +RLE +C G+VSCADILA+AARDSVEITGG GYDVPAGRRDG IS + E + NLP+P   
Sbjct  458   SRLEFLCPGIVSCADILAYAARDSVEITGGPGYDVPAGRRDGRISSSREASANLPSPALG  517

Query  1448  VDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKL  1269
             V+QL   F NKG    EMVTLSGAHTIGRSHC SFSNRL+NFNTTT QD S+DP YAA+L
Sbjct  518   VNQLIQAFANKGLRPDEMVTLSGAHTIGRSHCISFSNRLFNFNTTTTQDPSMDPSYAAQL  577

Query  1268  KQQCPQGS-KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQN  1092
              QQCPQGS  +PNLVV MDP+TP + D  YY N+LANRGL TSDQTLLT+PSTA QV QN
Sbjct  578   AQQCPQGSISNPNLVVPMDPSTPTVMDTCYYDNILANRGLFTSDQTLLTNPSTANQVIQN  637

Query  1091  ARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVNH  972
             A+ P  W++KFA AMV+MG++GVLTG+AGEIRANCRV+N+
Sbjct  638   AQNPLLWENKFADAMVRMGQIGVLTGDAGEIRANCRVINN  677


 Score =   376 bits (965),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 227/305 (74%), Gaps = 5/305 (2%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             ++A+L VGFY + C   E ++ +EV KAF +D+G+A GLVR HFHDCFVRGCDGS+ IDS
Sbjct  18    IKAQLVVGFYNSRCPRTESIIGEEVLKAFLKDKGIAPGLVRAHFHDCFVRGCDGSLFIDS  77

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N AEKD P N  +LRG EV+D AKARLE+ CKGVVSCADILA+AARDSV ITGG G+
Sbjct  78    TPTNVAEKDGPPNGITLRGLEVVDNAKARLEAECKGVVSCADILAYAARDSVVITGGRGW  137

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG IS A+E   ++P PF N+DQ+T  F  K  T  EM+ LSGAHTIGRSHCT
Sbjct  138   GVPAGRRDGRISRAAETI-DIPGPFQNLDQITQAFAKKNMTLDEMIALSGAHTIGRSHCT  196

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPATPAIFDVAYY  1179
             SFSNRLY+F+    QD SLD   AA LK QCPQG +   DPNLVV M+  +PA+F+ +YY
Sbjct  197   SFSNRLYDFSPANSQDPSLDRFLAALLKIQCPQGPQGDVDPNLVVPMN-RSPALFENSYY  255

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              ++LA+R +LTSDQTL+T P +  +V + A     W+  FA AMVKM ++ VLTG AGEI
Sbjct  256   RDILAHRVVLTSDQTLITSPESLSEVREYAFNEREWQEDFADAMVKMSQIEVLTGTAGEI  315

Query  998   RANCR  984
             R+NCR
Sbjct  316   RSNCR  320



>gb|KHN19575.1| Peroxidase 5 [Glycine soja]
Length=327

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 249/304 (82%), Gaps = 0/304 (0%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
              ++LQVG+Y  SC  AE +VKDEVRK    + G+AAGLVR+HFHDCF+RGCD SVL+DST
Sbjct  23    HSELQVGYYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHFHDCFIRGCDASVLLDST  82

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
             P N AEKDSPAN PSLRG+EVID AKA+LE++C G+VSCADI+AFAARDSVE   GLGYD
Sbjct  83    PLNTAEKDSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIVAFAARDSVEFARGLGYD  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG ISLAS+    LP P FNV+QLT LF  KG TQ EMVTLSGAHTIGRSHC++
Sbjct  143   VPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSA  202

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             FS+RLYNF+TT+ QD SLDP YAA LK+QCPQGS + NLVV MDP++P I DV YY ++L
Sbjct  203   FSSRLYNFSTTSSQDPSLDPSYAALLKRQCPQGSTNQNLVVPMDPSSPGIADVGYYVDIL  262

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
             ANRGL TSDQTLLT+  TA QV QNAR P+ W S+FA AMVKMG++ VL GNAGEIR NC
Sbjct  263   ANRGLFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKMGQIIVLKGNAGEIRTNC  322

Query  986   RVVN  975
             RVVN
Sbjct  323   RVVN  326



>gb|AHL39182.1| class III peroxidase [Populus trichocarpa]
Length=329

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 265/330 (80%), Gaps = 4/330 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS+ L+  S +    +L  C  +  +++LQVGFYRNSCR AEL+V++ VR    +DRGV
Sbjct  3     MSSKKLTQLSVICWVAVLF-CQSV--QSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGC+GSVL+DST +N AEKDSPANNPSLRG+EV+D A+A+LE+ C+
Sbjct  60    AAGLVRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANNPSLRGYEVVDDARAKLEAECR  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADILAFAARDS ++TGG+ YDVPAGRRDG +SL +E ++ LP P  NVDQLT  F
Sbjct  120   GVVSCADILAFAARDSFDLTGGISYDVPAGRRDGTVSLVAETSD-LPPPTLNVDQLTQNF  178

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
               KG +Q+EMVTLSG HTIGRSHCTSF +RLYNF+ T  QD SLD  YAA LKQ+CPQ S
Sbjct  179   AKKGLSQEEMVTLSGGHTIGRSHCTSFRDRLYNFSGTNSQDPSLDATYAASLKQKCPQAS  238

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              D NLVV MD  TP I DV+YY ++LANRGL TSDQTLL++ +TA QV+ N+R+P  WK 
Sbjct  239   TDTNLVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVNSNSRSPLGWKR  298

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFAAAMVKMG++ VLTGN GEIRANCRV+N
Sbjct  299   KFAAAMVKMGQIEVLTGNTGEIRANCRVIN  328



>ref|XP_002321949.2| hypothetical protein POPTR_0015s00580g [Populus trichocarpa]
 gb|EEF06076.2| hypothetical protein POPTR_0015s00580g [Populus trichocarpa]
Length=329

 Score =   460 bits (1184),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 265/330 (80%), Gaps = 4/330 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS+ L+  S +    +L  C  +  +++LQVGFYRNSCR AEL+V++ VR    +DRGV
Sbjct  3     MSSKKLTQLSVICWVAVLF-CQSV--QSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGV  59

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGLVR+HFHDCFVRGC+GSVL+DST +N AEKDSPANNPSLRG+EV+D A+A+LE+ C+
Sbjct  60    AAGLVRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANNPSLRGYEVVDDARAKLEAECR  119

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADILAFAARDS ++TGG+ YDVPAGRRDG +SL +E ++ LP P  NVDQLT  F
Sbjct  120   GVVSCADILAFAARDSFDLTGGISYDVPAGRRDGTVSLVAETSD-LPPPTLNVDQLTQNF  178

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
               KG +Q+EMVTLSG HTIGRSHCTSF +RLYNF+ T  QD SLD  YAA LKQ+CPQ S
Sbjct  179   AKKGLSQEEMVTLSGRHTIGRSHCTSFRDRLYNFSGTNSQDPSLDATYAASLKQKCPQAS  238

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              D NLVV MD  TP I DV+YY ++LANRGL TSDQTLL++ +TA QV+ N+R+P  WK 
Sbjct  239   TDTNLVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVNSNSRSPLGWKR  298

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFAAAMVKMG++ VLTGN GEIRANCRV+N
Sbjct  299   KFAAAMVKMGQIEVLTGNTGEIRANCRVIN  328



>ref|XP_011003281.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=328

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 220/326 (67%), Positives = 261/326 (80%), Gaps = 6/326 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVL-----EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGL  1773
             SS  LT + + C   VL     +++LQVGFYRNSCR AEL+V++ VR    +DRGVAAGL
Sbjct  3     SSKRLTQLSVVCWVAVLFFQSVQSQLQVGFYRNSCRRAELIVRNAVRDGINKDRGVAAGL  62

Query  1772  VRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVS  1593
             VR+HFHDCFVRGC+GSVL+DST +N AEKDSPAN+ SLRG+EV+D AKA+LE+ C+GVVS
Sbjct  63    VRMHFHDCFVRGCEGSVLLDSTSSNTAEKDSPANSNSLRGYEVVDDAKAKLEAECRGVVS  122

Query  1592  CADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKG  1413
             CADILAFAARDS ++TGG+ YDVPAGRRDG +SLA+E ++ LP P  NVDQLT  F  KG
Sbjct  123   CADILAFAARDSFDLTGGISYDVPAGRRDGTVSLAAETSD-LPPPTLNVDQLTQNFAKKG  181

Query  1412  FTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPN  1233
              +Q+EMVTLSG HTIGRSHCTSF NRLYNF+    QD SLD  YAA LKQ+CPQ S DPN
Sbjct  182   LSQEEMVTLSGGHTIGRSHCTSFRNRLYNFSGANSQDPSLDATYAASLKQKCPQASTDPN  241

Query  1232  LVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAA  1053
             LVV MD  TP I DV+YY ++LANRGL TSDQTLL++ +TA QV  N+R+P  WK KFAA
Sbjct  242   LVVPMDTITPTISDVSYYRDILANRGLFTSDQTLLSNTATASQVKSNSRSPLGWKRKFAA  301

Query  1052  AMVKMGKLGVLTGNAGEIRANCRVVN  975
             AMVKMG++ VLTGN GEIRANCRV+N
Sbjct  302   AMVKMGQIEVLTGNTGEIRANCRVIN  327



>ref|NP_001241968.1| uncharacterized protein LOC100779031 precursor [Glycine max]
 gb|ACU20835.1| unknown [Glycine max]
Length=327

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/304 (71%), Positives = 249/304 (82%), Gaps = 0/304 (0%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
              ++LQVG+Y  SC  AE +VKDEVRK    + G+AAGLVR+HFHDCF+RGCD SVL+DST
Sbjct  23    HSELQVGYYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHFHDCFIRGCDASVLLDST  82

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
             P N AEKDSPAN PSLRG+EVID AKA+LE++C G+VSCADI+AFAARDSVE   GLGY+
Sbjct  83    PLNTAEKDSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIVAFAARDSVEFARGLGYN  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG ISLAS+    LP P FNV+QLT LF  KG TQ EMVTLSGAHTIGRSHC++
Sbjct  143   VPAGRRDGRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSA  202

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             FS+RLYNF+TT+ QD SLDP YAA LK+QCPQGS + NLVV MDP++P I DV YY ++L
Sbjct  203   FSSRLYNFSTTSSQDPSLDPSYAALLKRQCPQGSTNQNLVVPMDPSSPGIADVGYYVDIL  262

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
             ANRGL TSDQTLLT+  TA QV QNAR P+ W S+FA AMVKMG++ VL GNAGEIR NC
Sbjct  263   ANRGLFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKMGQIIVLKGNAGEIRTNC  322

Query  986   RVVN  975
             RVVN
Sbjct  323   RVVN  326



>ref|XP_011043754.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=329

 Score =   457 bits (1176),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 219/305 (72%), Positives = 252/305 (83%), Gaps = 0/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             +++ LQVGFYRNSCR AE +V+  VR A  +DRGVAAGLVR+HFHDCFVRGC+GSVL+DS
Sbjct  24    VQSHLQVGFYRNSCRRAESIVRGAVRDALRQDRGVAAGLVRLHFHDCFVRGCEGSVLLDS  83

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T +NKAEKDSPAN PSLRGFEVID AKARLE+ CKGVVSCADILAFAARDS ++TGGL Y
Sbjct  84    TSSNKAEKDSPANFPSLRGFEVIDDAKARLEAECKGVVSCADILAFAARDSFDLTGGLDY  143

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVPAGRRDG +SLASE  +NLP P FNVDQLT  F +KG TQ+EMVTLSGAHTIG SHC+
Sbjct  144   DVPAGRRDGIVSLASETFSNLPPPNFNVDQLTRRFSDKGLTQEEMVTLSGAHTIGTSHCS  203

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             +F+ RLYNF+ T  QD SLD  YAA L++ CPQ S DPNL V MD  TP I DV YY ++
Sbjct  204   AFTYRLYNFSGTNSQDPSLDSQYAASLRKSCPQDSTDPNLEVPMDTRTPTISDVNYYKDI  263

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LANRGL +SDQ LLT+P+TA +V  NAR+P  WK KFAAAMVKMG++ VLTGN GEIRAN
Sbjct  264   LANRGLFSSDQILLTNPATASEVKSNARSPSGWKRKFAAAMVKMGQIEVLTGNKGEIRAN  323

Query  989   CRVVN  975
             CRV+N
Sbjct  324   CRVIN  328



>ref|XP_010671317.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010671319.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   454 bits (1168),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 253/315 (80%), Gaps = 0/315 (0%)
 Frame = -3

Query  1919  MILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVR  1740
              +  SC  + LEA+L+VGFY NSC  AE +V++EV K F  D+G+A GLVR+HFHDCFVR
Sbjct  17    FLAFSCLCVQLEAQLRVGFYCNSCPLAERIVREEVMKGFMNDKGIAPGLVRMHFHDCFVR  76

Query  1739  GCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARD  1560
             GCDGSVLIDST +N AEKDSPAN+PSLRGFEVID AK RLES CKGVVSCADILAFAARD
Sbjct  77    GCDGSVLIDSTSSNTAEKDSPANSPSLRGFEVIDNAKTRLESQCKGVVSCADILAFAARD  136

Query  1559  SVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSG  1380
             SV IT G  Y+VP+GRRDG +S  SEV  NLP   FNVDQLT  F NK  TQ+EMVTLSG
Sbjct  137   SVAITRGQSYNVPSGRRDGRVSSESEVLQNLPGFSFNVDQLTQNFANKNLTQEEMVTLSG  196

Query  1379  AHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPA  1200
             AHT+GRSHCTS  +RLYNFN T G DS+L+  YA +L+QQCP+GS D +LVV MDP TP 
Sbjct  197   AHTLGRSHCTSVGSRLYNFNGTNGPDSTLESKYAGQLQQQCPEGSTDSSLVVSMDPQTPF  256

Query  1199  IFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVL  1020
             + DV YY ++LANRGL TSDQTLL++ +TA +V+QNAR  F W  KFAAAMVKMG++ VL
Sbjct  257   VTDVNYYQDLLANRGLFTSDQTLLSNSNTANEVNQNARNQFLWMRKFAAAMVKMGQIEVL  316

Query  1019  TGNAGEIRANCRVVN  975
             TGNAGEIRANCRV+N
Sbjct  317   TGNAGEIRANCRVIN  331



>gb|AFK42142.1| unknown [Medicago truncatula]
Length=327

 Score =   450 bits (1157),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 212/304 (70%), Positives = 249/304 (82%), Gaps = 0/304 (0%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
              ++L+VGFY  SC  AE +VKDEVRK+F ++ G+AAGLVR+HFHDCF+RGCD SVL+DST
Sbjct  23    HSQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDST  82

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
              +N AEKDSPAN PSLRGFEVID AKA+LE   KG+VSCADI+AFAARDSVE+ GGLGYD
Sbjct  83    LSNIAEKDSPANKPSLRGFEVIDNAKAKLEEERKGIVSCADIVAFAARDSVELAGGLGYD  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRD  ISLAS+    LP P FNV+QLT LF  KG TQ EMVTLSG HTIGRSHC++
Sbjct  143   VPAGRRDEKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGVHTIGRSHCSA  202

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             FS RLYNF++T+ QD SLDP YAA LK+QCPQG+ + NLVV MDP++P   D  YY ++L
Sbjct  203   FSKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADEGYYNDIL  262

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
             ANRGL TSDQT LT+  TA++V QNAR P+ W +KFA AMVKMG++GVLTGNAGEIR NC
Sbjct  263   ANRGLFTSDQTFLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNC  322

Query  986   RVVN  975
             RVVN
Sbjct  323   RVVN  326



>ref|XP_011043751.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=329

 Score =   446 bits (1146),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 248/305 (81%), Gaps = 0/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             +++ LQVGFYRNSCR AE +V+  VR A  +DRGVAAGL+R+HFHDCFVRGC+GSVL+DS
Sbjct  24    VQSHLQVGFYRNSCRRAESIVRRAVRHAIHQDRGVAAGLIRMHFHDCFVRGCEGSVLLDS  83

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP+NKAEKDSP N PSL GFEVID AKA+LE+ C+GVVSCADILAFAARDS ++TGGL Y
Sbjct  84    TPSNKAEKDSPVNFPSLHGFEVIDDAKAKLEAECQGVVSCADILAFAARDSFDLTGGLDY  143

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVPAGRRDG +SLASE  +NLP P FNVDQLT  F +KG TQ+EMVTLSGAHTIG S C 
Sbjct  144   DVPAGRRDGIVSLASETFSNLPPPNFNVDQLTRRFSDKGLTQEEMVTLSGAHTIGDSLCK  203

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SF++RLYNF+ T   D SLD  YAA L++ CPQ S DPN  V MD  TP I DV YY ++
Sbjct  204   SFTDRLYNFSGTNSPDPSLDSRYAASLRKSCPQDSTDPNFEVPMDTRTPTISDVNYYKDI  263

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LANRGL TSDQTLLT+ +TA++V  NAR+  RWK KFAAAMVKMG++ VLTGN GEIR N
Sbjct  264   LANRGLFTSDQTLLTNIATAREVKSNARSSSRWKRKFAAAMVKMGQIEVLTGNKGEIREN  323

Query  989   CRVVN  975
             CRV+N
Sbjct  324   CRVIN  328



>ref|XP_010919027.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   443 bits (1139),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 251/319 (79%), Gaps = 1/319 (0%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             + L ++++ C    LEA+LQVGFY  +C  AE++VK +V +A   + G+AAGLVR+HFHD
Sbjct  7     IVLAVMVVLCLSSQLEAQLQVGFYDTTCPQAEIIVKTQVTQALASNIGLAAGLVRMHFHD  66

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLIDST  N AEKDS  N  SLRGFEVI  AKA+LE+ C+GVVSCADILAF
Sbjct  67    CFVRGCDGSVLIDSTSTNTAEKDSSINK-SLRGFEVIYSAKAQLEATCEGVVSCADILAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS+ +TGGL Y VPAGRRDG +SLASE   NLP P FNVDQ+T  F  KG TQ +MV
Sbjct  126   AARDSIALTGGLSYQVPAGRRDGTVSLASETFTNLPGPNFNVDQVTQSFEVKGLTQDQMV  185

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAHTIGRSHC+SFSNRLY+F+T T QD SLD  YAA+LKQQCPQGS DPNLVV MDP
Sbjct  186   TLSGAHTIGRSHCSSFSNRLYDFSTNTKQDPSLDATYAAQLKQQCPQGSTDPNLVVPMDP  245

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP I D +YY ++L NRGL TSDQTLL++ +TA  V QNA     W++KFAAAMV MG+
Sbjct  246   PTPNIVDTSYYNDILGNRGLFTSDQTLLSEAATASLVRQNAANSLLWQNKFAAAMVAMGQ  305

Query  1031  LGVLTGNAGEIRANCRVVN  975
             +GVLTGN GEIR NCRV+N
Sbjct  306   IGVLTGNNGEIRLNCRVIN  324



>ref|XP_010919026.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   442 bits (1138),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 252/319 (79%), Gaps = 1/319 (0%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             + L ++++ C    LEA+LQVGFY + C  AEL+VK +V  A   + G+AAGLVR+HFHD
Sbjct  7     VVLAVMVVFCLSSQLEAQLQVGFYDSICPQAELIVKTQVTVALLSNIGLAAGLVRMHFHD  66

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CF+RGCDGSVLIDST  N AEKDS  N  SLRGF+VID AKA LE+ C G+VSCADILA 
Sbjct  67    CFIRGCDGSVLIDSTSTNTAEKDSSINK-SLRGFDVIDSAKALLEATCPGMVSCADILAI  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS+E+TGGL Y+VPAGRRDG +SLASE   NLP P FNVDQLT  F  KG TQ++MV
Sbjct  126   AARDSIELTGGLSYEVPAGRRDGTVSLASETFTNLPGPGFNVDQLTQSFKVKGLTQEQMV  185

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAHTIGRSHC+SFSNRLYNF+TT  +D SLD  YAA+L Q+CPQGS DPNLVV MDP
Sbjct  186   TLSGAHTIGRSHCSSFSNRLYNFSTTVKEDPSLDATYAAQLMQECPQGSTDPNLVVPMDP  245

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
             ++P I D  YY+N+LANRGL TSDQTLL+  +TA QV QNA     W++KFAAAMV MG+
Sbjct  246   SSPNIVDTGYYSNILANRGLFTSDQTLLSQVATAGQVRQNAANSMLWQNKFAAAMVAMGQ  305

Query  1031  LGVLTGNAGEIRANCRVVN  975
             +GVLTG+ GEIR NCRVVN
Sbjct  306   IGVLTGSNGEIRRNCRVVN  324



>ref|XP_006446429.1| hypothetical protein CICLE_v10017508mg [Citrus clementina]
 gb|ESR59669.1| hypothetical protein CICLE_v10017508mg [Citrus clementina]
Length=340

 Score =   442 bits (1136),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 249/319 (78%), Gaps = 25/319 (8%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
               + +++L C   ++ ++LQVGFYRNSC +AEL+VKDEVRK+  +D+GVAAGLVR+HFHD
Sbjct  47    FVILIVVLLC--TIVNSQLQVGFYRNSCSSAELIVKDEVRKSVLKDKGVAAGLVRMHFHD  104

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD SVLIDST +N AEKDSP NNPSLRGFEVID AKA LES+CKG+VSCADI+AF
Sbjct  105   CFVRGCDASVLIDSTSSNTAEKDSPVNNPSLRGFEVIDNAKAALESVCKGIVSCADIVAF  164

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSVEI+GGLGYDVP+GRRDG ISLASE      +P+ +                   
Sbjct  165   AARDSVEISGGLGYDVPSGRRDGRISLASEALTQSTSPYIH-------------------  205

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
                 +HTIGRSHCTSFSNRLYNF+ T  QD SL+P+YAA+LKQQCPQ   +PNLVV M+P
Sbjct  206   ----SHTIGRSHCTSFSNRLYNFSGTMSQDPSLNPMYAAQLKQQCPQDGTNPNLVVPMNP  261

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              +P+I D  YY ++L NRGL TSDQTLL+DP TA QV+QNA+ P  WK+ FAAAMVKMG+
Sbjct  262   GSPSIADTGYYIDILRNRGLFTSDQTLLSDPETASQVNQNAKTPKLWKTNFAAAMVKMGQ  321

Query  1031  LGVLTGNAGEIRANCRVVN  975
             +GVLT +AGEIRANCRVVN
Sbjct  322   IGVLTASAGEIRANCRVVN  340



>gb|AAF63024.1|AF244921_1 peroxidase prx12 precursor [Spinacia oleracea]
Length=331

 Score =   441 bits (1133),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 213/313 (68%), Positives = 245/313 (78%), Gaps = 0/313 (0%)
 Frame = -3

Query  1913  LLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGC  1734
             +LSC  + LEA+LQVGFY  SC +AE +V++EV K F  D+GVA GLVR+HFHDCFVRGC
Sbjct  19    VLSCLSVQLEAQLQVGFYCESCPSAERIVREEVMKGFMNDKGVAPGLVRMHFHDCFVRGC  78

Query  1733  DGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSV  1554
             DGSVLIDST +N AEKDSPANNPSLRGFEVID AK RLE+ CKGVVSCADILAFAARDSV
Sbjct  79    DGSVLIDSTSSNTAEKDSPANNPSLRGFEVIDSAKTRLEAECKGVVSCADILAFAARDSV  138

Query  1553  EITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAH  1374
              +T G  YDVP+GR+DG +SL SE   N+P   FNV +LT  F NK  TQ+EMVTLSGAH
Sbjct  139   AMTRGQRYDVPSGRKDGRVSLVSEGFQNIPGFTFNVTRLTQSFANKNLTQEEMVTLSGAH  198

Query  1373  TIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIF  1194
             TIGRSHCTS SNRLYNF+ T G D +LD  YA +L+QQCPQGS + N VV MDP +P I 
Sbjct  199   TIGRSHCTSVSNRLYNFSGTNGADPTLDSKYAGQLQQQCPQGSTNSNQVVLMDPVSPFIT  258

Query  1193  DVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTG  1014
             DV YY +VLAN+GL  SDQTLLTD +TA +V+QN R  F W  KFAAAMV MG++ VLTG
Sbjct  259   DVNYYQDVLANKGLFRSDQTLLTDSNTANEVNQNGRNQFLWMRKFAAAMVNMGQIEVLTG  318

Query  1013  NAGEIRANCRVVN  975
               GEIR NC V+N
Sbjct  319   TNGEIRTNCSVIN  331



>ref|XP_010671316.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 242/305 (79%), Gaps = 0/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             L+A LQ GFY  SC  AE +VKDEVR+AFF DRG AAGLVR+HFHDCFVRGCD SVL+DS
Sbjct  30    LKADLQPGFYMQSCPMAEFIVKDEVRQAFFSDRGYAAGLVRLHFHDCFVRGCDASVLLDS  89

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N AEKD+ ANNPSLRGF+VID AKARLE++C G VSCADILA+AARDSVE+TGG GY
Sbjct  90    TPGNAAEKDAEANNPSLRGFDVIDNAKARLENLCPGTVSCADILAYAARDSVEMTGGFGY  149

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVP GRRDG +S +SE   NLP PF +VD LT +F +KG TQ+EMV LSGAHTIGRSHCT
Sbjct  150   DVPGGRRDGRVSSSSEATRNLPPPFADVDLLTKIFGSKGLTQEEMVILSGAHTIGRSHCT  209

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFS RLY+F+TT  QD S++  YAA+L++QCP G+   N+VV MDP +P I D AYY N+
Sbjct  210   SFSKRLYSFSTTAAQDPSINSAYAAQLQRQCPAGNAGANIVVPMDPISPTISDTAYYRNI  269

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             L NRGL TSDQ LL+D +TA  V+  AR P  W  KFA AM  MG++GVLTG+ GEIR+N
Sbjct  270   LNNRGLFTSDQALLSDSTTASLVTLYARNPGLWGRKFATAMGSMGQIGVLTGDEGEIRSN  329

Query  989   CRVVN  975
             CRV+N
Sbjct  330   CRVIN  334



>ref|XP_010671321.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/313 (69%), Positives = 249/313 (80%), Gaps = 2/313 (1%)
 Frame = -3

Query  1910  LSCHPI-VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGC  1734
             LSC  + ++EA+L+VGFY  SC +AE +V++EV K F ++RGVA GL+R+HFHDCFVRGC
Sbjct  16    LSCLSVQIIEAQLRVGFYSRSCPSAERIVREEVMKGFNKNRGVAPGLIRMHFHDCFVRGC  75

Query  1733  DGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSV  1554
             D S+LID+T +N AEKDSPAN+PSLRGFEVID AKARLE+ CKGVVSCADIL FAARDSV
Sbjct  76    DASILIDTTSSNNAEKDSPANSPSLRGFEVIDNAKARLEAQCKGVVSCADILTFAARDSV  135

Query  1553  EITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAH  1374
              IT G  Y V AGRRDG ISL SEV  ++P   FNVDQLT  F  K  TQ+EMVTLSGAH
Sbjct  136   AITLGPRYAVQAGRRDGRISLMSEVLQDVPGFTFNVDQLTQSFLKKKLTQEEMVTLSGAH  195

Query  1373  TIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIF  1194
             TIGRSHCTS +NRLYNFN TTG D +LD  YA +L+QQCPQGS    LVV MD  TP I 
Sbjct  196   TIGRSHCTSITNRLYNFNGTTGPDPTLDSRYAGRLQQQCPQGSAS-TLVVPMDTRTPFIT  254

Query  1193  DVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTG  1014
             DV YY +VLANRGL TSDQTLLT+ +TAK+VSQNAR  F W  KFAAAM+KMG++ VLTG
Sbjct  255   DVNYYRDVLANRGLFTSDQTLLTNSNTAKEVSQNARNQFLWMRKFAAAMIKMGEIEVLTG  314

Query  1013  NAGEIRANCRVVN  975
             +AGEIR NC V+N
Sbjct  315   SAGEIRTNCSVIN  327



>ref|XP_008808268.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   434 bits (1116),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 242/305 (79%), Gaps = 1/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             LEA+L+VGFY  +C  AE +VK +V KA   + G+AAGLVR+HFHDCFVRGCDGSVLIDS
Sbjct  21    LEAQLKVGFYGTTCPQAEPIVKLQVTKALASNIGLAAGLVRMHFHDCFVRGCDGSVLIDS  80

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N AEKDS  N  SLRGFEVID AKA+LE+ C GVVSCADILAFAARDS+ +TGG+ Y
Sbjct  81    TSTNTAEKDSSINT-SLRGFEVIDSAKAQLEATCNGVVSCADILAFAARDSIAMTGGISY  139

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +SLAS+   NLP P  NVDQLT  F  KG TQ +MVTLSGAHTIGRSHC+
Sbjct  140   QVPAGRRDGRVSLASDTFANLPAPSSNVDQLTQSFQVKGLTQDQMVTLSGAHTIGRSHCS  199

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFSNRLYNFNTT  QD SLD  YAA+LKQQCPQGS +PNLVV MDP +P I D +YY ++
Sbjct  200   SFSNRLYNFNTTVKQDPSLDATYAAQLKQQCPQGSTNPNLVVPMDPPSPNIVDTSYYNDI  259

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             L NRGL TSDQTLL++ +TA  V+QNA     W++KFAAAMV MG++GVLTG+ GEIR N
Sbjct  260   LVNRGLFTSDQTLLSEAATASHVTQNAANSLLWQNKFAAAMVAMGQVGVLTGSNGEIRLN  319

Query  989   CRVVN  975
             CR +N
Sbjct  320   CRAIN  324



>ref|XP_008808296.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   431 bits (1109),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 244/319 (76%), Gaps = 1/319 (0%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             + L ++++ C    LEA+L+VGFY  +C  AEL+VK  V KA   + G+AAGLVR+HFHD
Sbjct  7     IVLAVMVVLCLSSQLEAQLEVGFYDATCPQAELIVKLLVTKAVASNIGLAAGLVRLHFHD  66

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLIDST  N AEKDS  N  SLRGFEVID AKA LE+ C GVVSCADILAF
Sbjct  67    CFVRGCDGSVLIDSTSTNTAEKDSSINT-SLRGFEVIDSAKALLEATCNGVVSCADILAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS+ +TGG+ Y VPAGRRDG +SLAS+   NLP P FNVDQLT  F  KG TQ +MV
Sbjct  126   AARDSIALTGGISYQVPAGRRDGRVSLASDTFANLPAPSFNVDQLTQSFQAKGLTQDQMV  185

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAHTIGRSHC+SFSNRLYNFNTT  QD SLD  YAA+LK+QCPQGS + NLVV MDP
Sbjct  186   TLSGAHTIGRSHCSSFSNRLYNFNTTVKQDPSLDATYAAQLKKQCPQGSTNSNLVVPMDP  245

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              +P I D  YY ++L NRGL TSDQTLL+  +TA  V QNA     W++KFA AMV MG+
Sbjct  246   PSPNIVDTNYYNDILVNRGLFTSDQTLLSKATTASHVKQNAANSLLWQNKFATAMVAMGQ  305

Query  1031  LGVLTGNAGEIRANCRVVN  975
             +GVLTG+ GEIR NCR +N
Sbjct  306   VGVLTGSNGEIRLNCRAIN  324



>ref|XP_003602406.1| Peroxidase [Medicago truncatula]
 gb|AES72657.1| peroxidase family protein [Medicago truncatula]
Length=316

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 243/304 (80%), Gaps = 11/304 (4%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
              ++L+VGFY  SC  AE +VKDEVRK+F ++ G+AAGL           GCD SVL+DST
Sbjct  23    HSQLEVGFYTYSCGMAEFIVKDEVRKSFNKNPGIAAGL-----------GCDASVLLDST  71

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
              +N AEKDSPAN PSLRGFEVID AKA+LE  CKG+VSCADI+AFAARDSVE+ GGLGYD
Sbjct  72    LSNIAEKDSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYD  131

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG ISLAS+    LP P FNV+QLT LF  KG TQ EMVTLSGAHTIGRSHC++
Sbjct  132   VPAGRRDGKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSA  191

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             FS RLYNF++T+ QD SLDP YAA LK+QCPQG+ + NLVV MDP++P   DV YY ++L
Sbjct  192   FSKRLYNFSSTSIQDPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDIL  251

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
             ANRGL TSDQTLLT+  TA++V QNAR P+ W +KFA AMVKMG++GVLTGNAGEIR NC
Sbjct  252   ANRGLFTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTGNAGEIRTNC  311

Query  986   RVVN  975
             RVVN
Sbjct  312   RVVN  315



>ref|XP_006846424.1| hypothetical protein AMTR_s00018p00028320 [Amborella trichopoda]
 gb|ERN08099.1| hypothetical protein AMTR_s00018p00028320 [Amborella trichopoda]
Length=325

 Score =   428 bits (1101),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 240/305 (79%), Gaps = 0/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
              EA+L+VGFY   C  AE +VKD VR A   D G+AA L+ ++FHDCFVRGCDGS+LIDS
Sbjct  21    FEAQLEVGFYSQRCSPAERIVKDAVRSAVSNDVGLAADLIHMYFHDCFVRGCDGSILIDS  80

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
                N AEKD  AN  SLR F V+D AK++LE +CKGVVSCADILAFAARD+ E+ GG+G+
Sbjct  81    NSTNTAEKDFFANKISLRSFGVLDSAKSKLEDMCKGVVSCADILAFAARDAAEMVGGIGW  140

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVPAGRRDG ISLASE   NLP P F V QLT LF +KG TQ+EMVTLSGAHTIGRSHCT
Sbjct  141   DVPAGRRDGRISLASENLANLPAPTFTVPQLTQLFLSKGLTQEEMVTLSGAHTIGRSHCT  200

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFSNRL+NF++T+ QD SLDP YA +LK +CP+G+ + NLVV MDP +P + D AYY N+
Sbjct  201   SFSNRLFNFSSTSSQDPSLDPRYATQLKSKCPKGNTNTNLVVPMDPLSPTVLDNAYYKNI  260

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LANRGL TSD  LL+DPST+ QVS+ A   F W++KF AAMV+MG++GVLTGNAGEIR N
Sbjct  261   LANRGLFTSDHALLSDPSTSSQVSEYAANVFLWRTKFGAAMVRMGQIGVLTGNAGEIRRN  320

Query  989   CRVVN  975
             CR VN
Sbjct  321   CRAVN  325



>ref|XP_009400935.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=329

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 243/312 (78%), Gaps = 2/312 (1%)
 Frame = -3

Query  1904  CHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGS  1725
             C+  VLEA+LQVGFY+++C  AE ++  EVR+A   + G+AAGLVR+HFHDCFVRGCDGS
Sbjct  18    CYSSVLEAQLQVGFYKSTCPQAESIIASEVRRALSSNIGLAAGLVRMHFHDCFVRGCDGS  77

Query  1724  VLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEIT  1545
             VLIDS+  N AEKDS  NNPSLRGFEVID AK RLE+ C+GVVSCADILA AARDSV +T
Sbjct  78    VLIDSSSNNTAEKDSFINNPSLRGFEVIDNAKTRLEAACQGVVSCADILALAARDSVVMT  137

Query  1544  GGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIG  1365
             GG+ Y VPAGRRDG +SL SEV  +LP P F+VDQLT  F +KG TQ EMVTLSGAHTIG
Sbjct  138   GGVMYQVPAGRRDGRVSLVSEVLASLPGPTFDVDQLTRSFTSKGLTQDEMVTLSGAHTIG  197

Query  1364  RSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVA  1185
             RSHC +FS+RL++FN+T G D SLD  YA++LKQQCPQGS D +LV  MDP +P   D A
Sbjct  198   RSHCAAFSSRLFDFNSTDGHDPSLDSAYASQLKQQCPQGSNDTSLVAFMDPRSPYTLDTA  257

Query  1184  YYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARA--PFRWKSKFAAAMVKMGKLGVLTGN  1011
             YY N+L NRGL  SDQ L TD +TA  V QNA A     WK KFAAAMVKMG++ VLTG+
Sbjct  258   YYANLLQNRGLFASDQALATDSTTAGLVKQNAAAGGGIAWKRKFAAAMVKMGQIDVLTGS  317

Query  1010  AGEIRANCRVVN  975
              GEIR+ CRV+N
Sbjct  318   DGEIRSRCRVIN  329



>gb|AHL39170.1| class III peroxidase [Populus trichocarpa]
Length=323

 Score =   422 bits (1086),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 243/319 (76%), Gaps = 8/319 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             +   + +L C  +  ++ LQVGFYRNSC  AE +V+         DRGVAAGLVR+HFHD
Sbjct  12    VTFWVAVLFCQSV--QSHLQVGFYRNSCGRAESIVRGA------GDRGVAAGLVRLHFHD  63

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVR C   VL+DST +NKAEK S AN PSLRGFEVID AKARLE+ C+GVVSCADILAF
Sbjct  64    CFVRACVVLVLLDSTSSNKAEKHSTANYPSLRGFEVIDDAKARLEAECQGVVSCADILAF  123

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS ++TGG  YDV AGRRDG +SLASE  +NLP P FNVDQLT  F +KG TQ+EMV
Sbjct  124   AARDSFDLTGGFDYDVQAGRRDGIVSLASETYSNLPPPTFNVDQLTQRFSDKGLTQEEMV  183

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAHTIG SHC SF+ RLYNF+ T  QD SLD  YAA L++ CPQ S DPNL V MD 
Sbjct  184   TLSGAHTIGNSHCRSFTYRLYNFSGTNSQDPSLDSQYAASLRKSCPQDSTDPNLEVPMDT  243

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP I DV YY ++LANRGL +SDQ LLT+P+TA +V  NAR+P  WK KFAAAMVKMG+
Sbjct  244   RTPTISDVNYYKDILANRGLFSSDQILLTNPATASEVKSNARSPSGWKKKFAAAMVKMGQ  303

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTGN GEIRANCRV+N
Sbjct  304   IEVLTGNKGEIRANCRVIN  322



>gb|EPS60748.1| hypothetical protein M569_14053, partial [Genlisea aurea]
Length=318

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/321 (63%), Positives = 243/321 (76%), Gaps = 6/321 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             S     MI++ C+     A+L V FY + C  A  ++++EV  AF RDRG+AAGLVR+HF
Sbjct  3     SFFVFGMIVVGCN-----AQLTVNFYDSVCPNARFIIREEVSNAFNRDRGLAAGLVRMHF  57

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCDGSVLIDSTP+NKAEKD+P NNPSLRGFEVID AK R+E+ C GVVSCADIL
Sbjct  58    HDCFVRGCDGSVLIDSTPSNKAEKDAPPNNPSLRGFEVIDAAKRRIEAACPGVVSCADIL  117

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDSVEITGG  ++VPAGRRDG +SLASEV  N+P P F+++QLT  F NKG TQ+E
Sbjct  118   AFAARDSVEITGGYRFEVPAGRRDGRVSLASEVLTNIPAPTFDLNQLTQSFQNKGLTQEE  177

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQM  1218
             MVTLSGAHTIGRSHCT+ ++RLYNF++T   D SLDP YA +LKQ+CP      +LV+ M
Sbjct  178   MVTLSGAHTIGRSHCTTITDRLYNFSSTASTDPSLDPAYANELKQRCPPNPA-ADLVLPM  236

Query  1217  DPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             DP TP   DV YY  V+ NRGL  SD  LLT  +T  QV  N R P  W +KF+ AMVK+
Sbjct  237   DPVTPDRTDVEYYREVIRNRGLFQSDAALLTSTNTRDQVVLNVRDPNAWFTKFSDAMVKL  296

Query  1037  GKLGVLTGNAGEIRANCRVVN  975
             G+ GVLTG+AGEIR NCRV+N
Sbjct  297   GQTGVLTGSAGEIRRNCRVIN  317



>ref|XP_008808270.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=332

 Score =   412 bits (1059),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 239/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1889  LEA-KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             LEA +L +G+Y  +C  AE +V DEV+KA   D G+AA LVR+HFHDCFVRGCDGS+LID
Sbjct  24    LEAYELHMGYYGKTCPQAEFIVLDEVKKAVAGDAGLAADLVRMHFHDCFVRGCDGSILID  83

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             STP N AEKD+P NNPSL GFE+ID AK RLE+ CKG+VSCADI+AFAARD+V +TGGL 
Sbjct  84    STPNNMAEKDAPPNNPSLEGFEIIDNAKKRLEAECKGMVSCADIVAFAARDAVVLTGGLF  143

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             Y+VPAGRRDG +S+A+E   NLP P F+++QLT  F  KG +Q EM+ LSGAHTIG+SHC
Sbjct  144   YEVPAGRRDGRVSIANEALTNLPPPSFDLNQLTQSFAQKGLSQDEMIILSGAHTIGQSHC  203

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             +SFS+RLYNFN+   QD SLDP YAA+LKQ+CP  S   N  V MDP +P+ FD +YY+N
Sbjct  204   SSFSSRLYNFNSAFSQDPSLDPAYAAQLKQECPNTSSGANQEVPMDPKSPSTFDTSYYSN  263

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +L NRGL TSDQTL++ P+TA +V QNA     ++ KF  AM KMGK+GVLTG+ GEIR 
Sbjct  264   LLVNRGLFTSDQTLMSTPATAAKVWQNAADWLGFQKKFGQAMRKMGKIGVLTGSEGEIRC  323

Query  992   NCRVVN  975
             NCRVVN
Sbjct  324   NCRVVN  329



>ref|XP_008808267.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=313

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 233/305 (76%), Gaps = 0/305 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             LEA+L +G+Y  +C  AE VV DEV+KA   + G AA LVR+HFHDCFVRGCDGS+LIDS
Sbjct  6     LEAQLHMGYYDKTCPQAEFVVMDEVKKAVAGNIGFAAALVRMHFHDCFVRGCDGSILIDS  65

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N AEKD+P NNPS+ GFE+ID AK RLE+ CK  VSCADILAFAARD+V +TGG  Y
Sbjct  66    TPNNMAEKDAPPNNPSMVGFEIIDNAKKRLEAECKRTVSCADILAFAARDAVVLTGGFFY  125

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              V AGRRDG +S+A+E   NLP P F+++QLT  F  KG +Q EM+ LSGAHTIGRSHC+
Sbjct  126   KVLAGRRDGKVSIANETLTNLPPPSFDLNQLTQSFAQKGLSQDEMIFLSGAHTIGRSHCS  185

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFSNRL NFN+T  QD SLDP YA +LKQ+CP  S   N VV MDP +P  FD +YY+N+
Sbjct  186   SFSNRLDNFNSTFSQDPSLDPAYAGQLKQECPNTSSGANQVVPMDPNSPNTFDTSYYSNI  245

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LANRGL TSDQTL++ P+TA +V QNA     ++ KF  AM KMGK+GVLTG+ GEIR N
Sbjct  246   LANRGLFTSDQTLMSTPATAAKVRQNAADWLGFQKKFGKAMRKMGKIGVLTGSEGEIRCN  305

Query  989   CRVVN  975
             CRVVN
Sbjct  306   CRVVN  310



>ref|XP_006650985.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=336

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 243/335 (73%), Gaps = 7/335 (2%)
 Frame = -3

Query  1958  SRNLSCCSSLALTMILLSC----HPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDR  1791
             +R+++   S  L++  L+      P    + L+ GFY  +C  AE +V+ EV +A + + 
Sbjct  2     TRSIATAESAVLSLCALAVVCGGFPANDGSSLRPGFYAATCPQAETIVRQEVARALYANA  61

Query  1790  GVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESI  1611
             G+AAGLVR+HFHDCFVRGCDGSVL++STP + AE+DSP NNPSLRGFEVID AK RLE+ 
Sbjct  62    GLAAGLVRMHFHDCFVRGCDGSVLLESTPDSAAERDSPINNPSLRGFEVIDSAKVRLEAA  121

Query  1610  CKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTT  1431
             C GVVSCAD+LA+AARDSV +TGG  YDVP GRRDG +SL SEVA+N+P P F +D+LT 
Sbjct  122   CPGVVSCADVLAYAARDSVALTGGPRYDVPGGRRDGTVSLESEVADNIPAPTFTLDELTR  181

Query  1430  LFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC--  1257
              F  KG TQ+EMVTLSGAHTIGR+HCTSFS+RLYNF+     D S+ P + ++L++ C  
Sbjct  182   SFAAKGLTQEEMVTLSGAHTIGRAHCTSFSDRLYNFSAMGAADPSVAPAFLSQLRRACPA  241

Query  1256  -PQGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAP  1080
              P G+ D NL V M+P TP  FD  YY  VL NRGL TSDQ LL+ P TA QV Q+A   
Sbjct  242   GPDGAVDANLAVPMEPRTPNGFDALYYWAVLRNRGLFTSDQALLSSPPTAAQVRQSAYGG  301

Query  1079  FRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             + WK KFAAAMVKMG++ VLTG++GEIR  C  VN
Sbjct  302   YPWKLKFAAAMVKMGQVEVLTGSSGEIRTKCAAVN  336



>ref|XP_004985933.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=316

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 223/304 (73%), Gaps = 3/304 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQ  FY  +C  AE +V+ EV +    D G AAGLVR+HFHDCFVRGCD S+L++STP N
Sbjct  13    LQPNFYGATCPQAETIVRQEVIRWLHSDMGFAAGLVRMHFHDCFVRGCDASILLESTPDN  72

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AE+DSP NNPSLRGFEVID AKARLE  C GVVSCADILAFAARDSV ++GG  YDVP 
Sbjct  73    TAERDSPVNNPSLRGFEVIDSAKARLEDACPGVVSCADILAFAARDSVALSGGPRYDVPG  132

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +S+ASEVA+N+P P FN+DQLT  F  KG TQ+EMVTLSGAHTIGR+HCT+FS+
Sbjct  133   GRRDGTLSMASEVADNIPAPTFNLDQLTQSFAAKGLTQEEMVTLSGAHTIGRAHCTAFSD  192

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCP---QGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             RLYNF+ T   D +LDP + A+L+  CP    G  DP LVV M+P TP   D  YY  VL
Sbjct  193   RLYNFSATGVADPTLDPPFLAQLQHACPAAGDGGVDPGLVVPMEPRTPHALDTLYYWGVL  252

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              NRGL  SDQ LL    TA QV Q+A   + WK KFAAAMVKMG++ VLTG  G+IRA C
Sbjct  253   RNRGLFASDQALLASAPTAAQVRQSAYGGYPWKLKFAAAMVKMGQIQVLTGGGGQIRAKC  312

Query  986   RVVN  975
               VN
Sbjct  313   SAVN  316



>gb|EPS67213.1| hypothetical protein M569_07559 [Genlisea aurea]
Length=790

 Score =   412 bits (1059),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 237/302 (78%), Gaps = 1/302 (0%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +L VGFY  +C +A+ ++ +EV  AF+ D G+AAGL+R+HFHDCFVRGCDGS+LIDST +
Sbjct  489   QLSVGFYDGTCPSAQYIISEEVANAFYGDPGLAAGLLRMHFHDCFVRGCDGSILIDSTQS  548

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             NKAEKD+P NNPSLRGF+VID AK+R+E+ C G+VSCADILAFAARDSV+ITGGL Y+VP
Sbjct  549   NKAEKDAPPNNPSLRGFQVIDSAKSRIENDCPGIVSCADILAFAARDSVDITGGLWYEVP  608

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             AGRRDG +SL SEV  N+P P FN+ QLT  F +KG TQ+EMVTLSGAHTIGRSHCTS +
Sbjct  609   AGRRDGRVSLLSEVVANIPAPTFNLAQLTQSFASKGLTQQEMVTLSGAHTIGRSHCTSIT  668

Query  1340  NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLAN  1161
              RLYNF+TT  QD +LD  YA +LK++CPQ +  PNLV+ MDP TP   DV YY  VL N
Sbjct  669   TRLYNFSTTQSQDPNLDSAYATQLKKECPQ-NPGPNLVLPMDPVTPDRTDVEYYREVLGN  727

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             +GL  SDQ L T  ST  +V +N      W++KFAAAMVK+G +GVLTG+AGEIR NCR 
Sbjct  728   KGLFASDQALATSGSTRDEVVRNVANEEGWRNKFAAAMVKLGGVGVLTGDAGEIRINCRA  787

Query  980   VN  975
             VN
Sbjct  788   VN  789



>emb|CBI23099.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   405 bits (1041),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 237/303 (78%), Gaps = 6/303 (2%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             +EA+LQVGFYR+ CRA E +VKDEV KAF RDRG+A GL+R+HFHDCFVRGCD S+L+DS
Sbjct  19    IEAELQVGFYRDKCRA-ESIVKDEVEKAFDRDRGIAPGLLRLHFHDCFVRGCDASILVDS  77

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N  EKD P N  +LRG EVID AKARLE+ CKGVVSCAD LAFAARD+VEI+ G G+
Sbjct  78    TPMNVGEKDGPPNVNTLRGTEVIDSAKARLEAECKGVVSCADTLAFAARDAVEISNGFGW  137

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +SLASE   ++P PF N+DQLT  F  KG TQ+EMVTLSGAHTIG +HCT
Sbjct  138   SVPAGRRDGRVSLASETL-DIPAPFLNLDQLTQSFAKKGLTQEEMVTLSGAHTIGHAHCT  196

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC---PQGSKDPNLVVQMDPATPAIFDVAYY  1179
             SFSNRLY+FN ++ QD SL+PLYA  LK+QC   PQG+ DPNLVV M+  +PA+ D +YY
Sbjct  197   SFSNRLYDFNASSSQDPSLNPLYAEDLKRQCPRGPQGTVDPNLVVDMN-FSPAVMDSSYY  255

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
             T+VL +RGL TSDQ L T  +TA+QV+  A     W+S+FA AMVKM ++ VLTG  GEI
Sbjct  256   TDVLHHRGLFTSDQALTTSQATARQVTTYAVNRLLWESEFAKAMVKMSQIEVLTGTDGEI  315

Query  998   RAN  990
             R N
Sbjct  316   RTN  318


 Score =   368 bits (945),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 200/239 (84%), Gaps = 4/239 (2%)
 Frame = -3

Query  1994  DMINKQMKKEMSSRNLSCCSSLALTMILLS-CHPIVLEAKLQVGFYRNSCRAAELVVKDE  1818
             ++I  + K+ MSS+ ++    L+LT +L+  C  + LEA+LQVGFYR SC  AE +VKDE
Sbjct  338   NVIAYKHKEVMSSKRVTW---LSLTWVLVFLCLSVELEAQLQVGFYRTSCGLAEFIVKDE  394

Query  1817  VRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVID  1638
             VRK F RD GVA GLVR+HFHDCFVRGCDGSVLIDSTP+N AEKDSPANNPSLRGFEVID
Sbjct  395   VRKGFIRDSGVAPGLVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVID  454

Query  1637  KAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTP  1458
              AKARLE++CKGVVSCADI+AFAARDSVEITGGLGYDVPAGRRDG ISLASE + NLP P
Sbjct  455   SAKARLEAVCKGVVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPP  514

Query  1457  FFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLY  1281
              F VDQLT  F NKG TQ EMVTLSGAHTIGRSHC+SFSNRLYNFN T+GQD +LDP Y
Sbjct  515   TFTVDQLTQFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQY  573



>ref|XP_002317837.2| hypothetical protein POPTR_0012s00700g, partial [Populus trichocarpa]
 gb|EEE96057.2| hypothetical protein POPTR_0012s00700g, partial [Populus trichocarpa]
Length=274

 Score =   391 bits (1005),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 192/273 (70%), Positives = 218/273 (80%), Gaps = 1/273 (0%)
 Frame = -3

Query  1790  GVAAGLVRVHFHDCFVRGCDGSVL-IDSTPANKAEKDSPANNPSLRGFEVIDKAKARLES  1614
             GVAAGLVR+HFHDCFVR C  + L +DST +NKAEK S AN PSLRGFEVID AKARLE+
Sbjct  1     GVAAGLVRLHFHDCFVRVCACAWLRLDSTSSNKAEKHSTANYPSLRGFEVIDDAKARLEA  60

Query  1613  ICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLT  1434
              C+GVVSCADILAFAARDS ++TGG  YDV AGRRDG +SLASE  +NLP P FNVDQLT
Sbjct  61    ECQGVVSCADILAFAARDSFDLTGGFDYDVQAGRRDGIVSLASETYSNLPPPTFNVDQLT  120

Query  1433  TLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP  1254
               F +KG TQ+EMVTLSGAHTIG SHC SF+ RLYNF+ T  QD SLD  YAA L++ CP
Sbjct  121   QRFSDKGLTQEEMVTLSGAHTIGNSHCRSFTYRLYNFSGTNSQDPSLDSQYAASLRKSCP  180

Query  1253  QGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFR  1074
             Q S DPNL V MD  TP I DV YY ++LANRGL +SDQ LLT+P+TA +V  NAR+P  
Sbjct  181   QDSTDPNLEVPMDTRTPTISDVNYYKDILANRGLFSSDQILLTNPATASEVKSNARSPSG  240

Query  1073  WKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             WK KFAAAMVKMG++ VLTGN GEIRANCRV+N
Sbjct  241   WKKKFAAAMVKMGQIEVLTGNKGEIRANCRVIN  273



>ref|XP_010671314.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   392 bits (1008),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 236/308 (77%), Gaps = 5/308 (2%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             +EA L+VGFYR+ C +AE ++K+EV K+F +++G+A GL+R+HFHDCFVRGCDGS+LIDS
Sbjct  21    IEAALEVGFYRDKCPSAEAIIKEEVSKSFDQNKGIAPGLIRLHFHDCFVRGCDGSILIDS  80

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N+AE D P N  ++RG EVID AKAR+E+ CKGVVSCADIL++AARDSV ITGGL +
Sbjct  81    TPTNQAEIDGPPNGITIRGREVIDNAKARIEATCKGVVSCADILSYAARDSVVITGGLYW  140

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVPAGRRDG IS ASE   ++P P FN+DQLT  F NKG TQ +MV LSGAHTIGRSHCT
Sbjct  141   DVPAGRRDGRISRASETL-DIPAPSFNLDQLTQSFANKGLTQDDMVALSGAHTIGRSHCT  199

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP---QGSKDPNLVVQMDPATPAIFDVAYY  1179
             SF+NRLYNF++TT QD  L P+YA  LKQQCP   QG+ + +LVV M+  TP +F+ +YY
Sbjct  200   SFTNRLYNFSSTTMQDPKLSPIYAQFLKQQCPRDSQGNVNQDLVVFMN-QTPYVFESSYY  258

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              N+  + GL TSDQ LL    T ++V+  A     W+  F  AM+KM ++ VLTGN GEI
Sbjct  259   QNLFQHTGLFTSDQALLDRQETTREVALYAVNNLAWQRDFVQAMIKMSQIEVLTGNQGEI  318

Query  998   RANCRVVN  975
             RANCRV+N
Sbjct  319   RANCRVIN  326



>gb|AAM52320.1|AC105363_9 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69277.1| TPA: class III peroxidase 35 precursor [Oryza sativa Japonica 
Group]
 gb|EAZ25397.1| hypothetical protein OsJ_09215 [Oryza sativa Japonica Group]
Length=319

 Score =   387 bits (994),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 222/308 (72%), Gaps = 4/308 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +  L   FY  +C  AE +V+ EV +A + + G AAGLVR+HFHDCFVRGCDGSVL++ST
Sbjct  12    DGSLHPNFYAATCPQAETIVRQEVTRALYTNIGFAAGLVRMHFHDCFVRGCDGSVLLEST  71

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N AE+DSP NNPSLRGFEVID AKARLE+ C GVVSCAD+LA+AARD V +TGG  YD
Sbjct  72    SDNVAERDSPINNPSLRGFEVIDAAKARLEAACPGVVSCADVLAYAARDGVALTGGPRYD  131

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VP GRRDG  SL  EVA+N+P P F +DQLT  F  KG TQ+EMVTLSGAHT+GR+HCTS
Sbjct  132   VPGGRRDGTASLEPEVADNIPAPTFTLDQLTQSFAAKGLTQEEMVTLSGAHTVGRAHCTS  191

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQC----PQGSKDPNLVVQMDPATPAIFDVAYY  1179
             FS+RLYNF+ T   D S+DP    +L++ C    P G+ D  LVV M+P TP  FD  YY
Sbjct  192   FSDRLYNFSATGAADPSVDPALLPQLRRACPAAGPDGAVDAGLVVPMEPRTPNGFDALYY  251

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
               VL NR L TSDQ LL+ P TA QV Q A   + WK KFAAAMVKMG++ VLTG +GEI
Sbjct  252   WAVLRNRALFTSDQALLSSPPTAAQVRQTAYGGYPWKLKFAAAMVKMGQIEVLTGGSGEI  311

Query  998   RANCRVVN  975
             R  C  VN
Sbjct  312   RTKCSAVN  319



>ref|XP_006662005.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=334

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 191/322 (59%), Positives = 237/322 (74%), Gaps = 4/322 (1%)
 Frame = -3

Query  1946  SCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVR  1767
             SC    A++++L++     L+A+L+VGFY NSC AAE++V+ EV KA   + G+AAGLVR
Sbjct  16    SCLQVAAVSVLLMATG---LQAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVR  72

Query  1766  VHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCA  1587
             +HFHDCFVRGCD SVLIDST  N+AEKD+   N SLRGFEV+D+ KAR+E  C GVVSCA
Sbjct  73    LHFHDCFVRGCDASVLIDSTKGNQAEKDA-GPNTSLRGFEVVDRIKARVEQACFGVVSCA  131

Query  1586  DILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFT  1407
             DILAFAARDSV +TGG  Y VPAGRRDG +S AS+   NLP P   V QLT +F  KG +
Sbjct  132   DILAFAARDSVALTGGNAYQVPAGRRDGSVSRASDTGGNLPPPTAGVSQLTQMFAAKGLS  191

Query  1406  QKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLV  1227
             Q+EMV LSGAHTIG SHC+SFS+RLY   TT GQD ++DP Y A+L QQCPQ       +
Sbjct  192   QREMVALSGAHTIGASHCSSFSSRLYRSGTTAGQDPTMDPAYVAQLAQQCPQSGGGGGPL  251

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V MD  TP  FD  ++  V+ANRGLL+SDQ LL+D +TA QV   A     ++S FAAAM
Sbjct  252   VPMDAVTPNTFDEGFFKGVMANRGLLSSDQVLLSDKNTAVQVVAYANDASTFQSDFAAAM  311

Query  1046  VKMGKLGVLTGNAGEIRANCRV  981
             VKMG +GVLTG++G++R+NCRV
Sbjct  312   VKMGAVGVLTGSSGKVRSNCRV  333



>gb|AAM52317.1|AC105363_6 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69275.1| TPA: class III peroxidase 33 precursor [Oryza sativa Japonica 
Group]
Length=311

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 221/305 (72%), Gaps = 2/305 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+LQVG+Y   C AAE++V++EV KA   + G+AAGLVR+HFHDCFVRGCD SVL+DST
Sbjct  8     QAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDST  67

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N+AEKD+P N  SLRGFEVID AK+RLE+ C GVVSCAD+LAFAARD++ + GG  Y 
Sbjct  68    QGNRAEKDAPPNT-SLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQ  126

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VP GRRDG++S+A E   NLP P  NV QL  +F  KG TQ EMV LSGAHTIG SHC+S
Sbjct  127   VPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSS  186

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL-VVQMDPATPAIFDVAYYTNV  1170
             FSNRLY+     GQD S+DP Y A L  QCPQ    P   +V MD  TP  FD  YY  +
Sbjct  187   FSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAI  246

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +ANRGLL+SDQ LL D +TA QV      P  +++ FAAAMVKMG +GVLTGNAG IR N
Sbjct  247   VANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTN  306

Query  989   CRVVN  975
             CRV +
Sbjct  307   CRVAS  311



>gb|EEC74412.1| hypothetical protein OsI_09774 [Oryza sativa Indica Group]
Length=313

 Score =   377 bits (969),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 221/305 (72%), Gaps = 2/305 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+LQVG+Y   C AAE++V++EV KA   + G+AAGLVR+HFHDCFVRGCD SVL+DST
Sbjct  10    QAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDST  69

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N+AEKD+P N  SLRGFEVID AK+RLE+ C GVVSCAD+LAFAARD++ + GG  Y 
Sbjct  70    QGNRAEKDAPPNT-SLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQ  128

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VP GRRDG++S+A E   NLP P  NV QL  +F  KG TQ EMV LSGAHTIG SHC+S
Sbjct  129   VPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSS  188

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL-VVQMDPATPAIFDVAYYTNV  1170
             FSNRLY+     GQD S+DP Y A L  QCPQ    P   +V MD  TP  FD  YY  +
Sbjct  189   FSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAI  248

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +ANRGLL+SDQ LL D +TA QV      P  +++ FAAAMVKMG +GVLTGNAG IR N
Sbjct  249   VANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTN  308

Query  989   CRVVN  975
             CRV +
Sbjct  309   CRVAS  313



>ref|NP_001048793.1| Os03g0121200 [Oryza sativa Japonica Group]
 gb|ABF93699.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10707.1| Os03g0121200 [Oryza sativa Japonica Group]
 dbj|BAG96194.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   377 bits (968),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 221/305 (72%), Gaps = 2/305 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+LQVG+Y   C AAE++V++EV KA   + G+AAGLVR+HFHDCFVRGCD SVL+DST
Sbjct  28    QAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDST  87

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N+AEKD+P N  SLRGFEVID AK+RLE+ C GVVSCAD+LAFAARD++ + GG  Y 
Sbjct  88    QGNRAEKDAPPNT-SLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQ  146

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VP GRRDG++S+A E   NLP P  NV QL  +F  KG TQ EMV LSGAHTIG SHC+S
Sbjct  147   VPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSS  206

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL-VVQMDPATPAIFDVAYYTNV  1170
             FSNRLY+     GQD S+DP Y A L  QCPQ    P   +V MD  TP  FD  YY  +
Sbjct  207   FSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAI  266

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +ANRGLL+SDQ LL D +TA QV      P  +++ FAAAMVKMG +GVLTGNAG IR N
Sbjct  267   VANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTN  326

Query  989   CRVVN  975
             CRV +
Sbjct  327   CRVAS  331



>ref|XP_004985934.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   376 bits (966),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/303 (60%), Positives = 220/303 (73%), Gaps = 2/303 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +LQVGFY   C AAE++V++EV KA   + GVAA LVR+HFHDCFVRGCD SVL+DSTP 
Sbjct  30    QLQVGFYDMLCPAAEIIVQEEVSKAVSGNPGVAASLVRLHFHDCFVRGCDASVLLDSTPG  89

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             N+AEKD+  N  SLRGFEVID AK RLE  C GVVSCAD+LAFAARD++ + GG  Y VP
Sbjct  90    NQAEKDASPNT-SLRGFEVIDSAKTRLEQACYGVVSCADVLAFAARDALALVGGNAYQVP  148

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             +GRRDG++S+A E + NLP P  +V QL  +F +KG TQ +MV LSGAHTIG +HC+SF 
Sbjct  149   SGRRDGNVSVAQETSGNLPPPTASVSQLNQIFGSKGLTQADMVALSGAHTIGNAHCSSFD  208

Query  1340  NRLYNFNTTTGQDSSLDPLYAAKLKQQCP-QGSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             +RLY +    GQD S+DP Y A L QQCP Q    P+  V MDP TP  FD  YY +++A
Sbjct  209   SRLYAYGPNAGQDPSMDPSYLAALTQQCPNQSGGGPDGTVAMDPVTPTAFDTNYYASIVA  268

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
              RGLL SDQ LL DP+TA QV     +P  +++ FAAAMVKMG +GVLTG AG IR NCR
Sbjct  269   KRGLLASDQALLADPTTAAQVVAYTNSPDTFQADFAAAMVKMGAIGVLTGTAGTIRTNCR  328

Query  983   VVN  975
             V +
Sbjct  329   VAS  331



>ref|XP_006840300.1| hypothetical protein AMTR_s00045p00066730 [Amborella trichopoda]
 gb|ERN01975.1| hypothetical protein AMTR_s00045p00066730 [Amborella trichopoda]
Length=349

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/309 (59%), Positives = 225/309 (73%), Gaps = 1/309 (0%)
 Frame = -3

Query  1898  PIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVL  1719
             P+++   L+VGFY  +C  AE ++ D V  A   + G+AAGL+R++FHDCFVRGCDGSVL
Sbjct  18    PVLVNGALEVGFYNETCPQAEQLIFDAVSTAVTANPGIAAGLIRMYFHDCFVRGCDGSVL  77

Query  1718  IDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGG  1539
             +DST  N+AEKDSP NNPSLRGFEVID+AKA +E++C   VSCAD+LAFAARDS  +TGG
Sbjct  78    LDSTADNQAEKDSPVNNPSLRGFEVIDEAKAAIETVCPNTVSCADVLAFAARDSTSLTGG  137

Query  1538  LGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRS  1359
             L Y +PAGRRDG++S+A+E  +NLP P FNV QL   F  K  T +EMVTLSG HTIGRS
Sbjct  138   LNYTLPAGRRDGNVSIANETFSNLPPPSFNVTQLVDNFAIKNLTLEEMVTLSGGHTIGRS  197

Query  1358  HCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP-QGSKDPNLVVQMDPATPAIFDVAY  1182
             HCTSF +RLYNF++T+  D +LD  YAA L+  CP   S +    V MD  TP   DV Y
Sbjct  198   HCTSFVSRLYNFSSTSQVDPTLDADYAATLQSLCPFNASTNNETTVPMDVFTPDDLDVNY  257

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y  V  N GL TSDQTLLT+ ST+  V +N  +P  W+++FAAAM+KMG + VLTG  GE
Sbjct  258   YVGVTQNFGLFTSDQTLLTNDSTSALVEENIGSPDVWQARFAAAMIKMGDIEVLTGTDGE  317

Query  1001  IRANCRVVN  975
             IR NCRVVN
Sbjct  318   IRTNCRVVN  326



>ref|XP_006840299.1| hypothetical protein AMTR_s00045p00065690 [Amborella trichopoda]
 gb|ERN01974.1| hypothetical protein AMTR_s00045p00065690 [Amborella trichopoda]
Length=348

 Score =   375 bits (962),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 229/325 (70%), Gaps = 2/325 (1%)
 Frame = -3

Query  1934  SLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFH  1755
             +L L +I++   P  ++  L++GFY  +C+ AEL+V D V +A   + G+AAGL+R+ FH
Sbjct  7     TLCLFLIVV-IAPAAVKCDLEIGFYDQTCQGAELLVFDAVARAVNANPGIAAGLIRMFFH  65

Query  1754  DCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILA  1575
             DCFVRGCDGSVLIDST  N AEKDSP NNPSLRGFEVIDKAKA +E++C   VSCAD+LA
Sbjct  66    DCFVRGCDGSVLIDSTAGNSAEKDSPINNPSLRGFEVIDKAKAAIEAVCPKTVSCADVLA  125

Query  1574  FAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEM  1395
             FAARDS  +TGGL + VPAGRRDG IS+ASE   NLP P FN  QL   F  K  T +EM
Sbjct  126   FAARDSTALTGGLNFPVPAGRRDGRISIASETFTNLPPPTFNATQLEQSFARKNLTLEEM  185

Query  1394  VTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL-VVQM  1218
             VTLSGAH+IGRSHC+SF  RLYNF++T   D +LDP YA  L+ QCP  +   N+ VV M
Sbjct  186   VTLSGAHSIGRSHCSSFVRRLYNFSSTNQVDPTLDPGYATFLQSQCPFNASTNNVTVVPM  245

Query  1217  DPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             D  TP   DV YY  +  + GL TSDQTLLT+ ST   V +N   P  W  +FA AM+KM
Sbjct  246   DVFTPNDLDVGYYVGLTQHFGLFTSDQTLLTNSSTRPFVEENIVNPGVWAIRFAKAMIKM  305

Query  1037  GKLGVLTGNAGEIRANCRVVNH*RS  963
             GK+ VLTG  GEIR NCRV+N  +S
Sbjct  306   GKIEVLTGTTGEIRTNCRVINSAKS  330



>gb|ABS44862.1| putative peroxidase [Oryza sativa Japonica Group]
Length=331

 Score =   374 bits (960),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 219/305 (72%), Gaps = 2/305 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+LQVG+Y   C AAE++V++EV KA   + G+AAGLVR+HFHDCFVRGCD SVL+DST
Sbjct  28    QAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDST  87

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N+A KD+P N  SLRGFEVID AK+RLE+ C GVVSCAD+LAFAARD++ + GG  Y 
Sbjct  88    XGNRAXKDAPPNT-SLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYX  146

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VP GRRDG++S+A E   NLP P  NV QLT +F  KG TQ EMV LSGAHTIG  HC S
Sbjct  147   VPGGRRDGNVSVAQETNGNLPPPSANVAQLTQMFGAKGLTQAEMVALSGAHTIGVXHCXS  206

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL-VVQMDPATPAIFDVAYYTNV  1170
             FSNRLY+     GQD S+DP Y A L  QCPQ    P   +V MD  TP  FD  YY  +
Sbjct  207   FSNRLYSSGPNAGQDPSMDPXYVAALTTQCPQQQGQPVAGMVPMDAVTPNAFDTNYYAAI  266

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +ANRGLL+SDQ LL D +TA QV      P  +++ FAAAMVKMG +GVLTGNAG IR N
Sbjct  267   VANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTN  326

Query  989   CRVVN  975
             CRV +
Sbjct  327   CRVAS  331



>ref|XP_008246297.1| PREDICTED: peroxidase 5-like [Prunus mume]
Length=327

 Score =   374 bits (959),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 228/319 (71%), Gaps = 5/319 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             LA++M++      +  A  +VGFY+ SC AAE +V+  V KA  ++ G+AAGL+R+HFHD
Sbjct  14    LAMSMVVF-----MASAAPKVGFYQRSCPAAEAIVRKAVNKAVAKNPGIAAGLIRMHFHD  68

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD S+L+DSTP   +EK+ PANNPSLRGFEVID+AKA +E+ C   VSCADILAF
Sbjct  69    CFVRGCDASILLDSTPGQPSEKEHPANNPSLRGFEVIDEAKAEIEAKCPKTVSCADILAF  128

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS    GG+ YDVP+GRRDG +SL  E   +LP+P FN  QL   F  KG +  EMV
Sbjct  129   AARDSALEVGGINYDVPSGRRDGRVSLQDEPTQHLPSPSFNAKQLEESFARKGLSLDEMV  188

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG SHC+SFS+RLY FN T  QD S+DP++A  LK++CP+ S +  + V +D 
Sbjct  189   TLSGAHSIGVSHCSSFSDRLYFFNATHPQDPSMDPIFARNLKKKCPRSSNNDRVTVPLDI  248

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP   D  YYT++  + GLLTSDQTLLT  STA  V  NAR    W +KFAAAMVKMG 
Sbjct  249   LTPNRLDNKYYTDLKNHHGLLTSDQTLLTSHSTAGIVRNNARFGTAWANKFAAAMVKMGS  308

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTG  GEIR NC+VVN
Sbjct  309   IDVLTGRQGEIRNNCKVVN  327



>ref|XP_006840292.1| hypothetical protein AMTR_s00045p00063130 [Amborella trichopoda]
 gb|ERN01967.1| hypothetical protein AMTR_s00045p00063130 [Amborella trichopoda]
Length=334

 Score =   372 bits (955),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 181/303 (60%), Positives = 223/303 (74%), Gaps = 1/303 (0%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             + L+VGFYR SC +AE VV+  V KA  RD G+AAGL+R+HFHDCFVRGCD SVL+DSTP
Sbjct  31    SSLKVGFYRRSCPSAEAVVRRTVAKAIARDPGLAAGLIRLHFHDCFVRGCDASVLLDSTP  90

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+SPAN PSLRG EVID+AKA LES C   VSCADILAFAARDS    G + Y V
Sbjct  91    GNPSEKESPANAPSLRGDEVIDEAKAILESQCPQTVSCADILAFAARDSAHQVGRINYLV  150

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +S+  EV  NLP PF ++ QL   F +KG + ++MVTLSGAH+IGRS C SF
Sbjct  151   PAGRRDGRVSIEREVLQNLPAPFDDLKQLQANFSSKGLSLEDMVTLSGAHSIGRSFCPSF  210

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             ++RLYNF++  GQD +LD  YA+ LK +CP  +  P++ V MDP +P + D  YY N+  
Sbjct  211   TDRLYNFDSPDGQDPTLDQAYASYLKTKCPAPAT-PDVTVAMDPLSPNVLDNKYYINLRM  269

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
             NRGLL SDQ L+T P+TA+ V QNA  P  W  KF +AMV+MG + VLTG+ GEIR +CR
Sbjct  270   NRGLLASDQALMTSPATARMVRQNAHYPGLWAHKFGSAMVRMGFIDVLTGSKGEIRRSCR  329

Query  983   VVN  975
             VVN
Sbjct  330   VVN  332



>gb|EAY79346.1| hypothetical protein OsI_34475 [Oryza sativa Indica Group]
Length=335

 Score =   372 bits (955),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 227/307 (74%), Gaps = 5/307 (2%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             LEA+L+VGFY NSC AAE++V+ EV KA   + G+AAGLVR+HFHDCFVRGCD SVLIDS
Sbjct  29    LEAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRLHFHDCFVRGCDASVLIDS  88

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N+AEKD+   N SLRGFEV+D+ KAR+E  C GVVSCADILAFAARDSV +TGG  Y
Sbjct  89    TKVNQAEKDA-GPNTSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAY  147

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +S +S+   NLP P  +V QLT +F  KG +Q+EMV LSGAHTIG SHC+
Sbjct  148   QVPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLSQREMVALSGAHTIGASHCS  207

Query  1349  SFSNRLYNFNTTT--GQDSSLDPLYAAKLKQQCPQG--SKDPNLVVQMDPATPAIFDVAY  1182
             SFS+RLY   TT   GQD ++DP Y A+L QQCPQ   +     +V MD  TP  FD  +
Sbjct  208   SFSSRLYRAGTTAGGGQDPTMDPAYVAQLAQQCPQSGGAAGGGALVPMDAVTPNAFDEGF  267

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             +  V+ NRGLL+SDQ LL D +TA QV   A     ++S FAAAMVKMG +GVLTG++G+
Sbjct  268   FKGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQSDFAAAMVKMGAVGVLTGSSGK  327

Query  1001  IRANCRV  981
             +RANCRV
Sbjct  328   VRANCRV  334



>ref|XP_004304932.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 225/324 (69%), Gaps = 4/324 (1%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKL---QVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVR  1767
             S+L L +I L+   +V  +     +VGFYR +C +AE +V+  V KA  ++ G+AAGL+R
Sbjct  2     SNLRLCLIFLTMSMMVFMSSAITPRVGFYRTTCPSAEAIVRKAVNKAVMKNPGIAAGLIR  61

Query  1766  VHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCA  1587
             +HFHDCFVRGCD SVL+DSTP   +EK+ PAN PSLRGFEVID+AK  LE++C   VSCA
Sbjct  62    MHFHDCFVRGCDASVLLDSTPGKLSEKEHPANKPSLRGFEVIDEAKRELETLCPRTVSCA  121

Query  1586  DILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFT  1407
             DILAFAARD     GG+ Y VP+GRRDG +SL  E +NNLP+P  N  +L   F  KGF+
Sbjct  122   DILAFAARDGALAVGGISYQVPSGRRDGRVSLFDEPSNNLPSPSLNAKELAASFARKGFS  181

Query  1406  QKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLV  1227
               EMVTLSGAH+IG SHC+SFSNRLY FN T  QD SLDP +A  LK +CP  S  PN V
Sbjct  182   LDEMVTLSGAHSIGVSHCSSFSNRLYAFNETHTQDPSLDPKFARDLKAKCPP-SSSPNNV  240

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             VQ+D  TP   D  YYTN++ +RGL  SDQTLL+  STA  V  NAR    W  KFA+AM
Sbjct  241   VQLDGVTPNRLDNKYYTNLMNHRGLFASDQTLLSSRSTAGMVRNNARLGPAWAKKFASAM  300

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             VKMG + VLTG  GEIR  C VVN
Sbjct  301   VKMGSIDVLTGRQGEIRKKCGVVN  324



>emb|CAN68183.1| hypothetical protein VITISV_028562 [Vitis vinifera]
Length=322

 Score =   370 bits (949),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 222/309 (72%), Gaps = 5/309 (2%)
 Frame = -3

Query  1892  VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             V  A L+VGFY+ +C +AE +V+  V KA  R+ G+AAGL+R+HFHDCFVRGCDGSVL+D
Sbjct  16    VSSASLKVGFYKYTCPSAETIVRKVVNKAVSRNPGMAAGLIRMHFHDCFVRGCDGSVLLD  75

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             STP N +EK++PANNPSLRGFEVID AKA +E+ C   VSCAD+LAFAARDS    GG+ 
Sbjct  76    STPGNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGIN  135

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             Y VP+GRRDG +SL  E + +LP PFFN  QL   F  KG T  EMVTLSGAH+IG SHC
Sbjct  136   YAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVSHC  195

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPATPAIFDVAY  1182
             +SFSNRLY+FN T  QD S+DP +A  LK +CP  S    DP + +++   TP   D  Y
Sbjct  196   SSFSNRLYSFNATHPQDPSMDPEFARHLKTKCPPPSNTGSDPTVPLEIQ--TPNKLDNKY  253

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y ++  +RGLL SDQTL   PSTA+ V  NAR    W +KFAAAMV+MG + VLTG  GE
Sbjct  254   YKDLKNHRGLLASDQTLFYSPSTARMVKNNARYGENWGNKFAAAMVRMGAIDVLTGTQGE  313

Query  1001  IRANCRVVN  975
             IR NCRVVN
Sbjct  314   IRKNCRVVN  322



>ref|XP_010659811.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=322

 Score =   370 bits (949),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 223/309 (72%), Gaps = 5/309 (2%)
 Frame = -3

Query  1892  VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             V  A L+VGFY+ +C +AE +V+  V KA  ++ G+AAGL+R+HFHDCFVRGCDGSVL+D
Sbjct  16    VSSASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDCFVRGCDGSVLLD  75

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             STP N +EK++PANNPSLRGFEVID AKA +E+ C   VSCAD+LAFAARDS    GG+ 
Sbjct  76    STPGNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGVN  135

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             Y VP+GRRDG +SL  E + +LP PFFN  QL   F  KG T  EMVTLSGAH+IG SHC
Sbjct  136   YAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVSHC  195

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPATPAIFDVAY  1182
             +SFSNRLY+FN T  QD S+DP +A  LK +CP  S    DP + +++   TP   D  Y
Sbjct  196   SSFSNRLYSFNATHPQDPSMDPEFARYLKTKCPPPSNTGSDPTVALEVQ--TPNRLDNKY  253

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y ++  +RGLLTSDQTL   PSTA+ V  NAR    W +KFAAAMV+MG + VLTG  GE
Sbjct  254   YKDLKNHRGLLTSDQTLFDSPSTARMVKNNARYGENWGNKFAAAMVRMGAIDVLTGTQGE  313

Query  1001  IRANCRVVN  975
             IR NCRVVN
Sbjct  314   IRKNCRVVN  322



>gb|KCW44165.1| hypothetical protein EUGRSUZ_L02416, partial [Eucalyptus grandis]
Length=302

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 216/303 (71%), Gaps = 4/303 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP N
Sbjct  2     LQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGN  61

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y VPA
Sbjct  62    PSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAVPA  121

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +SL  E + +LP  FFN  QL   F  KG +  EMVTLSGAH+IG SHC+SFSN
Sbjct  122   GRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSFSN  181

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             RLY+FN T  QD S+D   A +LK +CP   G+ DP   V +D  TP   D  YYTN+  
Sbjct  182   RLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNLKN  239

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
              RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + VLTGN GEIR  CR
Sbjct  240   RRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRKCR  299

Query  983   VVN  975
             VVN
Sbjct  300   VVN  302



>ref|XP_010671315.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   369 bits (947),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 233/324 (72%), Gaps = 9/324 (3%)
 Frame = -3

Query  1934  SLALTMI-LLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             +L + M+  LS H    EA LQVGFYR+ C  AE ++KDEV K+F +D+G+A G+ R+ F
Sbjct  4     TLVIIMVCFLSYHN---EATLQVGFYRDKCPFAEAIIKDEVTKSFLKDQGIAPGITRLQF  60

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCDGS+LIDSTP N+AEKD P N  ++RGF V+D AKAR+E++C GVVSCADIL
Sbjct  61    HDCFVRGCDGSILIDSTPTNQAEKDGPPNGITVRGFNVLDNAKARIEAVCNGVVSCADIL  120

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             A+A RDSV +T GL +DVPAGRRDG IS ASE + ++PT FFN+DQ+T  F  KG TQ +
Sbjct  121   AYATRDSVVLTKGLYWDVPAGRRDGRISRASETS-DIPTAFFNLDQITQSFAKKGLTQSD  179

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ---GSKDPNLV  1227
             MV LSGAHTIGRSHC SF++RLY F+T   QD +L+P YA  LK +CP+   G  +  LV
Sbjct  180   MVALSGAHTIGRSHCFSFTDRLYRFDTKMMQDPNLNPYYAQFLKLKCPRDVHGILNQTLV  239

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V M+  +P + D +YY N+L + GL  SDQ LL    TA+Q +  A     W++ F  AM
Sbjct  240   VFMN-QSPLLMDQSYYGNLLKHAGLFMSDQVLLDSQKTAQQAAIYAANGLIWQADFVKAM  298

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             +KM ++ VLTG  GEIRANCRV+N
Sbjct  299   IKMSQIQVLTGEQGEIRANCRVIN  322



>ref|XP_010032734.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 220/305 (72%), Gaps = 4/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  24    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  83

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  84    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  143

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP  FFN  QL   F +KG +  EMVTLSGAH+IG SHC+SF
Sbjct  144   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  203

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             S+RLY+FN T  QD S+D   A++LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  204   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  261

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + VLTG+ GEIR  
Sbjct  262   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGSEGEIRRK  321

Query  989   CRVVN  975
             CRVVN
Sbjct  322   CRVVN  326



>ref|XP_010041692.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   368 bits (945),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 217/305 (71%), Gaps = 4/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  21    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  80

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  81    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  140

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + +LP  FFN  QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  141   PAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  200

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SNRLY+FN T  QD S+D   A +LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  201   SNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  258

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
                RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + VLTGN GEIR  
Sbjct  259   KNRRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRK  318

Query  989   CRVVN  975
             CRVVN
Sbjct  319   CRVVN  323



>ref|XP_010032732.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   368 bits (944),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/305 (60%), Positives = 219/305 (72%), Gaps = 4/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  24    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  83

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  84    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  143

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP  FFN  QL   F +KG +  EMVTLSGAH+IG SHC+SF
Sbjct  144   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  203

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             S+RLY+FN T  QD S+D   A++LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  204   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  261

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + +LTGN GEIR  
Sbjct  262   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGNEGEIRRK  321

Query  989   CRVVN  975
             C VVN
Sbjct  322   CTVVN  326



>ref|XP_010659743.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=314

 Score =   367 bits (942),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 226/318 (71%), Gaps = 7/318 (2%)
 Frame = -3

Query  1919  MILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVR  1740
             M+ L+    V  A L+VGFY++SC +AE +V+  V KA  ++ G+AAGL+R+HFHDCFVR
Sbjct  1     MLFLTAS--VSSASLEVGFYKSSCPSAETIVRKAVNKAVSKNPGMAAGLIRMHFHDCFVR  58

Query  1739  GCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARD  1560
             GCDGSVL+DSTP N +EK+SP N+PSLRGFEVID+AKA +E+ C   VSCAD+LAFAARD
Sbjct  59    GCDGSVLLDSTPGNPSEKESPVNDPSLRGFEVIDEAKAEIEAQCPQTVSCADVLAFAARD  118

Query  1559  SVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSG  1380
             S    GG+ Y VP+GRRDG ISL  E + +LP PFFN  QL   F  KG T  EMVTLSG
Sbjct  119   SAYKVGGINYAVPSGRRDGRISLKDEPSLHLPPPFFNAKQLEENFARKGLTLDEMVTLSG  178

Query  1379  AHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPA  1209
             AH+IG SHC+SFSNRLY+FN T  QD S++P +A  LK +CP  S    DP + +++   
Sbjct  179   AHSIGVSHCSSFSNRLYSFNATHPQDPSIEPEFARHLKTKCPPPSNTGSDPTVPLEVQ--  236

Query  1208  TPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKL  1029
             TP   D  YY ++ + +GLLTSDQTL   PST + V  NAR    W +KFAAAMV+MG +
Sbjct  237   TPNRLDNKYYKDLKSRKGLLTSDQTLFDSPSTVRMVKNNARYGANWGNKFAAAMVQMGAI  296

Query  1028  GVLTGNAGEIRANCRVVN  975
              VLTG  G IR NCRVVN
Sbjct  297   DVLTGTQGVIRKNCRVVN  314



>ref|XP_002530462.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
 gb|EEF31932.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
Length=331

 Score =   367 bits (943),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 184/303 (61%), Positives = 215/303 (71%), Gaps = 1/303 (0%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L VGFYR+SC +AE +V+  V K   R+ G+ AGL+R+HFHDCFVRGCD SVL+DSTP
Sbjct  30    ASLSVGFYRSSCPSAEAIVRRAVNKLVSRNPGLGAGLIRMHFHDCFVRGCDASVLLDSTP  89

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +E++  ANNPSLRGFEVI++AKA++ESIC   VSCADILAFAARDS    GG+ Y V
Sbjct  90    GNPSEREHVANNPSLRGFEVINEAKAQIESICPKTVSCADILAFAARDSSFKLGGINYAV  149

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +S   EVA NLP  FFN  QLT  F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  150   PAGRRDGRVSNVDEVAQNLPPFFFNAQQLTDNFARKGMSADEMVTLSGAHSIGISHCSSF  209

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             S RLY+FN T  QD S+DP YAA LK +CP  S + +  V +DP TP   D  YY  +  
Sbjct  210   SGRLYSFNATYPQDPSMDPRYAAFLKTKCPPPSNNGDPTVPLDP-TPNRMDNKYYIELTR  268

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
             NRGLLTSDQTL+  PST + V  NAR    W +KFA AMV MG L VLTG  GEIR  C 
Sbjct  269   NRGLLTSDQTLMNSPSTQRMVVNNARNGATWAAKFAKAMVHMGSLDVLTGTQGEIRTQCS  328

Query  983   VVN  975
             VVN
Sbjct  329   VVN  331



>ref|XP_010921348.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 219/305 (72%), Gaps = 2/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFY  +C +AE +V++ V +A  ++ G AAGL+R+HFHDCFVRGCD SVL++STP
Sbjct  16    ASLKVGFYEETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTP  75

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK++P NNPSLRGFEVID AKA +E+ C   VSCADI+AFAARDS  ITGG  Y+V
Sbjct  76    GNPSEKEAPPNNPSLRGFEVIDAAKAAVEAKCPCKVSCADIIAFAARDSAYITGGNDYEV  135

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG ISLASE  +N+P P F  D+L   F  KG T  EMVTLSGAH+IGRSHC+SF
Sbjct  136   PAGRRDGRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGRSHCSSF  195

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
             + RLYNF+ T  QD S++P +AA LK +CP  +  P+    V +D  TP   D  YY N+
Sbjct  196   TTRLYNFSATQPQDPSMEPAFAAYLKTRCPPSTASPSDPTTVLLDAVTPTRLDNMYYRNL  255

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             L +RG+LTSDQTL     T K V  NA+    W +KFA+AMVKMG + VLTG+ GEIR  
Sbjct  256   LKHRGVLTSDQTLQDSSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQGEIREK  315

Query  989   CRVVN  975
             C VVN
Sbjct  316   CWVVN  320



>ref|XP_002467585.1| hypothetical protein SORBIDRAFT_01g030530 [Sorghum bicolor]
 gb|EER94583.1| hypothetical protein SORBIDRAFT_01g030530 [Sorghum bicolor]
Length=325

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 225/303 (74%), Gaps = 3/303 (1%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             L A+L+VGFY NSC AAE++V+ EV  A   + G+AAGL+R+HFHDCFV GCD SVLIDS
Sbjct  25    LRAQLRVGFYDNSCPAAEIIVQQEVSTAVAANPGIAAGLLRLHFHDCFVGGCDASVLIDS  84

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N AEKD+   N SLRGFEVID+ KAR+E  C GVVSCADILAFAARDSV + GG  Y
Sbjct  85    TKGNTAEKDA-GPNTSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDSVALAGGNAY  143

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG  S AS+   NLP P  NV QLT +F NKG TQKEMV LSGAHTIG SHC+
Sbjct  144   QVPAGRRDGSTSRASDTNGNLPPPTANVAQLTKIFGNKGLTQKEMVILSGAHTIGSSHCS  203

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFS RL + +TT GQD ++DP Y A+L +QCPQ   DP  +V MD  +P  FD  +Y  V
Sbjct  204   SFSGRLSSSSTTAGQDPTMDPAYVAQLARQCPQAGGDP--LVAMDYVSPNAFDEGFYKGV  261

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +ANRGLL+SDQ LL+D +TA QV   A  P  ++S FAAAMVKMG +GVLTG +G+IRAN
Sbjct  262   MANRGLLSSDQALLSDKNTAVQVVTYANDPATFQSDFAAAMVKMGTVGVLTGASGKIRAN  321

Query  989   CRV  981
             CRV
Sbjct  322   CRV  324



>gb|KCW52190.1| hypothetical protein EUGRSUZ_J01619, partial [Eucalyptus grandis]
Length=313

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 218/303 (72%), Gaps = 4/303 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  13    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  72

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  73    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  132

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP  FFN  QL   F +KG +  EMVTLSGAH+IG SHC+SF
Sbjct  133   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  192

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             S+RLY+FN T  QD S+D   A++LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  193   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  250

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + VLTG+ GEIR  
Sbjct  251   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGSEGEIRRK  310

Query  989   CRV  981
             CRV
Sbjct  311   CRV  313



>ref|XP_010032733.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 216/305 (71%), Gaps = 4/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  24    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNSGIGAGLIRMHFHDCFVRGCDASILLDSTP  83

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  84    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  143

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + +LP  FFN  QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  144   PAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  203

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SNRLY+FN T  QD S+D   A +LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  204   SNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  261

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
                RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + VLTGN GEIR  
Sbjct  262   KNRRGLLTSDQTLSNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRK  321

Query  989   CRVVN  975
             C VVN
Sbjct  322   CMVVN  326



>ref|XP_010911662.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   365 bits (936),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/305 (58%), Positives = 218/305 (71%), Gaps = 2/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L VGFY  +C +AE +V++ V +A  ++ G AAGL+R+HFHDCFVRGCD SVL++STP
Sbjct  16    ASLNVGFYEKTCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTP  75

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK++P NNPSLRGFEVI+ AKA +E+ C   VSCADI+AFAARDS  ITGG+ Y+V
Sbjct  76    GNPSEKEAPPNNPSLRGFEVINAAKAAVEAKCPCKVSCADIIAFAARDSAYITGGIDYEV  135

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG ISLASE  +N+P P F  D+L   F  KG T  EMVTLSGAH+IGRSHC+SF
Sbjct  136   PAGRRDGRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGRSHCSSF  195

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
             + RLYNF+ T  QD S++P +AA LK +CP  +  P     V +D  TP   D  YY N+
Sbjct  196   TTRLYNFSATHPQDPSMEPAFAAYLKTRCPPSTASPTDPTTVLLDAVTPTRLDNMYYRNL  255

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             L +RG+LTSDQTL     T K V  NA+    W +KFA+AMVKMG + VLTG+ GEIR  
Sbjct  256   LKHRGVLTSDQTLQESSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQGEIREK  315

Query  989   CRVVN  975
             C VVN
Sbjct  316   CWVVN  320



>gb|KCW52189.1| hypothetical protein EUGRSUZ_J01618, partial [Eucalyptus grandis]
Length=313

 Score =   364 bits (934),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 217/303 (72%), Gaps = 4/303 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  13    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  72

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  73    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  132

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP  FFN  QL   F +KG +  EMVTLSGAH+IG SHC+SF
Sbjct  133   PAGRRDGLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSF  192

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             S+RLY+FN T  QD S+D   A++LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  193   SDRLYSFNATHTQDPSMDTKLASQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  250

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + +LTGN GEIR  
Sbjct  251   KNHRGLLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTGNEGEIRRK  310

Query  989   CRV  981
             C V
Sbjct  311   CTV  313



>ref|XP_002450360.1| hypothetical protein SORBIDRAFT_05g004180 [Sorghum bicolor]
 gb|EES09348.1| hypothetical protein SORBIDRAFT_05g004180 [Sorghum bicolor]
Length=340

 Score =   364 bits (935),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 220/308 (71%), Gaps = 7/308 (2%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +L+VGFY++SC  AE +V++ VR+   RD GV AGL+R+HFHDCFVRGCD S+LI+STP 
Sbjct  31    ELEVGFYKHSCPKAESIVRNAVRRGIARDAGVGAGLIRMHFHDCFVRGCDASILINSTPR  90

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             NKAEKDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARD   + GGL Y VP
Sbjct  91    NKAEKDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIIAFAARDGAYLAGGLDYKVP  150

Query  1520  AGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             +GRRDG +S   EV  NN+P PF +V +L   F  KG    +MVTLSGAHTIGRSHC+SF
Sbjct  151   SGRRDGRVSKEDEVLDNNVPAPFDDVAELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSF  210

Query  1343  SNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCP----QGSKDPNLVVQMDPATPAIFDVAYY  1179
             + RLYNF+   G+ D SLDP YA  LK +CP     G  DP  VV +DP TPA FD  YY
Sbjct  211   TQRLYNFSGQLGRTDPSLDPTYAEHLKMRCPWPSSNGQMDPT-VVPLDPVTPATFDNQYY  269

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              NVLA++GL  SD TLL +P TA  V  NA     W+ KFA AMVKMGK+ VLTG+ GEI
Sbjct  270   KNVLAHKGLFVSDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEI  329

Query  998   RANCRVVN  975
             R  C VVN
Sbjct  330   REKCFVVN  337



>ref|XP_009629163.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=346

 Score =   364 bits (934),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 216/311 (69%), Gaps = 3/311 (1%)
 Frame = -3

Query  1898  PIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVL  1719
             P   ++   VGFY+ SC AAE +++  V KA   + G AAG++R+HFHDCF+RGCDGSVL
Sbjct  36    PKSKKSTFGVGFYKRSCPAAEAIIRKAVFKAVLMNPGTAAGIIRMHFHDCFIRGCDGSVL  95

Query  1718  IDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITG  1542
             +DS    + AEKDSP NNPSLRGFEVID+AKA LE +C   VSCADILAFAARDS    G
Sbjct  96    LDSVRGKETAEKDSPINNPSLRGFEVIDEAKALLEKVCPRTVSCADILAFAARDSALFAG  155

Query  1541  GLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGR  1362
             G+ Y +P GRRDG ISL+SEV  NLP PFFN  QL   F  KG +  EMVTLSGAH+IGR
Sbjct  156   GISYALPGGRRDGRISLSSEVIQNLPPPFFNAQQLQDNFKRKGLSLDEMVTLSGAHSIGR  215

Query  1361  SHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL--VVQMDPATPAIFDV  1188
             +HC+SFSNRLY FN T  QD SLDP YA+ LK +CP+   D  +  +V +D +TP   D 
Sbjct  216   THCSSFSNRLYGFNATHPQDPSLDPRYASFLKNKCPRPISDTQVDPIVNLDISTPNRLDN  275

Query  1187  AYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNA  1008
              YY N+  ++GLLTSDQTL   P T+K V  N +    W  KFAAAMV MG + VLTGN 
Sbjct  276   KYYLNLKNHKGLLTSDQTLFESPLTSKLVFNNVKYGSTWARKFAAAMVHMGSIEVLTGNK  335

Query  1007  GEIRANCRVVN  975
             GEIR NC  VN
Sbjct  336   GEIRKNCHFVN  346



>gb|ACN25837.1| unknown [Zea mays]
 tpg|DAA46079.1| TPA: hypothetical protein ZEAMMB73_352661 [Zea mays]
Length=319

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 226/304 (74%), Gaps = 6/304 (2%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             L A+L+VGFY +SC AAE++V+ EV +A   + G+AAGL+R+HFHDCFV GCD SVLIDS
Sbjct  20    LRAQLRVGFYDSSCPAAEIIVQQEVSRAVAANPGLAAGLLRLHFHDCFVGGCDASVLIDS  79

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N AEKD+   N SLRGFEV+D+ KAR+E  C GVVSCADILAFAARDSV + GG  Y
Sbjct  80    TKGNTAEKDA-GPNLSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALAGGNAY  138

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +S AS+  +NLP P  NV QLT +F  KG TQKEMV LSGAHTIG SHC+
Sbjct  139   QVPAGRRDGSVSRASDT-SNLPPPTANVAQLTQIFGTKGLTQKEMVILSGAHTIGSSHCS  197

Query  1349  SFSNRLYNFNTTT-GQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             SFS RL    TT  GQD ++DP Y A+L +QCPQG  DP  +V MD  +P  FD  +Y  
Sbjct  198   SFSGRLSGSATTAGGQDPTMDPAYVAQLARQCPQGG-DP--LVPMDYVSPNAFDEGFYKG  254

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             V+ANRGLL+SDQ LL+D +TA QV   A  P  +++ FAAAMVKMG +GVLTG +G++RA
Sbjct  255   VMANRGLLSSDQALLSDKNTAVQVVTYANDPATFQADFAAAMVKMGSVGVLTGTSGKVRA  314

Query  992   NCRV  981
             NCRV
Sbjct  315   NCRV  318



>emb|CBI39654.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   365 bits (937),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 220/304 (72%), Gaps = 5/304 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFY+ +C +AE +V+  V KA  ++ G+AAGL+R+HFHDCFVRGCDGSVL+DSTP
Sbjct  14    ASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDCFVRGCDGSVLLDSTP  73

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK++PANNPSLRGFEVID AKA +E+ C   VSCAD+LAFAARDS    GG+ Y V
Sbjct  74    GNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGVNYAV  133

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +SL  E + +LP PFFN  QL   F  KG T  EMVTLSGAH+IG SHC+SF
Sbjct  134   PSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVSHCSSF  193

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPATPAIFDVAYYTN  1173
             SNRLY+FN T  QD S+DP +A  LK +CP  S    DP + +++   TP   D  YY +
Sbjct  194   SNRLYSFNATHPQDPSMDPEFARYLKTKCPPPSNTGSDPTVALEVQ--TPNRLDNKYYKD  251

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +  +RGLLTSDQTL   PSTA+ V  NAR    W +KFAAAMV+MG + VLTG  GEIR 
Sbjct  252   LKNHRGLLTSDQTLFDSPSTARMVKNNARYGENWGNKFAAAMVRMGAIDVLTGTQGEIRK  311

Query  992   NCRV  981
             NCRV
Sbjct  312   NCRV  315



>ref|XP_008662930.1| PREDICTED: peroxidase 5-like [Zea mays]
 ref|XP_008662931.1| PREDICTED: peroxidase 5-like [Zea mays]
 gb|AFW57502.1| hypothetical protein ZEAMMB73_638404 [Zea mays]
 gb|AFW57506.1| hypothetical protein ZEAMMB73_715795 [Zea mays]
Length=338

 Score =   363 bits (933),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/307 (60%), Positives = 217/307 (71%), Gaps = 5/307 (2%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KL+VGFY +SC  AE +V++ VR+   R+ GV AGL+R+HFHDCFVRGCDGS+LI+STP 
Sbjct  29    KLEVGFYEHSCAQAEDIVRNAVRRGIAREPGVGAGLIRMHFHDCFVRGCDGSILINSTPG  88

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCADI+AFAARDS  + GGL Y VP
Sbjct  89    NLAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADIVAFAARDSTYLAGGLDYKVP  148

Query  1520  AGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             +GRRDG +S   EV  NN+P P   VD+L   F  KG    +MVTLSGAHTIGRSHC+SF
Sbjct  149   SGRRDGRVSKEEEVLDNNVPAPTDEVDELIESFKRKGLNADDMVTLSGAHTIGRSHCSSF  208

Query  1343  SNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAIFDVAYYT  1176
             + RLYNF+   GQ D SLDP YA  LK +CP  S D  +   VV +DP TPA FD  YY 
Sbjct  209   TQRLYNFSGQLGQTDPSLDPAYAGHLKARCPWPSSDDQMDPTVVPLDPVTPATFDNQYYK  268

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
             NVLA++ L  SD TLL +P TA  V  NA     W+ KFA AMVKMGK+ VLTG+ GEIR
Sbjct  269   NVLAHKVLFISDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIR  328

Query  995   ANCRVVN  975
               C  VN
Sbjct  329   EKCFAVN  335



>ref|NP_001065172.1| Os10g0536700 [Oryza sativa Japonica Group]
 gb|AAL58122.1|AC092697_10 putative peroxidase [Oryza sativa Japonica Group]
 gb|AAM76351.1|AC074196_9 putative peroxidase [Oryza sativa Japonica Group]
 gb|AAP54814.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 tpe|CAH69370.1| TPA: class III peroxidase 128 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27086.1| Os10g0536700 [Oryza sativa Japonica Group]
Length=338

 Score =   363 bits (932),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 225/310 (73%), Gaps = 8/310 (3%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             LEA+L+VGFY NSC AAE++V+ EV KA   + G+AAGLVR+HFHDCFVRGCD SVLIDS
Sbjct  29    LEAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRLHFHDCFVRGCDASVLIDS  88

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N+AEKD+   N SLRGFEV+D+ KAR+E  C GVVSCADILAFAARDSV +TGG  Y
Sbjct  89    TKGNQAEKDA-GPNTSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAY  147

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +S +S+   NLP P  +V QLT +F  KG +Q+EMV LSGAHTIG SHC+
Sbjct  148   QVPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLSQREMVALSGAHTIGASHCS  207

Query  1349  SFSNRLYN-----FNTTTGQDSSLDPLYAAKLKQQCPQG--SKDPNLVVQMDPATPAIFD  1191
             SFS+RLY           GQD ++DP Y A+L QQCPQ   +     +V MD  TP  FD
Sbjct  208   SFSSRLYRAGTTAGGAGGGQDPTMDPAYVAQLAQQCPQSGGAAGGGALVPMDAVTPNAFD  267

Query  1190  VAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGN  1011
               ++  V+ NRGLL+SDQ LL D +TA QV   A     ++S FAAAMVKMG +GVLTG+
Sbjct  268   EGFFKGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQSDFAAAMVKMGAVGVLTGS  327

Query  1010  AGEIRANCRV  981
             +G++RANCRV
Sbjct  328   SGKVRANCRV  337



>gb|KCW52187.1| hypothetical protein EUGRSUZ_J01616, partial [Eucalyptus grandis]
Length=313

 Score =   362 bits (930),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 214/303 (71%), Gaps = 4/303 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C +AE VV+  V KA  ++ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  13    ATLQVGFYRSTCPSAESVVRKAVNKAVAKNSGIGAGLIRMHFHDCFVRGCDASILLDSTP  72

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRGFEVID+AKA LES+C   VSCADILAFAARDS    G + Y V
Sbjct  73    GNPSEKEHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAV  132

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + +LP  FFN  QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  133   PAGRRDGLVSLKDEPSQDLPPFFFNAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  192

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SNRLY+FN T  QD S+D   A +LK +CP   G+ DP   V +D  TP   D  YYTN+
Sbjct  193   SNRLYSFNATHTQDPSMDTKLATQLKSKCPNNGGASDP--TVPLDLVTPNRLDNKYYTNL  250

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
                RGLLTSDQTL   PSTA  V  NA     W +KFAAAMVKMG + VLTGN GEIR  
Sbjct  251   KNRRGLLTSDQTLSNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDVLTGNEGEIRRK  310

Query  989   CRV  981
             C V
Sbjct  311   CMV  313



>ref|XP_010040180.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=337

 Score =   363 bits (931),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 219/328 (67%), Gaps = 10/328 (3%)
 Frame = -3

Query  1928  ALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDC  1749
             AL ++L      +    L+VG+Y  +C  AE ++K  V  A  R+ G+AAGLVR+HFHDC
Sbjct  10    ALALVLFVSVSAMAAPPLKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDC  69

Query  1748  FVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFA  1569
             FVRGCD SVL+ STP N AE+D PANNPSLRGFE+ID+AKARLE++C G VSCADI+AFA
Sbjct  70    FVRGCDASVLLKSTPGNPAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFA  129

Query  1568  ARDSVE--------ITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKG  1413
             ARDS +         TGG+ YDVPAGRRDG +S   EV  NLP P FN  QL   F  KG
Sbjct  130   ARDSAQFASRNSALFTGGIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKG  189

Query  1412  FTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK--D  1239
              +  EMVTLSGAH+IG SHC+SFS+RLY FN T  QD +LD  YAA LK +CP  S    
Sbjct  190   LSVDEMVTLSGAHSIGISHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQ  249

Query  1238  PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKF  1059
             P+  V +D  T    D  YY  +L  RGLLTSD+TL T PST+  V  N R  + W  KF
Sbjct  250   PDPTVPLDSITANTLDNKYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKF  309

Query  1058  AAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             A AMVKMG + VLTGN GEIR  C VVN
Sbjct  310   AKAMVKMGSIEVLTGNQGEIRKVCSVVN  337



>gb|KDP37026.1| hypothetical protein JCGZ_06082 [Jatropha curcas]
Length=325

 Score =   362 bits (929),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 223/325 (69%), Gaps = 5/325 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SS  + ++LL     +  A L+VGFY+++C  AE +V+  V K   R+ G+ AGL+R+HF
Sbjct  2     SSSIIFLVLLCSLATLSSASLRVGFYKSTCPLAETIVRRAVNKFVSRNPGLGAGLIRMHF  61

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCD SVL++STP N +E++  ANNPSLRGFEVI++AKA++E+IC   VSCADIL
Sbjct  62    HDCFVRGCDASVLLESTPGNPSEREHIANNPSLRGFEVINEAKAQIEAICPQTVSCADIL  121

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDS    GG+ Y VPAGRRDG  S  +EV  NLP PFFN +QL+  F  KG +  E
Sbjct  122   AFAARDSSNKLGGINYAVPAGRRDGRTSNINEVEQNLPPPFFNAEQLSQNFARKGMSVDE  181

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP----QGSKDPNL  1230
             MVTLSGAH+IG SHC+SFSNRLY+FN+T  QD S+D  YAA LK +CP     G    + 
Sbjct  182   MVTLSGAHSIGISHCSSFSNRLYSFNSTHAQDPSMDSAYAAFLKTRCPPSNNNGGSTSDP  241

Query  1229  VVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAA  1050
              V +DP TP   D  YY  +  NRGLLTSDQTL+  PST   V  NAR    W +KFA A
Sbjct  242   TVALDP-TPNQMDNRYYMELKKNRGLLTSDQTLMNSPSTQNMVVNNARNSRVWAAKFAKA  300

Query  1049  MVKMGKLGVLTGNAGEIRANCRVVN  975
             MV MG L VLTG  GEIR  C VVN
Sbjct  301   MVHMGSLDVLTGTQGEIRKQCSVVN  325



>ref|XP_004983811.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=323

 Score =   362 bits (928),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 240/328 (73%), Gaps = 6/328 (2%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             M+ + ++    +A  ++LL+     L A+L+VGFY NSC AAE++V+ EV KA   + G+
Sbjct  1     MAVQRMALYFQVAAVVVLLTATG--LRAQLRVGFYDNSCPAAEIIVQQEVSKAVGANPGL  58

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGL+R+HFHDCFV+GCD SVLIDSTP N AEKD+   N SLRGFEV+D+ KAR+E  C 
Sbjct  59    AAGLLRLHFHDCFVKGCDASVLIDSTPGNTAEKDA-GPNTSLRGFEVVDRIKARVEQACS  117

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCADILAFAARDSV + GG  Y VPAGRRDG +S AS+   NLP P  NV QLT +F
Sbjct  118   GVVSCADILAFAARDSVALAGGNAYQVPAGRRDGAVSRASDTGGNLPPPTANVAQLTQIF  177

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS  1245
               KG TQK+MV LSGAHTIG SHC+SFS+RL    TT GQD ++DP Y A+L +QCPQG 
Sbjct  178   GTKGLTQKDMVVLSGAHTIGSSHCSSFSSRLSRSGTTAGQDPTMDPAYVAQLARQCPQGG  237

Query  1244  KDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
              DP  +V MD  +P  FD  +Y  V+ANRGLL+SDQ LL+D +TA QV   A  P  ++S
Sbjct  238   -DP--LVPMDYVSPNAFDEGFYKGVMANRGLLSSDQALLSDKNTAVQVVTYANDPATFQS  294

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRV  981
              FAAAMVKMG +GVLTG++G+IR NCRV
Sbjct  295   DFAAAMVKMGSVGVLTGSSGKIRGNCRV  322



>ref|XP_009768802.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=343

 Score =   362 bits (930),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 216/311 (69%), Gaps = 3/311 (1%)
 Frame = -3

Query  1898  PIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVL  1719
             P   ++   VGFY+ SC AAE +++  V KA   + G AAG++R+HFHDCF+RGCDGSVL
Sbjct  33    PKPKKSTFGVGFYKRSCPAAEAIIRKAVFKAVLMNPGTAAGIIRMHFHDCFIRGCDGSVL  92

Query  1718  IDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITG  1542
             +DS    + AEKDSP NNPSLRGFEVID+AKA LE +C   VSCADILAFAARDS    G
Sbjct  93    LDSVRGKETAEKDSPINNPSLRGFEVIDEAKALLEKLCPRTVSCADILAFAARDSALFAG  152

Query  1541  GLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGR  1362
             G+ Y +P GRRDG +SL+SEV  NLP PFFN  QL   F  KG +  EMVTLSGAH+IGR
Sbjct  153   GISYALPGGRRDGRVSLSSEVIQNLPPPFFNAQQLQDNFKRKGLSLDEMVTLSGAHSIGR  212

Query  1361  SHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL--VVQMDPATPAIFDV  1188
             +HC+SFSNRLY FN T  QD SLDP YA+ LK +CP+   D  +  +V +D +TP   D 
Sbjct  213   THCSSFSNRLYGFNATHPQDPSLDPRYASFLKNKCPRPISDTQVDPIVNLDISTPNRLDN  272

Query  1187  AYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNA  1008
              YY N+  ++GLLTSDQTL   P T+K V  N +    W  KFAAAMV MG + VLTGN 
Sbjct  273   KYYLNLKNHKGLLTSDQTLFESPLTSKLVFNNVKYGSTWARKFAAAMVHMGSIEVLTGNK  332

Query  1007  GEIRANCRVVN  975
             GEIR NC  VN
Sbjct  333   GEIRKNCHFVN  343



>ref|XP_010921347.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   361 bits (927),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 221/306 (72%), Gaps = 4/306 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFY  +C +AE +V++ V +A  ++ G AAGL+R+HFHDCFVRGCD SVL++STP
Sbjct  16    ASLKVGFYGETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTP  75

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK++P NNP+LRGFEVID AKA +E+ C   VSCADI+AFAARDS  ITGG+ Y+V
Sbjct  76    GNPSEKEAPPNNPTLRGFEVIDAAKAAVEAKCPRKVSCADIIAFAARDSAYITGGMDYEV  135

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG ISLASE  +N+P P F  D+L   F  KG +  EMVTLSGAH+IGRSHC+SF
Sbjct  136   PAGRRDGRISLASEALDNIPFPTFTADKLKENFERKGLSLDEMVTLSGAHSIGRSHCSSF  195

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS---KDPNLVVQMDPATPAIFDVAYYTN  1173
             + RLYNF+ T  QD S++P +AA LK +CP  +    DP  V+ +D  TP   D  YY N
Sbjct  196   TTRLYNFSATHPQDPSMEPAFAAYLKARCPPSTASLSDPTTVL-LDAVTPTRLDNIYYRN  254

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +L +RG+LTSDQTL     TAK V  NA+    W +KFA+AMVKMG + VLTG+ G+IR 
Sbjct  255   LLKHRGVLTSDQTLQESSETAKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTGSQGKIRE  314

Query  992   NCRVVN  975
              C V N
Sbjct  315   KCWVAN  320



>ref|XP_006654965.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=337

 Score =   362 bits (928),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 225/306 (74%), Gaps = 4/306 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KL+VGFY++SC  AE +V++ VR+A  RD G+AAGL+R+HFHDCFVRGCDGS+LI+STP 
Sbjct  29    KLKVGFYQHSCPQAEEIVRNAVRRAVARDAGLAAGLIRMHFHDCFVRGCDGSILINSTPG  88

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             NKAEKDS ANNPS+RGF+V+D AKA +E+ C   VSCAD+LAFAARD+  + GG+ Y VP
Sbjct  89    NKAEKDSVANNPSMRGFDVVDDAKAVVEAHCPRTVSCADVLAFAARDAAYLAGGIEYPVP  148

Query  1520  AGRRDGHISLASEV-ANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             +GRRDG +SL+ EV  NN+P P FNV  L   F  KG T  +MVTLSGAHTIGRSHC+SF
Sbjct  149   SGRRDGRVSLSDEVLVNNVPGPTFNVSDLIESFARKGLTADDMVTLSGAHTIGRSHCSSF  208

Query  1343  SNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTN  1173
             + RLYNF+   G+ D ++DP YA +LK +CP  + D N    V +DP TP  FD  YY N
Sbjct  209   TQRLYNFSGEAGRTDPAIDPAYAEQLKYRCPPATDDQNDPTTVPLDPVTPTAFDNQYYKN  268

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             VLA++ +L SDQTLL +P TA  V  ++     +K KFAAAMVKMG + VLTG+ GEIR 
Sbjct  269   VLAHKVVLHSDQTLLDNPWTAGLVKFHSAVDKVFKVKFAAAMVKMGNVEVLTGDEGEIRE  328

Query  992   NCRVVN  975
              C  VN
Sbjct  329   KCFAVN  334



>ref|XP_002465968.1| hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
 gb|EER92966.1| hypothetical protein SORBIDRAFT_01g049140 [Sorghum bicolor]
Length=333

 Score =   362 bits (928),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 219/305 (72%), Gaps = 5/305 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A+LQVGFY   C AAE++V++EV KA   + GVAAGL+R+HFHDCFVRGCDGSVL+DST 
Sbjct  32    AQLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDGSVLLDSTA  91

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N+AEKD+ A N SLRGFEVID AK RLE  C GVVSCADILAFAARD++ + GG  Y V
Sbjct  92    GNQAEKDA-APNASLRGFEVIDSAKTRLEQACFGVVSCADILAFAARDALALVGGNAYQV  150

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG++S A E   NLP P  +V +L  +F  KG TQ +MV LSGAHT+G + C+SF
Sbjct  151   PAGRRDGNVSSAQEAGANLPPPTASVSRLNQVFGAKGLTQADMVALSGAHTVGAARCSSF  210

Query  1343  SNRLYNFNTT-TGQDSSLDPLYAAKLKQQCPQ-GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             + RLY++  +  GQD S+DP Y A L QQCPQ    DP   V MDP TP  FD  YY N+
Sbjct  211   NGRLYSYGPSGAGQDPSMDPAYLAALTQQCPQVQGSDP--AVPMDPVTPTTFDTNYYANL  268

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +A RGLL SDQ LL DP+TA QV     +P  +++ F AAM+KMG + VLTG AG IR N
Sbjct  269   VAKRGLLASDQALLADPTTAAQVVGYTNSPATFQTDFVAAMLKMGNIEVLTGTAGTIRTN  328

Query  989   CRVVN  975
             CRV +
Sbjct  329   CRVAS  333



>ref|XP_010921346.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=328

 Score =   361 bits (927),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 192/324 (59%), Positives = 228/324 (70%), Gaps = 4/324 (1%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SS A   ++L     +  A LQVGFY + C AAE +V+  V +A  ++ G+AAGLVR+HF
Sbjct  6     SSFAFIAVMLMMT-TMSSATLQVGFYLSRCPAAESIVRRTVTEAVAKNPGIAAGLVRMHF  64

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCD SVL+DSTP N AEK+SPANNPSLRGFEVIDKAKA +E+ C   VSCADIL
Sbjct  65    HDCFVRGCDASVLLDSTPGNPAEKESPANNPSLRGFEVIDKAKAEIEAQCPQTVSCADIL  124

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARD     GG+ Y VPAGRRDG ISL S+V  N+P PFF VDQL   F  KG +  E
Sbjct  125   AFAARDGAFRAGGIDYTVPAGRRDGRISLESDVLQNIPAPFFTVDQLQQNFARKGLSLDE  184

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD---PNLV  1227
             MVTLSGAH+IG SHC+SFSNRLY+FN T  QD SL+P +AA LK +CP  S      +  
Sbjct  185   MVTLSGAHSIGVSHCSSFSNRLYSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGAGQDAT  244

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V +D  TP   D  YY N+  N+GLLTSDQ+L++DPST   V  NA     W +KFAAAM
Sbjct  245   VPLDIVTPNRLDNRYYKNLRNNKGLLTSDQSLMSDPSTKTIVRNNANRGAEWAAKFAAAM  304

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V+MG + VLTG  GEIR NCR+VN
Sbjct  305   VQMGSIEVLTGTQGEIRKNCRLVN  328



>ref|XP_004960409.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=333

 Score =   361 bits (927),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 230/323 (71%), Gaps = 9/323 (3%)
 Frame = -3

Query  1928  ALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDC  1749
             AL +  +S H     + L+VGFY++SC  AE +V++ VR+   RD GV AGL+R+HFHDC
Sbjct  12    ALVLASVSAH----ASHLEVGFYKHSCPEAEEIVRNAVRRGLARDPGVGAGLIRMHFHDC  67

Query  1748  FVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFA  1569
             FVRGCDGS+LI+STP N+AEKDS ANNPS+RGF+VID AKA LE+ C   VSCAD++AFA
Sbjct  68    FVRGCDGSILINSTPGNRAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADVVAFA  127

Query  1568  ARDSVEITGGLGYDVPAGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             ARD   + GG+ Y VP+GRRDG +S+ +EV  NN+P P   + +L   F  KG +  +MV
Sbjct  128   ARDGAYLAGGIEYQVPSGRRDGRVSIEAEVLNNNVPAPTDRLRELIESFKRKGLSADDMV  187

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VV  1224
             TLSGAHTIGRSHC+SF+ RLYNF+   G+ D S+DP YA  LK +CP  S D  +   VV
Sbjct  188   TLSGAHTIGRSHCSSFTQRLYNFSGQLGKTDPSIDPAYAEHLKMRCPWPSSDDQMDPTVV  247

Query  1223  QMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMV  1044
              +DP TPA FD  Y+ NVLA++ +LTSDQTLL  P TA  V  N+     W+ KFAA+M+
Sbjct  248   PLDPVTPASFDNQYFKNVLAHKVVLTSDQTLLDSPWTAGIVKFNSAVEKAWQLKFAASMI  307

Query  1043  KMGKLGVLTGNAGEIRANCRVVN  975
             KMGK+ VLTG+ GEIR  C VVN
Sbjct  308   KMGKIEVLTGDEGEIREKCFVVN  330



>gb|EMT13671.1| Peroxidase 5 [Aegilops tauschii]
Length=341

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 225/306 (74%), Gaps = 4/306 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+++C  AE +V+D VR+A  R+ G+A G++R+HFHDCFVRGCDGS+LI+STP N
Sbjct  35    LKVGFYKHTCPQAEYIVRDAVRRAVARNPGLAGGIIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS ANNPS+RGFEVID+AKA LE+ C   +SCAD+LAFAARD   + GG+ Y VP+
Sbjct  95    SAEKDSQANNPSMRGFEVIDEAKAALEASCPRTISCADVLAFAARDGAYLAGGINYRVPS  154

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S+A EV  NN+P P   V +L   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  155   GRRDGRVSIADEVLNNNVPFPTDEVAELVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              R++NF+   G+ D S+D  YAA+LK QCP  + +P+    V +DP TP  FD  Y+ NV
Sbjct  215   QRIHNFSGEVGRTDPSIDRSYAAELKHQCPPSTDNPSDPTTVPLDPVTPGEFDNQYFKNV  274

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA +  LTSDQTLLT P TA  V+ +A     W++KFAAAMVKMGK+ VLTG  GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVAFHAAVEKAWQAKFAAAMVKMGKVEVLTGEEGEIREK  334

Query  989   CRVVNH  972
             C VVNH
Sbjct  335   CFVVNH  340



>gb|EMS60334.1| Peroxidase 5 [Triticum urartu]
Length=341

 Score =   361 bits (926),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 223/306 (73%), Gaps = 4/306 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY ++C  AE +V+D VR+A  R+ G+A G++R+HFHDCFVRGCDGS+LI+STP N
Sbjct  35    LKVGFYEHTCPQAEYIVRDVVRRAVARNPGLAGGIIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS ANNPS+RGFEVID+AKA LE+ C   VSCAD+LAFAARD   + GG+ Y VP+
Sbjct  95    SAEKDSQANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S+A EV  NN+P P   V +L   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  155   GRRDGRVSIADEVLNNNVPFPTDEVAELVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              R++NF+   G+ D S+D  YAA+LK QCP  + +P+    V +DP TP  FD  Y+ NV
Sbjct  215   QRIHNFSGEAGRTDPSIDRSYAAELKHQCPLSTNNPSDPTTVALDPVTPGKFDNQYFKNV  274

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA +  LTSDQTLLT P TA  V+ +A     W+ KFAAAMVKMGK+ VLTG  GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVASHAAVEKAWQVKFAAAMVKMGKVEVLTGEEGEIREK  334

Query  989   CRVVNH  972
             C VVNH
Sbjct  335   CFVVNH  340



>gb|KCW45421.1| hypothetical protein EUGRSUZ_L00890 [Eucalyptus grandis]
Length=316

 Score =   359 bits (922),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 213/311 (68%), Gaps = 10/311 (3%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VG+Y  +C  AE ++K  V  A  R+ G+AAGLVR+HFHDCFVRGCD SVL+ STP N
Sbjct  6     LKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGN  65

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVE--------ITG  1542
              AE+D PANNPSLRGFE+ID+AKARLE++C G VSCADI+AFAARDS +         TG
Sbjct  66    PAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFTG  125

Query  1541  GLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGR  1362
             G+ YDVPAGRRDG +S   EV  NLP P FN  QL   F  KG +  EMVTLSGAH+IG 
Sbjct  126   GIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSIGI  185

Query  1361  SHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK--DPNLVVQMDPATPAIFDV  1188
             SHC+SFS+RLY FN T  QD +LD  YAA LK +CP  S    P+  V +D  T    D 
Sbjct  186   SHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQPDPTVPLDSITANTLDN  245

Query  1187  AYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNA  1008
              YY  +L  RGLLTSD+TL T PST+  V  N R  + W  KFA AMVKMG + VLTGN 
Sbjct  246   KYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKFAKAMVKMGSIEVLTGNQ  305

Query  1007  GEIRANCRVVN  975
             GEIR  C VVN
Sbjct  306   GEIRKVCSVVN  316



>dbj|BAK03531.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   360 bits (924),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 225/304 (74%), Gaps = 3/304 (1%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             + A+L+VGFY +SC AAE++V+ EV KA   + G+AAGL+R+HFHDCFV GC+ SVL+DS
Sbjct  34    VRAQLRVGFYDSSCPAAEIIVQQEVSKAVTANPGLAAGLLRLHFHDCFVGGCEASVLVDS  93

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N AEKD+   N SLRGFEVID+ KAR+E  C GVVSCADILAFAARDSV +TGG  Y
Sbjct  94    TKGNTAEKDA-GPNTSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAY  152

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +S A +   NLP P  NV+QLT +F +KG  QK++VTLSGAHTIG SHC+
Sbjct  153   QVPAGRRDGGVSRAQDTGGNLPPPSPNVNQLTKIFASKGLNQKDLVTLSGAHTIGGSHCS  212

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFS+RL    + T QD ++DP Y A+L QQC   S  P  +V MD  TP  FD  +Y  +
Sbjct  213   SFSSRLQT-PSPTAQDPTMDPGYVAQLAQQC-GASSSPGPLVPMDAVTPNSFDEGFYKGI  270

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             ++NRGLL SDQ LL+D +TA QV   A  P  ++S FAAAMVKMG +GVLTG++G+IRAN
Sbjct  271   MSNRGLLASDQALLSDGNTAVQVVSYANDPATFQSDFAAAMVKMGYVGVLTGSSGKIRAN  330

Query  989   CRVV  978
             CRVV
Sbjct  331   CRVV  334



>ref|NP_001048794.1| Os03g0121300 [Oryza sativa Japonica Group]
 gb|AAM52318.1|AC105363_7 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69276.1| TPA: class III peroxidase 34 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10708.1| Os03g0121300 [Oryza sativa Japonica Group]
 gb|EAY88316.1| hypothetical protein OsI_09775 [Oryza sativa Indica Group]
 gb|EAZ25393.1| hypothetical protein OsJ_09211 [Oryza sativa Japonica Group]
Length=322

 Score =   359 bits (922),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 223/305 (73%), Gaps = 4/305 (1%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             ++ +LQVGFY  SC  AE++V+DEV KA   + G+AAGLVR+HFHDCFV+GCD SVL+DS
Sbjct  22    VQGQLQVGFYDQSCPQAEVIVRDEVGKAVSANVGLAAGLVRMHFHDCFVKGCDASVLLDS  81

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  + AEKD+  N  SLRGFEV+D AK RLES CKGVVSCADILAFAARDSV + GG  Y
Sbjct  82    TANSTAEKDAIPNK-SLRGFEVVDSAKRRLESACKGVVSCADILAFAARDSVVLAGGTPY  140

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG+ S+AS+   NLP P  +V QLT  F   G +Q +MV LSGAHTIG +HC+
Sbjct  141   RVPAGRRDGNTSVASDAMANLPRPTSDVAQLTQSFATHGLSQDDMVILSGAHTIGVAHCS  200

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFS+RLY +N++TGQD +L+   A++L + CPQGS +    V MD  +   FD +YY N+
Sbjct  201   SFSSRLYGYNSSTGQDPALNAAMASRLSRSCPQGSAN---TVAMDDGSENTFDTSYYQNL  257

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA RG+L SDQTL  D +TA  V+QNA   + + +KF  AMVKMG + VLTG+ G+IR N
Sbjct  258   LAGRGVLASDQTLTADNATAALVAQNAYNMYLFATKFGQAMVKMGAIQVLTGSDGQIRTN  317

Query  989   CRVVN  975
             CRV N
Sbjct  318   CRVAN  322



>ref|XP_011092685.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=335

 Score =   360 bits (923),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 230/335 (69%), Gaps = 5/335 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSL--ALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDR  1791
             M+SR L   SS+   +  + +S    V  A L+VG+Y+NSC +AE +V+  V KA  R+ 
Sbjct  1     MASRVLKLSSSVFFLILFVFVSEFATVSLASLRVGYYQNSCPSAEAIVRKVVEKAVSRNL  60

Query  1790  GVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESI  1611
             G+ AGL+R+HFHDCFVRGCD SVL+DSTP  ++EK  PANNPSLRGFEVID+AKA LE  
Sbjct  61    GLGAGLIRMHFHDCFVRGCDASVLLDSTPGRRSEKQHPANNPSLRGFEVIDEAKAELEFA  120

Query  1610  CKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTT  1431
             C   VSCADI+AFAARDS    G + Y VP+GRRDG ISL  +V  NLP P FN  QL  
Sbjct  121   CPRTVSCADIIAFAARDSAYRLGNIKYMVPSGRRDGRISLEDDVTANLPPPSFNAAQLEQ  180

Query  1430  LFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ  1251
              F  KG T +EMVTLSGAH++G SHC+SFSNRLY+FN+T  QD SLDP  A +L++ CP+
Sbjct  181   NFARKGLTMEEMVTLSGAHSVGVSHCSSFSNRLYSFNSTHPQDPSLDPDLARELRKSCPR  240

Query  1250  ---GSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAP  1080
                 + + + VV +D ATP   D  YY N+ + R LLTSDQTLL+   +   V +NA+  
Sbjct  241   PDGEAGNSDRVVALDFATPNRLDNRYYLNLKSGRVLLTSDQTLLSSARSGWMVRRNAKHG  300

Query  1079  FRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
               W  KFA AMVKMG + VLTGN GEIR NCR VN
Sbjct  301   ASWAGKFADAMVKMGYIDVLTGNQGEIRNNCRFVN  335



>ref|XP_004960411.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=336

 Score =   360 bits (923),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 225/308 (73%), Gaps = 5/308 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             AKL+VGFY++SC  AE +V++ VR+   RD GV AGL+R+HFHDCFVRGCD S+LI+STP
Sbjct  26    AKLKVGFYKHSCPEAEEIVRNAVRRGLARDPGVGAGLIRMHFHDCFVRGCDSSILINSTP  85

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N+AEKDS ANNPS+RGF+VID AKA LE+ C   VSCAD++AFAARD   + GG+ Y V
Sbjct  86    GNRAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADVVAFAARDGAYLAGGIEYQV  145

Query  1523  PAGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             P+GRRDG +S+ +EV  NN+P P   + +L   F  KG +  +MVTLSGAHTIGRSHC+S
Sbjct  146   PSGRRDGRVSIEAEVLNNNVPAPTDRLRELIESFKRKGLSADDMVTLSGAHTIGRSHCSS  205

Query  1346  FSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAIFDVAYY  1179
             F+ RLYNF+   G+ D S+DP YA  LK++CP  S D  +   VV +DP TPA FD  Y+
Sbjct  206   FTQRLYNFSGQLGKTDPSIDPAYAEHLKKRCPWPSSDDQMDPTVVPLDPVTPASFDNQYF  265

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              NVL+++ +LTSDQTLL  P TA  V  N+     W+ KFAA+M+KMGK+ VLTG+ GEI
Sbjct  266   KNVLSHKVVLTSDQTLLDSPWTAGIVKFNSAVEKAWQLKFAASMIKMGKIEVLTGDEGEI  325

Query  998   RANCRVVN  975
             R  C VVN
Sbjct  326   REKCFVVN  333



>ref|XP_007153060.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
 gb|ESW25054.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
Length=331

 Score =   359 bits (922),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 220/319 (69%), Gaps = 2/319 (1%)
 Frame = -3

Query  1928  ALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDC  1749
             AL +ILLS   +   A L+VGFY ++C +AE +V+  V K   ++ G+AAGL+R+HFHDC
Sbjct  14    ALVLILLSGSSMA-SASLKVGFYASTCPSAEEIVRTAVNKGVSQNPGIAAGLIRMHFHDC  72

Query  1748  FVRGCDGSVLIDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             FVRGC+GSVL+ STP N  AE+D  ANNPSLRGFEVI++AK +LE+ C   VSCADILAF
Sbjct  73    FVRGCEGSVLLASTPGNPIAERDHFANNPSLRGFEVIEEAKIQLEAACPETVSCADILAF  132

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS    GG+ YDVP+GRRDG +S+A EV  NLP P  NVD+L   F  KG +  EMV
Sbjct  133   AARDSALKVGGITYDVPSGRRDGRVSVADEVGQNLPGPTSNVDELVNRFAQKGLSADEMV  192

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG SHC++FS RLY+FN T  QD S+D  YA  LK QCP      +  V  DP
Sbjct  193   TLSGAHSIGVSHCSAFSKRLYSFNDTFKQDPSMDSSYAETLKTQCPAPPATSDPTVSFDP  252

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
             +TP   D  YY  ++ +RGLLTSDQTL    ST + V  NA     W  KFA AMVKMG 
Sbjct  253   STPLRLDSKYYEGLIGHRGLLTSDQTLFATQSTREMVVSNANNGASWSEKFARAMVKMGS  312

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTGN+GEIR +C  VN
Sbjct  313   IEVLTGNSGEIRKHCSFVN  331



>ref|XP_008781200.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=328

 Score =   359 bits (921),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 190/324 (59%), Positives = 230/324 (71%), Gaps = 4/324 (1%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SSLA   ++L    I   A LQVGFY++ C AAE +V+  V +A  ++ G+AAGL+R+HF
Sbjct  6     SSLAFIAVMLMMTTIS-SATLQVGFYQSKCPAAESIVRRTVTEAVAKNPGIAAGLLRMHF  64

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCD SVL+DSTP N AEK+SPAN PSLRGFEVID+AKA +E+ C   VSCADIL
Sbjct  65    HDCFVRGCDASVLLDSTPGNPAEKESPANKPSLRGFEVIDRAKAEIEAQCPQTVSCADIL  124

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARD     GG+ Y VPAGRRDG ISL SEV  N+P PFF VDQL   F  KG ++ E
Sbjct  125   AFAARDGAFRAGGIDYAVPAGRRDGRISLESEVLQNIPAPFFTVDQLQQNFARKGLSRDE  184

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD---PNLV  1227
             MVTLSGAH+IG SHC+SFSNRLY+FN T  QD SL+P +AA LK +CP  S      +  
Sbjct  185   MVTLSGAHSIGVSHCSSFSNRLYSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGTGQDGT  244

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V +D  +P   D  YY N+ +++GLLTSDQ+L+ DPST   V  NA     W +KFAAAM
Sbjct  245   VPLDIVSPNRLDNWYYKNLRSSKGLLTSDQSLMDDPSTKTIVRNNANRGAEWAAKFAAAM  304

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V+MG + VLTG  GEIR NCR+VN
Sbjct  305   VRMGSIEVLTGTQGEIRKNCRLVN  328



>ref|XP_011077203.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=463

 Score =   364 bits (934),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 215/304 (71%), Gaps = 2/304 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KLQVG+Y  +C  AE++V+  V KA  ++ G+AAGL+R+HFHDCFVRGCDGSVL+DS P 
Sbjct  160   KLQVGYYAKTCPYAEIIVRQAVEKAVSKNPGIAAGLIRMHFHDCFVRGCDGSVLLDSVPG  219

Query  1700  NKA-EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
               A EK SP N PSLRGFEVID+AKA +E+ C G VSCADILAFAARDS    G +GYDV
Sbjct  220   KPAAEKASPINFPSLRGFEVIDEAKALIEAKCPGTVSCADILAFAARDSALKVGWIGYDV  279

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +SL+SEV  NLP PFF   QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  280   PSGRRDGRVSLSSEVVQNLPPPFFTASQLRDNFKRKGLSLDEMVTLSGAHSIGVSHCSSF  339

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-GSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             SNRL  FN T  QD SLDP +AA LK +CP  GS + + VV  D  TP   D  YY N+ 
Sbjct  340   SNRLSGFNATFNQDPSLDPGFAAFLKSRCPAPGSSNSDPVVNNDVLTPNQLDNKYYVNLK  399

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              ++GLLTSDQTL   P T+K V  N +    W  KFAAAMV MG + VLTG  GEIR NC
Sbjct  400   NHKGLLTSDQTLFDSPLTSKLVVNNVKYGSVWAKKFAAAMVHMGSIDVLTGKKGEIRRNC  459

Query  986   RVVN  975
             RVVN
Sbjct  460   RVVN  463



>ref|XP_010270944.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=339

 Score =   359 bits (922),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 215/308 (70%), Gaps = 7/308 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFY ++C +AE +V+  V KA  ++ G+ AGL+R+HFHDCFVRGCD SVL+DSTP
Sbjct  34    ASLKVGFYSSTCPSAEAIVRKAVTKAISQNPGIGAGLIRMHFHDCFVRGCDASVLLDSTP  93

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEK  PANNPSLRGFEVID AKA +E++C   VSCADI+AFAARDS    GG+ Y V
Sbjct  94    GNDAEKSHPANNPSLRGFEVIDMAKAHIEAVCPQTVSCADIIAFAARDSAYKLGGINYAV  153

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG IS ++++  NLP P F   QL   F  KG + +EMVTLSGAH+IG SHC+SF
Sbjct  154   PAGRRDGLISRSADIRANLPPPSFTAKQLEDRFAGKGLSLEEMVTLSGAHSIGVSHCSSF  213

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK-----DPNLVVQMDPATPAIFDVAYY  1179
              NRLYNFN T  QD S+DP YAA LK +CP  S      DP   V +D  TP   D  YY
Sbjct  214   LNRLYNFNATHPQDPSMDPDYAAFLKTRCPPTSTAGSSLDP--TVPLDVLTPNRLDNKYY  271

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              N+  + GLLTSD TL++  STA  V  NA+ P  W SKFAAAMV MG + VLTG  GEI
Sbjct  272   KNLKNHHGLLTSDWTLMSSHSTAWMVRNNAKHPSAWASKFAAAMVHMGYIDVLTGTQGEI  331

Query  998   RANCRVVN  975
             R +C VVN
Sbjct  332   RKSCSVVN  339



>ref|XP_007031236.1| Class III peroxidase 70 [Theobroma cacao]
 gb|EOY11738.1| Class III peroxidase 70 [Theobroma cacao]
Length=329

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 228/333 (68%), Gaps = 7/333 (2%)
 Frame = -3

Query  1964  MSSRNLSC-CSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRG  1788
             M + N SC C +     I L+       A L+VGFY++SC +AE  V+  V KA  R+ G
Sbjct  1     MQTLNSSCFCFTTFFLAIFLTIS--FSSATLKVGFYQSSCPSAEAAVRKAVDKAVSRNPG  58

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             +AA L+R+HFHDCFVRGCD SVL+DSTP   +EK+ PANNPSLRGFEVID+AKA +E+ C
Sbjct  59    MAAALIRMHFHDCFVRGCDASVLLDSTPGRPSEKEHPANNPSLRGFEVIDQAKAEIEAQC  118

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
                VSCADILAFAARDS    GG+ Y VP+GRRDG +SL  E   NLP PFFN  QL   
Sbjct  119   PRTVSCADILAFAARDSAYKVGGIKYAVPSGRRDGRVSLRDEGFGNLPPPFFNAKQLEDN  178

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-  1251
             F  KG    EMVTLSGAH+IG SHC+SFSNRL++FN T  QD SLDP +A +L+++CP  
Sbjct  179   FARKGLNLDEMVTLSGAHSIGVSHCSSFSNRLFSFNATHLQDPSLDPEFARQLRKRCPAP  238

Query  1250  -GSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFR  1074
               S+DP   V +D  +P   D  YY  +  + GLLTSDQTLL+  +TAK V +NAR    
Sbjct  239   GSSRDP--TVPLDVLSPHRLDNKYYEVLKNHHGLLTSDQTLLSSRATAKIVRENARHGKA  296

Query  1073  WKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             W  KF AAMVKMG + VLTG+ GEIR NCRVVN
Sbjct  297   WAKKFTAAMVKMGYIDVLTGSKGEIRKNCRVVN  329



>ref|XP_010034487.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/305 (60%), Positives = 216/305 (71%), Gaps = 4/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C AAE VV+  V KA  R+ G  AGL+R+HFHDCFVRGCD S+L+DST 
Sbjct  25    ATLQVGFYRSACPAAESVVRKAVNKAVARNPGTGAGLIRMHFHDCFVRGCDASILLDSTL  84

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PAN+PSLRG+EVIDKAKA LE +    VSCADILAFAARDS    G + Y V
Sbjct  85    GNPSEKEHPANDPSLRGYEVIDKAKAELEHLYPQTVSCADILAFAARDSTYKLGSINYAV  144

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP P  +  QL   F  KG +  EMVT+SGAH+IG SHC+SF
Sbjct  145   PAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTVSGAHSIGVSHCSSF  204

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SNRLY+FN T  QD SL+P  A++LK +CP   G+ DP   V +D  T    D  YYTN+
Sbjct  205   SNRLYSFNATHKQDPSLEPKLASELKAKCPNNGGTSDP--TVPLDFVTANRLDNKYYTNL  262

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RG+LTSDQTL   PSTA  V +NA     W SKFAAAMVKMG + VLTG+ GEIR N
Sbjct  263   KKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWASKFAAAMVKMGSIDVLTGSQGEIRRN  322

Query  989   CRVVN  975
             CRVVN
Sbjct  323   CRVVN  327



>ref|XP_008673305.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF83711.1| unknown [Zea mays]
 tpg|DAA43003.1| TPA: peroxidase 66 [Zea mays]
Length=329

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 217/306 (71%), Gaps = 7/306 (2%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +LQVGFY   C AAE++V++EV KA   + GVAAGL+R+HFHDCFVRGCD SVL+DS+  
Sbjct  27    QLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDASVLLDSSAG  86

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             N+AEKD+ A N SLRGFEVID AK RLE  C GVVSCAD+LAFAARD++ + GG  Y VP
Sbjct  87    NQAEKDA-APNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVP  145

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             AGRRDG++S A E   NLP P  +  QLT  F  KG +Q EMV LSGAHT+G + C+SF+
Sbjct  146   AGRRDGNVSSAQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFA  205

Query  1340  NRLYNFNTT-TGQDSSLDPLYAAKLKQQCP---QGSKDPNLVVQMDPATPAIFDVAYYTN  1173
              RLY++  +  GQD S+DP Y A L QQCP    G+ DP L   MDP TP  FD  YY N
Sbjct  206   PRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPL--PMDPVTPTAFDTNYYAN  263

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             ++A RGLL SDQ LL DP+TA QV     +P  +++ F AAM+KMG + VLTG AG +R 
Sbjct  264   LVARRGLLASDQALLADPATAAQVLAYTNSPATFQTDFVAAMIKMGAIQVLTGTAGTVRT  323

Query  992   NCRVVN  975
             NCRV +
Sbjct  324   NCRVAS  329



>dbj|BAJ95224.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   359 bits (921),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 226/306 (74%), Gaps = 4/306 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+++C  AE +V+D VR+A  R+ G+A G++R+HFHDCFVRGCDGS+LI+STP N
Sbjct  35    LKVGFYKHTCPQAEDIVRDAVRRAVARNPGLAPGIIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS ANNPS+RGFEVID+AKA LE+ C   VSCAD+LAFAARD   + GG+ Y VP+
Sbjct  95    TAEKDSVANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S+A EV  NN+P P   V +L   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  155   GRRDGRVSIADEVLNNNVPPPTDEVAELVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              R++NF+   G+ D S+D  YAA+L++QCP  + +P+    V +DP TP  FD  Y+ NV
Sbjct  215   QRIHNFSGEIGRTDPSIDKSYAAELRRQCPPSTDNPSDLTTVPLDPVTPREFDNQYFKNV  274

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA +  LTSDQTLLT P TA  V+ +A     W++KFAAAMVKMG + VLTG+ GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPHTAGIVALHAAVEKAWQAKFAAAMVKMGNVEVLTGHEGEIREK  334

Query  989   CRVVNH  972
             C VVNH
Sbjct  335   CFVVNH  340



>gb|KDP34818.1| hypothetical protein JCGZ_11180 [Jatropha curcas]
Length=322

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 222/324 (69%), Gaps = 6/324 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SS  + ++LL     +  A L+VGFY+++C  AE +V+  V K   R+  + AGL+R+HF
Sbjct  2     SSWIIFLVLLCSLATLSSASLRVGFYKSTCPLAETIVRRAVNKFVSRNPELGAGLIRMHF  61

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCF+RGCD SVL++STP   +E++  ANNPSLRGFEVI++AKA++E+IC   VSCADIL
Sbjct  62    HDCFIRGCDASVLLESTPGKPSEREHRANNPSLRGFEVINEAKAQIEAICPQTVSCADIL  121

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDS +  GG+ Y VPAGRRDG IS   EVA NLP P FN +QL+  F  KG +  E
Sbjct  122   AFAARDSSKKLGGINYAVPAGRRDGRISNVDEVAQNLPPPTFNAEQLSQNFARKGMSVDE  181

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ---GSKDPNLV  1227
             MVTLSGAH+IG SHC+SFSNRLY+FN T  QD S+D  YAA LK +CP     S DP   
Sbjct  182   MVTLSGAHSIGISHCSSFSNRLYSFNATHAQDLSMDSTYAAFLKTRCPNDGGSSSDP--T  239

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V +DP TP   D  YY  +  NRGLLTSDQTL+  PST   V  NAR    W +KFA AM
Sbjct  240   VALDP-TPNQMDNRYYMELKKNRGLLTSDQTLMNSPSTQNIVMNNARNSRLWAAKFAKAM  298

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V MG L VLTG  GEIR  C V+N
Sbjct  299   VHMGSLDVLTGTQGEIRKQCNVIN  322



>ref|XP_008781197.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=334

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 224/324 (69%), Gaps = 4/324 (1%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SS  + ++ +     V  A L+VGFY  +C +AE +V++ V +A  R+ G AAGL+R+HF
Sbjct  11    SSCMIVLMAILTMASVTSASLKVGFYEETCPSAETIVRETVSQAIVRNPGFAAGLIRMHF  70

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCD SVL++ST  N +EK++P NNPSLRGFEVID AKA +E+ C   VSCADI+
Sbjct  71    HDCFVRGCDASVLLNSTSGNPSEKEAPPNNPSLRGFEVIDAAKAAVEAKCPRKVSCADII  130

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDS  + GG+ Y VPAGRRDG ISL+SE  +N+P P F  D+L   F  KG +  E
Sbjct  131   AFAARDSAYLAGGIDYQVPAGRRDGRISLSSEALDNIPFPSFTADKLKENFERKGLSLNE  190

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS---KDPNLV  1227
             MVTLSGAH+IGRSHC+SF+ RLYNF+ T  QD S++P  AA LK +CP  +    DP  V
Sbjct  191   MVTLSGAHSIGRSHCSSFTTRLYNFSATHPQDPSMEPALAAYLKARCPPSTASLSDPTTV  250

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             + +D  TP   D  YY N+L +RG+LTSDQTL     T K V  NA+    W +KFA+AM
Sbjct  251   L-LDSVTPTCLDNLYYRNLLKHRGVLTSDQTLQDSSETTKLVWYNAKHQSAWAAKFASAM  309

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             VKMG + VLTG+ GEIR  C VVN
Sbjct  310   VKMGSIEVLTGSQGEIREKCWVVN  333



>ref|XP_010026045.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=330

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 217/307 (71%), Gaps = 6/307 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             +K +VGFY+ +C AA  +VK  V +A  ++ G+AAGL+R+HFHDCFVRGCD SVL+ STP
Sbjct  26    SKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTP  85

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AE+D P NNPSLRGFE+ID+AKARLE++C   VSCADI+AFAARDSV  TGG+ Y+V
Sbjct  86    ENPAERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIYYNV  145

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +S  SEV  NLP+P FN  QL   F  KG +  EMVTL GAH+IG SHC+SF
Sbjct  146   PAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHCSSF  205

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQC-PQGS---KDPNLVVQMDPATPAIFDVAYYT  1176
             S+RLY FN T  QD SLDP +AA LK +C PQ +    DP   V +D  TP   D  YY 
Sbjct  206   SSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDP--TVPLDSITPGTLDNKYYL  263

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
              +L  RG+L  D+TL T PST++ V  NA     W++KFA AMVKMG L VLTG  GEIR
Sbjct  264   QLLKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGEIR  323

Query  995   ANCRVVN  975
               C VVN
Sbjct  324   ELCSVVN  330



>ref|XP_003568991.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=336

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 222/305 (73%), Gaps = 4/305 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY +SC  AE +V+D VR+   R+ G A GL+R+HFHDCFVRGCDGSVLI+STP N
Sbjct  30    LKVGFYEHSCPQAEAIVRDAVRRGIARNPGFAPGLIRMHFHDCFVRGCDGSVLINSTPGN  89

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
             +AEKDS AN PSLRGFEVID AKA LES+C   VSCAD+LAFAARDS ++ GG+ Y +P+
Sbjct  90    RAEKDSVANTPSLRGFEVIDDAKAILESVCPRTVSCADVLAFAARDSADLAGGISYPLPS  149

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +SL SEV  NN+P P  +V  L   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  150   GRRDGRVSLESEVLDNNVPPPTDDVAALIASFARKGLSADDMVTLSGAHTIGRSHCSSFT  209

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              R++NF    G+ D S++P YA+ LK++CP  + DPN   VV +D  TPA FD  YY NV
Sbjct  210   QRIHNFTGVQGRTDPSIEPAYASDLKRRCPPATDDPNDPTVVPLDVVTPAEFDNQYYKNV  269

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA++  LTSDQTL+T   TA  V  +A     W++KFA +MV+MG +GVLTG+ GEIR  
Sbjct  270   LAHKVPLTSDQTLITSKRTAAIVVFHAAVEKAWRAKFAVSMVRMGNVGVLTGHQGEIREK  329

Query  989   CRVVN  975
             C  +N
Sbjct  330   CFAIN  334



>ref|XP_011077202.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=429

 Score =   361 bits (926),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 215/304 (71%), Gaps = 2/304 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KL+VG+Y  +C  AE++V+  V KA  ++ G+AAGL+R+HFHDCFVRGCDGSVL+DS P 
Sbjct  126   KLKVGYYAKTCPYAEIIVRQAVEKAVSKNPGIAAGLIRMHFHDCFVRGCDGSVLLDSVPG  185

Query  1700  NKA-EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
               A EK SP N PSLRGFEV+D+AKA +E+ C G VSCADILAFAARDS    G +GYDV
Sbjct  186   KPAAEKASPINFPSLRGFEVVDEAKALIEAKCPGTVSCADILAFAARDSALKVGWIGYDV  245

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +SL+SEV  NLP PFF   QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  246   PSGRRDGRVSLSSEVVQNLPPPFFTASQLRDNFKRKGLSLDEMVTLSGAHSIGVSHCSSF  305

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-GSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             SNRL  FN T  QD SLDP +AA LK +CP  GS + + VV  D  TP   D  YY N+ 
Sbjct  306   SNRLSGFNATFNQDPSLDPGFAAFLKSRCPAPGSSNSDPVVNNDVLTPNQLDNKYYVNLK  365

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              ++GLLTSDQTL   P T+K V  N +    W  KFAAAMV MG + VLTG  GEIR NC
Sbjct  366   NHKGLLTSDQTLFDSPLTSKLVVDNVKYGSVWAKKFAAAMVHMGSIDVLTGKKGEIRRNC  425

Query  986   RVVN  975
             RVVN
Sbjct  426   RVVN  429



>ref|XP_010069737.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
 gb|KCW58171.1| hypothetical protein EUGRSUZ_H00888 [Eucalyptus grandis]
Length=338

 Score =   357 bits (917),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 214/312 (69%), Gaps = 6/312 (2%)
 Frame = -3

Query  1898  PIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVL  1719
             P    +K  V FY+ +C AAE ++K  V  A  ++ G+AAGL+R+HFHDCFVRGCD SVL
Sbjct  29    PCPTSSKFTVRFYKYTCPAAESIIKQTVYGAIAKNPGMAAGLLRLHFHDCFVRGCDASVL  88

Query  1718  IDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGG  1539
             + STP N AE+D PANNPSLRGFE+ID+AKARLE++C   VSCADI+AFAARDS+  TGG
Sbjct  89    LKSTPKNPAERDHPANNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSIFKTGG  148

Query  1538  LGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRS  1359
             + YDVPAGRRDG IS   EV  NLP P FN  QL   F  KG +  EMVTLSGAH+IG S
Sbjct  149   IYYDVPAGRRDGRISRLPEVTQNLPPPNFNAQQLIANFARKGLSADEMVTLSGAHSIGIS  208

Query  1358  HCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK----DPNLVVQMDPATPAIFD  1191
             HC+SFS+RLY FNTT  QD +LDP +A+ LK +CP  S     DP   V +D  TP   D
Sbjct  209   HCSSFSSRLYAFNTTLAQDPTLDPAFASLLKTKCPPPSNATRADPT--VPLDSITPNALD  266

Query  1190  VAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGN  1011
               YY  +   RG+L +D+TL   PST++ V  NA     W+ KFA AMVKMG L VLTG 
Sbjct  267   NKYYLQLQKLRGVLATDETLYKSPSTSRMVVSNAVNGAAWRVKFAKAMVKMGSLDVLTGK  326

Query  1010  AGEIRANCRVVN  975
              GEIR  C VVN
Sbjct  327   QGEIRKVCSVVN  338



>ref|XP_009411413.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=324

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 227/321 (71%), Gaps = 6/321 (2%)
 Frame = -3

Query  1931  LALTMILLSC-HPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFH  1755
             ++L +I + C   +  EA L+VGFY  SC  AE +VK+E+ KA   D+G+ + L+R+HFH
Sbjct  8     MSLAIIAVLCLSAMGTEAYLKVGFYSYSCPKAEEIVKEELDKALQEDKGIGSDLLRMHFH  67

Query  1754  DCFVRGCDGSVLIDSTPANKAEKDS-PANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             DCFVRGCDGS+LIDST  N AEKD  P       GFEVIDK K RLE+ CKG VSCADIL
Sbjct  68    DCFVRGCDGSLLIDSTKDNAAEKDGKPNETVEDEGFEVIDKVKERLEAECKGTVSCADIL  127

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AF ARDSV   GG+ Y VPAGRRDG IS +++  + LP P F +  LT LF +KG ++ +
Sbjct  128   AFLARDSVAHYGGVHYPVPAGRRDGRISRSNDTID-LPPPTFKLGNLTKLFVSKGLSRDD  186

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQM  1218
             MV LSGAHTIG +HC++FS+RLYNF+ T   D SL P YAA+L+ QCP GS +    V M
Sbjct  187   MVALSGAHTIGIAHCSAFSDRLYNFSQTVKADPSLGPNYAAQLRGQCPTGSDNE---VDM  243

Query  1217  DPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             DP +P  FD +YY N+LA+RGL TSDQTL++   TA  V + A+ P  +K KFAAAMVKM
Sbjct  244   DPPSPLTFDSSYYKNLLAHRGLFTSDQTLMSKHGTATLVKRFAKKPALFKKKFAAAMVKM  303

Query  1037  GKLGVLTGNAGEIRANCRVVN  975
             G +GVLTG  GEIR NCRVVN
Sbjct  304   GSIGVLTGEQGEIRTNCRVVN  324



>ref|XP_006649294.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=325

 Score =   357 bits (916),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 225/306 (74%), Gaps = 6/306 (2%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+LQVGFY  SC  AE++V+DEV KA   + G+AAGLVR+HFHDCFV+GCD SVL+DS 
Sbjct  24    KAQLQVGFYDQSCPQAEVIVRDEVGKAVSANPGLAAGLVRMHFHDCFVKGCDASVLLDSA  83

Query  1706  P--ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
                   AEKD+P N  SLRGFEV+D AK RLES CKGVVSCAD+LAFAARDSV +TGG  
Sbjct  84    ANSTTAAEKDAPPNK-SLRGFEVVDSAKQRLESACKGVVSCADVLAFAARDSVVLTGGSP  142

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             Y VPAGRRDG+ S+AS+   +LP P  +V  LT +F   G +Q+EMVTLSGAHTIG +HC
Sbjct  143   YRVPAGRRDGNTSVASDAMASLPPPTADVPTLTRMFAKYGLSQEEMVTLSGAHTIGVTHC  202

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             +SFS+RLY +N++TGQD +L+   A++L + CPQGS +    V MD  +   FD +YY N
Sbjct  203   SSFSSRLYGYNSSTGQDPALNAAMASRLARVCPQGSGN---TVAMDDGSENTFDTSYYQN  259

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +LA RG+L SDQTL  D +TA  V+QNA   + + ++F  AMVKMG + VLTG+ G+IR 
Sbjct  260   LLAGRGVLASDQTLTADNATAALVAQNAYNMYLFATRFGQAMVKMGAIQVLTGSNGQIRT  319

Query  992   NCRVVN  975
             NCRV N
Sbjct  320   NCRVAN  325



>gb|KCW52188.1| hypothetical protein EUGRSUZ_J01617, partial [Eucalyptus grandis]
Length=319

 Score =   357 bits (915),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 220/311 (71%), Gaps = 4/311 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C AAE VV+  V KA  R+ G  AGL+R+HFHDCFVRGCD S+L+DST 
Sbjct  7     ATLQVGFYRSACPAAESVVRKAVNKAVARNPGTGAGLIRMHFHDCFVRGCDASILLDSTL  66

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PAN+PSLRG+EVIDKAKA LE +    VSCADILAFAARDS    G + Y V
Sbjct  67    GNPSEKEHPANDPSLRGYEVIDKAKAELEHLYPQTVSCADILAFAARDSTYKLGSINYAV  126

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP P  +  QL   F  KG +  EMVT+SGAH+IG SHC+SF
Sbjct  127   PAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTVSGAHSIGVSHCSSF  186

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SNRLY+FN T  QD SL+P  A++LK +CP   G+ DP   V +D  T    D  YYTN+
Sbjct  187   SNRLYSFNATHKQDPSLEPKLASELKAKCPNNGGTSDP--TVPLDFVTANRLDNKYYTNL  244

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RG+LTSDQTL   PSTA  V +NA     W SKFAAAMVKMG + VLTG+ GEIR N
Sbjct  245   KKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWASKFAAAMVKMGSIDVLTGSQGEIRRN  304

Query  989   CRVVNH*RSEE  957
             CRV+++ +S +
Sbjct  305   CRVLSNGKSTQ  315



>ref|XP_008461392.1| PREDICTED: peroxidase 5-like [Cucumis melo]
Length=338

 Score =   357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 234/346 (68%), Gaps = 15/346 (4%)
 Frame = -3

Query  1991  MINKQMKKEMSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVR  1812
             M +   K E+ S   S C      +     H  +    L+VGFY++SC  AE ++K+ V 
Sbjct  1     MASSSQKFELLSNLFSNC-----IIFFFLFHSTLASTTLKVGFYKSSCPRAETIIKNAVN  55

Query  1811  KAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKA  1632
             +A  ++ G+AAGL+R+HFHDCFVRGC+GSVL+ STP N +E++  AN PSLR FEVID+A
Sbjct  56    QAISQNPGIAAGLIRMHFHDCFVRGCEGSVLLQSTPNNPSEREHRANFPSLRAFEVIDEA  115

Query  1631  KARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFF  1452
             KA++E+IC   VSCADILAFAARDS    GG+ Y VPAGRRDG IS+  E AN+LP P F
Sbjct  116   KAKIEAICPNTVSCADILAFAARDSAYRVGGINYAVPAGRRDGRISIKEE-ANSLPGPSF  174

Query  1451  NVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAK  1272
             N +QLT  F  +GF+ +EMVTLSGAH+IG +HC +FSNRLY+FNTT  QD S+DPLYAA 
Sbjct  175   NAEQLTESFAKRGFSSEEMVTLSGAHSIGVAHCPTFSNRLYSFNTTHPQDPSMDPLYAAY  234

Query  1271  LKQQCP-------QGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPST  1113
             LK +CP        GS++P   ++    +P   D  YY  +  +RGLL+SDQTLL+  ST
Sbjct  235   LKTKCPPPSGNNGNGSEEPTAALEF--FSPYRLDNWYYIELKNHRGLLSSDQTLLSSSST  292

Query  1112  AKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
              + V  NA+   +W +KF  AMVKMG L VLTG+ GEIR +C  VN
Sbjct  293   KEMVLHNAKHGHQWAAKFGKAMVKMGFLDVLTGSQGEIRRHCSFVN  338



>gb|EMT10333.1| Peroxidase 5 [Aegilops tauschii]
Length=341

 Score =   357 bits (916),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 224/306 (73%), Gaps = 4/306 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+++C  AE +V+D VR+A  R+ G A GL+R+HFHDCFVRGCDGS+LI+STP N
Sbjct  35    LKVGFYKHTCPQAEDIVRDAVRRAVARNPGFAPGLIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS ANNPS+RGFEVID+AKA LE+ C   VSCAD+LAFAARD   + GG+ Y VP+
Sbjct  95    TAEKDSVANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S+A EV  NN+P P   V QL   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  155   GRRDGRVSIADEVLNNNVPPPTDEVAQLVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              R++NF+   G+ D S+D  YAA+L++QCP  + +P+    V +DP TP  FD  Y+ NV
Sbjct  215   QRIHNFSGEVGRTDPSIDKSYAAELRRQCPPSTDNPSDLTTVPLDPITPREFDNQYFKNV  274

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA +  LTSDQTLLT P TA  V+ +A     W++KFAAAMVKMG + VLTG+ GEIR  
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVAFHAAVEKAWRAKFAAAMVKMGNVEVLTGHEGEIREK  334

Query  989   CRVVNH  972
             C  VNH
Sbjct  335   CFAVNH  340



>ref|XP_010032731.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 216/305 (71%), Gaps = 4/305 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFY ++C + E VV+  V KA  R+ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  25    ATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  84

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEK+ PANNPSLRG+EVID+AKA LE +C   VSCADILAFAARDS    G + Y V
Sbjct  85    GNPAEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINYAV  144

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP P  +  QL   F  KG +  EMVTLSGAH++G SHC+SF
Sbjct  145   PAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSVGVSHCSSF  204

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             S RL +FN T  QD S++P  A++LK +C    G+ DP   V +D ATP   D  YYTN+
Sbjct  205   STRLSSFNATHKQDPSMEPRMASELKAKCLNNGGASDP--TVPLDFATPNRLDNKYYTNL  262

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RG+LTSDQTL   PSTA  V ++A     W +KFAAAMVKMG + +LTGN GEIR N
Sbjct  263   KDHRGVLTSDQTLFDSPSTAYIVRKHANHGGAWANKFAAAMVKMGSIDILTGNQGEIRRN  322

Query  989   CRVVN  975
             CRVVN
Sbjct  323   CRVVN  327



>ref|NP_001141025.1| uncharacterized protein LOC100273104 precursor [Zea mays]
 gb|ACF85208.1| unknown [Zea mays]
 gb|AFW57507.1| hypothetical protein ZEAMMB73_610484 [Zea mays]
Length=340

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 217/308 (70%), Gaps = 5/308 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
              KL+VGFY +SC  AE +V++ VR+   R+ GV AGL+R+HFHDCFVRGCDGS+LI+STP
Sbjct  30    GKLEVGFYEHSCPQAEDIVRNAVRRGIAREPGVGAGLIRMHFHDCFVRGCDGSILINSTP  89

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              NKAEKDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARDS  + GGL Y V
Sbjct  90    DNKAEKDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIVAFAARDSAYLAGGLDYKV  149

Query  1523  PAGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             P+GRRDG +S   EV  NN+P P   VD+L   F  KG    +MVTLSGAHTIGRSHC+S
Sbjct  150   PSGRRDGRVSKEDEVLDNNVPAPTDEVDELIESFKRKGLNADDMVTLSGAHTIGRSHCSS  209

Query  1346  FSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAIFDVAYY  1179
             F+ RLYNF+   G+ D SLDP YA  LK +CP  S +  +   VV +DP T A FD  YY
Sbjct  210   FTERLYNFSGQLGRTDPSLDPAYAEHLKMRCPWPSSNDQMDPTVVPLDPVTSATFDNQYY  269

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              NVLA++ L  SD TLL +P TA  V  NA     W+ KFA AMVKMGK+ VLTG+ GEI
Sbjct  270   KNVLAHKVLFISDNTLLENPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEI  329

Query  998   RANCRVVN  975
             R  C  VN
Sbjct  330   REKCFAVN  337



>ref|XP_010234947.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=303

 Score =   354 bits (909),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 222/304 (73%), Gaps = 5/304 (2%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             + A+L+VGFY +SC AAE++V+ EV  A   + G+AAGL+R+HFHDCFV GC+ SVL+DS
Sbjct  5     VSAQLRVGFYDSSCPAAEIIVQQEVSSAVAANPGLAAGLLRLHFHDCFVGGCEASVLVDS  64

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T +N AEKD+   N SLRGFEVID+ KAR+E  C GVVSCADILAFAARD + +TGG GY
Sbjct  65    TASNTAEKDA-GPNKSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDGIALTGGNGY  123

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG +S AS+ + NLP P  +V QLT +F +KG TQK+MVTLSGAHTIG SHCT
Sbjct  124   QVPAGRRDGSVSKASDTSGNLPPPTPSVPQLTAIFASKGLTQKDMVTLSGAHTIGGSHCT  183

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SFS+RL      T  D ++DP Y A+L  QC   S     +V MD  TP  FD  Y+  V
Sbjct  184   SFSSRLQTPGPQT-PDPTMDPGYVAQLASQCSSSSSG---MVPMDAVTPNTFDEGYFKGV  239

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             +ANRGLL SDQ LL D +TA QV   A  P  ++S FAAAMVKMG +GVLTG++G+IRAN
Sbjct  240   MANRGLLASDQALLGDGATAGQVVAYANDPATFQSDFAAAMVKMGYVGVLTGSSGKIRAN  299

Query  989   CRVV  978
             CRVV
Sbjct  300   CRVV  303



>gb|KCW58170.1| hypothetical protein EUGRSUZ_H00887, partial [Eucalyptus grandis]
Length=337

 Score =   355 bits (910),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 216/310 (70%), Gaps = 6/310 (2%)
 Frame = -3

Query  1898  PIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVL  1719
             P    +K +VGFY+ +C AA  +VK  V +A  ++ G+AAGL+R+HFHDCFVRGCD SVL
Sbjct  30    PCRTSSKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVL  89

Query  1718  IDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGG  1539
             + STP N AE+D P NNPSLRGFE+ID+AKARLE++C   VSCADI+AFAARDSV  TGG
Sbjct  90    LKSTPENPAERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGG  149

Query  1538  LGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRS  1359
             + Y+VPAGRRDG +S  SEV  NLP+P FN  QL   F  KG +  EMVTL GAH+IG S
Sbjct  150   IYYNVPAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGIS  209

Query  1358  HCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC-PQGS---KDPNLVVQMDPATPAIFD  1191
             HC+SFS+RLY FN T  QD SLDP +AA LK +C PQ +    DP   V +D  TP   D
Sbjct  210   HCSSFSSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPT--VPLDSITPGTLD  267

Query  1190  VAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGN  1011
               YY  +L  RG+L  D+TL T PST++ V  NA     W++KFA AMVKMG L VLTG 
Sbjct  268   NKYYLQLLKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGA  327

Query  1010  AGEIRANCRV  981
              GEIR  C V
Sbjct  328   QGEIRELCSV  337



>gb|KDP37024.1| hypothetical protein JCGZ_06080 [Jatropha curcas]
Length=318

 Score =   353 bits (907),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 222/325 (68%), Gaps = 13/325 (4%)
 Frame = -3

Query  1934  SLALTMILLSCHPIVLE-AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             S ++  ++L C  + L  A L+VGFY+++C  AE +V+  V K   R+ G+ AGL+R+HF
Sbjct  2     SSSIIFLVLLCSLVTLSSASLKVGFYKSTCPLAETIVRRAVNKFVSRNPGLGAGLIRMHF  61

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCDGSVL++STP N +E++  ANNPSLRGFEVI++AKA++E+IC   VSCADIL
Sbjct  62    HDCFVRGCDGSVLLESTPGNPSEREHIANNPSLRGFEVINEAKAQIEAICPQTVSCADIL  121

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFA+RDS    GG+ Y VPAGRRDG       +  NLP PFFN +QL+  F  KG +  E
Sbjct  122   AFASRDSSSKLGGINYAVPAGRRDG-------LEQNLPPPFFNAEQLSQNFARKGMSVDE  174

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP----QGSKDPNL  1230
             MVTLSGAH+IG SHC+SFSNRLY+FN+T  QD S+D  YAA LK +CP     G    + 
Sbjct  175   MVTLSGAHSIGISHCSSFSNRLYSFNSTHAQDPSMDSAYAAVLKTRCPPSNNNGGSTNDP  234

Query  1229  VVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAA  1050
              V  DP TP   D  YY  +  NRGLLTSDQTLL  PST K V  NAR    W +KFA A
Sbjct  235   TVARDP-TPNRMDNRYYMELKKNRGLLTSDQTLLNSPSTQKMVVNNARNSRVWAAKFAKA  293

Query  1049  MVKMGKLGVLTGNAGEIRANCRVVN  975
             MV MG L VLTG  GE+R  C VVN
Sbjct  294   MVHMGSLDVLTGTQGEVRKQCSVVN  318



>ref|XP_007207711.1| hypothetical protein PRUPE_ppa025326mg [Prunus persica]
 gb|EMJ08910.1| hypothetical protein PRUPE_ppa025326mg [Prunus persica]
Length=320

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 226/319 (71%), Gaps = 5/319 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             LA+ M++      +  A  +VGFY+ SC +AE +V+  V KA  ++ G+AAGL+R+HFHD
Sbjct  7     LAMFMVVF-----MASAAPKVGFYQRSCPSAEAIVRKAVNKAVAKNPGIAAGLIRMHFHD  61

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD S+L+DSTP   +EK+ PANNPSLRGFEVID+AKA +E+ C   VSCADILAF
Sbjct  62    CFVRGCDASILLDSTPGQPSEKEHPANNPSLRGFEVIDEAKAEIEAKCPKTVSCADILAF  121

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS    GG+ YDVP+GRRDG +SL  E   +LP P FN  QL   F  KG +  EMV
Sbjct  122   AARDSALKVGGINYDVPSGRRDGRVSLQDEPTQHLPPPSFNAKQLEDSFARKGLSLDEMV  181

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG SHC+SFS+RLY FN T  QD S+DP++A  LK++CP+ S +  + V +D 
Sbjct  182   TLSGAHSIGVSHCSSFSDRLYFFNATHPQDPSMDPIFARNLKKKCPRSSNNDRVTVPLDV  241

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP   D  YYT++  + GLLTSDQTLLT  STA  V  NAR    W +KFAAAMVKMG 
Sbjct  242   LTPNRLDNKYYTDLKNHHGLLTSDQTLLTSRSTAGIVRNNARFGAAWANKFAAAMVKMGS  301

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTG  GEIR NC+VVN
Sbjct  302   IDVLTGRQGEIRNNCKVVN  320



>ref|XP_010938174.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=329

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 216/306 (71%), Gaps = 9/306 (3%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFY+ SC +AE +V++ V +A  ++ G+AAGL+R+HFHDCFVRGCD SVL++STP
Sbjct  29    ASLEVGFYKESCPSAEDIVRNTVSQAVAQNPGIAAGLIRMHFHDCFVRGCDASVLLNSTP  88

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEKD+P NNPSLRGF+VID AKA +E+ C   VSCADILAFAARD   +TGG+ Y V
Sbjct  89    GNTAEKDAPPNNPSLRGFQVIDAAKAAVEACCPRKVSCADILAFAARDGAYLTGGIDYQV  148

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG IS  SE   N+P+P  N +QL   F NKG +  EMVTLSGAH+IGRSHC+SF
Sbjct  149   PAGRRDGRISRESEALANIPSPNSNAEQLKENFTNKGLSLDEMVTLSGAHSIGRSHCSSF  208

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS---KDPNLVVQMDPATPAIFDVAYYTN  1173
             +NRLY       QD S+DP +AA+LK  CP  +    DP  VV +D  TP   D  YY N
Sbjct  209   TNRLYGV-----QDPSMDPAFAAQLKATCPPSTASPSDPTTVV-LDAVTPDRLDNMYYWN  262

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +L +RG+LTSDQTL     TAK V   A     W +KFAAAMVKMG + VLTG+ GEIR 
Sbjct  263   LLKHRGVLTSDQTLEESSETAKLVWYYAEDQSTWAAKFAAAMVKMGSIEVLTGSQGEIRE  322

Query  992   NCRVVN  975
              C VVN
Sbjct  323   KCWVVN  328



>ref|XP_007145114.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
 gb|ESW17108.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
Length=324

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 222/319 (70%), Gaps = 5/319 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L+  +++LS  P+   A L+  FY+ +C +AE +V+  V KA   + G+AAGL+R+HFHD
Sbjct  11    LSSFLLILSIFPLA-SASLKADFYKTTCPSAESIVRSAVEKAVSLNPGIAAGLIRMHFHD  69

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVL++STP N +E+D PANNPSLRGF+VID+AKA++E+ C   VSCADILAF
Sbjct  70    CFVRGCDGSVLLESTPGNPSERDHPANNPSLRGFQVIDEAKAQIEAECPHTVSCADILAF  129

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS    GG+ Y VPAGRRDG +S+  E A+ LP P  N DQL   F  KG +  EMV
Sbjct  130   AARDSANKVGGINYAVPAGRRDGRVSIRDE-ASQLPLPTSNADQLIANFRRKGLSADEMV  188

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG SHC+SFS+RLY+FN T  QD S+D  YA  LK +CP GS +    V +D 
Sbjct  189   TLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDSKYATSLKSKCPAGSDN---TVPLDA  245

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
             +TP   D  YYT +  +RGLLTSDQTLL  PST   +  NA+    W  KFA AMV MG 
Sbjct  246   STPNRLDNKYYTELKKHRGLLTSDQTLLGSPSTRPMLLTNAKHSSVWARKFAKAMVHMGS  305

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTG+ GEIR  C +VN
Sbjct  306   IDVLTGSQGEIRTRCALVN  324



>ref|XP_007161518.1| hypothetical protein PHAVU_001G076000g [Phaseolus vulgaris]
 gb|ESW33512.1| hypothetical protein PHAVU_001G076000g [Phaseolus vulgaris]
Length=331

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 214/301 (71%), Gaps = 1/301 (0%)
 Frame = -3

Query  1874  QVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANK  1695
             +VGFY ++C +AE +V+  V K    + G+AAGL+R+HFHDCFVRGC+GSVL+ STP N 
Sbjct  31    KVGFYTSTCPSAEEIVRSAVNKGISENSGIAAGLIRMHFHDCFVRGCEGSVLLASTPGNP  90

Query  1694  -AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AE+D  ANNPSLRGFEVI++AK +LE+ C G VSCADILAFAARDS    GG+ YDVP+
Sbjct  91    IAERDHFANNPSLRGFEVIEEAKIQLEAACPGTVSCADILAFAARDSALKVGGINYDVPS  150

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +S+A EVA NLP P  NVD+L + F  KG +  EMVTLSGAH+IG SHC++FS 
Sbjct  151   GRRDGRVSIADEVAQNLPAPTSNVDELVSRFEQKGLSADEMVTLSGAHSIGVSHCSTFSK  210

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANR  1158
             RLY+FN T  QD S+D  YA  LK +CP      +  + +DP+TP   D  YY  ++ +R
Sbjct  211   RLYSFNDTFKQDPSMDSSYAETLKTKCPAPPPTSDPTLSLDPSTPVRLDNKYYEGLINHR  270

Query  1157  GLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVV  978
             GLLTSDQTL T  ST + V  NA     W  KFA AMV+MG + VLTG++GEIR +C  V
Sbjct  271   GLLTSDQTLFTTQSTREMVVSNADNGANWSEKFAKAMVQMGSIEVLTGSSGEIRKHCSFV  330

Query  977   N  975
             N
Sbjct  331   N  331



>gb|AFW57508.1| peroxidase 1 [Zea mays]
Length=339

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 217/308 (70%), Gaps = 5/308 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             + LQVGFY++SC  AE +V++ VR+   RD GV AGL+R+HFHDCFVRGCD S+LI+STP
Sbjct  29    SSLQVGFYKHSCPQAEDIVRNAVRRGLVRDPGVGAGLIRMHFHDCFVRGCDASILINSTP  88

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCADI+AFAARDS    GGL Y+V
Sbjct  89    GNLAEKDSVANNPSMRGFDVIDDAKAALEAHCPRTVSCADIVAFAARDSACSAGGLEYEV  148

Query  1523  PAGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             P+GRRDG +S   EV  NN+PTP   V +L   F  KG +  +MVTLSGAHTIGRSHC+S
Sbjct  149   PSGRRDGRVSRQDEVLDNNVPTPTDVVAELIESFKRKGLSADDMVTLSGAHTIGRSHCSS  208

Query  1346  FSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAIFDVAYY  1179
             F+ RLYNF+   G  D SLDP YA  LK +CP  S D  +   VV  DP TPA FD  Y+
Sbjct  209   FTQRLYNFSGQLGWTDPSLDPAYAGHLKARCPWPSSDDQMDPTVVPQDPVTPATFDNQYF  268

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
              NVLA++ L  SD TLL +P TA  V  NA     W+ +FA AMVKMGK+ VLTG+ GEI
Sbjct  269   KNVLAHKVLFVSDNTLLDNPWTAGIVQFNAAVEKAWQVRFAKAMVKMGKVQVLTGDEGEI  328

Query  998   RANCRVVN  975
             R  C VVN
Sbjct  329   REKCFVVN  336



>gb|KCW52185.1| hypothetical protein EUGRSUZ_J01614, partial [Eucalyptus grandis]
Length=307

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 214/303 (71%), Gaps = 4/303 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFY ++C + E VV+  V KA  R+ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  7     ATLQVGFYHSTCPSVESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  66

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEK+ PANNPSLRG+EVID+AKA LE +C   VSCADILAFAARDS    G + Y V
Sbjct  67    GNPAEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINYAV  126

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +SL  E + NLP P  +  QL   F  KG +  EMVTLSGAH++G SHC+SF
Sbjct  127   PAGRRDGLVSLRDEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSVGVSHCSSF  186

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             S RL +FN T  QD S++P  A++LK +C    G+ DP   V +D ATP   D  YYTN+
Sbjct  187   STRLSSFNATHKQDPSMEPRMASELKAKCLNNGGASDP--TVPLDFATPNRLDNKYYTNL  244

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RG+LTSDQTL   PSTA  V ++A     W +KFAAAMVKMG + +LTGN GEIR N
Sbjct  245   KDHRGVLTSDQTLFDSPSTAYIVRKHANHGGAWANKFAAAMVKMGSIDILTGNQGEIRRN  304

Query  989   CRV  981
             CRV
Sbjct  305   CRV  307



>ref|XP_004136139.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
 ref|XP_004158219.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
 gb|KGN45061.1| hypothetical protein Csa_7G419570 [Cucumis sativus]
Length=337

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 235/345 (68%), Gaps = 14/345 (4%)
 Frame = -3

Query  1991  MINKQMKKEMSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVR  1812
             M +   K ++ S+ LS C      +     H  +    L+VGFY++SC  AE ++K+ V 
Sbjct  1     MASSSQKFKLLSKLLSNC-----IIFFFLFHSTLASKTLKVGFYKSSCPHAETIIKNAVN  55

Query  1811  KAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKA  1632
             +A  ++ G+AAGL+R+HFHDCFVRGC+ SVL+ STP N +E++  AN PSLRGFEVID+A
Sbjct  56    QAISQNPGIAAGLIRMHFHDCFVRGCEASVLLKSTPNNPSEREHIANFPSLRGFEVIDEA  115

Query  1631  KARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFF  1452
             KA++E+IC   VSCADILAFAARDS    GG+ Y VPAGRRDG IS+  E AN+LP P F
Sbjct  116   KAKIEAICPNTVSCADILAFAARDSACRVGGINYAVPAGRRDGRISIKEE-ANSLPGPSF  174

Query  1451  NVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAK  1272
             N +QLT  F  +GF+ +EMVTLSGAH+IG +HC +FSNRLY+FNTT  QD S+DPLYAA 
Sbjct  175   NAEQLTESFGKRGFSSEEMVTLSGAHSIGVAHCPTFSNRLYSFNTTHPQDPSMDPLYAAY  234

Query  1271  LKQQCP------QGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTA  1110
             LK +CP       GS +P   ++    +P   D  YY  +  +RGLL+SDQTLL+  ST 
Sbjct  235   LKTKCPPPSGNNDGSDEPTAALEF--FSPHRLDNWYYIELKNHRGLLSSDQTLLSSSSTK  292

Query  1109  KQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             + V  NA+   +W +KF  AMVKMG + VLTG+ GEIR +C  VN
Sbjct  293   EMVLHNAKHGHQWAAKFGKAMVKMGFVDVLTGSQGEIRRHCSFVN  337



>ref|XP_004251979.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=354

 Score =   353 bits (907),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 212/307 (69%), Gaps = 3/307 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             ++   +GFY  SC  AE ++K  V KA   + G+AAG++R+HFHDCF+RGCDGSVL+DS 
Sbjct  48    KSTFGIGFYSKSCPQAEGIIKKAVFKAVLMNPGIAAGIIRMHFHDCFIRGCDGSVLLDSI  107

Query  1706  PANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             P  + AEKDSP NNPSLRGF VID+AK  LE +C   VSCADILA+AARDS    GG+ Y
Sbjct  108   PGKETAEKDSPINNPSLRGFGVIDEAKVLLEKVCPHTVSCADILAYAARDSAFFVGGIKY  167

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VP GRRDG +SL+SEV  NLP PFF+  QL   F  KG +  EMVTLSGAH+IG SHC+
Sbjct  168   AVPGGRRDGRVSLSSEVIQNLPPPFFDAKQLEDNFKAKGLSLDEMVTLSGAHSIGVSHCS  227

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDP--NLVVQMDPATPAIFDVAYYT  1176
             SFSNRLY FNTT  QD SLDP YA+ LK +CP+   D   + +V +D ++P   D  YY 
Sbjct  228   SFSNRLYGFNTTHPQDPSLDPRYASYLKHKCPRPMSDTQNDPIVNLDVSSPIYLDNKYYL  287

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
             N+  ++GLLTSDQTL   P T+K V  N +    W  KFA AMV MG + +LTGN GEIR
Sbjct  288   NLRNHKGLLTSDQTLYQSPLTSKLVLNNIKFRSTWARKFANAMVHMGSIEILTGNKGEIR  347

Query  995   ANCRVVN  975
              NC  +N
Sbjct  348   KNCHFIN  354



>ref|XP_010941488.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=315

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 212/307 (69%), Gaps = 4/307 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VG+Y + C  AE +V+  V KA  RD G+AAGL+R++FHDCFVRGCD SVL+D  P
Sbjct  8     ASLEVGYYESKCPMAEKIVRRTVVKAAARDHGLAAGLIRLYFHDCFVRGCDASVLLDPLP  67

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK SPANN SLRG+EVID AKA LE+ C   VSCADI+AFAARDS  ITGGL Y V
Sbjct  68    NNPSEKLSPANNASLRGYEVIDDAKAELEAFCPETVSCADIIAFAARDSTFITGGLDYSV  127

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +S+ SEV  NLP P FN +QL   F  KG + K+MVTLSGAH+IG SHC+SF
Sbjct  128   PSGRRDGMVSIDSEVVQNLPFPTFNAEQLIKSFAGKGLSVKDMVTLSGAHSIGVSHCSSF  187

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK----DPNLVVQMDPATPAIFDVAYYT  1176
              +RLY FN T  QD SL+   A  LK +C   SK         V +D   P   DV YY 
Sbjct  188   DSRLYRFNATHPQDPSLNHHLANFLKARCLPSSKTVRTQTEPTVPLDIKAPNHLDVKYYK  247

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
             N+L  +GLLTSDQTL    ST   V  +AR P +WK +FAAAMV+MG + VLTGN GEIR
Sbjct  248   NLLKGKGLLTSDQTLAGSRSTLGLVIDHARNPSKWKEEFAAAMVRMGNIDVLTGNKGEIR  307

Query  995   ANCRVVN  975
              NCRVVN
Sbjct  308   KNCRVVN  314



>ref|XP_002440543.1| hypothetical protein SORBIDRAFT_09g002810 [Sorghum bicolor]
 gb|EES18973.1| hypothetical protein SORBIDRAFT_09g002810 [Sorghum bicolor]
Length=333

 Score =   352 bits (903),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 178/303 (59%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -3

Query  1868  GFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAE  1689
             GFY++SC  AE +V++ VR+   RD GV AGL+R+ FHDCFVRGCD S+LI+STP NKAE
Sbjct  28    GFYKHSCPKAEEIVRNAVRRGIARDAGVGAGLIRMQFHDCFVRGCDASILINSTPGNKAE  87

Query  1688  KDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRR  1509
             KDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARD   + GGL Y VP+GRR
Sbjct  88    KDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIIAFAARDGAYLAGGLDYKVPSGRR  147

Query  1508  DGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRL  1332
             DG +S   EV  NN+P PF +V +L   F  KG    +MVTLSGAHTIGRSHC+SF+ RL
Sbjct  148   DGRVSKEDEVLDNNVPAPFDDVAELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSFTQRL  207

Query  1331  YNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAIFDVAYYTNVLA  1164
             YNF+   G+ D SLDP YA  LK +CP  S +  +   VV +DP TPA FD  YY NVLA
Sbjct  208   YNFSGQLGRTDPSLDPTYAEHLKMRCPWPSSNGQMDTTVVPLDPVTPATFDNQYYKNVLA  267

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
             ++ L  SD TLL +P TA  V  NA     W+ KFA AMVKMGK+ VLTG+ GEIR  C 
Sbjct  268   HKVLFVSDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIREKCF  327

Query  983   VVN  975
             VVN
Sbjct  328   VVN  330



>ref|XP_009799014.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=334

 Score =   352 bits (903),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 223/334 (67%), Gaps = 4/334 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLE-AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRG  1788
             M S      S L   +++ S     +  A L+VGFY+++C  AE +V+  V KA  R+ G
Sbjct  1     MRSDMAKWSSFLTFFLVVFSSFTFTVSLASLKVGFYQSNCPNAEAIVRKTVNKAVSRNPG  60

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             + AG++R+HFHDCFVRGCD S+L+DSTP N  EK+ PANNPSLRG+EVID AKA LES+C
Sbjct  61    LGAGIIRMHFHDCFVRGCDASILLDSTPGNPTEKEHPANNPSLRGYEVIDAAKAALESVC  120

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
                VSC+DI+AFAARDS    GG+ Y VPAGRRDG +S+  E   +LP   FN  QL   
Sbjct  121   PQTVSCSDIIAFAARDSAYKLGGIRYSVPAGRRDGRVSILDEPNEHLPPFTFNAKQLEEN  180

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG  1248
             F  KG +  EMVTLSGAH+IGR+HC+SFS+RLY+FN+T  QD S+DP  A +L+++CP  
Sbjct  181   FARKGLSLDEMVTLSGAHSIGRTHCSSFSSRLYSFNSTHTQDPSMDPRLAKQLRKRCPSP  240

Query  1247  SKD---PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPF  1077
             + D    +  V +D  TP   D  YY N+  +RGLLTSDQTL   P TA  V  NA    
Sbjct  241   NNDGTGNDPTVPLDVVTPNRLDNKYYVNLKNHRGLLTSDQTLWNSPLTAGMVRSNAIHGV  300

Query  1076  RWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
              W  K+AAAMVKMG + V+TG  GEIR NCRVVN
Sbjct  301   NWARKYAAAMVKMGSIEVMTGKQGEIRKNCRVVN  334



>ref|XP_003558949.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=333

 Score =   352 bits (903),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 227/319 (71%), Gaps = 5/319 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L + ++L++  P +  A+L VG+Y   C AAE++V++EV K      G AAGL+R+HFHD
Sbjct  20    LVVMLVLMAARPAM--AQLAVGYYDTLCPAAEIIVQEEVSKGVSGSPGTAAGLLRLHFHD  77

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD SVL+DSTP NKAEKD+P N+ SLRGF+VIDKAK RLE  C  VVSCADILAF
Sbjct  78    CFVRGCDASVLLDSTPGNKAEKDAPPNS-SLRGFDVIDKAKTRLEQACYRVVSCADILAF  136

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARD++ + GG  Y VPAGRRDG++S A E   NLP P  NV+QLT +F +KG ++ +MV
Sbjct  137   AARDALALVGGSAYQVPAGRRDGNVSSAGETNGNLPPPTANVNQLTQIFGSKGLSKAQMV  196

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAHT+G + C+SFS+RLY+     GQD ++DP Y   L  QCPQ  K     V MDP
Sbjct  197   TLSGAHTVGAAQCSSFSSRLYSSGPNGGQDPTMDPKYLTALTAQCPQ--KGAQQAVPMDP  254

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP  FD  YY N++ANRGLL+SDQ LL DP+ + QV     +P  +++ FA AM+ MG 
Sbjct  255   VTPNAFDTNYYANLVANRGLLSSDQALLADPNASAQVVAYTSSPDTFQTDFANAMIAMGN  314

Query  1031  LGVLTGNAGEIRANCRVVN  975
             +GVLTGNAG IR NCRV +
Sbjct  315   VGVLTGNAGNIRTNCRVAS  333



>ref|XP_007051236.1| Class III peroxidase 70 [Theobroma cacao]
 gb|EOX95393.1| Class III peroxidase 70 [Theobroma cacao]
Length=338

 Score =   352 bits (902),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 214/306 (70%), Gaps = 6/306 (2%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+ SC +AE +V+  V KA  R+ G+AAGL+R++FHDCFVRGCD SVL+ STP N
Sbjct  34    LKVGFYKGSCPSAETIVRKAVNKAVSRNPGIAAGLIRMYFHDCFVRGCDASVLLKSTPGN  93

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AE D PANNPSLRGFEVID+AKA++E++C G VSCADILAFAARDS   TGG+ Y +PA
Sbjct  94    LAEMDHPANNPSLRGFEVIDEAKAQIEALCPGTVSCADILAFAARDSTYKTGGIYYAIPA  153

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +S++ EV  NLP+P  N +Q +  F  KG +  EMVTLSGAH+IG SHC+SFSN
Sbjct  154   GRRDGRVSISDEVTQNLPSPSSNAEQNSQRFARKGMSVDEMVTLSGAHSIGVSHCSSFSN  213

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-----GSKDPNLVVQMDPATPAIFDVAYYTN  1173
             RLY+FN T  QD SLDP YAA LK +CP        +DP   V +D  TP   D  YY+ 
Sbjct  214   RLYSFNATHAQDPSLDPNYAAFLKTKCPPPPTAGAGRDPT-TVALDMVTPNRLDNNYYSE  272

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +   RGLLTSDQTL+    T++ V  N R    W  KFA AMV +G L VLTG  GEIR 
Sbjct  273   LRRRRGLLTSDQTLMDSSLTSRMVLNNKRDGALWAKKFAKAMVHLGSLDVLTGAQGEIRR  332

Query  992   NCRVVN  975
              C V N
Sbjct  333   ICCVAN  338



>ref|XP_002530464.1| Peroxidase 3 precursor, putative [Ricinus communis]
 gb|EEF31934.1| Peroxidase 3 precursor, putative [Ricinus communis]
Length=329

 Score =   351 bits (901),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 227/336 (68%), Gaps = 13/336 (4%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             MSS  +S C    + ++L      +  A L+VGFY++SC +AE +V+  V+K    + G+
Sbjct  1     MSSETMSSC----VVLVLFCSLATLSSASLRVGFYKSSCPSAEAIVRKTVKKFVSINPGL  56

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             AAGL+R+HFHDCFVRGCD SVL+ STP N +E++  ANNPSLRGFEVID+AKA+LE++C 
Sbjct  57    AAGLIRMHFHDCFVRGCDASVLLQSTPGNPSEREHIANNPSLRGFEVIDEAKAKLEAVCP  116

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
               VSCADILAFAARDS    GG+ Y VPAGRRDG +S  +EVA NLP P  N ++L   F
Sbjct  117   KTVSCADILAFAARDSSYKLGGVNYAVPAGRRDGLVSNMAEVAQNLPPPSSNAEKLADSF  176

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP---  1254
               KG ++ E+VTLSGAH++G S C+SFSNRLY+FN T  QD S+DP YAA LK +CP   
Sbjct  177   SRKGLSEDELVTLSGAHSVGISRCSSFSNRLYSFNATHAQDPSMDPKYAAFLKTKCPPPN  236

Query  1253  ---QGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARA  1083
                +   DP   V +DP TP   D  YY  +  +RGLL SDQTL+  P T K V  NA++
Sbjct  237   PIYEAKVDP--TVGLDP-TPNRLDNKYYVQLSNDRGLLNSDQTLMKSPFTQKMVLDNAKS  293

Query  1082  PFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
                W +KFA AMV MG + VLTG  GEIR  C VVN
Sbjct  294   GAAWTAKFAKAMVHMGSIDVLTGPQGEIRTQCSVVN  329



>ref|XP_004968663.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=362

 Score =   352 bits (904),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 221/319 (69%), Gaps = 4/319 (1%)
 Frame = -3

Query  1919  MILLSCHPIV-LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFV  1743
             + +L+  P+V + A L+VGFY  SC +AE +V+  V  AF  + G+AAGL+R+HFHDCFV
Sbjct  13    LAILALLPVVAIGAGLKVGFYNKSCPSAESLVQQAVAAAFKNNSGIAAGLIRLHFHDCFV  72

Query  1742  RGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAAR  1563
             RGCDGSVLID+T  N AEKD+P NNPSLRGFEVID AK  +E+ C  VVSCADILAFAAR
Sbjct  73    RGCDGSVLIDTTSNNTAEKDAPPNNPSLRGFEVIDAAKKAIEARCPKVVSCADILAFAAR  132

Query  1562  DSVEITG-GLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             D+V ++G  L Y VPAGRRDG IS  ++ +NNLP+P  N  +L   F  K  T ++MV L
Sbjct  133   DAVALSGNNLTYKVPAGRRDGRISRDTDASNNLPSPLSNATELVGNFTVKNLTAEDMVVL  192

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMDP  1212
             SGAHT+GRSHC+SF+NRLY F+  +  D ++   YA  L+  CP  S    PN   +MD 
Sbjct  193   SGAHTVGRSHCSSFTNRLYGFSNASDVDPTISSAYAFLLRGICPSNSSQFFPNTTTEMDL  252

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TPA+ D  YY  +  N GL TSDQ LLT+ +  K V +  ++  RW+SKFA AMVKMG 
Sbjct  253   MTPAVLDNKYYLGLANNLGLFTSDQALLTNATLKKSVDEFVKSENRWRSKFAKAMVKMGN  312

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTG  GEIR NCRV+N
Sbjct  313   IEVLTGTQGEIRLNCRVIN  331



>ref|NP_001148340.1| peroxidase 1 precursor [Zea mays]
 gb|ACG30856.1| peroxidase 1 precursor [Zea mays]
Length=339

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 220/314 (70%), Gaps = 9/314 (3%)
 Frame = -3

Query  1901  HPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSV  1722
             HP    + LQVGFY++SC  AE +V++ VR+   RD G+ AGL+R+HFHDCFVRGCD S+
Sbjct  27    HP----SSLQVGFYKHSCPQAEDIVRNAVRRGLARDPGIGAGLIRMHFHDCFVRGCDASI  82

Query  1721  LIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITG  1542
             LI+STP N AEKDS ANNPS+RGF+VID AKA LE+ C   VSCADI+AFAARDS    G
Sbjct  83    LINSTPGNLAEKDSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADIVAFAARDSACSAG  142

Query  1541  GLGYDVPAGRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIG  1365
             GL Y+VP+GRRDG +S   EV  NN+PTP  +V +L   F  KG +  +MVTLSGAHT+G
Sbjct  143   GLEYEVPSGRRDGRVSRQDEVLDNNVPTPTDDVAELIESFKRKGLSADDMVTLSGAHTVG  202

Query  1364  RSHCTSFSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAI  1197
             RSHC+SF+ RLYNF+   G+ D S+DP YA  LK +CP  S D  +   VV  DP TPA 
Sbjct  203   RSHCSSFTQRLYNFSGQLGRTDPSVDPAYAGHLKARCPWPSSDDQMDPTVVPQDPVTPAT  262

Query  1196  FDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLT  1017
             FD  Y+ NVLA++ L  SD TLL +P TA  V  NA     W+ +F  AMVKMGK+ VLT
Sbjct  263   FDNQYFKNVLAHKVLFVSDNTLLDNPWTAGIVQFNAAVEKAWQVRFVKAMVKMGKVQVLT  322

Query  1016  GNAGEIRANCRVVN  975
             G+ GEIR  C VVN
Sbjct  323   GDEGEIREKCFVVN  336



>gb|KDP27791.1| hypothetical protein JCGZ_18871 [Jatropha curcas]
Length=328

 Score =   349 bits (896),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 221/324 (68%), Gaps = 7/324 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             S   + +++    P VL   L+ GFY+ SC  AE +V+  V+ AF  D G+   L+R+HF
Sbjct  6     SYFGILLLIFLISP-VLSVPLKKGFYKKSCPLAETIVRSTVKNAFANDTGIPPALIRLHF  64

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCD S+L+DSTP +KAEK+S   N  + GFEVID+AKA++E+ C   VSCADI+
Sbjct  65    HDCFVRGCDASILLDSTPGSKAEKES-MGNKGVGGFEVIDEAKAKMETYCPNTVSCADII  123

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDSV + GG+ Y+VP+GRRDG  SL  EV+ NLP  FFNV QL   F NKG + +E
Sbjct  124   AFAARDSVLLAGGIYYEVPSGRRDGTKSLIHEVSKNLPDSFFNVIQLKDNFANKGLSLEE  183

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ---GSKDPNLV  1227
             MVTLSGAH+IG SHC+SFS RLY+FN T GQD S+D  YA+ LK +CP+      DP  +
Sbjct  184   MVTLSGAHSIGDSHCSSFSKRLYSFNATHGQDPSMDSAYASFLKTKCPKPVNNGIDP--L  241

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V  DP+TP   D  YY N+  N+GLL SDQ L ++  T   V  N   P  W SKFA+AM
Sbjct  242   VSFDPSTPTRLDNNYYRNLKMNKGLLFSDQVLWSNSLTKSMVKSNINHPGSWASKFASAM  301

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V MG + V+TG+ GE+R NCRV+N
Sbjct  302   VHMGSIEVITGSNGEVRKNCRVLN  325



>tpe|CAH69312.1| TPA: class III peroxidase 70 precursor [Oryza sativa Japonica 
Group]
Length=335

 Score =   349 bits (896),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 225/308 (73%), Gaps = 5/308 (2%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KL+VGFY +SC  AE +V++ VR+A  RD G+AAGL+R+HFHDCFVRGCDGS+LI+STP 
Sbjct  26    KLKVGFYEHSCPQAEEIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDGSILINSTPG  85

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGG-LGYDV  1524
             + AEKDS ANNPS+RGFEV+D AKA +E+ C   VSCADILAFAARDS  + G  + Y V
Sbjct  86    HVAEKDSVANNPSMRGFEVVDDAKAIVEAHCPRTVSCADILAFAARDSAHLAGATVDYPV  145

Query  1523  PAGRRDGHISLASEV-ANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             P+GRRDG +S++ EV A+N+P P F++ QL   F  KG T  +MVTLSGAHTIGRSHC+S
Sbjct  146   PSGRRDGRVSVSDEVLADNVPAPTFSLAQLVASFERKGLTADDMVTLSGAHTIGRSHCSS  205

Query  1346  FSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDP--NLVVQMDPATPAIFDVAYYT  1176
             F+ RLYNF+   G+ D ++DP YAA+LK++CP  + D      V +DP TPA FD  YY 
Sbjct  206   FTARLYNFSGEAGRTDPAIDPAYAAELKRRCPPATDDQMDPTTVPLDPVTPASFDNQYYK  265

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
             NVL +R +L SDQ LL  P TA  V  ++     ++ KFAAAMVKMG + VLTG+ GEIR
Sbjct  266   NVLKHRVVLNSDQALLDSPWTAGVVKLHSAVEKVFQVKFAAAMVKMGNIDVLTGDEGEIR  325

Query  995   ANCRVVNH  972
               C +VN+
Sbjct  326   EKCFMVNN  333



>ref|XP_002439234.1| hypothetical protein SORBIDRAFT_09g002830 [Sorghum bicolor]
 gb|EES17664.1| hypothetical protein SORBIDRAFT_09g002830 [Sorghum bicolor]
Length=343

 Score =   349 bits (896),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 215/306 (70%), Gaps = 5/306 (2%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY++SC  AE +V+D VR+   RD GV AGL+R+ FHDCFVRGCD S+LI+STP N
Sbjct  36    LEVGFYKHSCPEAESIVRDAVRRGVARDAGVGAGLIRMQFHDCFVRGCDASILINSTPGN  95

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
             KAEKDS ANNPS+RGF+V+D AKA LE+ C   VSCADI+AFAARD   + GGL Y VP+
Sbjct  96    KAEKDSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIVAFAARDGAYLAGGLDYKVPS  155

Query  1517  GRRDGHISLASEVAN-NLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S   EV + N+P PF +V +L   F  KG T  +MVTLSGAHTIGRSHC+SF+
Sbjct  156   GRRDGRVSREDEVLDSNVPAPFDDVAELIQSFKRKGLTADDMVTLSGAHTIGRSHCSSFT  215

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN---LVVQMDPATPAIFDVAYYTN  1173
              RLYNF+   G+ D SLD  YA  LK +CP  S D      VV  DP TPA FD  Y+ N
Sbjct  216   QRLYNFSGQLGRTDPSLDVAYADHLKMRCPWPSSDGKRHPAVVPQDPVTPATFDNQYFKN  275

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             V+A++GL  SD+TLL    TA  V  NA     W+ KFA AMVKMGK+ VLTG+ GEIR 
Sbjct  276   VVAHKGLFVSDKTLLDSTCTAGIVHFNAAVDKAWQVKFAKAMVKMGKIQVLTGDEGEIRE  335

Query  992   NCRVVN  975
              C VVN
Sbjct  336   KCFVVN  341



>gb|KHN29593.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   348 bits (894),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 218/317 (69%), Gaps = 1/317 (0%)
 Frame = -3

Query  1922  TMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFV  1743
             +++L+     +  A L+VGFY ++C +AE +V+  V KA     G+AAGL+R+HFHDCFV
Sbjct  12    SLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISHKAGIAAGLIRMHFHDCFV  71

Query  1742  RGCDGSVLIDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             RGCDGSVL+ STP N  AE+D+ ANNPSLRGFEVI++AK +LE+ C   VSCADILAFAA
Sbjct  72    RGCDGSVLLASTPGNPVAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAA  131

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDS    GG+ YDVP+GRRDG IS+A EV  NLP P    D+L + F  KG +  EMVTL
Sbjct  132   RDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTL  191

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPAT  1206
             SGAH+IG SHC++FS RLY+FN T  QD S+D  YA  LK  CP      +  V +DP+T
Sbjct  192   SGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPST  251

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   D  YY  ++ +RGLLTSDQTL T  +T + V  NA     W  KFA AMV+MG + 
Sbjct  252   PIRLDNKYYEGLINHRGLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIE  311

Query  1025  VLTGNAGEIRANCRVVN  975
             VLTG+ GEIR +C +VN
Sbjct  312   VLTGSDGEIRRHCSLVN  328



>ref|XP_002516915.1| Cationic peroxidase 2 precursor, putative [Ricinus communis]
 gb|EEF45529.1| Cationic peroxidase 2 precursor, putative [Ricinus communis]
Length=326

 Score =   348 bits (894),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 214/307 (70%), Gaps = 3/307 (1%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             L A+L+ GFY+ +C  AE +V+  V+ A   D G+ A L+R+HFHDCFVRGCD S+L++S
Sbjct  21    LSAQLKKGFYQKTCPLAETLVRSTVKNALASDAGIPAALIRLHFHDCFVRGCDASILLNS  80

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP NKAEK+S   N  + GFEVID+AKA++ES C   VSCADI+AFAARDSV ++GG  Y
Sbjct  81    TPGNKAEKES-MGNKGVGGFEVIDEAKAKIESYCPNTVSCADIIAFAARDSVLLSGGTYY  139

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             DVP GRRDG  SL SEV  NLP  FFN  QL   F NKG + +EMVTLSGAH+IG SHC+
Sbjct  140   DVPGGRRDGTTSLISEVTGNLPDSFFNATQLKQNFANKGLSLEEMVTLSGAHSIGDSHCS  199

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMDPATPAIFDVAYYT  1176
             SFS RLY+FN T  QD SLDP+YA+ LK +CP+  K   P+ VV  DP TP   D  YY 
Sbjct  200   SFSKRLYSFNATYSQDPSLDPVYASYLKIKCPRHVKPGLPDPVVPFDPLTPTRLDSNYYK  259

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
             N+  ++GLL SDQ L     T K V++N R P +W SKFAAAM  MG + V+TG+ GEIR
Sbjct  260   NLKNDKGLLFSDQVLWNSELTKKIVNRNIRHPNKWASKFAAAMGHMGSIEVITGSQGEIR  319

Query  995   ANCRVVN  975
               C  +N
Sbjct  320   KYCWRMN  326



>ref|XP_009598825.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=334

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 225/334 (67%), Gaps = 4/334 (1%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLE-AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRG  1788
             M S+     S L L +++ +     +  A L+VGFY+++C  AE +V+  V +A  R+ G
Sbjct  1     MRSKMAKWSSFLTLFLVVFTSFNFTVSFASLKVGFYQSNCPNAEAIVRKAVNRAVSRNPG  60

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             + AG++R+HFHDCFVRGCD S+L+DSTP N AEK+ PANNPSLRG+EVID AK+ LES+C
Sbjct  61    LGAGIIRMHFHDCFVRGCDASILLDSTPGNPAEKEHPANNPSLRGYEVIDAAKSELESVC  120

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
                VSC+DI+AFAARDS    GG+ Y VPAGRRDG +S+  E   +LP   FN  QL   
Sbjct  121   PQTVSCSDIIAFAARDSSFKLGGIRYSVPAGRRDGRVSIKDEPNEHLPPFTFNARQLEEN  180

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG  1248
             F  KG +  EMVTLSGAH+IGR+HC+SFS+RLY+FN+T  QD S+D   A +L+++CP  
Sbjct  181   FAKKGLSLDEMVTLSGAHSIGRTHCSSFSSRLYSFNSTHTQDPSMDTRLAKQLRKRCPPS  240

Query  1247  SKD---PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPF  1077
             + D    +  V +D  TP   D  YY N+  +RGLLTSDQTL   P TA  V  NA    
Sbjct  241   NNDGSGNDPTVPLDVVTPNRLDNKYYVNLKNHRGLLTSDQTLWKSPLTAGMVRSNAIHGV  300

Query  1076  RWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
              W  K+AAAMVKMG + V+TG  GEIR NCRVVN
Sbjct  301   NWARKYAAAMVKMGSIEVMTGMQGEIRNNCRVVN  334



>ref|XP_004953531.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   348 bits (893),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 218/306 (71%), Gaps = 4/306 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQVGFY +SC  AE +V++ VR+A  RD G+AAGL+R+HFHDCFVRGCD S+L++STP  
Sbjct  25    LQVGFYEHSCPQAEDIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDASILLESTPWQ  84

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
             KAE+DS ANNPSLRGFEVID+AKA +E+ C   VSCADI+AFAARD   + GG+ Y VP+
Sbjct  85    KAERDSTANNPSLRGFEVIDEAKAIVEAHCPRTVSCADIVAFAARDGAALAGGIDYRVPS  144

Query  1517  GRRDGHISLASEVAN-NLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S+  EV + N+P P F V +L   F  KG +  +MVTLSGAH+IGRSHC+S +
Sbjct  145   GRRDGRVSVEGEVLDGNVPFPTFTVGELVENFRRKGLSADDMVTLSGAHSIGRSHCSSVT  204

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCP--QGSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             +RLYNF    G+ D  LDP YAA LK++CP    + D    V +DP TPA  D  Y+ NV
Sbjct  205   DRLYNFQGEPGRTDPELDPAYAADLKRRCPPSMSNMDYPTTVPLDPVTPAGLDNQYFKNV  264

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA++   TSDQ LL  P TA  V+ +A     W++KFAAAMVKMG + VLTG  GEIR  
Sbjct  265   LAHKVPFTSDQALLDSPWTAGLVAFHAAVGQAWEAKFAAAMVKMGAIEVLTGQEGEIREK  324

Query  989   CRVVNH  972
             C VVNH
Sbjct  325   CSVVNH  330



>gb|ACU20445.1| unknown [Glycine max]
Length=324

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 223/321 (69%), Gaps = 8/321 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SSLAL   ++S  P+   A L+V FY+ +C +AE +VK  V KA   + G+AAGL+R+HF
Sbjct  12    SSLAL---IISVLPLA-SASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMHF  67

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCDGSVL++ST  N +E++ PANNPSLRGFEVID+AKA +E+ C   VSCADIL
Sbjct  68    HDCFVRGCDGSVLLESTQGNPSEREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADIL  127

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDS    GG+ Y VPAGRRDG +S   E A+ LP P FN  QL + F  KG +  E
Sbjct  128   AFAARDSSNKVGGINYVVPAGRRDGRVSNRDE-ASQLPRPTFNTQQLISNFEQKGLSADE  186

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQM  1218
             MVTLSGAH+IG SHC+SFS+RLY+FN T  QD S+D  +A  LK +CP  S +    V++
Sbjct  187   MVTLSGAHSIGVSHCSSFSDRLYSFNVTFPQDPSMDTKFATSLKSKCPPRSDN---TVEL  243

Query  1217  DPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             D ++P   D  YYT +  +RGLLTSDQTLLT PST   V  NA+    W  KFA AMV M
Sbjct  244   DASSPNRLDNNYYTMLNNHRGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVHM  303

Query  1037  GKLGVLTGNAGEIRANCRVVN  975
             G + VLTG+ GEIR  C VVN
Sbjct  304   GSIEVLTGSQGEIRTRCSVVN  324



>gb|KHN00317.1| Peroxidase 5 [Glycine soja]
 gb|KHN00320.1| Peroxidase 5 [Glycine soja]
Length=318

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 223/321 (69%), Gaps = 8/321 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SSLAL   ++S  P+   A L+V FY+ +C +AE +VK  V KA   + G+AAGL+R+HF
Sbjct  6     SSLAL---IISVLPLA-SASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMHF  61

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCDGSVL++ST  N +E++ PANNPSLRGFEVID+AKA +E+ C   VSCADIL
Sbjct  62    HDCFVRGCDGSVLLESTQGNPSEREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADIL  121

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDS    GG+ Y VPAGRRDG +S   E A+ LP P FN  QL + F  KG +  E
Sbjct  122   AFAARDSSNKVGGINYVVPAGRRDGRVSNRDE-ASQLPRPTFNTQQLISNFEQKGLSADE  180

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQM  1218
             MVTLSGAH+IG SHC+SFS+RLY+FN T  QD S+D  +A  LK +CP  S +    V++
Sbjct  181   MVTLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDTKFATSLKSKCPPRSDN---TVEL  237

Query  1217  DPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             D ++P   D  YYT +  +RGLLTSDQTLLT PST   V  NA+    W  KFA AMV M
Sbjct  238   DASSPNRLDNNYYTMLNNHRGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVHM  297

Query  1037  GKLGVLTGNAGEIRANCRVVN  975
             G + VLTG+ GEIR  C VVN
Sbjct  298   GSIEVLTGSQGEIRTRCSVVN  318



>ref|XP_003534685.2| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 218/317 (69%), Gaps = 1/317 (0%)
 Frame = -3

Query  1922  TMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFV  1743
             +++L+     +  A L+VGFY ++C +AE +V+  V KA     G+AAGL+R+HFHDCFV
Sbjct  12    SLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDKAGIAAGLIRMHFHDCFV  71

Query  1742  RGCDGSVLIDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             RGCDGSVL+ STP N  AE+D+ ANNPSLRGFEVI++AK +LE+ C   VSCADILAFAA
Sbjct  72    RGCDGSVLLASTPGNPVAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAA  131

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDS    GG+ YDVP+GRRDG IS+A EV  NLP P    D+L + F  KG +  EMVTL
Sbjct  132   RDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTL  191

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPAT  1206
             SGAH+IG SHC++FS RLY+FN T  QD S+D  YA  LK  CP      +  V +DP+T
Sbjct  192   SGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPST  251

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   D  YY  ++ +RGLLTSDQTL T  +T + V  NA     W  KFA AMV+MG + 
Sbjct  252   PIRLDNKYYEGLINHRGLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIE  311

Query  1025  VLTGNAGEIRANCRVVN  975
             VLTG+ GEIR +C +VN
Sbjct  312   VLTGSDGEIRRHCSLVN  328



>ref|XP_004495876.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=334

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 224/333 (67%), Gaps = 7/333 (2%)
 Frame = -3

Query  1958  SRNLSCCSSLALTMIL-LSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVA  1782
             SR L   + +  T +L LS   +     L+VGFY+ +C +AE +V+  V KA   + G+A
Sbjct  2     SRTLRMHALMLFTFVLILSVSTLASSTSLKVGFYKTTCPSAEAIVRRAVNKAVSLNPGIA  61

Query  1781  AGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKG  1602
             AGL+R+HFHDCFVRGCDGSVL++ST  N +E+D PANNPSLRGFEVI++AK+++E+ C  
Sbjct  62    AGLIRMHFHDCFVRGCDGSVLLESTQGNPSERDHPANNPSLRGFEVINEAKSQIEAACPK  121

Query  1601  VVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFC  1422
              VSCADILAFAARDS    GG+ Y V +GRRDG +S+  EV  NLP P FN  +L + F 
Sbjct  122   TVSCADILAFAARDSTHKVGGIYYTVQSGRRDGRVSIFDEVTQNLPGPSFNAKELISNFG  181

Query  1421  NKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP----  1254
              KG +  EMVTLSGAH+IG SHC+SFSNRLY+FN T  QD S++P +A  LK +CP    
Sbjct  182   RKGLSADEMVTLSGAHSIGVSHCSSFSNRLYSFNKTFSQDPSMNPKFAELLKSKCPPPQT  241

Query  1253  QGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFR  1074
             Q   DP +V   D +TP   D  YY  +  +RGLLTSDQTL++   T   V +NA+   R
Sbjct  242   QTQSDPTVV--FDASTPNRLDNNYYLRLQKHRGLLTSDQTLVSSGLTRNSVLRNAKHGSR  299

Query  1073  WKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             W  KFA AMV MG L VLTG  GEIR  C VVN
Sbjct  300   WGVKFAKAMVHMGSLDVLTGFEGEIRERCNVVN  332



>ref|XP_003535856.1| PREDICTED: peroxidase 5-like [Glycine max]
 ref|XP_003535859.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=324

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 223/321 (69%), Gaps = 8/321 (2%)
 Frame = -3

Query  1937  SSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHF  1758
             SSLAL   ++S  P+   A L+V FY+ +C +AE +VK  V KA   + G+AAGL+R+HF
Sbjct  12    SSLAL---IISVLPLA-SASLKVDFYKTTCPSAEAIVKRAVNKAVSLNPGIAAGLIRMHF  67

Query  1757  HDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADIL  1578
             HDCFVRGCDGSVL++ST  N +E++ PANNPSLRGFEVID+AKA +E+ C   VSCADIL
Sbjct  68    HDCFVRGCDGSVLLESTQGNPSEREHPANNPSLRGFEVIDEAKAEIEAECPHTVSCADIL  127

Query  1577  AFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKE  1398
             AFAARDS    GG+ Y VPAGRRDG +S   E A+ LP P FN  QL + F  KG +  E
Sbjct  128   AFAARDSSNKVGGINYVVPAGRRDGRVSNRDE-ASQLPRPTFNTQQLISNFEQKGLSADE  186

Query  1397  MVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQM  1218
             MVTLSGAH+IG SHC+SFS+RLY+FN T  QD S+D  +A  LK +CP  S +    V++
Sbjct  187   MVTLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDTKFATSLKSKCPPRSDN---TVEL  243

Query  1217  DPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             D ++P   D  YYT +  +RGLLTSDQTLLT PST   V  NA+    W  KFA AMV M
Sbjct  244   DASSPNRLDNNYYTMLNNHRGLLTSDQTLLTSPSTRPMVLTNAKHGSTWARKFAKAMVHM  303

Query  1037  GKLGVLTGNAGEIRANCRVVN  975
             G + VLTG+ GEIR  C VVN
Sbjct  304   GSIEVLTGSQGEIRTRCSVVN  324



>ref|XP_009365500.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=327

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/319 (55%), Positives = 220/319 (69%), Gaps = 6/319 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             LA++M++      V  A   VGFYR+SC +AE +V+  V KA  R+ G+AAGL+R+HFHD
Sbjct  15    LAMSMMVF-----VSSAAPTVGFYRSSCPSAEAIVRKAVTKAVARNPGIAAGLIRMHFHD  69

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD SVL+DSTP N +EK+ PAN PSLRGFEVID+AK  LE+ C   VSCADILAF
Sbjct  70    CFVRGCDASVLLDSTPENPSEKEHPANFPSLRGFEVIDEAKVELEAKCPNTVSCADILAF  129

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARD     GG+ Y VP+GRRDG ISL  E  ++LP P F  +QL   F  KG +  EMV
Sbjct  130   AARDGALQVGGINYAVPSGRRDGRISLRDEPNDHLPPPSFGANQLEENFARKGLSLDEMV  189

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG + C++  +RLY+FN T   D S+DP++A  LK++CP+ S D    V +D 
Sbjct  190   TLSGAHSIGVTRCSTILDRLYSFNATHPTDPSMDPIFARNLKKKCPRSSDDLK-TVPLDV  248

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP   D  YYT++  ++G+L SDQTLLT  STA  V  NAR    W +KF AAMVKMG 
Sbjct  249   LTPNELDNKYYTDLKNHQGMLASDQTLLTSQSTAGFVRNNARFGAAWANKFGAAMVKMGS  308

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTG  GEIR NCRVVN
Sbjct  309   IDVLTGRQGEIRKNCRVVN  327



>ref|XP_009401741.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=325

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/302 (58%), Positives = 217/302 (72%), Gaps = 5/302 (2%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L VGFY  SC  AE +VK+ +  A   D G+ A L+R+HFHDCFVRGCDGSVLIDST  N
Sbjct  28    LNVGFYSYSCPQAEAIVKEALNDALEEDSGIGADLLRMHFHDCFVRGCDGSVLIDSTNGN  87

Query  1697  KAEKDSPANNP-SLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
              AEKD+  N       F+VIDKAK +LE++CKGVVSCADILAF ARDSV   GG+ Y VP
Sbjct  88    TAEKDAEINQTIEDEAFQVIDKAKKKLEAVCKGVVSCADILAFVARDSVAHYGGIFYQVP  147

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             AGRRDG IS + + A+ LPT   N+ +LT  F  KG +Q +M+ LSGAHTIG +HC SFS
Sbjct  148   AGRRDGRISRSVDTAD-LPTADLNLARLTNSFARKGLSQNDMIILSGAHTIGVAHCPSFS  206

Query  1340  NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLAN  1161
             NRLYNF+ ++  D +LD  YAA+LK++CP GS +    V MDP +P +FD +YY  +L +
Sbjct  207   NRLYNFSRSSSSDPTLDASYAAELKEECPPGSNNE---VNMDPPSPLVFDTSYYQGILKH  263

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             RGL +SDQTL++  S+A +V+  A     +KS+FAAAMVKMG +GVLTG AGEIR NCRV
Sbjct  264   RGLFSSDQTLVSTASSAAKVTLLATNSVVFKSEFAAAMVKMGGIGVLTGRAGEIRGNCRV  323

Query  980   VN  975
             VN
Sbjct  324   VN  325



>ref|XP_003589739.1| Peroxidase [Medicago truncatula]
 gb|AES59990.1| cationic peroxidase [Medicago truncatula]
Length=332

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 214/303 (71%), Gaps = 3/303 (1%)
 Frame = -3

Query  1874  QVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANK  1695
             QVGFY  SC +AE +V+  + KA   + G+ AGL+R+HFHDCFVRGCD SVL+ STP N 
Sbjct  30    QVGFYSYSCPSAEAIVRSAIDKAVSLNPGIGAGLIRMHFHDCFVRGCDASVLLASTPGNP  89

Query  1694  -AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSV-EITGG-LGYDV  1524
              AEKD+  NNPSL GFEVID+AKA+LE +C   VSCADIL FA RDS+ +++GG + YDV
Sbjct  90    IAEKDNFINNPSLHGFEVIDEAKAQLEVVCPQTVSCADILTFATRDSILKLSGGTINYDV  149

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +S++ EV  N+P+PF N DQL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  150   PSGRRDGRVSISDEVPKNIPSPFLNADQLIANFAQKGLSIDEMVTLSGAHSIGVSHCSSF  209

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             SNRLY+F+ T  QD S+DP +A  LK +CP    + N +V +D ATP   D  YY  ++ 
Sbjct  210   SNRLYSFSDTISQDPSMDPSFAESLKTKCPPPPSNTNPIVMLDVATPNRLDNLYYEGLIN  269

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
             +RGLLTSDQTLL+  ST + V  NA     W +KFA AMV MG + VL+G  GEIR +C 
Sbjct  270   HRGLLTSDQTLLSSQSTQESVLSNANYGSNWATKFAQAMVHMGSIDVLSGYDGEIRKHCS  329

Query  983   VVN  975
              VN
Sbjct  330   FVN  332



>ref|XP_009335532.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri]
Length=311

 Score =   346 bits (888),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 215/312 (69%), Gaps = 1/312 (0%)
 Frame = -3

Query  1910  LSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCD  1731
             +S    V  A   VGFYR+SC +AE +V+  V KA  R+ G+AAGL+R+HFHDCFVRGCD
Sbjct  1     MSMMVFVSSAAPTVGFYRSSCPSAEAIVRKAVTKAVARNPGIAAGLIRMHFHDCFVRGCD  60

Query  1730  GSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVE  1551
              SVL+DSTP N +EK+ PAN PSLRGFEVID+AK  LE+ C   VSCADILAFAARD   
Sbjct  61    ASVLLDSTPENPSEKEHPANFPSLRGFEVIDEAKVELEAKCPNTVSCADILAFAARDGAL  120

Query  1550  ITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHT  1371
               GG+ Y VP+GRRDG ISL  E  ++LP P F  +QL   F  KG +  EMVTLSGAH+
Sbjct  121   QVGGINYAVPSGRRDGRISLRDEPNDHLPPPSFGANQLEENFARKGLSLDEMVTLSGAHS  180

Query  1370  IGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFD  1191
             IG + C++  +RLY+FN T   D S+DP++A  LK++CP+ S D    V +D  TP   D
Sbjct  181   IGVTRCSTILDRLYSFNATHPTDPSMDPIFARNLKKKCPRSSDDLK-TVPLDVLTPNELD  239

Query  1190  VAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGN  1011
               YYT++  ++G+L SDQTLLT  STA  V  NAR    W +KF AAMVKMG + VLTG 
Sbjct  240   NKYYTDLKNHQGMLASDQTLLTSQSTAGFVRNNARFGAAWANKFGAAMVKMGSIDVLTGR  299

Query  1010  AGEIRANCRVVN  975
              GEIR NCRVVN
Sbjct  300   QGEIRKNCRVVN  311



>gb|KHN30703.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   347 bits (889),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 217/317 (68%), Gaps = 1/317 (0%)
 Frame = -3

Query  1922  TMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFV  1743
             +++L+     +  A L+VGFY ++C +AE +V+  V KA   + G+AAGL+R+HFHDCFV
Sbjct  12    SLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDNAGIAAGLIRMHFHDCFV  71

Query  1742  RGCDGSVLIDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             RGCDGSVL+ STP N  AE+D  ANNPSLRGFEVI++AK +LE+ C   VSCADILAFAA
Sbjct  72    RGCDGSVLLASTPGNPVAERDHFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAA  131

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDS    GG+ YDVP+GRRDG IS+A EV  NLP P  +  +L + F  KG +  EMVTL
Sbjct  132   RDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSSAHELVSNFSRKGLSADEMVTL  191

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPAT  1206
             SGAH+IG SHC++FS RLY+FN T  QD S+D  YA  LK  CP      +  V +DP+T
Sbjct  192   SGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSNCPAPPSTTDSTVSLDPST  251

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   D  YY  ++ +RGLLTSDQTL T  +T + V  NA     W  KFA AMV+MG + 
Sbjct  252   PIRLDNKYYEGLINHRGLLTSDQTLYTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIE  311

Query  1025  VLTGNAGEIRANCRVVN  975
             VLTG+ GEIR  C +VN
Sbjct  312   VLTGSDGEIRRRCSLVN  328



>ref|XP_010093296.1| Peroxidase 5 [Morus notabilis]
 gb|EXB53829.1| Peroxidase 5 [Morus notabilis]
Length=310

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 214/301 (71%), Gaps = 1/301 (0%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+V FYR SC  AE V+K  V +   R+ G+ AGL+R+HFHDCFVRGCD SVL+DSTP N
Sbjct  11    LKVDFYRFSCPLAESVIKKVVNREVSRNPGIGAGLIRLHFHDCFVRGCDASVLLDSTPEN  70

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEK+ PANNPSLRGFEVID AK  LES+C   VSCADILAFAARDS    GG+ Y VPA
Sbjct  71    PAEKEHPANNPSLRGFEVIDSAKTELESLCPQTVSCADILAFAARDSAFKLGGIKYSVPA  130

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +SL ++   NLP P F+  QL   F +K  T +EMVTLSGAH+IG S C+SFSN
Sbjct  131   GRRDGTVSLKADPNGNLPAPSFSTAQLQESFASKSLTLEEMVTLSGAHSIGVSRCSSFSN  190

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANR  1158
             RLY+FN+T  QD S+DP +A  LK++CP  + D + VV +D  TP   D  YY N+   R
Sbjct  191   RLYSFNSTHPQDPSMDPNFATFLKKKCPASTSD-DPVVNLDSVTPNRLDNRYYVNLKNRR  249

Query  1157  GLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVV  978
             G+L SDQ LL+  STA  VS NAR    W  KFA AMVKMG + VLTG++G+IR NCR+V
Sbjct  250   GVLASDQILLSSSSTASSVSYNARNNGAWAEKFADAMVKMGSIDVLTGSSGQIRKNCRLV  309

Query  977   N  975
             N
Sbjct  310   N  310



>gb|KCW58173.1| hypothetical protein EUGRSUZ_H00890, partial [Eucalyptus grandis]
Length=309

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 178/309 (58%), Positives = 213/309 (69%), Gaps = 10/309 (3%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             + L+VG+YR +C + E +V+  V +A  R+ G+AAGL+R+HFHDCFVRGCD SVL+ ST 
Sbjct  5     SSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVLLKSTA  64

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AE+D PANNPSLRGFE+ID+AKA+LE++C   VSCADI+AFAARDS     G+ YDV
Sbjct  65    GNPAERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYDV  124

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
              AGRRDG IS   EV  NLP P FN  QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  125   AAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSF  184

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPA------IFDVAY  1182
             S+RLY FN T  QD SLDP YAA LK++CP     P+ V Q DP  P         D  Y
Sbjct  185   SSRLYTFNATLAQDPSLDPAYAAFLKRKCPP----PSNVTQADPTVPLDSITANTLDNKY  240

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y  +L  RGLLTSD+TL T PST++ V  NA+  F W  KFA AMVKMG + VLTG  GE
Sbjct  241   YLQLLKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGE  300

Query  1001  IRANCRVVN  975
             IR  C +VN
Sbjct  301   IRKLCSIVN  309



>ref|XP_003568990.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=337

 Score =   347 bits (889),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 218/305 (71%), Gaps = 4/305 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY +SC  AE +V+D VR+A  R+ G A GL+R+HFHDCFVRGCDGSVLI+STP N
Sbjct  30    LKVGFYEHSCPQAEAIVRDAVRRAIARNPGFAPGLIRMHFHDCFVRGCDGSVLINSTPGN  89

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
             +AEKDS AN PSLRGFEVID AKA LES+C   VSCADILAFAARDS  + G + Y VP+
Sbjct  90    RAEKDSVANTPSLRGFEVIDDAKAILESVCPRTVSCADILAFAARDSTLLAGDIAYAVPS  149

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDG +S  SEV  NN+P P   V  L   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  150   GRRDGLVSRESEVLDNNVPPPTDEVGALIASFARKGLSADDMVTLSGAHTIGRSHCSSFT  209

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              RL+NF    G+ D S++P YAA+LK++CP  + D N   VV +D  TP  FD  Y+ NV
Sbjct  210   QRLHNFTGVRGRTDPSIEPYYAAELKRRCPPETNDMNNPTVVPLDVVTPVQFDNQYFKNV  269

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LA++  LTSDQTLLT   TA  V  +A     W++KFA +MV+MG +GVLTG+ GEIR  
Sbjct  270   LAHKVPLTSDQTLLTCKRTAGIVVFHAAVEKAWRAKFAVSMVRMGNVGVLTGDQGEIREK  329

Query  989   CRVVN  975
             C  VN
Sbjct  330   CFAVN  334



>ref|XP_004231304.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=321

 Score =   346 bits (887),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 210/304 (69%), Gaps = 3/304 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L++G+Y +SC  AE +V+  V KA  R+ G+ AG++R+HFHDCFVRGCD S+L+D TP
Sbjct  20    ASLKIGYYHSSCPNAESIVRKAVNKAVSRNPGLGAGIIRMHFHDCFVRGCDASILLDPTP  79

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N  EK+ PANNPSLRG+EVID+AK  LESIC   VSC+DI+AFAARDS    GG+ Y V
Sbjct  80    GNPTEKEHPANNPSLRGYEVIDEAKIELESICPETVSCSDIIAFAARDSAFKLGGIRYSV  139

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +S+  E   NLP    N  +L   F  KG +  EMVTLSGAH+IGRSHC+SF
Sbjct  140   PSGRRDGRVSIKDEPTANLPPSTLNAGELEENFAKKGLSLDEMVTLSGAHSIGRSHCSSF  199

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS-KDPNLVVQMDPATPAIFDVAYYTNVL  1167
             S+RLY+FN+T  QD S+DP  A +L ++CP+ S  DP  +  +D  TP   D  YY N+ 
Sbjct  200   SDRLYSFNSTHPQDPSMDPKLAQQLIKRCPRPSTTDP--IAPLDVDTPNRLDNKYYLNLK  257

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
               RG+LTSDQTL   PSTA+    NA     W  KFA AMVKMG + V+TG  GEIR NC
Sbjct  258   NKRGVLTSDQTLWNSPSTARMARSNAIHGANWAHKFADAMVKMGSIEVMTGIQGEIRKNC  317

Query  986   RVVN  975
             RVVN
Sbjct  318   RVVN  321



>ref|XP_010069739.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=333

 Score =   346 bits (888),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 178/309 (58%), Positives = 213/309 (69%), Gaps = 10/309 (3%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             + L+VG+YR +C + E +V+  V +A  R+ G+AAGL+R+HFHDCFVRGCD SVL+ ST 
Sbjct  29    SSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVLLKSTA  88

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AE+D PANNPSLRGFE+ID+AKA+LE++C   VSCADI+AFAARDS     G+ YDV
Sbjct  89    GNPAERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYDV  148

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
              AGRRDG IS   EV  NLP P FN  QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  149   AAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSF  208

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPA------IFDVAY  1182
             S+RLY FN T  QD SLDP YAA LK++CP     P+ V Q DP  P         D  Y
Sbjct  209   SSRLYTFNATLAQDPSLDPAYAAFLKRKCPP----PSNVTQADPTVPLDSITANTLDNKY  264

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y  +L  RGLLTSD+TL T PST++ V  NA+  F W  KFA AMVKMG + VLTG  GE
Sbjct  265   YLQLLKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGE  324

Query  1001  IRANCRVVN  975
             IR  C +VN
Sbjct  325   IRKLCSIVN  333



>ref|XP_008388923.1| PREDICTED: peroxidase 5-like [Malus domestica]
Length=327

 Score =   346 bits (887),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 220/319 (69%), Gaps = 6/319 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             LA++M++      V  A   VG Y +SC +AE +V+  V KA  R+ G+AAGL+R+HFHD
Sbjct  15    LAMSMMVF-----VSSAAPTVGXYGSSCPSAEAIVRKAVTKAVARNPGIAAGLIRMHFHD  69

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD SVL+DSTP N +EK+ PAN PSLRGFEVID+AKA LE+ C   VSCADILAF
Sbjct  70    CFVRGCDASVLLDSTPENPSEKEHPANFPSLRGFEVIDEAKAELEAKCPNTVSCADILAF  129

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARD     GG+ Y VP+GRRDG ISL  E  ++LP P F+  QL   F  KG +  EMV
Sbjct  130   AARDGALQVGGINYAVPSGRRDGRISLRDEPNDHLPPPXFDAKQLEENFARKGLSLDEMV  189

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG + C++  +RLY+FN T   D S+DP++A  LK++CP+ S +P   V +D 
Sbjct  190   TLSGAHSIGVTRCSTILDRLYSFNATHPTDPSMDPIFARNLKKKCPRSSDNPK-TVPLDV  248

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
              TP   D  YYT++  ++G+L SDQTLLT  STA  V  NAR    W +KF AAMVKMG 
Sbjct  249   LTPNKLDNKYYTDLKNHQGMLASDQTLLTSRSTAGFVRNNARFGAAWANKFGAAMVKMGS  308

Query  1031  LGVLTGNAGEIRANCRVVN  975
             + VLTG  GEIR NCRVVN
Sbjct  309   IDVLTGRQGEIRKNCRVVN  327



>ref|XP_003536264.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   346 bits (887),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 217/317 (68%), Gaps = 1/317 (0%)
 Frame = -3

Query  1922  TMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFV  1743
             +++L+     +  A L+VGFY ++C +AE +V+  V KA   + G+AAGL+R+HFHDCFV
Sbjct  12    SLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDNAGIAAGLIRMHFHDCFV  71

Query  1742  RGCDGSVLIDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             RGCDGSVL+ STP N  AE+D  ANNPSLRGFEVI++AK +LE+ C   VSCADILAFAA
Sbjct  72    RGCDGSVLLASTPGNPVAERDHFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAA  131

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDS    GG+ YDVP+GRRDG IS+A EV  NLP P  +  +L + F  KG +  EMVTL
Sbjct  132   RDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSSAHELVSNFSRKGLSADEMVTL  191

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPAT  1206
             SGAH+IG SHC++FS RLY+FN T  QD S+D  YA  LK  CP      +  V +DP+T
Sbjct  192   SGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSNCPAPPSTIDSTVSLDPST  251

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   D  YY  ++ +RGLLTSDQTL T  +T + V  NA     W  KFA AMV+MG + 
Sbjct  252   PIRLDNKYYEGLINHRGLLTSDQTLYTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIE  311

Query  1025  VLTGNAGEIRANCRVVN  975
             VLTG+ GEIR  C +VN
Sbjct  312   VLTGSDGEIRRRCSLVN  328



>gb|KCW52186.1| hypothetical protein EUGRSUZ_J01615 [Eucalyptus grandis]
Length=300

 Score =   344 bits (882),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 212/306 (69%), Gaps = 14/306 (5%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A LQVGFYR++C AAE VV+  V KA  R+ G+ AGL+R+HFHDCFVRGCD S+L+DSTP
Sbjct  7     ATLQVGFYRSTCPAAESVVRKAVNKAVARNPGIGAGLIRMHFHDCFVRGCDASILLDSTP  66

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+ PANNPSLRG+EVID+AKA LE +C   VSCADILAFAARDS    G + Y V
Sbjct  67    GNPSEKEHPANNPSLRGYEVIDEAKAELEYLCPQTVSCADILAFAARDSTYKLGSINYAV  126

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PA           E + NLP P  +  QL   F  KG +  EMVTLSGAH+IG SHC+SF
Sbjct  127   PA----------DEPSQNLPPPSLDAQQLEANFARKGLSLDEMVTLSGAHSIGVSHCSSF  176

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ--GSKDPNLVVQMDPATPAIFDVAYYTNV  1170
             SNRLY+FN T  +D S++P  A++LK +CP   G+ DP   V +D  T    D  YYTN+
Sbjct  177   SNRLYSFNATHKRDPSMEPKLASELKAKCPNNGGTSDP--TVPLDFVTANGLDNKYYTNL  234

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
               +RG+LTSDQTL   PSTA  V +NA     W +KFAAAMVKMG + VLTG+ GEIR N
Sbjct  235   KKHRGVLTSDQTLFNSPSTAHIVRRNANHGGAWANKFAAAMVKMGSIDVLTGSQGEIRRN  294

Query  989   CRVVNH  972
             CRVVN+
Sbjct  295   CRVVNY  300



>emb|CBI39655.3| unnamed protein product [Vitis vinifera]
Length=856

 Score =   362 bits (928),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 223/315 (71%), Gaps = 5/315 (2%)
 Frame = -3

Query  1916  ILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRG  1737
             I+L     V  A L+VGFY++SC +AE +V+  V KA  ++ G+AAGL+R+HFHDCFVRG
Sbjct  246   IMLFLTASVSSASLEVGFYKSSCPSAETIVRKAVNKAVSKNPGMAAGLIRMHFHDCFVRG  305

Query  1736  CDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDS  1557
             CDGSVL+DSTP N +EK+SP N+PSLRGFEVID+AKA +E+ C   VSCAD+LAFAARDS
Sbjct  306   CDGSVLLDSTPGNPSEKESPVNDPSLRGFEVIDEAKAEIEAQCPQTVSCADVLAFAARDS  365

Query  1556  VEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGA  1377
                 GG+ Y VP+GRRDG ISL  E + +LP PFFN  QL   F  KG T  EMVTLSGA
Sbjct  366   AYKVGGINYAVPSGRRDGRISLKDEPSLHLPPPFFNAKQLEENFARKGLTLDEMVTLSGA  425

Query  1376  HTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPAT  1206
             H+IG SHC+SFSNRLY+FN T  QD S++P +A  LK +CP  S    DP + +++   T
Sbjct  426   HSIGVSHCSSFSNRLYSFNATHPQDPSIEPEFARHLKTKCPPPSNTGSDPTVPLEVQ--T  483

Query  1205  PAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLG  1026
             P   D  YY ++ + +GLLTSDQTL   PST + V  NAR    W +KFAAAMV+MG + 
Sbjct  484   PNRLDNKYYKDLKSRKGLLTSDQTLFDSPSTVRMVKNNARYGANWGNKFAAAMVQMGAID  543

Query  1025  VLTGNAGEIRANCRV  981
             VLTG  G IR NCRV
Sbjct  544   VLTGTQGVIRKNCRV  558


 Score =   233 bits (595),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 139/188 (74%), Gaps = 3/188 (2%)
 Frame = -3

Query  1892  VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             V  A L+VGFY+ +C +AE +V+  V KA  ++ G+AAGL+R+HFHDCFVRGCDGSVL+D
Sbjct  16    VSSASLKVGFYKYTCPSAETIVRKVVNKAVSQNPGMAAGLIRMHFHDCFVRGCDGSVLLD  75

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             STP N +EK++PANNPSLRGFEVID AKA +E+ C   VSCAD+LAFAARDS    GG+ 
Sbjct  76    STPGNPSEKENPANNPSLRGFEVIDAAKAEIEAQCPQTVSCADVLAFAARDSAYKVGGIN  135

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIG---R  1362
             Y VP+GRRDG +SL  E + +LP PFFN  QL   F  KG T  EMVTLSGAH+IG   +
Sbjct  136   YAVPSGRRDGRVSLKDEPSLHLPPPFFNAKQLEDNFARKGLTLDEMVTLSGAHSIGVHLK  195

Query  1361  SHCTSFSN  1338
             + C   SN
Sbjct  196   TKCPPPSN  203



>ref|XP_010069738.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=335

 Score =   345 bits (885),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 204/299 (68%), Gaps = 0/299 (0%)
 Frame = -3

Query  1871  VGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKA  1692
             VGFY+ +C  AE +V+  + +AF  D G+AA  +R++FHDCFVRGCD S+L++ST  N A
Sbjct  37    VGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTA  96

Query  1691  EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGR  1512
             EKDSP NNPSL GF+VID+AKARLE+ C   VSCADI+AFAARDSV   G + YDVP+GR
Sbjct  97    EKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGR  156

Query  1511  RDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRL  1332
             RDG IS ASEV  NLP P F V QL   F  KGF+  EMVTLSGAH+IG SHC+SFSNRL
Sbjct  157   RDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRL  216

Query  1331  YNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGL  1152
             Y+FN T  QD  LDP YAA LK +CPQG+   +  V +D  TP   D  YY  +L  RGL
Sbjct  217   YSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGL  276

Query  1151  LTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
              +SD+ L T   T   V  NA+    W  KF  AMVK+G L VLTG  GEIR  C  VN
Sbjct  277   FSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIRKVCGAVN  335



>gb|EEE58234.1| hypothetical protein OsJ_09210 [Oryza sativa Japonica Group]
Length=271

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/270 (63%), Positives = 196/270 (73%), Gaps = 2/270 (1%)
 Frame = -3

Query  1787  VAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESIC  1608
             +AAGLVR+HFHDCFVRGCD SVL+DST  N+AEKD+P N  SLRGFEVID AK+RLE+ C
Sbjct  1     MAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEKDAPPNT-SLRGFEVIDSAKSRLETAC  59

Query  1607  KGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTL  1428
              GVVSCAD+LAFAARD++ + GG  Y VP GRRDG++S+A E   NLP P  NV QL  +
Sbjct  60    FGVVSCADVLAFAARDALALVGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQM  119

Query  1427  FCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG  1248
             F  KG TQ EMV LSGAHTIG SHC+SFSNRLY+     GQD S+DP Y A L  QCPQ 
Sbjct  120   FGAKGLTQAEMVALSGAHTIGVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQ  179

Query  1247  SKDPNL-VVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRW  1071
                P   +V MD  TP  FD  YY  ++ANRGLL+SDQ LL D +TA QV      P  +
Sbjct  180   QGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSF  239

Query  1070  KSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             ++ FAAAMVKMG +GVLTGNAG IR NCRV
Sbjct  240   QTDFAAAMVKMGSIGVLTGNAGTIRTNCRV  269



>ref|XP_002440652.1| hypothetical protein SORBIDRAFT_09g004650 [Sorghum bicolor]
 gb|EES19082.1| hypothetical protein SORBIDRAFT_09g004650 [Sorghum bicolor]
Length=357

 Score =   345 bits (886),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 211/314 (67%), Gaps = 9/314 (3%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             + A+L VGFY  +C +AE +V+  V  AF    GVA  L+R+HFHDCFVRGCDGSVLIDS
Sbjct  21    VTARLDVGFYNKTCPSAESIVQQTVAAAFGNSSGVAPALIRMHFHDCFVRGCDGSVLIDS  80

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N AEKDSPANNPSLR F+V+D+AKA LE+ C GVVSCADILAFAARDSV +TGGLGY
Sbjct  81    TANNTAEKDSPANNPSLRFFDVVDRAKASLEAQCPGVVSCADILAFAARDSVVLTGGLGY  140

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VP+GRRDG +S A++  NNLP PFFN  QL   F +K  T ++MV LSGAHT+G SHC+
Sbjct  141   QVPSGRRDGRVSNATQATNNLPPPFFNATQLVDRFASKNLTLEDMVVLSGAHTLGVSHCS  200

Query  1349  SFS------NRLYNFN-TTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMDPATPAI  1197
             SF+      +RLYNF+ +  G D +L   YA  LK  CP  S    PN    MD  TP  
Sbjct  201   SFAGPANLGDRLYNFSGSADGIDPALSKAYAFLLKSICPSNSSQFFPNTTTFMDIITPDK  260

Query  1196  FDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLT  1017
             FD  YY  +  N GL  SD  LLT+ +    V    R    WK KFA +MVKMGK+ VLT
Sbjct  261   FDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRNETTWKRKFAKSMVKMGKIEVLT  320

Query  1016  GNAGEIRANCRVVN  975
             G  GEIR NCRV+N
Sbjct  321   GTQGEIRRNCRVIN  334



>ref|XP_010024692.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   343 bits (880),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 219/324 (68%), Gaps = 7/324 (2%)
 Frame = -3

Query  1937  SSLALTMILLSC--HPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRV  1764
             SS  L+ +L+ C   P  +   L+VGFY+  C +AE +V++ V+KA   D G  A L+R+
Sbjct  4     SSAYLSFVLVICLISP-AISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRL  62

Query  1763  HFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCAD  1584
             HFHDCFVRGCDGS+L++ST  N AEKDS   N  + GFEVID AKA++E+ C   VSCAD
Sbjct  63    HFHDCFVRGCDGSILLNSTKGNTAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCAD  121

Query  1583  ILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQ  1404
             I+AFAARD V   GGL Y VP+GRRDG +SLASEV  NLP  FF+  QL   F  KG + 
Sbjct  122   IVAFAARDGVRAAGGLHYAVPSGRRDGRVSLASEVIQNLPGAFFDAAQLKANFAKKGLSL  181

Query  1403  KEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK-DPNLV  1227
             + MVTLSGAH+IG SHC+ F+ RLY+FN+T  QD SL+P YA  LK +CP+ S  DP  +
Sbjct  182   RNMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNSPTDP--I  239

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V  DP TP + D AYY N+ +++GLL SDQ L   P T   V  NA  P  W  +F AAM
Sbjct  240   VPFDPVTPNVLDNAYYRNLKSDKGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAM  299

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V+MG + VLTG  GEIR NCRV+N
Sbjct  300   VRMGSIEVLTGTQGEIRKNCRVIN  323



>ref|XP_006358573.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=324

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/304 (55%), Positives = 209/304 (69%), Gaps = 3/304 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+ G+Y +SC  AE +V+  V KA   + G+ AG++R+HFHDCFVRGCD S+L+D TP
Sbjct  23    ASLKTGYYHSSCPNAESIVRKAVNKAVSSNPGLGAGIIRMHFHDCFVRGCDASILLDPTP  82

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEK+ PANNPSLRG+EVID+AK  LES+C   VSC+DI+AFAARDS    GG+ Y V
Sbjct  83    GNPAEKEHPANNPSLRGYEVIDEAKIELESVCPQTVSCSDIVAFAARDSAFKLGGIRYSV  142

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +S+  E   +LP    N  +L   F  KG +  EMVTLSGAH+IGRSHC+SF
Sbjct  143   PSGRRDGRVSIKDEPTAHLPPSTLNAKELEENFAKKGLSLDEMVTLSGAHSIGRSHCSSF  202

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS-KDPNLVVQMDPATPAIFDVAYYTNVL  1167
             S+RLY+FN+T  QD ++DP  A +L ++CP+ S  DP  +  +D  TP   D  YY N+ 
Sbjct  203   SDRLYSFNSTHPQDPTMDPKLAQQLMKRCPRPSTTDP--IAPLDVDTPNRLDNKYYLNLR  260

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              NRGLLTSDQTL   PSTA+    NA     W  KFA AMVKMG + V+TG  GEIR NC
Sbjct  261   NNRGLLTSDQTLWNSPSTARMARSNAIHGANWAHKFADAMVKMGSIEVMTGMQGEIRKNC  320

Query  986   RVVN  975
             R VN
Sbjct  321   RFVN  324



>ref|XP_006353128.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=353

 Score =   343 bits (881),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 210/307 (68%), Gaps = 3/307 (1%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             ++   +GFY  SC  AE +++  V KA   + G AAG++R+HFHDCF+RGCDGSVL+DS 
Sbjct  47    KSTFGIGFYSKSCPQAEGIIRKAVFKAVLMNPGFAAGIIRMHFHDCFIRGCDGSVLLDSV  106

Query  1706  PANK-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             P  + AEKDSP NNPSLRGF VID+AKA LE +C   VSCADILA+AARDS    GG+ Y
Sbjct  107   PGKETAEKDSPINNPSLRGFGVIDEAKALLEKVCPHTVSCADILAYAARDSAFFVGGIKY  166

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VP GRRDG +SL+SEV  NLP PFF+  QL   F  KG +  EMVTLSGAH+IG SHC+
Sbjct  167   AVPGGRRDGRVSLSSEVIQNLPPPFFDAKQLEDNFKAKGLSLDEMVTLSGAHSIGVSHCS  226

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDP--NLVVQMDPATPAIFDVAYYT  1176
             +FSNRLY FNTT  QD SLD  YA+ LK +CP+   D   + +V +D ++P   D  YY 
Sbjct  227   AFSNRLYGFNTTHPQDPSLDTRYASFLKNKCPRPMSDTQDDPIVNLDVSSPIHLDNKYYL  286

Query  1175  NVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
             N+  ++GLLTSDQTL   P T+K V  N +    W  KFA AMV MG + +LT N GEIR
Sbjct  287   NLRNHKGLLTSDQTLYESPLTSKLVLNNVKFRSTWTRKFANAMVHMGSIEILTDNKGEIR  346

Query  995   ANCRVVN  975
              NC  +N
Sbjct  347   KNCHFIN  353



>ref|XP_003591332.1| Peroxidase [Medicago truncatula]
 gb|AES61583.1| cationic peroxidase [Medicago truncatula]
Length=333

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 225/331 (68%), Gaps = 4/331 (1%)
 Frame = -3

Query  1955  RNLSCCSSLALTMILLSCHPIVLEA-KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAA  1779
             R  S  S   L +++LS    +  +  L+ GFY+ +C + E +V+  V KA   + G+AA
Sbjct  3     RMHSILSIATLVIVILSVSTTLASSTSLKYGFYKTTCSSVEAIVRRAVNKAVSLNPGIAA  62

Query  1778  GLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGV  1599
             GL+R+HFHDCFVRGCDGSVL+DS P  ++E+D PANNPSLRGFEVI++AKA++E+ C   
Sbjct  63    GLIRMHFHDCFVRGCDGSVLLDSIPGIQSERDHPANNPSLRGFEVINEAKAQIEAACPKT  122

Query  1598  VSCADILAFAARDSV-EITGG-LGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             VSCADILAFAARDS  +++GG + Y VP+GRRDG +S+  EV  NLP P F+ +QL   F
Sbjct  123   VSCADILAFAARDSARKVSGGRIDYSVPSGRRDGRVSIFDEVTQNLPPPTFSAEQLIDNF  182

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC-PQG  1248
               KG +  EMVTLSGAH+IG SHC+SFS RLY+FN T  QD S+DP +A  LK +C P  
Sbjct  183   DRKGLSVDEMVTLSGAHSIGVSHCSSFSKRLYSFNLTFPQDPSMDPNFARLLKSKCPPPQ  242

Query  1247  SKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWK  1068
             S+  N  V +D +TP   D  YY  +  NRGLLTSDQTLL    T + V +NAR    W 
Sbjct  243   SQSINPTVVLDGSTPNDLDNMYYKRLKNNRGLLTSDQTLLNSGLTRRMVLKNARHAAIWN  302

Query  1067  SKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
              KFA AMV MG L VLTG+ GEIR  C VVN
Sbjct  303   VKFAKAMVHMGSLDVLTGSEGEIRERCSVVN  333



>ref|XP_010906352.1| PREDICTED: peroxidase 5-like, partial [Elaeis guineensis]
Length=322

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 214/303 (71%), Gaps = 5/303 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VG+Y++ C +AE +V+  VRKA   + G+ AGL+R+HFHDCFVRGCD SVL+DSTP
Sbjct  23    ASLKVGYYKHKCPSAETIVRQTVRKAMIHNPGIGAGLIRMHFHDCFVRGCDASVLLDSTP  82

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N +EK+SPANNPSLRGFEVID+AKAR+ES+C   VSCADIL FA+RD+    GG+ Y V
Sbjct  83    GNPSEKESPANNPSLRGFEVIDEAKARIESVCPSTVSCADILTFASRDAAYFAGGIQYAV  142

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +S+ SEV +N+P  FFN  QL   F  KGFT  EMVTLSGAH+ G SHC+SF
Sbjct  143   PAGRRDGRVSIESEVLDNVPPFFFNAVQLENSFARKGFTLDEMVTLSGAHSFGVSHCSSF  202

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             ++RL   NTT  QD  +D  +AA LK +C +   DP   V +D  TP   D  YY N+  
Sbjct  203   ADRL---NTTAPQDPKMDRKFAAFLKSKCSRAGSDP--TVNLDVVTPNRLDNQYYKNLQK  257

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
              RGLLTSDQTL     T++ V  NA+ P  W + FAAAMVKMG + VLTG+ GEIR  CR
Sbjct  258   GRGLLTSDQTLQASALTSRLVDTNAKRPQAWAANFAAAMVKMGSIEVLTGDQGEIRRTCR  317

Query  983   VVN  975
              VN
Sbjct  318   AVN  320



>ref|XP_004135971.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=338

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 220/335 (66%), Gaps = 7/335 (2%)
 Frame = -3

Query  1961  SSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVA  1782
             SS+  +  S L+  +  L        A L+VGFYR+SC  AE +VK  V KA   + G A
Sbjct  5     SSQKFNILSKLSTVIFFLYLSTFASAATLKVGFYRSSCPNAEAIVKKVVNKAISLNPGAA  64

Query  1781  AGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKG  1602
             AGL+R+HFHDCF+RGC+GSVL+ STP +  E+D P+N PSL+GFE+ID+AKA LES C  
Sbjct  65    AGLIRLHFHDCFIRGCEGSVLLKSTPGHPTERDHPSNFPSLQGFEIIDEAKAYLESACPN  124

Query  1601  VVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFC  1422
              VSCADILAFAARDS    GG+ Y VPAGRRDG IS+  E A+ LP+P FN++QLT  F 
Sbjct  125   TVSCADILAFAARDSARKVGGINYAVPAGRRDGRISIKEE-ASRLPSPTFNIEQLTQNFA  183

Query  1421  NKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ---  1251
              +G ++ +MVTLSGAH+IG + C +FSNRLY+FN T  QD S++P YAA LK +CP    
Sbjct  184   ERGLSKTDMVTLSGAHSIGAARCLTFSNRLYSFNATHNQDPSMNPKYAAYLKTKCPPLTS  243

Query  1250  ---GSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAP  1080
                G     L   +D  TP   D  YY  +  ++GLL+SDQ LL+ PST+K     A+  
Sbjct  244   NVGGQNAQPLEAALDFTTPNRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYG  303

Query  1079  FRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
               W S F  +MVKMG +GVLTG+ GEIR  C  VN
Sbjct  304   SIWASNFKKSMVKMGSIGVLTGSQGEIRRQCSFVN  338



>ref|XP_008776272.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=339

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 217/324 (67%), Gaps = 5/324 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             LA+    +S   +   A L+VG+YR++C  AE +V+  V KA   D G+AAGL+R++FHD
Sbjct  15    LAIVAFFVSMLLMPSLASLEVGYYRSTCPMAEKIVRRTVVKAVAGDHGLAAGLIRLYFHD  74

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCD SVL+D  P N +EK SP NN SLRG+EVID AKA LE+ C   VSCADI+AF
Sbjct  75    CFVRGCDASVLLDPLPNNPSEKLSPVNNGSLRGYEVIDDAKAELEAYCSETVSCADIIAF  134

Query  1571  -AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEM  1395
              AARDS  ITGG  Y VP+GRRDG +S+ SEV  NLP P FN  QL   F  KG + K+M
Sbjct  135   AAARDSTFITGGFDYSVPSGRRDGVVSIDSEVVQNLPFPTFNAKQLIRNFARKGLSAKDM  194

Query  1394  VTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK----DPNLV  1227
             VTLSGAH+IG SHC+SF +RLY FN T  QD SL+   A  LK +C   SK     P   
Sbjct  195   VTLSGAHSIGVSHCSSFDSRLYRFNATHPQDPSLNHHLATFLKARCLPPSKTVRTQPAPT  254

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V +D   P   DV YY N+L  +GLLTSDQTL +  ST + V  +AR P +W  +FAAAM
Sbjct  255   VPLDIKAPNHLDVKYYKNLLKGKGLLTSDQTLASSRSTLRLVIDHARNPSKWNEEFAAAM  314

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V+MG + VL GN GEIR NCRVVN
Sbjct  315   VRMGNVDVLAGNEGEIRKNCRVVN  338



>ref|XP_007153059.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
 gb|ESW25053.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
Length=330

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 206/300 (69%), Gaps = 1/300 (0%)
 Frame = -3

Query  1871  VGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANK-  1695
             VGFY  +C +AE +VK  V KA   + G+AAGL+R+HFHDCFVRGCDGSVL+ S P N  
Sbjct  31    VGFYSFTCPSAEAIVKSTVEKAISANPGLAAGLIRMHFHDCFVRGCDGSVLLASIPGNPI  90

Query  1694  AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAG  1515
             AE+DS  NNPSLRGFEVI++AK ++E+ C   VSCADILAFAARDS    G + YDVP+G
Sbjct  91    AERDSFINNPSLRGFEVIEEAKKQVEAACPNTVSCADILAFAARDSASKVGAINYDVPSG  150

Query  1514  RRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNR  1335
             RRDG +S+  EV  NLP P F VD+L   F  KG +  EMVTLSGAH+IG +HC +FSNR
Sbjct  151   RRDGRVSIGDEVIQNLPGPGFVVDELIGNFAQKGLSVDEMVTLSGAHSIGVAHCGAFSNR  210

Query  1334  LYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANRG  1155
             LY+F+ T  QD SLDP YA  LK  CP      + +V ++P+TP   D  YY  ++ +RG
Sbjct  211   LYSFSDTLRQDPSLDPSYAETLKAMCPPPPPITDAIVSLEPSTPIRLDSKYYEGLINHRG  270

Query  1154  LLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             LLTSDQTL   PST + V  NA     W  KFA AMV+MG + VLTG+ GEIR  C  VN
Sbjct  271   LLTSDQTLFDTPSTKEIVESNAYNGANWAQKFALAMVRMGSIQVLTGSDGEIRKQCSFVN  330



>ref|XP_003533700.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 208/301 (69%), Gaps = 1/301 (0%)
 Frame = -3

Query  1874  QVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANK  1695
             +VGFY ++C +AE +V+  V KA   + G+AAGL+R+HFHDCFVRGCDGSVL+ S P N 
Sbjct  29    KVGFYSSTCPSAEAIVRSAVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASRPGNP  88

Query  1694  -AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              +E+D+  NNPSLRGFEVI++AK ++E  C   VSCADILAFAARDSV   GG+ YDVP+
Sbjct  89    ISERDNLVNNPSLRGFEVIEEAKNQIEDACPQTVSCADILAFAARDSVSKVGGINYDVPS  148

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +S+  EV  NLP P F+ D+L + F  KG +  EMVTLSGAH+IG SHC SFSN
Sbjct  149   GRRDGGVSIGGEVIGNLPGPSFSADELVSSFSRKGLSADEMVTLSGAHSIGVSHCGSFSN  208

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANR  1158
             RLY+F+ T  QD SLD  YA  LK +CP      +  V ++P+TP   D  YY  ++ +R
Sbjct  209   RLYSFSDTATQDPSLDSSYAETLKGKCPPPPPTSDPTVSLEPSTPIRLDSKYYEALINHR  268

Query  1157  GLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVV  978
             GLLTSDQTL T  ST   V  NA     W  KFA AMV+MG + VLTG+ GEIR  C  V
Sbjct  269   GLLTSDQTLYTSQSTRAMVESNAYNAASWAEKFALAMVRMGSIEVLTGSDGEIRKQCSFV  328

Query  977   N  975
             N
Sbjct  329   N  329



>ref|XP_010024694.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score =   341 bits (875),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 219/324 (68%), Gaps = 7/324 (2%)
 Frame = -3

Query  1937  SSLALTMILLSC--HPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRV  1764
             SS  L+ +L+ C   P  +   L+VGFY+  C +AE +V++ V+KA   D G  A L+R+
Sbjct  4     SSAYLSFVLVICLISP-AISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRL  62

Query  1763  HFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCAD  1584
             HFHDCFVRGCDGS+L++ST  N AEKDS   N  + GFEVID AKA++E+ C   VSCAD
Sbjct  63    HFHDCFVRGCDGSILLNSTKGNTAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCAD  121

Query  1583  ILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQ  1404
             I+AFAARD V   GG  Y VP+GRRDG +SLASEV  NLP PFF+  QL   F  KG + 
Sbjct  122   IVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGPFFDAVQLEANFAKKGLSL  181

Query  1403  KEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-GSKDPNLV  1227
             ++MVTLSGAH+IG SHC+ F+ RLY+FN+T  QD SL+P YA  LK +CP+ G  DP  +
Sbjct  182   RDMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNGPTDP--I  239

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V  DP TP + D AYY N+ +++GLL SDQ L     T   V  NA  P  W  +F AAM
Sbjct  240   VPFDPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDASLTRGLVKDNANHPSAWARRFTAAM  299

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             V+MG + VLTG  GEIR NCRV+N
Sbjct  300   VRMGLIEVLTGTQGEIRKNCRVIN  323



>pdb|3HDL|A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase 
From Royal Palm Tree
Length=304

 Score =   340 bits (873),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 208/302 (69%), Gaps = 1/302 (0%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQ+GFY  SC  AE +V+  V  AF  + G+A GL+R+HFHDCFVRGCD SVL+DST  N
Sbjct  2     LQIGFYNTSCPTAESLVQQAVAAAFANNSGIAPGLIRMHFHDCFVRGCDASVLLDSTANN  61

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKD+  NNPSLRGFEVI  AK+ +E+ C   VSCADILAFAARDS  + G + Y VP+
Sbjct  62    TAEKDAIPNNPSLRGFEVITAAKSAVEAACPQTVSCADILAFAARDSANLAGNITYQVPS  121

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +SLASE    +P+P FN  QL   F NK  T  EMVTLSGAH+IG +HC+SF+N
Sbjct  122   GRRDGTVSLASEANAQIPSPLFNATQLINSFANKTLTADEMVTLSGAHSIGVAHCSSFTN  181

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS-KDPNLVVQMDPATPAIFDVAYYTNVLAN  1161
             RLYNFN+ +G D +L P YAA L+  CP  S +   + V +D  TP++ D  YYT V   
Sbjct  182   RLYNFNSGSGIDPTLSPSYAALLRNTCPANSTRFTPITVSLDIITPSVLDNMYYTGVQLT  241

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
              GLLTSDQ L+T+ + +  V  NA     W SKFA AMVKMG++ VLTG  GEIR NC V
Sbjct  242   LGLLTSDQALVTEANLSAAVKANAMNLTAWASKFAQAMVKMGQIEVLTGTQGEIRTNCSV  301

Query  980   VN  975
             VN
Sbjct  302   VN  303



>gb|KCW61137.1| hypothetical protein EUGRSUZ_H03910, partial [Eucalyptus grandis]
Length=300

 Score =   340 bits (871),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 209/302 (69%), Gaps = 4/302 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+  C +AE +V++ V+KA   D G  A L+R+HFHDCFVRGCDGS+L++ST  N
Sbjct  2     LKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGN  61

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS   N  + GFEVID AKA++E+ C   VSCADI+AFAARD V   GGL Y VP+
Sbjct  62    TAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGLHYAVPS  120

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +SLASEV  NLP  FF+  QL   F  KG + + MVTLSGAH+IG SHC+ F+ 
Sbjct  121   GRRDGRVSLASEVIQNLPGAFFDAAQLKANFAKKGLSLRNMVTLSGAHSIGDSHCSQFTK  180

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK-DPNLVVQMDPATPAIFDVAYYTNVLAN  1161
             RLY+FN+T  QD SL+P YA  LK +CP+ S  DP  +V  DP TP + D AYY N+ ++
Sbjct  181   RLYSFNSTYSQDPSLNPNYAHLLKTKCPRNSPTDP--IVPFDPVTPNVLDNAYYRNLKSD  238

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             +GLL SDQ L   P T   V  NA  P  W  +F AAMV+MG + VLTG  GEIR NCRV
Sbjct  239   KGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRMGSIEVLTGTQGEIRKNCRV  298

Query  980   VN  975
             +N
Sbjct  299   IN  300



>ref|XP_003555769.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   341 bits (874),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 208/301 (69%), Gaps = 1/301 (0%)
 Frame = -3

Query  1874  QVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANK  1695
             +VGFY ++C +AE +VK  V KA   + G+AAGL+R+HFHDCFVRGCDGSVL+ STP N 
Sbjct  29    KVGFYSSTCPSAEAIVKSTVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNP  88

Query  1694  -AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              +E+D+  NNPSLRGFEVI+ AK ++E+ C   VSCADILAFAARDSV   GG+ YDVP+
Sbjct  89    ISERDNFVNNPSLRGFEVIEDAKNQIEAACPETVSCADILAFAARDSVSKVGGISYDVPS  148

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +S+  EV +NLP P  + D L + F  KG +  EMVTLSGAH+IG SHC +FSN
Sbjct  149   GRRDGRVSIGDEVLDNLPRPSLSADDLISNFERKGLSADEMVTLSGAHSIGVSHCGAFSN  208

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANR  1158
             RLY+F+ T  QD SLD  YA  LK QCP      +  V ++P+TP   D  YY  ++ +R
Sbjct  209   RLYSFSDTVTQDPSLDSSYAETLKTQCPPPPPTSDPTVSLEPSTPIRLDSKYYEGLINHR  268

Query  1157  GLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVV  978
             GLLTSDQTL T  ST   V  NA     W  KFA AM++MG + VLTG+ GEIR  C  V
Sbjct  269   GLLTSDQTLYTSQSTRGMVQSNANNGASWADKFALAMLRMGSIEVLTGSDGEIRKQCSFV  328

Query  977   N  975
             N
Sbjct  329   N  329



>gb|KCW58172.1| hypothetical protein EUGRSUZ_H00889, partial [Eucalyptus grandis]
Length=329

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/292 (58%), Positives = 201/292 (69%), Gaps = 0/292 (0%)
 Frame = -3

Query  1871  VGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKA  1692
             VGFY+ +C  AE +V+  + +AF  D G+AA  +R++FHDCFVRGCD S+L++ST  N A
Sbjct  37    VGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTA  96

Query  1691  EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGR  1512
             EKDSP NNPSL GF+VID+AKARLE+ C   VSCADI+AFAARDSV   G + YDVP+GR
Sbjct  97    EKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGR  156

Query  1511  RDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRL  1332
             RDG IS ASEV  NLP P F V QL   F  KGF+  EMVTLSGAH+IG SHC+SFSNRL
Sbjct  157   RDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRL  216

Query  1331  YNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGL  1152
             Y+FN T  QD  LDP YAA LK +CPQG+   +  V +D  TP   D  YY  +L  RGL
Sbjct  217   YSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGL  276

Query  1151  LTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIR  996
              +SD+ L T   T   V  NA+    W  KF  AMVK+G L VLTG  GEIR
Sbjct  277   FSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIR  328



>ref|XP_006574525.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=331

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 215/309 (70%), Gaps = 6/309 (2%)
 Frame = -3

Query  1901  HPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSV  1722
             H  VL +K  V FY+ +C +AE +V+  V KA   + G+AAGL+R+HFHDCFVRGCDGSV
Sbjct  29    HTHVLVSK--VDFYKTTCPSAEAIVRRAVNKAVSLNPGIAAGLIRMHFHDCFVRGCDGSV  86

Query  1721  LIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITG  1542
             L++ST  N +E++ PANNPSLRGFEVID+AKA++E+ C   VSC+DILAFAARDS    G
Sbjct  87    LLESTAGNPSEREHPANNPSLRGFEVIDEAKAQIEAECPHTVSCSDILAFAARDSTNRVG  146

Query  1541  GLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGR  1362
             G+ Y VPAGRRDG +S+  E A+ LP P FN  QL + F  KG +  EMVTLSGAH+IG 
Sbjct  147   GINYVVPAGRRDGRVSIRDE-ASQLPRPTFNTQQLISNFEQKGLSADEMVTLSGAHSIGV  205

Query  1361  SHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAY  1182
             SHC+SFS+RLY+FN T  QD S+DP +A  LK +C   S +    V +D +TP   D  Y
Sbjct  206   SHCSSFSDRLYSFNATFPQDPSMDPKFATSLKTKCLPRSDN---TVVLDASTPNRLDNNY  262

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y  +   RGLLTSDQTLLT PST   V  NA+   +W  KFA AMV MG + VLTG+ GE
Sbjct  263   YALLKNQRGLLTSDQTLLTSPSTRPMVLTNAKHGSKWARKFAKAMVHMGSIQVLTGSQGE  322

Query  1001  IRANCRVVN  975
             IR  C VVN
Sbjct  323   IRTRCSVVN  331



>ref|XP_002978679.1| hypothetical protein SELMODRAFT_177154 [Selaginella moellendorffii]
 gb|EFJ20126.1| hypothetical protein SELMODRAFT_177154 [Selaginella moellendorffii]
Length=326

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/305 (58%), Positives = 211/305 (69%), Gaps = 4/305 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +L++GFY +SC  AE VV+  V +A   + G+AAGL+R+HFHDCFVRGCDGSVLIDST  
Sbjct  23    ELRLGFYADSCPEAESVVQFTVAQAVATNPGIAAGLLRLHFHDCFVRGCDGSVLIDSTGN  82

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             NKAEKD+  N   LRGFEVID AKARLE  C G VSCADIL +AARD+V   GG  +DV 
Sbjct  83    NKAEKDAIPNF-GLRGFEVIDNAKARLEDRCPGTVSCADILTYAARDAVSQVGGPRWDVL  141

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
              GRRDG +S A +V  NLP+P FNVDQLT  F  KG TQ+EM+TLSGAHTIG +HC SF 
Sbjct  142   GGRRDGTVSRADQVGANLPSPLFNVDQLTKSFVRKGMTQEEMITLSGAHTIGIAHCLSFV  201

Query  1340  NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK--DP-NLVVQMDPATPAIFDVAYYTNV  1170
             NRLYNF+TT+ QD  LDP  A  LK  CP+GS   DP +  + +DP +P +FD  YYT++
Sbjct  202   NRLYNFSTTSVQDPDLDPNMARLLKSLCPKGSDFLDPKSKSIALDPLSPNLFDNGYYTSL  261

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
                R +LTSDQ L  D  T   V         W+ KF  AMVKM  +GVL+GN G IR N
Sbjct  262   SLRRSILTSDQILFADLDTRDSVEDKQANEAVWRFKFVNAMVKMSTIGVLSGNQGRIRTN  321

Query  989   CRVVN  975
             CRVV+
Sbjct  322   CRVVS  326



>ref|XP_002272800.1| PREDICTED: peroxidase 5 [Vitis vinifera]
 emb|CBI37010.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   340 bits (872),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 211/306 (69%), Gaps = 2/306 (1%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             L + L+VGFY ++C +AE VV+  V KA  R+ G+AAGL+R+HFHDCFVRGCD SVL+DS
Sbjct  35    LSSSLKVGFYGSTCPSAEAVVRKTVDKAVSRNLGIAAGLIRMHFHDCFVRGCDASVLLDS  94

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N +EK+ PANNPSLRGF+VI+KAKA+LE++C   VSCADI+AFAARD     GG+ Y
Sbjct  95    TPGNLSEKEHPANNPSLRGFQVINKAKAKLEALCPETVSCADIIAFAARDGALKVGGINY  154

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VP GRRDG +S   EVA +LP P FN +QL   F  KG +  EMVTLSGAH+IG SHC+
Sbjct  155   TVPGGRRDGRVSRKDEVAESLPPPHFNAEQLELRFARKGLSLDEMVTLSGAHSIGMSHCS  214

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC-PQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             SFS RLY+ N T   D S+   Y + L+ +C PQ +   N  V ++  TP   D  YY  
Sbjct  215   SFSKRLYS-NGTHAHDPSMRRKYVSFLRTKCHPQRNGGQNPTVPLEAKTPGRLDNKYYKE  273

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +  +RGLL SDQTL++  STA  V  NAR    W +KFAAAMV MG + VLT   GEIR 
Sbjct  274   LEKHRGLLNSDQTLMSSQSTAWMVRNNARHGSTWAAKFAAAMVHMGSIDVLTETQGEIRR  333

Query  992   NCRVVN  975
             +C VVN
Sbjct  334   SCHVVN  339



>ref|XP_009382469.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=334

 Score =   340 bits (871),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/310 (55%), Positives = 211/310 (68%), Gaps = 6/310 (2%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
              A L +GFYR +C +AE +V+  V +A   + G+AAGL+R+HFHDCFVRGCD S+L++S+
Sbjct  24    SASLHLGFYRKTCPSAEAIVRRTVSEAVANNPGLAAGLIRMHFHDCFVRGCDASLLLNSS  83

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
             P N AEKD+P NNPS+RGFEVID AKA +E+ C   VSCADI+AFAARDS  + GG+ Y 
Sbjct  84    PGNTAEKDAPPNNPSMRGFEVIDAAKAAVEARCPSTVSCADIIAFAARDSAYLAGGIDYP  143

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG +SL SE   N+P P      L   F  KG +  EMVTLSGAH+IGR+HCT+
Sbjct  144   VPAGRRDGRVSLDSEALTNIPLPNLTAAGLRDSFAKKGLSVDEMVTLSGAHSIGRAHCTA  203

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQG-----SKDPNLVVQMDPATPAIFDVAY  1182
             F+ RLYNFN T  QD S+DP +AA LK +C        SKDP   V +D  TP   D  Y
Sbjct  204   FAPRLYNFNATHTQDPSMDPAFAAYLKSRCSPSTVDFTSKDPT-TVPLDAVTPRRLDNQY  262

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y N+   RGLL SDQTL     TA+ V  +A+    W +KFAAAMV+MG + VLTG+ GE
Sbjct  263   YKNLAKRRGLLFSDQTLQASRLTARLVRLDAKLGSVWAAKFAAAMVRMGHIEVLTGSQGE  322

Query  1001  IRANCRVVNH  972
             IR  C VVN+
Sbjct  323   IRKMCGVVNN  332



>ref|XP_003565723.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=355

 Score =   340 bits (873),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 213/320 (67%), Gaps = 3/320 (1%)
 Frame = -3

Query  1925  LTMILLSCHPIV-LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDC  1749
             L + +L+  PI  + A L+VGFY  +C +AE +V+  V  +F  + GVAAGL+R+HFHDC
Sbjct  13    LAVAVLALFPIAAVGAGLKVGFYSKTCPSAETLVQQAVAASFKNNGGVAAGLIRLHFHDC  72

Query  1748  FVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFA  1569
             FV+GCDGSVLIDST  N AEKD+  NNPSLRGFEVID AK  +E+ C  +VSCADILAFA
Sbjct  73    FVKGCDGSVLIDSTANNTAEKDAIPNNPSLRGFEVIDAAKKAIEAKCPKIVSCADILAFA  132

Query  1568  ARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVT  1389
             ARDS+ + G + Y VPAGRRDG IS      NNLP+P     +L   F  K  T ++MV 
Sbjct  133   ARDSIALAGNVTYKVPAGRRDGRISSDQNALNNLPSPLSTASELVGNFTLKNLTAEDMVV  192

Query  1388  LSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMD  1215
             LSGAHTIG S C+SF+NRLY F+ T+  D ++   YA  LK  CP  S    PN  + MD
Sbjct  193   LSGAHTIGVSRCSSFTNRLYGFSNTSQVDPTMSSAYAFLLKNICPANSSQFFPNTTMDMD  252

Query  1214  PATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMG  1035
               TPA+ D  YY +++ N GL TSDQ LLT+ +    V +  +   RWKSKF  +MVKMG
Sbjct  253   IITPAVLDNKYYVSLINNLGLFTSDQALLTNSTLKASVDEFVKNENRWKSKFVKSMVKMG  312

Query  1034  KLGVLTGNAGEIRANCRVVN  975
              + VLTG  GEIR NCRV+N
Sbjct  313   NIEVLTGTQGEIRLNCRVIN  332



>ref|XP_010906360.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=311

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 212/303 (70%), Gaps = 5/303 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VG+Y + C +AE +V+  VRKA   + G+ AGL+R+HFHDCFVRGCD SVL+DSTP
Sbjct  12    ASLKVGYYNHKCPSAEAIVRQTVRKAMIHNIGIGAGLIRMHFHDCFVRGCDASVLLDSTP  71

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N++EK+SPANNPSLRGFEVID+AKAR+ES+C   VSCADIL FAARD+    GG+ Y V
Sbjct  72    DNRSEKESPANNPSLRGFEVIDEAKARIESVCPSTVSCADILTFAARDAAYFAGGIKYAV  131

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG +S+ SEV +NLP   FN  QL   F  KG T  EMVTLSGAH+ G SHCTSF
Sbjct  132   PAGRRDGRVSIESEVLSNLPGFSFNAVQLEDSFARKGLTLDEMVTLSGAHSFGVSHCTSF  191

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             ++RL   N T  QD  +D  +AA LK +C     DP   V +D  TP   D  YY N+  
Sbjct  192   ADRL---NATGPQDPKMDRKFAAFLKSKCSPAGSDP--TVNLDVVTPNRLDNQYYKNLRK  246

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
              RGLLTSDQTL T   T++ V  NA+ P  W + FAAAMVKMG + VLTG+ GEIR  CR
Sbjct  247   GRGLLTSDQTLQTSALTSRLVDANAKRPRAWAANFAAAMVKMGSIEVLTGDQGEIRRTCR  306

Query  983   VVN  975
             VVN
Sbjct  307   VVN  309



>gb|KCW61140.1| hypothetical protein EUGRSUZ_H03915, partial [Eucalyptus grandis]
Length=300

 Score =   338 bits (866),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/302 (56%), Positives = 209/302 (69%), Gaps = 4/302 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+  C +AE +V++ V+KA   D G  A L+R+HFHDCFVRGCDGS+L++ST  N
Sbjct  2     LKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGN  61

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS   N  + GFEVID AKA++E+ C   VSCADI+AFAARD V   GG  Y VP+
Sbjct  62    TAEKDS-MGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPS  120

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +SLASEV  NLP PFF+  QL   F  KG + ++MVTLSGAH+IG SHC+ F+ 
Sbjct  121   GRRDGRVSLASEVIKNLPGPFFDAVQLEANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTK  180

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-GSKDPNLVVQMDPATPAIFDVAYYTNVLAN  1161
             RLY+FN+T  QD SL+P YA  LK +CP+ G  DP  +V  DP TP + D AYY N+ ++
Sbjct  181   RLYSFNSTYSQDPSLNPNYAHLLKTKCPRNGPTDP--IVPFDPVTPNVLDNAYYHNLKSD  238

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             +GLL SDQ L     T   V  NA  P  W  +F AAMV+MG + VLTG  GEIR NCRV
Sbjct  239   KGLLYSDQVLWDASLTRGLVKDNANHPSAWARRFTAAMVRMGLIEVLTGTQGEIRKNCRV  298

Query  980   VN  975
             +N
Sbjct  299   IN  300



>ref|XP_002984610.1| hypothetical protein SELMODRAFT_181167 [Selaginella moellendorffii]
 gb|EFJ14255.1| hypothetical protein SELMODRAFT_181167 [Selaginella moellendorffii]
Length=326

 Score =   338 bits (868),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 210/305 (69%), Gaps = 4/305 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +L++GFY +SC  AE VV+  V +A   + G+AAGL+R+HFHDCFVRGCDGSVL+DST  
Sbjct  23    ELRLGFYADSCPEAESVVQFTVAQAVATNPGIAAGLLRLHFHDCFVRGCDGSVLVDSTGN  82

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             NKAEKD+  N   LRGFEVID AKARLE  C G VSCADIL +AARD+V   GG  +DV 
Sbjct  83    NKAEKDAIPNF-GLRGFEVIDNAKARLEDRCPGTVSCADILTYAARDAVSQVGGPRWDVL  141

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
              GRRDG +S A +V  NLP+P FNVDQLT  F  KG TQ+EM+TLSGAHTIG +HC SF 
Sbjct  142   GGRRDGTVSRADQVGANLPSPLFNVDQLTKSFVRKGMTQEEMITLSGAHTIGIAHCLSFV  201

Query  1340  NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK--DP-NLVVQMDPATPAIFDVAYYTNV  1170
             NRLYNF+TT+ QD  LDP  A  LK  CP+GS   DP +  + +DP +P  FD  YYT++
Sbjct  202   NRLYNFSTTSVQDPDLDPNMAKLLKSLCPKGSDFLDPKSKSIALDPLSPNFFDNGYYTSL  261

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
                R +LTSDQ L  D  T   V         W+ KF  AMVKM  +GVL+GN G IR N
Sbjct  262   SLRRSILTSDQILFADLDTRDSVEDKQANEAVWRFKFVNAMVKMSTIGVLSGNQGRIRTN  321

Query  989   CRVVN  975
             CRVV+
Sbjct  322   CRVVS  326



>ref|XP_008461391.1| PREDICTED: peroxidase 5-like [Cucumis melo]
Length=340

 Score =   339 bits (870),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 212/309 (69%), Gaps = 7/309 (2%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFYR+SC  AE +VK  V KA   + G AAGL+R+HFHDCF+RGC+GSVL+ STP
Sbjct  33    ATLKVGFYRSSCPNAEAIVKKVVNKAISLNPGAAAGLIRLHFHDCFIRGCEGSVLLKSTP  92

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              + AE+D P+N PSL+GFE+ID+AK  LE+ C   VSCADILAFAARDS    GG+ Y V
Sbjct  93    GHPAERDHPSNFPSLQGFEIIDEAKTYLEAACPNTVSCADILAFAARDSARKVGGINYAV  152

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG IS+  E A+ LP+P FN++QLT  F  +G ++ +MVTLSGAH+IG + C +F
Sbjct  153   PAGRRDGRISIKEE-ASRLPSPTFNIEQLTQNFAERGLSKTDMVTLSGAHSIGAARCVTF  211

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ------GSKDPNLVVQMDPATPAIFDVAY  1182
             S RLY+FNTT  QD S++P Y A LK +CP       G     L V +D  TP   D  Y
Sbjct  212   SKRLYSFNTTHNQDPSMNPKYVAYLKTKCPPPTSNVGGQNAQPLEVALDFTTPNRLDKQY  271

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y  +  + GLL+SDQ LL+ PST+K V   A+    W S F  +MVKMG +GVLTG+ GE
Sbjct  272   YVGLTKHEGLLSSDQILLSSPSTSKLVLAYAKYGSIWASNFGKSMVKMGSIGVLTGSQGE  331

Query  1001  IRANCRVVN  975
             IR +C  VN
Sbjct  332   IRRHCSFVN  340



>ref|XP_004298124.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   338 bits (868),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 200/306 (65%), Gaps = 0/306 (0%)
 Frame = -3

Query  1892  VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             V    L+VG YR SC +AE++V+D V+KA   D G+AA L+R+HFHDCFV GCD S+L+D
Sbjct  24    VASVPLEVGSYRKSCPSAEMIVRDTVKKAAATDPGIAAALIRLHFHDCFVMGCDASILLD  83

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             S P   A +     N  ++GFEVID+AKA +E+ C   VSCADI+ FAARDSV ITGG  
Sbjct  84    SKPGKPAAEKESMGNKGVQGFEVIDEAKANIEAQCPNTVSCADIITFAARDSVFITGGTY  143

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             Y  P GRRDG +SL SEV  NLP  F N  QL T F  KG + K+MVTLSGAH+IG SHC
Sbjct  144   YSAPGGRRDGTVSLVSEVTKNLPDAFLNATQLKTNFARKGLSLKDMVTLSGAHSIGDSHC  203

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             +SFS RLY+FN T  QD  LD  Y   LK +CP      + VV  DP TP + D  YY N
Sbjct  204   SSFSKRLYSFNKTHAQDPELDAAYGEYLKSKCPNVKNGVDPVVAFDPLTPTLLDNNYYKN  263

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             ++ ++GLL +DQ L +   T K V  N   P RW  +FAAAMVKMG + VL G  GEIR 
Sbjct  264   LVGHKGLLATDQELWSSDLTRKMVKYNRNHPGRWGLEFAAAMVKMGSIDVLVGKQGEIRK  323

Query  992   NCRVVN  975
             NCR VN
Sbjct  324   NCRAVN  329



>ref|XP_006444582.1| hypothetical protein CICLE_v10021010mg [Citrus clementina]
 ref|XP_006492388.1| PREDICTED: peroxidase 5-like [Citrus sinensis]
 gb|ESR57822.1| hypothetical protein CICLE_v10021010mg [Citrus clementina]
 gb|KDO86854.1| hypothetical protein CISIN_1g019585mg [Citrus sinensis]
Length=338

 Score =   339 bits (869),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 176/339 (52%), Positives = 224/339 (66%), Gaps = 10/339 (3%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPI--VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDR  1791
             MS   +  C  + + +IL+S  P+     AKL+VGFY+++C +AE +V+  V KA   + 
Sbjct  1     MSYAKMDSCMIMCI-LILVSTMPLGTSANAKLKVGFYKSTCPSAESIVRKAVNKAVSCNP  59

Query  1790  GVAAGLVRVHFHDCFVRGCDGSVLIDSTPANK-AEKDSPANNPSLRGFEVIDKAKARLES  1614
             G+AAGL+R+HFHDCFVRGCD SVL+++ P N  +E+D   NNPSLRGFEVID+AKA++E+
Sbjct  60    GIAAGLIRMHFHDCFVRGCDASVLLETIPGNPPSERDDHVNNPSLRGFEVIDEAKAQIEA  119

Query  1613  ICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLT  1434
             +C   VSCADIL FAARDS    GG+ Y VPAGRRDG +SL++E+A NLP+P FN +QL 
Sbjct  120   VCPNTVSCADILTFAARDSTSKVGGINYAVPAGRRDGRVSLSNEIAENLPSPTFNAEQLA  179

Query  1433  TLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP  1254
               F  KG +  EMVTL GAH+IG SHC+SFS RLY FNTT  QD S+D  +A  LK +CP
Sbjct  180   ARFARKGISVDEMVTLVGAHSIGVSHCSSFSKRLYAFNTTHPQDPSMDHRFANFLKNKCP  239

Query  1253  QGSKDPNLVVQMDPA------TPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQN  1092
                    L    DP       TP   D  YY  +  +RGLLTSDQTL+    T+K V  N
Sbjct  240   PPPPTDGLGCTRDPTVTQEFVTPNRLDNKYYRELRNHRGLLTSDQTLMDSRLTSKMVLDN  299

Query  1091  ARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
              R    W +KFA AMV +G L VLTG+ GEIR +C  VN
Sbjct  300   ERNGAMWGTKFAKAMVHVGSLDVLTGSQGEIRKHCSFVN  338



>gb|EMT07621.1| Peroxidase 5 [Aegilops tauschii]
Length=325

 Score =   338 bits (867),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 219/306 (72%), Gaps = 6/306 (2%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+LQVGFY +SC  AE++V+DEV +A     G AAGLVR+HFHDCFV+GCD SVL+DST
Sbjct  24    QAQLQVGFYAHSCPQAEVIVRDEVGRAVSAYPGFAAGLVRLHFHDCFVKGCDASVLLDST  83

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               + AEKD+P N  SLRGFEVID AK RLE+ C G VSCADILAFAARDSV + GG  Y 
Sbjct  84    ANSTAEKDAPPNK-SLRGFEVIDAAKKRLEAACAGTVSCADILAFAARDSVVLAGGSPYG  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG++S AS+   +LP P  NV  LT  F   G +Q++MVTLSGAHTIG +HC+S
Sbjct  143   VPAGRRDGNVSAASDAQASLPPPTANVAHLTEAFAKNGLSQEDMVTLSGAHTIGVTHCSS  202

Query  1346  FSNRLYNFNTT--TGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             FS RL+ +N T  TGQD ++D   AA+L +QC  GS  PN  V MD  +P  FD  Y+  
Sbjct  203   FSARLHGYNATTGTGQDPAMDGAKAAELARQCSPGS--PN-AVPMDAGSPDTFDTGYFRA  259

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +LAN G+L SDQTL +D +TA   +QNA   + + ++F  A+V+MG + VLTG  G+IR 
Sbjct  260   LLANPGVLASDQTLPSDNATAALGAQNAGNGYLFVTRFGDALVRMGGIRVLTGGDGQIRT  319

Query  992   NCRVVN  975
             NCRVVN
Sbjct  320   NCRVVN  325



>ref|XP_008793597.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=338

 Score =   338 bits (868),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 215/309 (70%), Gaps = 6/309 (2%)
 Frame = -3

Query  1898  PIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVL  1719
             P    A L+VG+Y + CR+AE +V+  VR+A  R+  + AGLVR+HFHDCFVRGCD SVL
Sbjct  33    PTTSRASLKVGYYNHKCRSAEAIVRQTVRQAMVRNLAIGAGLVRMHFHDCFVRGCDASVL  92

Query  1718  IDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGG  1539
             +DSTP N +EK+SPANNPSLRGFEVID+AK+R+ES+C   VSCADIL+FAARD+    GG
Sbjct  93    LDSTPGNPSEKESPANNPSLRGFEVIDEAKSRIESVCPSTVSCADILSFAARDAAYFAGG  152

Query  1538  LGYDVPAGRRDGHISLASEV-ANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGR  1362
             + Y VPAGRRDG +SL SEV +NNLP P FN  QL   F  KG T  EMVTLSGAH+ G 
Sbjct  153   IKYAVPAGRRDGRVSLESEVLSNNLPPPVFNAVQLEESFARKGLTLDEMVTLSGAHSFGV  212

Query  1361  SHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAY  1182
             SHC+SF++R+   N T  +D ++D  + A LK +C     DP   V +D  TP   D  Y
Sbjct  213   SHCSSFADRV---NATGPRDPTMDRRFNAFLKSKCSPAGSDP--TVNLDVVTPKRLDNQY  267

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y N+   RGLLTSDQTL T   TA+ V+ NA  P  W + FAAAMVKMG + VLTG+ GE
Sbjct  268   YKNLRKGRGLLTSDQTLQTSALTARLVAANAERPRAWAANFAAAMVKMGSIEVLTGDQGE  327

Query  1001  IRANCRVVN  975
             IR  CR VN
Sbjct  328   IRRTCRFVN  336



>ref|XP_007145112.1| hypothetical protein PHAVU_007G210900g [Phaseolus vulgaris]
 gb|ESW17106.1| hypothetical protein PHAVU_007G210900g [Phaseolus vulgaris]
Length=325

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 215/311 (69%), Gaps = 5/311 (2%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L+  +++LS  P+   A L+V FY+ +C +AE +V+  V KA   + G+AAGL+R+HFHD
Sbjct  11    LSTFLLILSIFPLA-SASLKVDFYKTTCPSAESIVRSAVEKAVSLNPGIAAGLIRMHFHD  69

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVL++STP N +E+D PANNPSLRGF+V+D+AKA++E+ C   VSCADILAF
Sbjct  70    CFVRGCDGSVLLESTPGNPSERDHPANNPSLRGFQVVDEAKAQIEAECPHTVSCADILAF  129

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDS    GG+ Y VPAGRRDG +S+  E  + LP P  N DQL   F  KG +  EMV
Sbjct  130   AARDSANKVGGINYAVPAGRRDGRVSIRDE-PSQLPLPTSNADQLIADFRRKGLSADEMV  188

Query  1391  TLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDP  1212
             TLSGAH+IG SHC+SFS+RLY+FN T  QD S+D  YA  LK +CP GS +    V +D 
Sbjct  189   TLSGAHSIGVSHCSSFSDRLYSFNATFPQDPSMDSKYATSLKSKCPAGSDN---TVPLDA  245

Query  1211  ATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGK  1032
             +TP   D  YYT +  +RGLLTSDQTLL  PST   +  NA+    W  K A AMV MG 
Sbjct  246   STPNRLDNKYYTELKKHRGLLTSDQTLLGSPSTRPMLLTNAKHSSVWARKVAKAMVHMGS  305

Query  1031  LGVLTGNAGEI  999
             + VLTG+ G +
Sbjct  306   IDVLTGSQGVV  316



>ref|NP_001141388.1| uncharacterized protein LOC100273479 precursor [Zea mays]
 gb|ACF86224.1| unknown [Zea mays]
 gb|AFW77216.1| hypothetical protein ZEAMMB73_709802 [Zea mays]
Length=357

 Score =   339 bits (869),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 220/332 (66%), Gaps = 13/332 (4%)
 Frame = -3

Query  1943  CCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRV  1764
             CC  +A  +  L    + + A L+ GFY  +C +AE +V+  V  AF  + GVA  L+R+
Sbjct  5     CCLVVATLLAAL----LSVSASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRM  60

Query  1763  HFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCAD  1584
             HFHDCFVRGCDGSVLIDST  NKAEKDS  N+PSLR F+V+D+AKA LE+ C GVVSCAD
Sbjct  61    HFHDCFVRGCDGSVLIDSTANNKAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCAD  120

Query  1583  ILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQ  1404
             ILAFAARDSV +TGGLGY VP+GRRDG IS A++  N LP PFFN  QL   F +K  + 
Sbjct  121   ILAFAARDSVVLTGGLGYKVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSL  180

Query  1403  KEMVTLSGAHTIGRSHCTSFS------NRLYNFN-TTTGQDSSLDPLYAAKLKQQCPQGS  1245
             ++MV LSGAHTIG SHC+SF+      +RLYNF+ ++ G D +L   YA  LK  CP  S
Sbjct  181   EDMVVLSGAHTIGVSHCSSFAGINNTGDRLYNFSGSSDGIDPALSKAYAFLLKSICPSNS  240

Query  1244  KD--PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRW  1071
                 PN    MD  TPA FD  YY  +  N GL  SD  LLT+ +    V    R+   W
Sbjct  241   GRFFPNTTTFMDLITPAKFDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRSEATW  300

Query  1070  KSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             K+KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  301   KTKFAKSMLKMGQIEVLTGTQGEIRRNCRVIN  332



>ref|XP_004136140.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=339

 Score =   338 bits (866),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 216/308 (70%), Gaps = 10/308 (3%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY +SC  AE +V+D V KA  R+ G+AAGL+R+HFHDCFVRGCD SVL++STP N
Sbjct  35    LRVGFYSSSCPDAETIVEDAVDKAVSRNPGIAAGLIRMHFHDCFVRGCDASVLLESTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              +EK   AN P+LRGFEVID+AKA++E++C   VSCAD+LAFAARDS    GG+ Y VPA
Sbjct  95    PSEKYHVANFPTLRGFEVIDEAKAKIEAVCPNTVSCADVLAFAARDSANKVGGINYAVPA  154

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG IS   E AN LP   F+ ++L + F  +G + +EMVTLSGAH+IG +HC +F  
Sbjct  155   GRRDGFIS-RKEDANALPGFTFHAERLASEFGKRGLSVEEMVTLSGAHSIGIAHCPTFVG  213

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-------GSKDPNLVVQMDPATPAIFDVAYY  1179
             RLY+FNTT  QD SLDP YA  LK +CPQ       GS+ P+  V +D +TP   D  YY
Sbjct  214   RLYSFNTTHAQDPSLDPSYADYLKSKCPQPSSSGDDGSQQPD--VDLDFSTPHRLDNRYY  271

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
               +  +RGLL SDQTLL+   T+K V +NA    +W +KF  AMVKMGK+ VLTG+ GEI
Sbjct  272   IELKNHRGLLISDQTLLSSSLTSKMVLRNAHHGSKWATKFGKAMVKMGKIDVLTGSKGEI  331

Query  998   RANCRVVN  975
             R  C  VN
Sbjct  332   RRQCSFVN  339



>ref|XP_004135967.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=339

 Score =   338 bits (866),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 219/324 (68%), Gaps = 10/324 (3%)
 Frame = -3

Query  1925  LTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCF  1746
             L +I            L+VGFY +SC  AE +V+D V KA  R+ G+AAGL+R+HFHDCF
Sbjct  19    LCIIFFFSLSTFASTSLRVGFYSSSCPDAETIVEDAVDKAVSRNPGIAAGLIRMHFHDCF  78

Query  1745  VRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAA  1566
             VRGCD SVL++STP N +EK   AN P+LRGFEVID+AKA++E++C   VSCAD+LAFAA
Sbjct  79    VRGCDASVLLESTPGNPSEKYHVANFPTLRGFEVIDEAKAKIEAVCPNTVSCADVLAFAA  138

Query  1565  RDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTL  1386
             RDS    GG+ Y VPAGRRDG IS   E AN LP   F+ ++L + F  +G + +EMVTL
Sbjct  139   RDSANKVGGINYAVPAGRRDGFIS-RKEDANALPGFTFHAERLASEFGKRGLSVEEMVTL  197

Query  1385  SGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-------GSKDPNLV  1227
             SGAH+IG +HC +F  RLY+FNTT  QD SLDP YA  LK +CPQ       GS+ P+  
Sbjct  198   SGAHSIGIAHCPTFVGRLYSFNTTHAQDPSLDPSYADYLKSKCPQPSSSGDDGSQQPD--  255

Query  1226  VQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAM  1047
             V +D +TP   D  YY  +  +RGLL SDQTLL+   T+K V +NA    +W +KF  AM
Sbjct  256   VDLDFSTPHRLDNRYYIELKNHRGLLISDQTLLSSSLTSKMVLRNAHYGSKWATKFGKAM  315

Query  1046  VKMGKLGVLTGNAGEIRANCRVVN  975
             VKMGK+ VLTG+ GEIR  C  VN
Sbjct  316   VKMGKIDVLTGSKGEIRRQCSFVN  339



>ref|XP_009382231.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 219/304 (72%), Gaps = 11/304 (4%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             E +L+VGFY  SC AAEL+VK+EV KA   D GV A L+R+HFHDCFVRGCDGS+L++ST
Sbjct  24    EPQLEVGFYSYSCPAAELLVKEEVEKALQDDPGVGADLLRMHFHDCFVRGCDGSILLNST  83

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N AEKD+  N   L GF+VID  K +LE+ CKGVVSCADILAFA+RDS+   GG+ Y 
Sbjct  84    KGNTAEKDARVNT-DLEGFDVIDTIKEKLEAACKGVVSCADILAFASRDSIVHYGGVPYK  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VP+GRRDG +S+A++ +  LP+P   + +LT LF +KG +Q +M+TLSGAHT+G +HC +
Sbjct  143   VPSGRRDGRVSIAADTS-ILPSPKLGLSELTKLFISKGLSQNDMITLSGAHTVGIAHCDA  201

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             FSNRLYN       D++LD  YAA LK QCP GS   N  V MDP TP  FD  YY  +L
Sbjct  202   FSNRLYN------GDATLDQNYAAYLKTQCPPGS---NNTVSMDPKTPRKFDNLYYRLIL  252

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              N+ L TSDQTL++   TA QV + A +  R++ KFA A+VKMG + VLTG+ GEIRA+C
Sbjct  253   KNQALFTSDQTLVSTQGTATQVKRLAESYKRFQKKFADAIVKMGAIEVLTGSEGEIRADC  312

Query  986   RVVN  975
             +VVN
Sbjct  313   KVVN  316



>ref|XP_004167191.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Cucumis sativus]
Length=338

 Score =   338 bits (866),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/335 (51%), Positives = 218/335 (65%), Gaps = 7/335 (2%)
 Frame = -3

Query  1961  SSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVA  1782
             SS+  +  S L+  +  L        A L+VGFYR+SC  AE +VK  V KA   + G A
Sbjct  5     SSQKFNILSKLSTVIFFLYLSTFASAATLKVGFYRSSCPNAEAIVKKVVNKAISLNPGAA  64

Query  1781  AGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKG  1602
             AGL+R+HFHDCF+RGC+GSVL+ STP +  E+D P+N PSL+GFE+ID+AKA LES C  
Sbjct  65    AGLIRLHFHDCFIRGCEGSVLLKSTPGHPTERDHPSNFPSLQGFEIIDEAKAYLESACPN  124

Query  1601  VVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFC  1422
              VSCADILAFAARDS    GG+ Y VPAGRRDG IS+  E A+ LP+P FN++QLT  F 
Sbjct  125   TVSCADILAFAARDSARKVGGINYAVPAGRRDGRISIKEE-ASRLPSPTFNIEQLTQNFA  183

Query  1421  NKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQ---  1251
              +G +++ MVTLSGAH+IG + C +FSNRLY+FN T  QD S++P YA  L+ Q P    
Sbjct  184   ERGLSKQYMVTLSGAHSIGAARCLTFSNRLYSFNATHNQDPSMNPKYAVLLEDQMPPLTS  243

Query  1250  ---GSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAP  1080
                G     L   +D  TP   D  YY  +  ++GLL+SDQ LL+ PST+K     A+  
Sbjct  244   NVGGQNAQPLEAALDFTTPNRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYG  303

Query  1079  FRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
               W S F  +MVKMG +GVLTG+ GEIR  C  VN
Sbjct  304   SIWASNFKKSMVKMGSIGVLTGSQGEIRRQCSFVN  338



>gb|EYU39444.1| hypothetical protein MIMGU_mgv1a009735mg [Erythranthe guttata]
Length=333

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 211/304 (69%), Gaps = 4/304 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KL+VGFY   C  AE++V+  V KA   + G+AAG++R+HFHDCFVRGCDGS+L+D+   
Sbjct  32    KLKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAG  91

Query  1700  NKA-EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
               A EK++ AN PSLRGFEVID+AKA +E++C G VSCADILAFAARDS    G +GY+V
Sbjct  92    KPAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYEV  151

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +SL+SEV  NLP PFF+  +L   F  KG +  EMVTLSGAH+IG SHC++F
Sbjct  152   PSGRRDGRVSLSSEVLQNLPPPFFSAAELKENFKRKGLSLDEMVTLSGAHSIGVSHCSAF  211

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCP-QGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             SNRL  FN T  +D SLD  YAA LK +CP   + DP   V  D  TP + D  YY N+ 
Sbjct  212   SNRLSGFNATFDKDPSLDSGYAAFLKTKCPVPANGDP--AVNNDFQTPTVLDNKYYVNLK  269

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              ++GLLTSDQTL   P T   V  N +    W  KFAAAMV MG + VLTG  GEIR NC
Sbjct  270   NHKGLLTSDQTLFDSPLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIEVLTGKQGEIRKNC  329

Query  986   RVVN  975
             R+VN
Sbjct  330   RLVN  333



>ref|XP_004158168.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
 gb|KGN45060.1| hypothetical protein Csa_7G419560 [Cucumis sativus]
Length=339

 Score =   337 bits (864),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 216/308 (70%), Gaps = 10/308 (3%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY +SC  AE +V+D V KA  R+ G+AAGL+R+HFHDCFVRGCD SVL++STP N
Sbjct  35    LRVGFYSSSCPDAEAIVEDAVDKAVSRNPGIAAGLIRMHFHDCFVRGCDASVLLESTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              +EK   AN P+LRGFEVID+AKA++E++C   VSCAD+LAFAARDS    GG+ Y VPA
Sbjct  95    PSEKYHVANFPTLRGFEVIDEAKAKIEAVCPNTVSCADVLAFAARDSANKVGGINYAVPA  154

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG IS   E AN LP   F+ ++L + F  +G + +EMVTLSGAH+IG +HC +F  
Sbjct  155   GRRDGFIS-RKEDANALPGFTFHAERLASEFGKRGLSVEEMVTLSGAHSIGIAHCPTFVG  213

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQ-------GSKDPNLVVQMDPATPAIFDVAYY  1179
             RLY+FNTT  QD SLDP YA  LK +CPQ       GS+ P+  V +D +TP   D  YY
Sbjct  214   RLYSFNTTHAQDPSLDPSYADYLKSKCPQPSSSGDDGSQQPD--VDLDFSTPHRLDNRYY  271

Query  1178  TNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEI  999
               +  +RGLL SDQTLL+   T+K V +NA    +W +KF  AMVKMGK+ VLTG+ GEI
Sbjct  272   IELKNHRGLLISDQTLLSSSLTSKMVLRNAHYGSKWATKFGKAMVKMGKIDVLTGSKGEI  331

Query  998   RANCRVVN  975
             R  C  VN
Sbjct  332   RRQCSFVN  339



>ref|XP_009411414.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   335 bits (859),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 218/304 (72%), Gaps = 11/304 (4%)
 Frame = -3

Query  1886  EAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST  1707
             +A+L+VG+Y   C AAEL+VK+EV KA   D GV A L+R+HFHDCFVRGCDGSVLIDST
Sbjct  24    DAQLKVGYYSYGCPAAELIVKEEVEKALIDDPGVGADLLRMHFHDCFVRGCDGSVLIDST  83

Query  1706  PANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
               N AEKD+   N +L GFE+ID  K +LE+ CKGVVSCAD+LAFAARDSV   GG+ Y 
Sbjct  84    EDNTAEKDAQI-NLTLEGFEIIDAIKEKLEAACKGVVSCADLLAFAARDSVVHYGGIHYR  142

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGR+DG +S   + +  LP+P  ++ +LT LF +KG +Q +M+TLSGAHT+G +HC +
Sbjct  143   VPAGRKDGTVSKEGDTS-ILPSPALDLTELTKLFISKGLSQNDMITLSGAHTVGIAHCDA  201

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             F++RLY+       D +LD  YA  L++QCP GS   N  V MDP +P  FD  YY ++L
Sbjct  202   FTDRLYD------TDETLDQKYAKALRKQCPPGS---NNTVSMDPKSPRRFDNHYYRSLL  252

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              NRGL  SDQTLL+   T  QV + A    R++ KFAAA+VKMG++G+LTG+ GE+RANC
Sbjct  253   KNRGLFISDQTLLSTQGTTTQVKRLASNYKRFQRKFAAAIVKMGEIGILTGSEGEVRANC  312

Query  986   RVVN  975
             R +N
Sbjct  313   RKIN  316



>ref|XP_010271091.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=345

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 209/303 (69%), Gaps = 4/303 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L++GFY  SC +AE  V+  V  A+  +R +A GL+R+HFHDCFVRGCDGSVL+DST  N
Sbjct  25    LEIGFYDKSCPSAEETVRQVVAGAYANNRRIAPGLIRMHFHDCFVRGCDGSVLLDSTLGN  84

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              +EK++  N  SL GF+VID AKA +E+ C GVVSCADILAFAARDS  + G + Y VPA
Sbjct  85    SSEKEAEPNR-SLHGFQVIDDAKAMVEAQCPGVVSCADILAFAARDSASLAGKIHYRVPA  143

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GRRDG +S+ SEV  N+P+P  N  +L   F  K  T  +MVTLSGAH++G +HC+SF N
Sbjct  144   GRRDGLVSIESEVITNIPSPLLNATELVGSFAAKNLTTADMVTLSGAHSVGVAHCSSFIN  203

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQG--SKDPNLVVQMDPATPAIFDVAYYTNVLA  1164
             RLYNF+ T   D +LDP+YA+ L+ +CP    S DP  VV +D  TPA+ D  YY  +  
Sbjct  204   RLYNFSDTDDIDPTLDPIYASILRSKCPSNVTSTDPT-VVSLDSLTPAVLDNMYYVGLQL  262

Query  1163  NRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCR  984
             NRGLLTSDQ LLT+ S    V  NA     W  KFA AMVKMG + VLTG+ GEIR NCR
Sbjct  263   NRGLLTSDQALLTETSLKDLVDLNAYYGKVWDWKFAKAMVKMGGIEVLTGSDGEIRKNCR  322

Query  983   VVN  975
             VVN
Sbjct  323   VVN  325



>ref|XP_002440653.1| hypothetical protein SORBIDRAFT_09g004660 [Sorghum bicolor]
 gb|EES19083.1| hypothetical protein SORBIDRAFT_09g004660 [Sorghum bicolor]
Length=363

 Score =   336 bits (862),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 210/312 (67%), Gaps = 9/312 (3%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L VGFY  +C  AE VV+  V  AF  + GVA  L+R+HFHDCFVRGCDGSVLIDST 
Sbjct  28    ACLDVGFYDQTCPTAETVVQQTVAAAFTNNSGVAPALIRMHFHDCFVRGCDGSVLIDSTA  87

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
              N AEKD+P NNPSLR F+V+D AKA LE+ C GVVSCAD+LAFAARDSV ++GGLGY V
Sbjct  88    NNTAEKDAPPNNPSLRFFDVVDSAKAALEAQCPGVVSCADVLAFAARDSVVLSGGLGYQV  147

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             PAGRRDG IS A+E  NNLP PFFN  QL   F +K  T +++V LSGAHT+G SHC+SF
Sbjct  148   PAGRRDGLISTATEALNNLPPPFFNATQLAASFASKNLTVEDLVVLSGAHTLGVSHCSSF  207

Query  1343  S------NRLYNFN-TTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMDPATPAIFD  1191
             +      +RLYNF+ ++ G D +L   YA  LK  CP  S    PN    MD  TP  FD
Sbjct  208   AGVGNLGDRLYNFSGSSDGTDPALSKAYAFLLKSICPSNSSQFFPNTTTFMDLITPEKFD  267

Query  1190  VAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGN  1011
               YY  +  N GL  SD  LLT+ +    V    R+   +++KFA +M+KMG++ VLTG 
Sbjct  268   NKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRTKFARSMLKMGQIEVLTGT  327

Query  1010  AGEIRANCRVVN  975
              GEIR NCRV+N
Sbjct  328   QGEIRLNCRVIN  339



>ref|XP_004977108.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=351

 Score =   335 bits (860),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 218/333 (65%), Gaps = 8/333 (2%)
 Frame = -3

Query  1964  MSSRNLSCCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGV  1785
             M+ R+LS  S LA    LLS   +   A L+VGFY  +C +AE VV+  V  AF  + GV
Sbjct  1     MARRSLSLASVLA---ALLSATAVC--ACLEVGFYDRTCPSAETVVQQTVAAAFRNNSGV  55

Query  1784  AAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICK  1605
             A  L+R+HFHDCFVRGCD SVLIDST  N AEKDSP NNPSLR F+V+D+AKA +E+ C 
Sbjct  56    APALIRLHFHDCFVRGCDCSVLIDSTANNTAEKDSPPNNPSLRFFDVVDRAKAAVEARCP  115

Query  1604  GVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLF  1425
             GVVSCAD+LAFAARD V + GGLGY VPAGRRDG +SLA+E  N LP P FN  +L   F
Sbjct  116   GVVSCADVLAFAARDGVALAGGLGYQVPAGRRDGRVSLAAEAFNELPPPSFNATELLDSF  175

Query  1424  CNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNF-NTTTGQDSSLDPLYAAKLKQQCPQ-  1251
              +K  T ++MV LSGAH+IG SHC  F +RLYN  NTT G D +L   YA  L+  CP+ 
Sbjct  176   ASKNLTLEDMVVLSGAHSIGVSHCIHFFDRLYNVTNTTDGIDPALSKAYAFLLQCICPRN  235

Query  1250  -GSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFR  1074
              G   PN    MD  TP   D  YY  +  N GL  SD  LLT+ +    V    R+   
Sbjct  236   TGQFFPNTTTFMDLITPTKLDNKYYVGLTNNLGLFQSDAALLTNATMKALVDSFIRSEAT  295

Query  1073  WKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             WKSKFA +MVKMG++GVL+G  GEIR NCR +N
Sbjct  296   WKSKFARSMVKMGQIGVLSGTQGEIRRNCRAIN  328



>emb|CDP04200.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 225/335 (67%), Gaps = 11/335 (3%)
 Frame = -3

Query  1949  LSCCSSLALTMILLSCHPIVLEAK-------LQVGFYRNSCRAAELVVKDEVRKAFFRDR  1791
             +S  +S +  +++LSC  I +E +       L+VGFY   C  AE +V+  V KA   + 
Sbjct  1     MSSSTSKSALLLMLSCL-IFIEFEFSLASPLLKVGFYNKYCPPAEAIVRKAVYKAVASNP  59

Query  1790  GVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKA-EKDSPANNPSLRGFEVIDKAKARLES  1614
               AAGL+R+HFHDCFVRGCDGSVL+D+ P   A EKDS  NNPSL GFEVID AKA +E+
Sbjct  60    RTAAGLIRMHFHDCFVRGCDGSVLLDTAPGGPAAEKDSIVNNPSLHGFEVIDAAKAEIEA  119

Query  1613  ICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLT  1434
              C   VSCADI+AFAARDS  I GG+ Y VPAGRRDG +SL+ EV  NLP PFFNV QL 
Sbjct  120   TCPKTVSCADIIAFAARDSALIAGGISYQVPAGRRDGSVSLSDEVIQNLPAPFFNVTQLE  179

Query  1433  TLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC-  1257
               F  KG +  EMVTLSGAH+IG +HC+SFSNRLYNF+ T  QD +LDP +AA LK  C 
Sbjct  180   ENFEAKGLSLDEMVTLSGAHSIGVAHCSSFSNRLYNFSATHPQDPALDPEHAAFLKTICP  239

Query  1256  -PQGSKDPNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAP  1080
              P  S   N    +D +TP   D  YY N+  +RGLLTSDQTLL+ PSTAKQV  NA   
Sbjct  240   PPSSSGSSNPTANLDVSTPFRLDNKYYVNLKYHRGLLTSDQTLLSSPSTAKQVWYNAVYG  299

Query  1079  FRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
               W +K+AAAMV MG + VLTG  GEIR NC  VN
Sbjct  300   SAWAAKYAAAMVHMGSIDVLTGKVGEIRRNCHFVN  334



>ref|XP_010674523.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 209/302 (69%), Gaps = 5/302 (2%)
 Frame = -3

Query  1871  VGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKA  1692
             VGFY+ +C +AE +V++ V  A  R+ G+ AGL+R+HFHDCFVRGCD S+L+DST  N +
Sbjct  37    VGFYQQTCPSAEEIVRNVVNNAVTRNPGLGAGLIRMHFHDCFVRGCDASILLDSTLENPS  96

Query  1691  EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGR  1512
             EK++ ANNPS+RG+EVID+AK +LE+ C  VVSCADI+AFAARDS    GG+ Y V +GR
Sbjct  97    EKENIANNPSMRGYEVIDEAKKQLEAQCPQVVSCADIIAFAARDSASKLGGINYGVESGR  156

Query  1511  RDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRL  1332
             RDG +SL  +   NLP PFFN++QL   F  KG + +EMV LSGAH+IG SHC+SF+ RL
Sbjct  157   RDGRVSLKDDPTQNLPPPFFNLNQLKENFERKGLSLEEMVILSGAHSIGVSHCSSFTQRL  216

Query  1331  YNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLV---VQMDPATPAIFDVAYYTNVLAN  1161
             Y+FN T  QD S+DP +A+ LK +C   S  PN V   V  D  TP   D  YY N+   
Sbjct  217   YSFNATHPQDPSMDPRFASMLKSKCLNNS--PNNVDPTVLQDFVTPNRLDNKYYQNLQNK  274

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             RGLLTSDQTL+T P TA  V         W +KFA AMV MG + VLTG  GEIR NCR+
Sbjct  275   RGLLTSDQTLVTSPETANMVRNYGGRSSDWANKFAKAMVHMGSIEVLTGIEGEIRKNCRI  334

Query  980   VN  975
             VN
Sbjct  335   VN  336



>gb|EYU39450.1| hypothetical protein MIMGU_mgv1a009721mg [Erythranthe guttata]
Length=333

 Score =   334 bits (857),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/304 (57%), Positives = 210/304 (69%), Gaps = 4/304 (1%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             KL+VGFY   C  AE++V+  V KA   + G+AAG++R+HFHDCFVRGCDGS+L+D+   
Sbjct  32    KLKVGFYAYKCPHAEIIVRKAVNKAVSLNPGLAAGIIRLHFHDCFVRGCDGSLLLDTVAG  91

Query  1700  NKA-EKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
               A EK++ AN PSLRGFEVID+AKA +E++C G VSCADILAFAARDS    G +GYDV
Sbjct  92    KPAAEKENVANFPSLRGFEVIDQAKADIEAVCPGTVSCADILAFAARDSSLKAGYIGYDV  151

Query  1523  PAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF  1344
             P+GRRDG +SL+SEV  NLP PFF+  QL   F  KG +  EMVTLSGAH+IG SHC++F
Sbjct  152   PSGRRDGRVSLSSEVLANLPPPFFSAAQLKENFKRKGLSLDEMVTLSGAHSIGVSHCSAF  211

Query  1343  SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK-DPNLVVQMDPATPAIFDVAYYTNVL  1167
             S RL  FN T  +D SLD  YAA LK +CP  +K DP   V  D  TP + D  YY N+ 
Sbjct  212   STRLSGFNATFDKDPSLDSGYAAFLKTKCPVPAKGDP--AVNNDFQTPTVLDNKYYVNLK  269

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
              ++GLLTSDQTL     T   V  N +    W  KFAAAMV MG + VLTG  GEIR NC
Sbjct  270   NHKGLLTSDQTLFDSSLTKNLVLNNVKYGSVWAKKFAAAMVHMGSIDVLTGKQGEIRKNC  329

Query  986   RVVN  975
             R+VN
Sbjct  330   RLVN  333



>gb|ACG35820.1| peroxidase 66 precursor [Zea mays]
Length=328

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 204/291 (70%), Gaps = 7/291 (2%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +LQVGFY   C AAE++V++EV KA   + GVAAGL+R+HFHDCFVRGCD SVL+DS+  
Sbjct  27    QLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDASVLLDSSAG  86

Query  1700  NKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
             N+AEKD+ A N SLRGFEVID AK RLE  C GVVSCAD+LAFAARD++ + GG  Y VP
Sbjct  87    NQAEKDA-APNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVP  145

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             AGRRDG++S   E   NLP P  +  QLT  F  KG +Q EMV LSGAHT+G + C+SF+
Sbjct  146   AGRRDGNVSSXQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFA  205

Query  1340  NRLYNFNTT-TGQDSSLDPLYAAKLKQQCP---QGSKDPNLVVQMDPATPAIFDVAYYTN  1173
              RLY++  +  GQD S+DP Y A L QQCP    G+ DP L   MDP TP  FD  YY N
Sbjct  206   PRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPL--PMDPVTPTAFDTNYYAN  263

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVL  1020
             ++A RGLL SDQ LL DP+TA QV     +P  +++ F  AM+KMG + VL
Sbjct  264   LVARRGLLASDQALLADPATAAQVLAYTNSPATFQTXFVXAMIKMGAIQVL  314



>ref|XP_002987767.1| hypothetical protein SELMODRAFT_126670 [Selaginella moellendorffii]
 gb|EFJ11070.1| hypothetical protein SELMODRAFT_126670 [Selaginella moellendorffii]
Length=334

 Score =   333 bits (855),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 170/310 (55%), Positives = 215/310 (69%), Gaps = 10/310 (3%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             K+QVGFY  +C  AE +VK+ V  A   +RG+AAGL+R+ FHDCFV+GCD SVLID+TP+
Sbjct  27    KIQVGFYSTTCPQAESIVKNVVSSAVSANRGLAAGLLRLQFHDCFVQGCDASVLIDTTPS  86

Query  1700  NK--AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
              K  AEKD+P N  +LRGFEVID AKA+LE+ C G VSCADILAFA RD+V   GG  +D
Sbjct  87    TKGGAEKDAPPNK-TLRGFEVIDAAKAQLEAKCPGTVSCADILAFATRDAVVQVGGPRWD  145

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSG------AHTIG  1365
             VPAGRRDG IS A+E  ++LP P F+++QLT  F  KG +Q  M+TLSG      +HTIG
Sbjct  146   VPAGRRDGRISSAAEATSSLPDPSFSINQLTQRFAAKGLSQDNMITLSGKTHHLSSHTIG  205

Query  1364  RSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVA  1185
              +HC +F NRLY F+++   D SLDP +A  LK QCP+ + +PN VV +DP TP  FD +
Sbjct  206   VAHCKTFINRLYGFSSSADTDPSLDPTFAQSLKAQCPRENPNPNTVVSLDP-TPNTFDNS  264

Query  1184  YYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAG  1005
             YY+N+   RGLL SD+ L TD ST   V+ N+     W  KF  AMVKM  + V TG+ G
Sbjct  265   YYSNLALGRGLLASDELLFTDGSTTLNVALNSFFGSTWLQKFPDAMVKMSLIEVKTGSQG  324

Query  1004  EIRANCRVVN  975
             EIR NCR +N
Sbjct  325   EIRKNCRRIN  334



>ref|XP_002452710.1| hypothetical protein SORBIDRAFT_04g031120 [Sorghum bicolor]
 gb|EES05686.1| hypothetical protein SORBIDRAFT_04g031120 [Sorghum bicolor]
Length=336

 Score =   333 bits (855),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 219/307 (71%), Gaps = 6/307 (2%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQVGFY++SC  AE +V++ VR+A  RD GVAAGL+R+HFHDCFVRGCD S+L+DSTP  
Sbjct  30    LQVGFYKHSCPQAEDMVRNAVRRAVARDPGVAAGLIRMHFHDCFVRGCDASILLDSTPGQ  89

Query  1697  ---KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
                +AEK SPAN PSLRGFEVID+AKA +E+ C   VSCADI+AFAARD   + GG+ Y 
Sbjct  90    PQQEAEKHSPANFPSLRGFEVIDEAKAIVEAHCPRTVSCADIVAFAARDGAYLAGGIDYR  149

Query  1526  VPAGRRDGHISLASEV-ANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             VPAGRRDG +S+  EV  +NLP P   V +L   F  KG +  +MVTLSGAH+IGRSHC+
Sbjct  150   VPAGRRDGRVSVKDEVLKDNLPFPDSTVAKLIESFRRKGLSADDMVTLSGAHSIGRSHCS  209

Query  1349  SFSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             S + RLY+F   TG+ D +L+P YAA LK++CP  ++D    V +D  TP  FD  Y+ N
Sbjct  210   SVTARLYSFLGETGRTDPALNPAYAADLKRRCPPSTED-RTTVPLDMVTPNTFDNQYFKN  268

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             VLA++   TSDQTLL  P TA  V+ +A     W++KFA AMVKMG + VLTG+ GEIR 
Sbjct  269   VLAHKVPFTSDQTLLDSPWTAGLVAFHAAVGQAWEAKFAKAMVKMGAIEVLTGHEGEIRQ  328

Query  992   NCRVVNH  972
              C +VN+
Sbjct  329   KCSMVNY  335



>ref|XP_004498110.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 206/302 (68%), Gaps = 1/302 (0%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY  +C +AE +V+  V KA   + G+ AGL+R+HFHDCFVRGCD SVL+ S P N
Sbjct  26    LEVGFYSYTCPSAETIVRSIVNKAVSDNPGIGAGLIRMHFHDCFVRGCDASVLLASIPGN  85

Query  1697  K-AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVP  1521
               AE+DS  NNPSLRGFEVID+AKA LE+ C   VSCADIL FAARDS    G + Y+VP
Sbjct  86    PTAERDSFVNNPSLRGFEVIDEAKAELEAKCPQTVSCADILTFAARDSALKLGNINYNVP  145

Query  1520  AGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             +GRRDG +S+A EV  N+P P FN D+L T F  KG ++ EMVTLSGAH+IG SHC+SFS
Sbjct  146   SGRRDGRVSIADEVPQNVPGPSFNADRLITTFAKKGLSKDEMVTLSGAHSIGVSHCSSFS  205

Query  1340  NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTNVLAN  1161
             NRLY+F+     D S+DP +   LK +CP+   + + +V +D  TP   D  YY  ++ +
Sbjct  206   NRLYSFDDANAIDPSMDPSFVELLKTKCPKPPSNIDPIVVLDAITPIRLDNVYYEGLINH  265

Query  1160  RGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRV  981
             +GLL SDQTLL+  ST + V  NA     W +KFA AMV MG + VLTG  GEIR  C  
Sbjct  266   QGLLGSDQTLLSSESTKEIVLSNANYGAHWATKFAEAMVHMGSIDVLTGYDGEIRKYCNF  325

Query  980   VN  975
             VN
Sbjct  326   VN  327



>ref|XP_002993742.1| hypothetical protein SELMODRAFT_137572 [Selaginella moellendorffii]
 gb|EFJ05161.1| hypothetical protein SELMODRAFT_137572 [Selaginella moellendorffii]
Length=337

 Score =   332 bits (851),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 215/313 (69%), Gaps = 13/313 (4%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             K+QVGFY  +C  AE +VK+ V  A   +RG+AAGL+R+ FHDCFV+GCD SVLIDSTP+
Sbjct  27    KIQVGFYSTTCPQAESIVKNVVSSAVSANRGLAAGLLRLQFHDCFVQGCDASVLIDSTPS  86

Query  1700  NK--AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYD  1527
              K  AEKD+P N  +LRGFEVID AKA++E+ C G VSCADILAFA RD+V   GG  +D
Sbjct  87    TKGGAEKDAPPNK-TLRGFEVIDAAKAQVEAKCPGTVSCADILAFATRDAVVQVGGPRWD  145

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSG---------AH  1374
             VPAGRRDG IS A+E  ++LP P F+++QLT  F  KG +Q  M+TLSG         +H
Sbjct  146   VPAGRRDGRISSAAEATSSLPDPSFSINQLTQRFAAKGLSQDNMITLSGKTHHLSSFQSH  205

Query  1373  TIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIF  1194
             TIG +HC +F NRLY F+++   D SLDP +A  LK QCP+ + +PN VV +DP TP  F
Sbjct  206   TIGVAHCKTFINRLYGFSSSADTDPSLDPTFAQSLKAQCPRENPNPNTVVSLDP-TPNTF  264

Query  1193  DVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTG  1014
             D +YY+N+   RGLL SD+ L TD ST   V+ N+     W  KF  AMVKM  + V TG
Sbjct  265   DNSYYSNLALGRGLLASDELLFTDGSTTLNVALNSFFGSTWLQKFPDAMVKMSLIEVKTG  324

Query  1013  NAGEIRANCRVVN  975
             + GEIR NCR +N
Sbjct  325   SQGEIRKNCRRIN  337



>ref|XP_002963661.1| hypothetical protein SELMODRAFT_266691 [Selaginella moellendorffii]
 gb|EFJ35532.1| hypothetical protein SELMODRAFT_266691 [Selaginella moellendorffii]
Length=325

 Score =   331 bits (849),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 206/307 (67%), Gaps = 1/307 (0%)
 Frame = -3

Query  1892  VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             V  ++L VGFY   C   E VV+  V+ A  R  GV AGL+R+ FHDCFV+GCD SVLID
Sbjct  19    VASSQLSVGFYEKQCPQVEAVVQSFVQDAITRKPGVGAGLLRLQFHDCFVQGCDASVLID  78

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             ST  N AEKD+P N  SLRGFEVID AKA LE+ C GVVSCADI+A+AARDSV   GG  
Sbjct  79    STKNNSAEKDAPPNI-SLRGFEVIDAAKAALETQCPGVVSCADIVAYAARDSVFKLGGPF  137

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             ++VP GRRDG IS   E   +LP PFFNV QLT  F  +G +Q +M+ LSGAHTIG +HC
Sbjct  138   WEVPVGRRDGTISRMKEANASLPAPFFNVAQLTQNFAAQGLSQDDMIVLSGAHTIGIAHC  197

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
              +FS RLYNF+     D +LDP +A  LK+QCP G       V +D  TP  FD +YY N
Sbjct  198   FTFSPRLYNFSANASTDPTLDPNFATALKKQCPPGKAAAFNSVVLDSHTPIHFDNSYYVN  257

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +   +G+L SDQ L +D +T+K +  ++     W++KFAAAM+KMG + V TG  GEIR 
Sbjct  258   LALQKGVLGSDQVLFSDAATSKAIKTSSVDEESWRAKFAAAMIKMGSVKVKTGQQGEIRK  317

Query  992   NCRVVNH  972
             +CR VNH
Sbjct  318   SCRAVNH  324



>ref|NP_001140982.1| uncharacterized protein LOC100273061 precursor [Zea mays]
 gb|ACF85102.1| unknown [Zea mays]
 gb|ACG36710.1| peroxidase 1 precursor [Zea mays]
Length=362

 Score =   331 bits (848),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 205/306 (67%), Gaps = 3/306 (1%)
 Frame = -3

Query  1883  AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTP  1704
             A L+VGFY  +C +AE +V+  V  AF  + G+AAGL+R+HFHDCFVRGCDGSVLIDST 
Sbjct  30    AGLKVGFYSKTCPSAESLVQQAVAAAFKNNSGIAAGLIRLHFHDCFVRGCDGSVLIDSTA  89

Query  1703  ANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITG-GLGYD  1527
              N AEKD+  NNPSLRGFEVID AK  +E+ C   VSCADILAFAARDS+ + G  L Y 
Sbjct  90    NNTAEKDAVPNNPSLRGFEVIDAAKKAVEARCPKTVSCADILAFAARDSIALAGNNLTYK  149

Query  1526  VPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTS  1347
             VPAGRRDG +S  ++  +NLP+P     +L   F  K  T ++MV LSGAHT+GRSHC+S
Sbjct  150   VPAGRRDGRVSRDTDANSNLPSPLSTAAELVGNFTRKNLTAEDMVVLSGAHTVGRSHCSS  209

Query  1346  FSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMDPATPAIFDVAYYTN  1173
             F+NRLY F+  +  D ++   YA  L+  CP  +    PN    MD  TPA+ D  YY  
Sbjct  210   FTNRLYGFSNASDVDPTISSAYALLLRAICPSNTSQFFPNTTTDMDLITPALLDNRYYVG  269

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             +  N GL TSDQ LLT+ +  K V    ++   WK+KFA +MVKMG + VLTG  GEIR 
Sbjct  270   LANNLGLFTSDQALLTNATLKKSVDAFVKSESAWKTKFAKSMVKMGNIDVLTGTKGEIRL  329

Query  992   NCRVVN  975
             NCRV+N
Sbjct  330   NCRVIN  335



>ref|XP_010553703.1| PREDICTED: peroxidase 5-like [Tarenaya hassleriana]
Length=329

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 206/306 (67%), Gaps = 3/306 (1%)
 Frame = -3

Query  1892  VLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLID  1713
             +  A L+VG+YR  C  AE +V+  V++A  RD GVAA L+R+HFHDCFVRGCD S+L+D
Sbjct  24    IASASLRVGYYRTRCPNAEAIVRKAVKRAMSRDPGVAAALIRMHFHDCFVRGCDASILLD  83

Query  1712  STPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLG  1533
             +TP N +EK++ AN PSLRGFEVID AK RLES C   VSCADIL FAARDSV  TGG  
Sbjct  84    TTPENASEKENAANTPSLRGFEVIDDAKRRLESRCSQTVSCADILTFAARDSVCETGGSH  143

Query  1532  YDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHC  1353
             Y VP+GRRDG +SL  E + +LP+P  +  QL   F  KG T  EMVTLSGAH+IG S C
Sbjct  144   YRVPSGRRDGRVSLKDEPSLHLPSPSLDAKQLEESFAKKGLTLDEMVTLSGAHSIGVSRC  203

Query  1352  TSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             +SFS RL++FN+T  QD SL+P  A  L+ +C     D +  V +D  TP   D  YY N
Sbjct  204   SSFSGRLFSFNSTHEQDPSLNPGLAKVLRSKC---RSDMDSTVDLDVKTPNRLDNEYYLN  260

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             ++    +LTSDQ+L+    TA+ V  NA     W  +FA AMVKMG + VLTG  GE+R 
Sbjct  261   LMNRNVVLTSDQSLMNSSETARMVRFNAENGRVWARRFARAMVKMGSIEVLTGFEGEVRK  320

Query  992   NCRVVN  975
             NCRVVN
Sbjct  321   NCRVVN  326



>ref|XP_007035579.1| Cationic peroxidase 2 precursor [Theobroma cacao]
 gb|EOY06505.1| Cationic peroxidase 2 precursor [Theobroma cacao]
Length=362

 Score =   329 bits (844),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 213/304 (70%), Gaps = 4/304 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L++GFY+ +C +AE +V   V+ A   D G+ A L+R+HFHDCFVRGCD S+L+DSTP+N
Sbjct  60    LKIGFYQKTCPSAEAIVMSTVKAALASDPGIPAALIRLHFHDCFVRGCDASILLDSTPSN  119

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
             +AEKDS   N  ++GF+VID+AKA++E+ C   VSC+DILAFAARDSV + GGL Y VP+
Sbjct  120   RAEKDS-MGNKGVQGFQVIDEAKAKIEAQCPNTVSCSDILAFAARDSVTLAGGLHYGVPS  178

Query  1517  GRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSN  1338
             GR DG +S A+EV  NLP  FFNV QL   F  KG + +EMVTLSGAH+IG SHC+SFS 
Sbjct  179   GRGDGRVSSAAEVTQNLPDAFFNVTQLKQNFARKGLSMEEMVTLSGAHSIGDSHCSSFSK  238

Query  1337  RLYNFNTTTGQDSSLDPLYAAKLKQQCPQ---GSKDPNLVVQMDPATPAIFDVAYYTNVL  1167
             RLY+F+ T+ QD S+DP YA  LK +CP+       P+ +V  DP TP   D  YY N+ 
Sbjct  239   RLYSFDKTSTQDPSMDPSYARLLKAKCPRPLNTRTGPDPLVPFDPVTPNRLDNNYYKNLK  298

Query  1166  ANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANC  987
             +++GLL SDQ L     T K V +N   P  W +KFAAAMV MG + VLTG  GEIR NC
Sbjct  299   SSKGLLASDQVLWNSMLTRKFVKENVNHPSAWAAKFAAAMVHMGSIDVLTGKQGEIRRNC  358

Query  986   RVVN  975
             RVVN
Sbjct  359   RVVN  362



>ref|XP_010914719.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=345

 Score =   328 bits (841),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 207/306 (68%), Gaps = 1/306 (0%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             +   LQ+GFY  SC  AE +V+  V  AF  + G+AAGL+R+HFHDCFVRGCD SVL+DS
Sbjct  20    VHGDLQIGFYNTSCPTAESLVQQAVAAAFANNSGIAAGLIRLHFHDCFVRGCDASVLLDS  79

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             T  N AEKD+P NNPSLRGFEVI  AK+ +E+ C   VSCADI+AFAARDS  + G + Y
Sbjct  80    TANNTAEKDAPPNNPSLRGFEVIAAAKSAVEAACPKTVSCADIVAFAARDSATLAGNISY  139

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VP+GRRDG++SLASE   N+P+P FN  QL   F  K  T  EMVTLSGAH+IG +HC+
Sbjct  140   QVPSGRRDGNVSLASEANANIPSPLFNATQLINSFAGKNLTTDEMVTLSGAHSIGVAHCS  199

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS-KDPNLVVQMDPATPAIFDVAYYTN  1173
             SF NR+YNF+ T+  D +L   YA  LK +CP  S +   + V +D  TP + D  YYT 
Sbjct  200   SFLNRIYNFSNTSDVDPTLSSAYADLLKNKCPSNSTRFTPITVSLDIITPTVLDNRYYTG  259

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRA  993
             V    GLLTSDQ L+T+ + +  V  NA     W SKFA AMVKMG + VLTG  GEIR 
Sbjct  260   VELTLGLLTSDQALVTEANLSAAVQDNANNSATWASKFAQAMVKMGLIEVLTGTQGEIRT  319

Query  992   NCRVVN  975
             NC VVN
Sbjct  320   NCSVVN  325



>ref|XP_003591355.1| Peroxidase [Medicago truncatula]
 gb|AES61606.1| cationic peroxidase [Medicago truncatula]
Length=342

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 220/328 (67%), Gaps = 11/328 (3%)
 Frame = -3

Query  1925  LTMILLSCHPIVLEA-KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDC  1749
             L +++LS    +  +  L+ GFY+ +C +AE +V+  V KA   + G+ AGL+R+HFHDC
Sbjct  13    LVIVILSVSTTLASSTSLKYGFYKTTCPSAEAIVRRAVNKAVSLNPGITAGLIRMHFHDC  72

Query  1748  FVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFA  1569
             FVRGCDGSVL+DS P  ++E+D PANNPSLRGFEVI++AKA++E+ C   VSCADILAFA
Sbjct  73    FVRGCDGSVLLDSIPGIRSERDHPANNPSLRGFEVINEAKAQIEAACPKTVSCADILAFA  132

Query  1568  ARDSV-EITGG-LGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEM  1395
             ARDS  +++GG + Y VP+GRRDG +S+  EV  NLP P F+ +QL   F  KG +  EM
Sbjct  133   ARDSARKVSGGRIDYSVPSGRRDGRVSIFDEVTQNLPPPTFSAEQLIDNFDRKGLSVDEM  192

Query  1394  VTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGS--------KD  1239
             VTLSGAH+IG SHC+SFS RLY+FN T  QD S+DP +A  L+ +CP           ++
Sbjct  193   VTLSGAHSIGVSHCSSFSKRLYSFNATFPQDPSMDPDFARLLRSKCPPPQSQQSQSQIQN  252

Query  1238  PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKF  1059
              +  V  D +TP   D  YY  +  NRGLLTSDQ L+    T + V +NAR    W  KF
Sbjct  253   LDSTVAFDGSTPNDLDNMYYKRLKNNRGLLTSDQILVNSGLTKRMVLKNARHAAIWNVKF  312

Query  1058  AAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             A AMV MG L VLTG+ GEIR  C VVN
Sbjct  313   AKAMVHMGNLDVLTGSQGEIREYCSVVN  340



>ref|XP_010674524.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=335

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 220/323 (68%), Gaps = 3/323 (1%)
 Frame = -3

Query  1940  CSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVH  1761
             C    L + L  C  I+  A L +G+Y+++C +AE +V+  V +A  +D G+ AGL+R+H
Sbjct  14    CLIFCLFLYLSLC--IISTATLDIGYYQSTCPSAEAIVRRAVNRAITQDPGLGAGLIRMH  71

Query  1760  FHDCFVRGCDGSVLIDSTPAN-KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCAD  1584
             FHDCFVRGCD S+L+DST +N  +EK+SPAN PSLRGFEVID+AKA LE IC   VSCAD
Sbjct  72    FHDCFVRGCDASILLDSTLSNPSSEKESPANGPSLRGFEVIDEAKAELEIICPRTVSCAD  131

Query  1583  ILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQ  1404
             ILAFAARDSV+  GG+ Y+VP+GR+DG IS+  E   N+P+P   V+QL  +F NKG   
Sbjct  132   ILAFAARDSVQELGGISYNVPSGRKDGTISIKDEATTNIPSPNSTVEQLQQMFSNKGLNL  191

Query  1403  KEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVV  1224
             +++V LSGAH+IG + C+ FS+RL+ FN T  QD S++  +A+++K +CP  +    + V
Sbjct  192   QDIVALSGAHSIGMTRCSLFSHRLHTFNATHLQDPSMEVKFASEMKDKCPSLAASEQVKV  251

Query  1223  QMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMV  1044
              +D  TP+  D  YY N++  RGLL SDQ L+  P T+K V + A+    W   F  AM 
Sbjct  252   PLDGLTPSRLDNKYYRNLVKGRGLLASDQALMDSPLTSKMVKRFAKYGRVWMPTFVDAMT  311

Query  1043  KMGKLGVLTGNAGEIRANCRVVN  975
             +MG + VLT + GE+R +CR+VN
Sbjct  312   RMGSIEVLTSSQGEVRRHCRIVN  334



>ref|XP_004977105.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=362

 Score =   327 bits (839),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 205/309 (66%), Gaps = 11/309 (4%)
 Frame = -3

Query  1868  GFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDST--PANK  1695
             GFY   C AAE +V+  V  AF  + GVA  L+R+HFHDCFVRGCDGSVLIDST  P N 
Sbjct  27    GFYDRMCPAAETIVQQTVADAFRNNSGVAPALIRLHFHDCFVRGCDGSVLIDSTTNPNNT  86

Query  1694  AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAG  1515
             AEKD+P NNPSLR F+VID+AKA +E+ C GVVSCADILAFAARDSV ++GGLGY +PAG
Sbjct  87    AEKDAPPNNPSLRFFDVIDRAKAAVEAQCPGVVSCADILAFAARDSVVLSGGLGYQLPAG  146

Query  1514  RRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSF---  1344
             RRDG IS  ++  N+LP PFFN  QL   F +K  T +++V LSGAHTIG SHC+SF   
Sbjct  147   RRDGRISRDTDALNDLPPPFFNATQLADSFASKNLTVEDLVVLSGAHTIGVSHCSSFAGV  206

Query  1343  ----SNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD--PNLVVQMDPATPAIFDVAY  1182
                 ++RLYNF++    D +L   YA  LK  CP  S    P     MD  TP   D  Y
Sbjct  207   PDNPADRLYNFSSPEKIDPALSKAYAFLLKSICPSNSSQFFPTTTTLMDLITPDKLDNKY  266

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             Y  +  N GL  SD  LLT+ +    V    R+   WK+KFA +M+KMG++GVLTG  GE
Sbjct  267   YVGLTNNLGLFISDAALLTNATMKALVDSFVRSEATWKAKFARSMLKMGQIGVLTGTQGE  326

Query  1001  IRANCRVVN  975
             IR NCRVVN
Sbjct  327   IRRNCRVVN  335



>emb|CAN71282.1| hypothetical protein VITISV_027092 [Vitis vinifera]
Length=329

 Score =   325 bits (834),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 204/296 (69%), Gaps = 2/296 (1%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             L + L+VGFY ++C +AE VV+  V KA  R+ G+AAGL+R+HFHDCFVRGCD SVL+DS
Sbjct  35    LSSSLKVGFYGSTCPSAEAVVRKTVDKAVSRNLGIAAGLIRMHFHDCFVRGCDASVLLDS  94

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             TP N +EK+ PANNPSLRGF+VI+KAKA+LE++C   VSCADI+AFAARDS    GG+ Y
Sbjct  95    TPGNLSEKEHPANNPSLRGFQVINKAKAKLEALCPETVSCADIIAFAARDSALKVGGINY  154

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VP GRRDG +S   EVA +LP P FN +QL   F  KG +  EMV LSGAH+IG SHC+
Sbjct  155   TVPGGRRDGRVSRKDEVAESLPPPHFNAEQLELRFARKGLSLDEMVXLSGAHSIGMSHCS  214

Query  1349  SFSNRLYNFNTTTGQDSSLDPLYAAKLKQQC-PQGSKDPNLVVQMDPATPAIFDVAYYTN  1173
             SFS RLY+ N T   D S+   Y + L+ +C PQ +   N  V ++  TP   D  YY  
Sbjct  215   SFSKRLYS-NGTHAHDPSMRRKYVSFLRTKCHPQRNGGQNPTVPLEAKTPGRLDNKYYKE  273

Query  1172  VLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAG  1005
             +  +RGLL SDQTL++  STA  V  NAR    W +KFAAAMV MG + VLT + G
Sbjct  274   LEKHRGLLNSDQTLMSSQSTAWMVRNNARHGSTWAAKFAAAMVHMGSIDVLTEDTG  329



>ref|XP_008649365.1| PREDICTED: peroxidase 5 [Zea mays]
 gb|AFW77214.1| peroxidase [Zea mays]
Length=360

 Score =   327 bits (837),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 170/330 (52%), Positives = 212/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  9     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  68

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  69    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAF  128

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VPAGRRDG IS  +E  NNLP PFFN  +L   F +K  T +++V
Sbjct  129   AARDSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLV  188

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  189   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  248

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  V MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  249   FFPNTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  308

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  309   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  338



>gb|AAS75401.1| peroxidase [Zea mays]
 gb|AAS75404.1| peroxidase [Zea mays]
 gb|AAS75406.1| peroxidase [Zea mays]
 gb|AAS75408.1| peroxidase [Zea mays]
 gb|AAS75409.1| peroxidase [Zea mays]
 gb|AAS75412.1| peroxidase [Zea mays]
 gb|AAS75416.1| peroxidase [Zea mays]
 gb|AAS75417.1| peroxidase [Zea mays]
 gb|AAS75420.1| peroxidase [Zea mays]
 gb|AAS75421.1| peroxidase [Zea mays]
 gb|AAS75424.1| peroxidase [Zea mays]
Length=357

 Score =   326 bits (836),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 170/330 (52%), Positives = 212/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  6     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  65

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  66    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VPAGRRDG IS  +E  NNLP PFFN  +L   F +K  T +++V
Sbjct  126   AARDSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLV  185

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  186   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  245

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  V MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  246   FFPNTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  305

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  306   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>gb|AAS75393.1| peroxidase [Zea mays]
 gb|AAS75407.1| peroxidase [Zea mays]
 gb|AAS75414.1| peroxidase [Zea mays]
 gb|AAS75415.1| peroxidase [Zea mays]
Length=357

 Score =   326 bits (836),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 170/330 (52%), Positives = 212/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  6     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  65

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  66    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKAALEAQCPGVVSCADVLAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VPAGRRDG IS  +E  NNLP PFFN  +L   F +K  T +++V
Sbjct  126   AARDSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLV  185

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  186   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  245

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  V MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  246   FFPNTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  305

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  306   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>ref|XP_008664057.1| PREDICTED: peroxidase 5-like [Zea mays]
Length=382

 Score =   327 bits (838),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 203/296 (69%), Gaps = 5/296 (2%)
 Frame = -3

Query  1847  RAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPANKAEKDSPANN  1668
             R AE +V+  VR+   R+ G+ A L+R+HFHDCFVRG DGS+LI+STP NKAEKDS ANN
Sbjct  84    RLAEDIVRHAVRRGIAREPGIGARLIRMHFHDCFVRGYDGSILINSTPGNKAEKDSVANN  143

Query  1667  PSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPAGRRDGHISLA  1488
             P++RGF++ID AKA LE+ C   VSCADI+AFAARDS  + GGL Y V +GRRDG +S  
Sbjct  144   PNMRGFDIIDDAKAVLEAHCPRTVSCADIVAFAARDSTYLAGGLDYKVSSGRRDGRVSKE  203

Query  1487  SEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTT  1311
              EV  NN+P P   VD+L   F  KG    +MVTLSGAHTIGRSHC+SF  RLYNF+   
Sbjct  204   EEVLDNNVPAPTDEVDELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSFMQRLYNFSGQL  263

Query  1310  GQ-DSSLDPLYAAKLKQQCPQGSKDPNL---VVQMDPATPAIFDVAYYTNVLANRGLLTS  1143
             GQ D SLDP+YA  LK +C   S D  +   VV +DP TPA FD  YY NVLA++ L  S
Sbjct  264   GQTDPSLDPVYAGHLKARCHWPSSDDQMDPTVVPLDPVTPATFDNQYYKNVLAHKVLFIS  323

Query  1142  DQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
               TLL +P TA  V  NA     W+ KFA AMVKMGK+ VLTG+ GEIR  C  VN
Sbjct  324   YNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIREKCFAVN  379



>ref|XP_011077167.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
 ref|XP_011077168.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
 ref|XP_011069438.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=327

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/326 (54%), Positives = 210/326 (64%), Gaps = 20/326 (6%)
 Frame = -3

Query  1916  ILLSCHPIVLE------AKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFH  1755
             ++LSC  + +         L+VGFY+ SC  AE +V+  V K    +RG+ AGLVR+HFH
Sbjct  10    VILSCFILFVSLTSAANPPLKVGFYKYSCPPAEAIVRKYVNKFVSLNRGLGAGLVRLHFH  69

Query  1754  DCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILA  1575
             DCFVRGCD SVL+D       EK S  N  SLRGFEVID AKA LE  C G+VSCADI+A
Sbjct  70    DCFVRGCDASVLLDGP---NTEKQSIPNKGSLRGFEVIDAAKAELELRCPGIVSCADIIA  126

Query  1574  FAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEM  1395
             FAARDS    G + YDVP+GRRDG++SL +E   NLP PFFN   L   F  KG +  EM
Sbjct  127   FAARDSSCKLGNINYDVPSGRRDGNVSLINEPLLNLPAPFFNATTLRDNFARKGLSLDEM  186

Query  1394  VTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCP----QGSKDPNL-  1230
             VTLSGAH+IG SHC+SF++RLY       QD +LDP YAA LK  CP      +  P + 
Sbjct  187   VTLSGAHSIGISHCSSFASRLY-----PTQDPTLDPSYAAFLKTICPPPVANATAAPTVD  241

Query  1229  -VVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAA  1053
               V +D  TP   D  YY  + ANRGLLTSDQ LL+ P TAK+V  NA+    W  KFAA
Sbjct  242   PTVNLDSITPTRLDSKYYVGLKANRGLLTSDQVLLSSPMTAKKVVYNAKYGNVWAKKFAA  301

Query  1052  AMVKMGKLGVLTGNAGEIRANCRVVN  975
             AMV+MG + VLTG  GEIR NCRVVN
Sbjct  302   AMVRMGNIEVLTGKQGEIRRNCRVVN  327



>ref|XP_008647554.1| PREDICTED: uncharacterized protein LOC100273479 isoform X1 [Zea 
mays]
 gb|AFW77217.1| hypothetical protein ZEAMMB73_709802 [Zea mays]
Length=343

 Score =   325 bits (833),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 215/331 (65%), Gaps = 25/331 (8%)
 Frame = -3

Query  1943  CCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRV  1764
             CC  +A  +  L    + + A L+ GFY  +C +AE +V+  V  AF  + GVA  L+R+
Sbjct  5     CCLVVATLLAAL----LSVSASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRM  60

Query  1763  HFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCAD  1584
             HFHDCFVRGCDGSVLIDST  NKAEKDS  N+PSLR F+V+D+AKA LE+ C GVVSCAD
Sbjct  61    HFHDCFVRGCDGSVLIDSTANNKAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCAD  120

Query  1583  ILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQ  1404
             ILAFAARDSV +TGGLGY VP+GRRDG IS A++  N LP PFFN  QL   F +K  + 
Sbjct  121   ILAFAARDSVVLTGGLGYKVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSL  180

Query  1403  KEMVTLSGAHTIGRSHCTSFS------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK  1242
             ++MV LSGAHTIG SHC+SF+      +RLYNF+ ++  D S+           CP  S 
Sbjct  181   EDMVVLSGAHTIGVSHCSSFAGINNTGDRLYNFSGSS--DGSI-----------CPSNSG  227

Query  1241  D--PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWK  1068
                PN    MD  TPA FD  YY  +  N GL  SD  LLT+ +    V    R+   WK
Sbjct  228   RFFPNTTTFMDLITPAKFDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRSEATWK  287

Query  1067  SKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             +KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  288   TKFAKSMLKMGQIEVLTGTQGEIRRNCRVIN  318



>gb|ACN36789.1| unknown [Zea mays]
Length=343

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 215/331 (65%), Gaps = 25/331 (8%)
 Frame = -3

Query  1943  CCSSLALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRV  1764
             CC  +A  +  L    + + A L+ GFY  +C +AE +V+  V  AF  + GVA  L+R+
Sbjct  5     CCLVVATLLAAL----LSVSASLEFGFYNKTCPSAETIVQQTVAAAFTNNSGVAPALLRM  60

Query  1763  HFHDCFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCAD  1584
             HFHDCFVRGCDGSVLIDST  NKAEKDS  N+PSLR F+V+D+AKA LE+ C GVVSCAD
Sbjct  61    HFHDCFVRGCDGSVLIDSTANNKAEKDSIPNSPSLRFFDVVDRAKASLEARCPGVVSCAD  120

Query  1583  ILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQ  1404
             ILAFAARDSV +TGGLGY VP+GRRDG IS A++  N LP PFFN  QL   F +K  + 
Sbjct  121   ILAFAARDSVVLTGGLGYKVPSGRRDGRISNATQALNELPPPFFNATQLVDNFASKNLSL  180

Query  1403  KEMVTLSGAHTIGRSHCTSFS------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK  1242
             ++MV LSGAHTIG SHC+SF+      +RLYNF+ ++  D S+           CP  S 
Sbjct  181   EDMVVLSGAHTIGVSHCSSFAGINNTGDRLYNFSGSS--DGSI-----------CPSNSG  227

Query  1241  D--PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWK  1068
                PN    MD  TPA FD  YY  +  N GL  SD  LLT+ +    V    R+   WK
Sbjct  228   RFFPNTTTFMDLITPAKFDNKYYVGLTNNLGLFESDAALLTNATMKALVDSFVRSEATWK  287

Query  1067  SKFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             +KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  288   TKFANSMLKMGRIEVLTGTQGEIRRNCRVIN  318



>gb|AAS75400.1| peroxidase [Zea mays]
 gb|AAS75402.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (833),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 212/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  6     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  65

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  66    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VPAGRRDG IS  +E  NNLP PFFN  +L   F +K  T +++V
Sbjct  126   AARDSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLV  185

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  186   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  245

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  + MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  246   FFPNTTLFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  305

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  306   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>gb|AAS75395.1| peroxidase [Zea mays]
 gb|AAS75397.1| peroxidase [Zea mays]
 gb|AAS75398.1| peroxidase [Zea mays]
 gb|AAS75399.1| peroxidase [Zea mays]
 gb|AAS75403.1| peroxidase [Zea mays]
 gb|AAS75405.1| peroxidase [Zea mays]
 gb|AAS75411.1| peroxidase [Zea mays]
 gb|AAS75418.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (833),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 212/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  6     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  65

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  66    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKAALEAQCPGVVSCADVLAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VPAGRRDG IS  +E  NNLP PFFN  +L   F +K  + +++V
Sbjct  126   AARDSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLSIEDLV  185

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  186   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  245

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  V MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  246   FFPNTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  305

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  306   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>gb|AAS75394.1| peroxidase [Zea mays]
 gb|AAS75396.1| peroxidase [Zea mays]
 gb|AAS75410.1| peroxidase [Zea mays]
 gb|AAS75413.1| peroxidase [Zea mays]
 gb|AAS75419.1| peroxidase [Zea mays]
 gb|AAS75422.1| peroxidase [Zea mays]
 gb|AAS75423.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (833),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 212/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  6     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  65

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  66    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VPAGRRDG IS  +E  NNLP PFFN  +L   F +K  + +++V
Sbjct  126   AARDSVVLSGGLGYQVPAGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLSIEDLV  185

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  186   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  245

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  V MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  246   FFPNTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  305

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  306   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>emb|CAC21393.1| peroxidase [Zea mays]
Length=357

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 211/330 (64%), Gaps = 11/330 (3%)
 Frame = -3

Query  1931  LALTMILLSCHPIVLEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHD  1752
             L  T +L +       A L VGFY  +C  AE +V+  V  AF  + GVA  L+R+HFHD
Sbjct  6     LRFTTVLATTLLSATAACLDVGFYDRTCPTAETIVQQTVAAAFRNNSGVAPALIRMHFHD  65

Query  1751  CFVRGCDGSVLIDSTPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAF  1572
             CFVRGCDGSVLID+     AEKD+P NNPSLR F+V+D+AKA LE+ C GVVSCAD+LAF
Sbjct  66    CFVRGCDGSVLIDTVGNLTAEKDAPPNNPSLRFFDVVDRAKASLEAQCPGVVSCADVLAF  125

Query  1571  AARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMV  1392
             AARDSV ++GGLGY VP GRRDG IS  +E  NNLP PFFN  +L   F +K  T +++V
Sbjct  126   AARDSVVLSGGLGYQVPGGRRDGRISNDTEALNNLPPPFFNATELADRFASKNLTIEDLV  185

Query  1391  TLSGAHTIGRSHCTSFS---------NRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKD  1239
              LSGAHTIG SHC+ F+         +RLYNF++  G D +L   YA  LK  CP  +  
Sbjct  186   VLSGAHTIGVSHCSGFAGPTDLNGPVDRLYNFSSPDGIDPTLSKAYAFLLKSICPANTSQ  245

Query  1238  --PNLVVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKS  1065
               PN  V MD  TP  FD  YY  +  N GL  SD  LLT+ +    V    R+   +++
Sbjct  246   FFPNTTVFMDLITPERFDNKYYVGLTNNLGLFKSDVALLTNATMKALVDSFVRSEATFRT  305

Query  1064  KFAAAMVKMGKLGVLTGNAGEIRANCRVVN  975
             KFA +M+KMG++ VLTG  GEIR NCRV+N
Sbjct  306   KFARSMIKMGQIEVLTGTQGEIRRNCRVIN  335



>gb|EMS47566.1| Peroxidase 5 [Triticum urartu]
Length=485

 Score =   328 bits (840),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 209/284 (74%), Gaps = 4/284 (1%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             L+VGFY+++C  AE +V+D VR+A  R+ G A GL+R+HFHDCFVRGCDGS+LI+STP N
Sbjct  35    LKVGFYKHTCPQAEDIVRDAVRRAVARNPGFAPGLIRMHFHDCFVRGCDGSLLINSTPGN  94

Query  1697  KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDVPA  1518
              AEKDS ANNPS+RGFEVID+AKA LE+ C   VSCAD+LAFAARD   + GG+ Y VP+
Sbjct  95    TAEKDSVANNPSMRGFEVIDEAKAALEASCPRTVSCADVLAFAARDGAYLAGGINYRVPS  154

Query  1517  GRRDGHISLASEVA-NNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCTSFS  1341
             GRRDGH+S+A EV  NN+P P   V QL   F  KG +  +MVTLSGAHTIGRSHC+SF+
Sbjct  155   GRRDGHVSIADEVLNNNVPPPTDEVAQLVASFKRKGLSADDMVTLSGAHTIGRSHCSSFT  214

Query  1340  NRLYNFNTTTGQ-DSSLDPLYAAKLKQQCPQGSKDPN--LVVQMDPATPAIFDVAYYTNV  1170
              R++NF+   G+ D S+D  YAA+L+++CP  + +P+    V +DP TP  FD  Y+ NV
Sbjct  215   QRIHNFSGEVGRTDPSIDKSYAAELRRRCPPSTDNPSDLTTVPLDPITPREFDNQYFKNV  274

Query  1169  LANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKM  1038
             LA +  LTSDQTLLT P TA  V+ +A     W+ +FAAAM+++
Sbjct  275   LARKVPLTSDQTLLTSPRTAGIVAFHASVEKAWRGQFAAAMLQV  318


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  1151  LTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGEIRAN  990
             LTSDQ LLT P TA+ V+ +A     W++KFA  MVK GK+ VL  + GEIR N
Sbjct  431   LTSDQMLLTSPRTARIVAFHAAVEKAWQAKFAVGMVKTGKVEVLISHVGEIREN  484



>ref|XP_002455568.1| hypothetical protein SORBIDRAFT_03g013220 [Sorghum bicolor]
 gb|EES00688.1| hypothetical protein SORBIDRAFT_03g013220 [Sorghum bicolor]
Length=371

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/317 (53%), Positives = 211/317 (67%), Gaps = 11/317 (3%)
 Frame = -3

Query  1889  LEAKLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDS  1710
             + A L+VGFY  SC +AE +V+  V  AF  D G+AAGL+R+HFHDCFVRGCDGSVLIDS
Sbjct  26    IAAGLKVGFYNKSCPSAEALVQQAVAAAFKNDSGIAAGLIRLHFHDCFVRGCDGSVLIDS  85

Query  1709  TPANKAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITG----  1542
             T  N AEKD+P NNPSLRGFEVID AKA +E+ C   VSCADILAFAARDSV ++     
Sbjct  86    TANNTAEKDAPPNNPSLRGFEVIDAAKAAIEAQCPKTVSCADILAFAARDSVALSSSSAS  145

Query  1541  ----GLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAH  1374
                  L Y VPAGRRDG +S  ++  +NLP+P     +L   F  K  T ++MV LSGAH
Sbjct  146   GSGKNLTYKVPAGRRDGRVSRDTDANSNLPSPLSTAAELVGNFTRKNLTAEDMVVLSGAH  205

Query  1373  TIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSK---DPNLVVQMDPATP  1203
             T+GRSHC+SF+NRLY F+  +  D ++   YA  L+  CP  +     PN    MD  TP
Sbjct  206   TVGRSHCSSFTNRLYGFSNGSDVDPAISSAYAFLLRSICPSNTTRFFPPNTTTDMDLITP  265

Query  1202  AIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGV  1023
             A+ D  YY  +  N GL TSDQ LLT+ +  K V +  ++  +WKSKFA +MVKMG + V
Sbjct  266   AVLDNKYYVGLTNNLGLFTSDQALLTNATLKKSVDEFVKSDSKWKSKFAKSMVKMGNIEV  325

Query  1022  LTGNAGEIRANCRVVNH  972
             LTG  GEIR +CRV+N+
Sbjct  326   LTGTQGEIRLSCRVINN  342



>ref|NP_001136740.1| uncharacterized protein LOC100216881 precursor [Zea mays]
 gb|ACF82515.1| unknown [Zea mays]
 gb|AFW72903.1| hypothetical protein ZEAMMB73_932177 [Zea mays]
Length=337

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 210/310 (68%), Gaps = 8/310 (3%)
 Frame = -3

Query  1877  LQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPAN  1698
             LQVGFY +SC  AE +V++ VR+A  RD G+AAGL+R+HFHDCFVRGCD S+L+DS P  
Sbjct  27    LQVGFYEHSCPQAEDIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDASILLDSAPGQ  86

Query  1697  K--AEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGYDV  1524
             +   EK SPAN  SLRGFEVID+AKA +E  C   VSCADI+AFAARD   + GG+ Y V
Sbjct  87    QHDTEKYSPANFQSLRGFEVIDEAKAVVEEHCPRTVSCADIVAFAARDGAYLAGGIDYRV  146

Query  1523  PAGRRDGHISLASEVAN--NLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
             PAGRRDG +S+  EV    NLP P F V +L   F  KG +  +MVTLSGAH+IGRSHC+
Sbjct  147   PAGRRDGRVSVKDEVLEDGNLPFPEFTVAELIENFRRKGLSADDMVTLSGAHSIGRSHCS  206

Query  1349  SFSNRLYNFNTTTGQ-DSSLDPLYAAKLKQQCP---QGSKDPNLVVQMDPATPAIFDVAY  1182
             S ++RLY+F    G+ D +L P YAA LK++CP    G  +    V +D  TP  FD  Y
Sbjct  207   SITDRLYSFQGEPGRTDPALHPAYAADLKRRCPPSTDGDMEDRTTVPLDTVTPNAFDNQY  266

Query  1181  YTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVLTGNAGE  1002
             + NVL ++   TSDQTLL  P TA  V+ +A     W++KFA AMVKMG + VLTG  GE
Sbjct  267   FKNVLEHKVPFTSDQTLLDSPWTAGLVAFHAAVGQAWEAKFAKAMVKMGAIEVLTGYEGE  326

Query  1001  IRANCRVVNH  972
             IR  C +VN+
Sbjct  327   IRQKCSMVNY  336



>ref|XP_009387798.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=261

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 194/265 (73%), Gaps = 5/265 (2%)
 Frame = -3

Query  1766  VHFHDCFVRGCDGSVLIDSTPANKAEKDS-PANNPSLRGFEVIDKAKARLESICKGVVSC  1590
             +HFHDCFVRGCDGS+L+DST  N AEKD+ P        F+VIDKAK +LE +CKG VSC
Sbjct  1     MHFHDCFVRGCDGSILLDSTKKNTAEKDAIPNRTLEDEAFQVIDKAKKKLEKVCKGTVSC  60

Query  1589  ADILAFAARDSVEITGGLGYDVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGF  1410
             ADILAFAARDSV   GG  Y VPAGRRDG IS +S+  + LP P FN+ QLT  F +KG 
Sbjct  61    ADILAFAARDSVAHYGGTFYAVPAGRRDGKISRSSDTID-LPPPTFNLIQLTNSFASKGM  119

Query  1409  TQKEMVTLSGAHTIGRSHCTSFSNRLYNFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNL  1230
             +Q +M+TLSGAHTIG +HC + SNRLYNF+     D +L+P YA +LK++CP GS   N 
Sbjct  120   SQDDMITLSGAHTIGEAHCPTVSNRLYNFSRKASTDPTLNPKYAYQLKRECPPGS---NN  176

Query  1229  VVQMDPATPAIFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAA  1050
              V MDP +P  FD +YY+N+L NRGL TSDQTL++ P+TA +V Q A +   +K KFAAA
Sbjct  177   EVDMDPPSPLTFDTSYYSNLLDNRGLFTSDQTLMSTPATAGKVRQLAGSSVLFKQKFAAA  236

Query  1049  MVKMGKLGVLTGNAGEIRANCRVVN  975
             MVKMGK+GVLTG  GEIR  CRVVN
Sbjct  237   MVKMGKIGVLTGEQGEIRNYCRVVN  261



>ref|XP_003558948.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=338

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 217/315 (69%), Gaps = 17/315 (5%)
 Frame = -3

Query  1880  KLQVGFYRNSCRAAELVVKDEVRKAFFRDRGVAAGLVRVHFHDCFVRGCDGSVLIDSTPA  1701
             +LQ+GFY  SC  AE++V+DEV +A   D G+AAGL+R+HFHDCFV+GCD SVL+D+   
Sbjct  28    QLQLGFYAQSCPQAEVIVRDEVGRAVSGDPGLAAGLLRLHFHDCFVKGCDASVLLDTIAG  87

Query  1700  N---KAEKDSPANNPSLRGFEVIDKAKARLESICKGVVSCADILAFAARDSVEITGGLGY  1530
             N    AEKD+ A N +LRGFEVID AK RLES C G VSCADILAFAARDSV +TGG  Y
Sbjct  88    NGSTAAEKDA-APNRTLRGFEVIDGAKKRLESACAGTVSCADILAFAARDSVVLTGGSPY  146

Query  1529  DVPAGRRDGHISLASEVANNLPTPFFNVDQLTTLFCNKGFTQKEMVTLSGAHTIGRSHCT  1350
              VPAGRRDG+ S AS+   +LP P  NV QLT +F   G +Q++MVTLSGAHTIG +HC+
Sbjct  147   GVPAGRRDGNESSASDAQASLPPPTANVAQLTQIFARNGLSQEDMVTLSGAHTIGVTHCS  206

Query  1349  SFSNRLY----NFNTTTGQDSSLDPLYAAKLKQQCPQGSKDPNLVVQMD------PATPA  1200
             SFS RLY    N +  TG D ++D   A +L ++CP GS D    V MD      P    
Sbjct  207   SFSARLYSGDNNNSDNTGHDPAMDDATATELARRCPPGSAD---TVPMDLGGGGGPVDEN  263

Query  1199  IFDVAYYTNVLANRGLLTSDQTLLTDPSTAKQVSQNARAPFRWKSKFAAAMVKMGKLGVL  1020
              FD  Y+  +LA+RGLL SDQ L  D +TA  V+QNA   + + ++FA AMV+MG + VL
Sbjct  264   AFDTGYFQALLAHRGLLGSDQALTADNATAALVAQNAGNLYLFVTRFADAMVRMGAVRVL  323

Query  1019  TGNAGEIRANCRVVN  975
             TG+ G+IR +CRVVN
Sbjct  324   TGSDGQIRTSCRVVN  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6943370728410