BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21052_g2_i2 len=1818 path=[5952:0-1146 7099:1147-1239
7192:1240-1817]

Length=1818
                                                                      Score     E

ref|XP_004237406.1|  PREDICTED: probable trehalose-phosphate phos...    564   0.0      
ref|XP_011097592.1|  PREDICTED: probable trehalose-phosphate phos...    561   0.0      
ref|XP_009595324.1|  PREDICTED: probable trehalose-phosphate phos...    560   0.0      
ref|XP_006355362.1|  PREDICTED: probable trehalose-phosphate phos...    552   0.0      
ref|XP_009775195.1|  PREDICTED: probable trehalose-phosphate phos...    550   0.0      
ref|XP_009613560.1|  PREDICTED: probable trehalose-phosphate phos...    550   0.0      
ref|XP_002533145.1|  trehalose-6-phosphate synthase, putative           546   0.0      Ricinus communis
ref|XP_004288217.1|  PREDICTED: probable trehalose-phosphate phos...    546   0.0      
ref|XP_002310573.1|  trehalose-6-phosphate phosphatase family pro...    545   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009797815.1|  PREDICTED: probable trehalose-phosphate phos...    545   0.0      
ref|XP_011090521.1|  PREDICTED: probable trehalose-phosphate phos...    543   0.0      
ref|XP_009797816.1|  PREDICTED: probable trehalose-phosphate phos...    543   0.0      
ref|XP_011022771.1|  PREDICTED: probable trehalose-phosphate phos...    541   0.0      
gb|EYU24005.1|  hypothetical protein MIMGU_mgv1a007720mg                542   0.0      
ref|XP_011022770.1|  PREDICTED: probable trehalose-phosphate phos...    536   0.0      
ref|XP_002307096.1|  trehalose-6-phosphate phosphatase family pro...    536   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU31023.1|  hypothetical protein MIMGU_mgv1a008338mg                535   0.0      
emb|CDP01436.1|  unnamed protein product                                535   0.0      
gb|KDP46861.1|  hypothetical protein JCGZ_24070                         534   0.0      
ref|XP_006601938.1|  PREDICTED: probable trehalose-phosphate phos...    531   0.0      
ref|XP_011030992.1|  PREDICTED: probable trehalose-phosphate phos...    530   0.0      
ref|XP_007205367.1|  hypothetical protein PRUPE_ppa007221mg             530   0.0      
ref|XP_010027843.1|  PREDICTED: probable trehalose-phosphate phos...    526   8e-180   
ref|XP_010519807.1|  PREDICTED: probable trehalose-phosphate phos...    524   4e-179   
ref|XP_010546407.1|  PREDICTED: probable trehalose-phosphate phos...    524   4e-179   
ref|XP_010519815.1|  PREDICTED: probable trehalose-phosphate phos...    524   4e-179   
ref|XP_007047993.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    523   7e-179   
gb|KHG13010.1|  Trehalose-phosphate phosphatase                         521   3e-178   
ref|XP_006591511.1|  PREDICTED: probable trehalose-phosphate phos...    521   4e-178   
ref|XP_007163639.1|  hypothetical protein PHAVU_001G251300g             519   3e-177   
ref|XP_007159639.1|  hypothetical protein PHAVU_002G254600g             516   3e-176   
ref|XP_004502438.1|  PREDICTED: probable trehalose-phosphate phos...    516   4e-176   
gb|KHG28413.1|  Trehalose-phosphate phosphatase                         516   7e-176   
ref|XP_002263078.1|  PREDICTED: probable trehalose-phosphate phos...    512   1e-174   Vitis vinifera
ref|XP_004146870.1|  PREDICTED: probable trehalose-phosphate phos...    513   2e-174   
ref|XP_008453786.1|  PREDICTED: probable trehalose-phosphate phos...    512   2e-174   
gb|KEH20856.1|  trehalose-phosphate phosphatase                         511   4e-174   
ref|XP_010680570.1|  PREDICTED: probable trehalose-phosphate phos...    510   8e-174   
ref|XP_008345555.1|  PREDICTED: probable trehalose-phosphate phos...    509   3e-173   
ref|XP_008453785.1|  PREDICTED: probable trehalose-phosphate phos...    508   1e-172   
ref|XP_010261265.1|  PREDICTED: probable trehalose-phosphate phos...    508   2e-172   
ref|XP_010547623.1|  PREDICTED: probable trehalose-phosphate phos...    506   6e-172   
gb|KCW54475.1|  hypothetical protein EUGRSUZ_I00423                     504   3e-171   
ref|XP_010027842.1|  PREDICTED: probable trehalose-phosphate phos...    504   3e-171   
ref|XP_010547624.1|  PREDICTED: probable trehalose-phosphate phos...    503   4e-171   
ref|XP_006366536.1|  PREDICTED: probable trehalose-phosphate phos...    503   6e-171   
ref|XP_003532832.1|  PREDICTED: probable trehalose-phosphate phos...    501   4e-170   
ref|XP_002284201.1|  PREDICTED: probable trehalose-phosphate phos...    497   1e-168   Vitis vinifera
ref|XP_010269219.1|  PREDICTED: probable trehalose-phosphate phos...    496   2e-168   
ref|XP_004502437.1|  PREDICTED: probable trehalose-phosphate phos...    496   4e-168   
ref|XP_003524269.1|  PREDICTED: probable trehalose-phosphate phos...    494   2e-167   
gb|KHN44334.1|  Trehalose-phosphate phosphatase                         493   2e-167   
ref|XP_004143475.1|  PREDICTED: probable trehalose-phosphate phos...    494   3e-167   
ref|XP_010484318.1|  PREDICTED: probable trehalose-phosphate phos...    491   3e-166   
ref|XP_006280660.1|  hypothetical protein CARUB_v10026620mg             491   3e-166   
ref|XP_004504060.1|  PREDICTED: probable trehalose-phosphate phos...    490   4e-166   
ref|XP_006399500.1|  hypothetical protein EUTSA_v10013874mg             489   9e-166   
gb|KHF97975.1|  Trehalose-phosphate phosphatase                         489   1e-165   
ref|XP_004504061.1|  PREDICTED: probable trehalose-phosphate phos...    489   1e-165   
ref|XP_010444490.1|  PREDICTED: probable trehalose-phosphate phos...    489   1e-165   
ref|XP_010462232.1|  PREDICTED: probable trehalose-phosphate phos...    488   3e-165   
ref|XP_010939628.1|  PREDICTED: probable trehalose-phosphate phos...    489   3e-165   
ref|XP_008440611.1|  PREDICTED: probable trehalose-phosphate phos...    488   6e-165   
ref|XP_010321465.1|  PREDICTED: probable trehalose-phosphate phos...    486   9e-165   
ref|XP_006394074.1|  hypothetical protein EUTSA_v10004405mg             486   3e-164   
ref|XP_007018810.1|  Haloacid dehalogenase-like hydrolase superfa...    485   6e-164   
ref|XP_009109445.1|  PREDICTED: probable trehalose-phosphate phos...    483   8e-164   
ref|XP_010422893.1|  PREDICTED: probable trehalose-phosphate phos...    484   1e-163   
ref|XP_009373162.1|  PREDICTED: probable trehalose-phosphate phos...    484   1e-163   
ref|XP_009109444.1|  PREDICTED: probable trehalose-phosphate phos...    483   1e-163   
ref|NP_195687.2|  probable trehalose-phosphate phosphatase H            483   1e-163   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90361.1|  BnaA08g16230D                                          483   2e-163   
ref|XP_008391072.1|  PREDICTED: LOW QUALITY PROTEIN: probable tre...    484   2e-163   
ref|XP_006287992.1|  hypothetical protein CARUB_v10001225mg             484   2e-163   
ref|NP_196572.2|  probable trehalose-phosphate phosphatase I            483   3e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127222.1|  PREDICTED: probable trehalose-phosphate phos...    482   3e-163   
ref|XP_010491663.1|  PREDICTED: probable trehalose-phosphate phos...    483   3e-163   
ref|XP_002868927.1|  predicted protein                                  482   4e-163   
ref|XP_008790818.1|  PREDICTED: probable trehalose-phosphate phos...    483   5e-163   
ref|XP_006411773.1|  hypothetical protein EUTSA_v10025622mg             481   6e-163   
ref|XP_010437099.1|  PREDICTED: probable trehalose-phosphate phos...    481   9e-163   
ref|XP_008782128.1|  PREDICTED: probable trehalose-phosphate phos...    482   2e-162   
ref|XP_010431963.1|  PREDICTED: probable trehalose-phosphate phos...    480   2e-162   
ref|XP_002866651.1|  hypothetical protein ARALYDRAFT_919840             481   2e-162   
gb|KHN29076.1|  Trehalose-phosphate phosphatase                         480   2e-162   
ref|XP_009150597.1|  PREDICTED: probable trehalose-phosphate phos...    481   3e-162   
ref|XP_010937497.1|  PREDICTED: probable trehalose-phosphate phos...    481   4e-162   
ref|XP_011016253.1|  PREDICTED: probable trehalose-phosphate phos...    480   5e-162   
ref|XP_009369663.1|  PREDICTED: probable trehalose-phosphate phos...    480   7e-162   
ref|XP_010446535.1|  PREDICTED: probable trehalose-phosphate phos...    479   7e-162   
ref|XP_009131141.1|  PREDICTED: probable trehalose-phosphate phos...    479   9e-162   
ref|XP_010453031.1|  PREDICTED: probable trehalose-phosphate phos...    480   1e-161   
ref|XP_008808174.1|  PREDICTED: probable trehalose-phosphate phos...    478   3e-161   
ref|XP_008375355.1|  PREDICTED: probable trehalose-phosphate phos...    479   5e-161   
ref|XP_009101850.1|  PREDICTED: probable trehalose-phosphate phos...    476   5e-161   
ref|XP_009101851.1|  PREDICTED: probable trehalose-phosphate phos...    476   6e-161   
ref|XP_006286088.1|  hypothetical protein CARUB_v10007631mg             476   7e-161   
ref|NP_201319.2|  probable trehalose-phosphate phosphatase J            477   9e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008375418.1|  PREDICTED: probable trehalose-phosphate phos...    476   3e-160   
ref|XP_002301043.2|  hypothetical protein POPTR_0002s09510g             476   3e-160   Populus trichocarpa [western balsam poplar]
ref|XP_008795570.1|  PREDICTED: probable trehalose-phosphate phos...    476   5e-160   
ref|XP_009122088.1|  PREDICTED: probable trehalose-phosphate phos...    474   1e-159   
ref|XP_010102586.1|  putative glycosyl hydrolase                        477   2e-159   
emb|CDY22393.1|  BnaA06g37150D                                          474   2e-159   
emb|CDX72676.1|  BnaC07g46980D                                          474   2e-159   
ref|XP_009587491.1|  PREDICTED: probable trehalose-phosphate phos...    473   2e-159   
ref|XP_010472213.1|  PREDICTED: probable trehalose-phosphate phos...    473   3e-159   
ref|XP_009130492.1|  PREDICTED: probable trehalose-phosphate phos...    473   3e-159   
gb|KFK28197.1|  hypothetical protein AALP_AA8G485000                    471   6e-159   
ref|XP_010926273.1|  PREDICTED: probable trehalose-phosphate phos...    473   7e-159   
ref|XP_009779130.1|  PREDICTED: probable trehalose-phosphate phos...    472   9e-159   
ref|XP_010916894.1|  PREDICTED: probable trehalose-phosphate phos...    472   1e-158   
ref|XP_010416975.1|  PREDICTED: probable trehalose-phosphate phos...    471   1e-158   
emb|CDP01035.1|  unnamed protein product                                471   2e-158   
ref|XP_002513897.1|  trehalose-6-phosphate synthase, putative           471   2e-158   Ricinus communis
ref|XP_011099372.1|  PREDICTED: probable trehalose-phosphate phos...    470   4e-158   
gb|ACK44515.1|  AT5G10100-like protein                                  470   5e-158   Arabidopsis arenosa
ref|XP_008234617.1|  PREDICTED: probable trehalose-phosphate phos...    469   5e-158   
ref|XP_009122089.1|  PREDICTED: probable trehalose-phosphate phos...    469   5e-158   
ref|XP_004299611.1|  PREDICTED: probable trehalose-phosphate phos...    470   6e-158   
ref|NP_179809.2|  probable trehalose-phosphate phosphatase E            469   8e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555351.1|  PREDICTED: probable trehalose-phosphate phos...    467   3e-157   
ref|XP_006472627.1|  PREDICTED: probable trehalose-phosphate phos...    468   3e-157   
ref|XP_008219665.1|  PREDICTED: probable trehalose-phosphate phos...    468   4e-157   
ref|XP_006434015.1|  hypothetical protein CICLE_v10001513mg             468   5e-157   
ref|XP_007224341.1|  hypothetical protein PRUPE_ppa020645mg             467   8e-157   
ref|XP_006428167.1|  hypothetical protein CICLE_v10025685mg             469   9e-157   
ref|XP_002871404.1|  hypothetical protein ARALYDRAFT_350217             466   1e-156   
ref|XP_010429136.1|  PREDICTED: probable trehalose-phosphate phos...    466   2e-156   
gb|KFK30542.1|  hypothetical protein AALP_AA7G275800                    464   5e-156   
ref|XP_009387126.1|  PREDICTED: probable trehalose-phosphate phos...    463   2e-155   
ref|XP_007018811.1|  Haloacid dehalogenase-like hydrolase superfa...    462   3e-155   
ref|XP_011043568.1|  PREDICTED: probable trehalose-phosphate phos...    463   3e-155   
ref|XP_006464217.1|  PREDICTED: probable trehalose-phosphate phos...    463   3e-155   
ref|NP_001190271.1|  probable trehalose-phosphate phosphatase I         462   3e-155   
emb|CAB92051.1|  trehalose-6-phosphate phosphatase-like protein         462   4e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004237894.1|  PREDICTED: probable trehalose-phosphate phos...    462   5e-155   
ref|XP_006428166.1|  hypothetical protein CICLE_v10025685mg             462   1e-154   
ref|XP_006353999.1|  PREDICTED: probable trehalose-phosphate phos...    461   1e-154   
dbj|BAB11650.1|  trehalose-6-phosphate phosphatase                      461   2e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003527912.1|  PREDICTED: probable trehalose-phosphate phos...    461   2e-154   
emb|CDY08815.1|  BnaA06g24090D                                          460   4e-154   
ref|XP_006826948.1|  hypothetical protein AMTR_s00010p00186780          461   5e-154   
ref|XP_003523824.2|  PREDICTED: probable trehalose-phosphate phos...    459   7e-154   
ref|XP_009380850.1|  PREDICTED: probable trehalose-phosphate phos...    459   9e-154   
gb|AAZ66928.1|  117M18_9                                                459   1e-153   Brassica rapa
sp|Q6ZAL2.1|TPP6_ORYSJ  RecName: Full=Probable trehalose-phosphat...    457   3e-153   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06967.1|  hypothetical protein OsI_29208                          457   4e-153   Oryza sativa Indica Group [Indian rice]
gb|KHN06593.1|  Trehalose-phosphate phosphatase                         454   4e-153   
ref|XP_010453030.1|  PREDICTED: probable trehalose-phosphate phos...    454   1e-152   
ref|XP_006404674.1|  hypothetical protein EUTSA_v10000217mg             456   1e-152   
gb|KDP41360.1|  hypothetical protein JCGZ_15767                         456   2e-152   
ref|XP_002880434.1|  trehalose-phosphatase                              455   2e-152   
gb|EPS68990.1|  hypothetical protein M569_05778                         451   6e-152   
ref|XP_006434014.1|  hypothetical protein CICLE_v10001513mg             454   6e-152   
ref|XP_007141163.1|  hypothetical protein PHAVU_008G172400g             453   1e-151   
ref|XP_006581545.1|  PREDICTED: probable trehalose-phosphate phos...    454   2e-151   
ref|XP_009140332.1|  PREDICTED: probable trehalose-phosphate phos...    453   2e-151   
gb|KDO56609.1|  hypothetical protein CISIN_1g020273mg                   451   2e-151   
ref|XP_009398164.1|  PREDICTED: probable trehalose-phosphate phos...    454   2e-151   
tpg|DAA49101.1|  TPA: hypothetical protein ZEAMMB73_457766              452   3e-151   
ref|XP_010531388.1|  PREDICTED: probable trehalose-phosphate phos...    451   4e-151   
ref|XP_003543766.1|  PREDICTED: probable trehalose-phosphate phos...    452   4e-151   
gb|AAZ67593.1|  80A08_8                                                 452   6e-151   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010321466.1|  PREDICTED: probable trehalose-phosphate phos...    450   7e-151   
ref|XP_010105898.1|  Trehalose-phosphate phosphatase                    451   9e-151   
gb|EYU23217.1|  hypothetical protein MIMGU_mgv1a023678mg                450   1e-150   
ref|XP_003574465.1|  PREDICTED: probable trehalose-phosphate phos...    451   1e-150   
emb|CDY14544.1|  BnaC03g49150D                                          453   2e-150   
emb|CDY31283.1|  BnaA02g34580D                                          450   3e-150   
ref|XP_006294548.1|  hypothetical protein CARUB_v10023582mg             447   1e-149   
ref|NP_001048143.1|  Os02g0753000                                       448   2e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003544198.1|  PREDICTED: probable trehalose-phosphate phos...    448   3e-149   
ref|XP_002454258.1|  hypothetical protein SORBIDRAFT_04g027650          446   5e-149   Sorghum bicolor [broomcorn]
gb|EEC71779.1|  hypothetical protein OsI_04393                          446   7e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_011074162.1|  PREDICTED: probable trehalose-phosphate phos...    446   7e-149   
ref|XP_004973406.1|  PREDICTED: probable trehalose-phosphate phos...    446   2e-148   
ref|XP_004953949.1|  PREDICTED: probable trehalose-phosphate phos...    445   2e-148   
ref|NP_001142999.1|  uncharacterized protein LOC100275460               445   2e-148   Zea mays [maize]
ref|XP_010544184.1|  PREDICTED: probable trehalose-phosphate phos...    445   3e-148   
gb|EMT32785.1|  Trehalose-phosphate phosphatase                         443   5e-148   
ref|XP_004513754.1|  PREDICTED: probable trehalose-phosphate phos...    444   1e-147   
gb|EAZ42700.1|  hypothetical protein OsJ_27268                          441   1e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010059987.1|  PREDICTED: probable trehalose-phosphate phos...    444   2e-147   
dbj|BAJ88024.1|  predicted protein                                      443   2e-147   
dbj|BAJ96268.1|  predicted protein                                      443   2e-147   
ref|XP_002307388.2|  hypothetical protein POPTR_0005s16910g             441   4e-147   Populus trichocarpa [western balsam poplar]
ref|XP_002444320.1|  hypothetical protein SORBIDRAFT_07g020100          442   4e-147   Sorghum bicolor [broomcorn]
gb|EMS59182.1|  Trehalose-phosphate phosphatase                         442   4e-147   
ref|XP_009406609.1|  PREDICTED: probable trehalose-phosphate phos...    442   5e-147   
ref|XP_010534065.1|  PREDICTED: trehalose-phosphate phosphatase B...    442   8e-147   
ref|XP_008445345.1|  PREDICTED: probable trehalose-phosphate phos...    441   1e-146   
gb|KHN19743.1|  Trehalose-phosphate phosphatase                         440   3e-146   
ref|XP_004500616.1|  PREDICTED: probable trehalose-phosphate phos...    439   5e-146   
ref|NP_001167890.1|  hypothetical protein                               439   5e-146   Zea mays [maize]
ref|XP_004956679.1|  PREDICTED: probable trehalose-phosphate phos...    439   8e-146   
gb|KEH34903.1|  trehalose-6-phosphate phosphatase                       438   1e-145   
ref|XP_004150660.1|  PREDICTED: probable trehalose-phosphate phos...    438   1e-145   
ref|XP_010064765.1|  PREDICTED: probable trehalose-phosphate phos...    437   2e-145   
ref|XP_009419974.1|  PREDICTED: probable trehalose-phosphate phos...    437   2e-145   
ref|XP_010500057.1|  PREDICTED: probable trehalose-phosphate phos...    437   3e-145   
ref|XP_010676890.1|  PREDICTED: probable trehalose-phosphate phos...    437   3e-145   
ref|XP_003576467.1|  PREDICTED: probable trehalose-phosphate phos...    437   6e-145   
ref|XP_006305131.1|  hypothetical protein CARUB_v10009500mg             436   6e-145   
ref|XP_010496062.1|  PREDICTED: probable trehalose-phosphate phos...    436   8e-145   
ref|XP_008646283.1|  PREDICTED: probable trehalose-phosphate phos...    435   1e-144   
ref|XP_009380195.1|  PREDICTED: probable trehalose-phosphate phos...    435   2e-144   
ref|NP_564464.1|  probable trehalose-phosphate phosphatase D            435   3e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002460140.1|  hypothetical protein SORBIDRAFT_02g023260          435   4e-144   Sorghum bicolor [broomcorn]
ref|XP_006660121.1|  PREDICTED: probable trehalose-phosphate phos...    432   4e-144   
emb|CDY15842.1|  BnaA04g12690D                                          433   6e-144   
emb|CDY63411.1|  BnaCnng42030D                                          432   7e-144   
gb|AAM63513.1|  trehalose-phosphatase, putative                         433   1e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647910.1|  PREDICTED: LOW QUALITY PROTEIN: probable tre...    432   2e-143   
ref|XP_009388774.1|  PREDICTED: probable trehalose-phosphate phos...    433   2e-143   
gb|AFK47239.1|  unknown                                                 433   2e-143   
ref|XP_003615055.1|  Trehalose-6-phosphate phosphatase                  433   2e-143   
ref|XP_010461341.1|  PREDICTED: probable trehalose-phosphate phos...    431   6e-143   
gb|AAD23621.1|  putative trehalose-6-phosphate phosphatase              427   8e-143   Arabidopsis thaliana [mouse-ear cress]
sp|Q6H5L4.2|TPP7_ORYSJ  RecName: Full=Probable trehalose-phosphat...    431   9e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002893908.1|  hypothetical protein ARALYDRAFT_891246             431   1e-142   
gb|EAZ08844.1|  hypothetical protein OsI_31105                          430   3e-142   Oryza sativa Indica Group [Indian rice]
gb|ADK11431.1|  trehalose-6-phosphate phosphatase                       430   3e-142   
ref|XP_009409163.1|  PREDICTED: probable trehalose-phosphate phos...    430   3e-142   
ref|XP_010446536.1|  PREDICTED: probable trehalose-phosphate phos...    424   9e-142   
ref|XP_009390913.1|  PREDICTED: probable trehalose-phosphate phos...    428   2e-141   
gb|AAG51089.1|AC027032_9  trehalose-phosphatase, putative               425   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660576.1|  PREDICTED: probable trehalose-phosphate phos...    422   2e-140   
ref|XP_006390024.1|  hypothetical protein EUTSA_v10018720mg             424   3e-140   
tpg|DAA39973.1|  TPA: hypothetical protein ZEAMMB73_891232              424   5e-140   
gb|EYU36516.1|  hypothetical protein MIMGU_mgv1a008595mg                423   1e-139   
gb|EMT12736.1|  hypothetical protein F775_52288                         423   2e-139   
ref|XP_003573088.1|  PREDICTED: probable trehalose-phosphate phos...    421   7e-139   
gb|KCW68839.1|  hypothetical protein EUGRSUZ_F02439                     420   2e-138   
gb|KHG18855.1|  Trehalose-phosphate phosphatase                         418   3e-138   
dbj|BAJ99358.1|  predicted protein                                      418   9e-138   
ref|XP_009390290.1|  PREDICTED: probable trehalose-phosphate phos...    416   1e-137   
ref|XP_010428924.1|  PREDICTED: trehalose-phosphate phosphatase B       417   2e-137   
ref|XP_002461047.1|  hypothetical protein SORBIDRAFT_02g039790          416   4e-137   Sorghum bicolor [broomcorn]
gb|KFK42193.1|  hypothetical protein AALP_AA2G223500                    416   4e-137   
ref|XP_007136236.1|  hypothetical protein PHAVU_009G0298000g            412   9e-137   
emb|CDY14635.1|  BnaC02g24780D                                          416   1e-136   
ref|XP_010321467.1|  PREDICTED: probable trehalose-phosphate phos...    413   1e-136   
ref|XP_004958375.1|  PREDICTED: probable trehalose-phosphate phos...    414   1e-136   
ref|NP_177932.1|  trehalose-6-phosphate phosphatase                     414   5e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302406.1|  hypothetical protein CARUB_v10020479mg             413   1e-135   
ref|XP_009128274.1|  PREDICTED: trehalose-phosphate phosphatase B...    412   2e-135   
ref|XP_009390912.1|  PREDICTED: probable trehalose-phosphate phos...    414   2e-135   
emb|CDY26848.1|  BnaA02g18730D                                          411   8e-135   
emb|CDX88416.1|  BnaC06g38600D                                          410   9e-135   
ref|XP_002461048.1|  hypothetical protein SORBIDRAFT_02g039810          410   1e-134   Sorghum bicolor [broomcorn]
ref|XP_009106458.1|  PREDICTED: trehalose-phosphate phosphatase B...    410   1e-134   
emb|CDX87477.1|  BnaA07g33960D                                          410   2e-134   
ref|XP_002887719.1|  trehalose-6-phosphate phosphatase                  409   4e-134   
gb|KDO56611.1|  hypothetical protein CISIN_1g020273mg                   404   7e-134   
ref|XP_010472010.1|  PREDICTED: trehalose-phosphate phosphatase B...    408   7e-134   
ref|XP_004958374.1|  PREDICTED: probable trehalose-phosphate phos...    408   1e-133   
gb|AAC39370.1|  trehalose-6-phosphate phosphatase                       407   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018812.1|  Haloacid dehalogenase-like hydrolase superfa...    404   6e-133   
ref|NP_001105814.1|  LOC677667                                          404   1e-132   Zea mays [maize]
gb|EMT31501.1|  Trehalose-phosphate phosphatase                         402   1e-132   
gb|ACF82891.1|  unknown                                                 404   1e-132   Zea mays [maize]
gb|ACF87631.1|  unknown                                                 404   1e-132   Zea mays [maize]
gb|EEE65353.1|  hypothetical protein OsJ_20634                          402   2e-132   Oryza sativa Japonica Group [Japonica rice]
gb|EMT24321.1|  Trehalose-phosphate phosphatase                         402   3e-132   
gb|KEH20857.1|  trehalose-phosphate phosphatase                         402   3e-132   
ref|XP_008652634.1|  PREDICTED: probable trehalose-phosphate phos...    404   4e-132   
ref|XP_006658837.1|  PREDICTED: probable trehalose-phosphate phos...    403   8e-132   
ref|XP_010416778.1|  PREDICTED: trehalose-phosphate phosphatase B       403   1e-131   
ref|XP_003561584.1|  PREDICTED: probable trehalose-phosphate phos...    401   3e-131   
ref|NP_173640.1|  probable trehalose-phosphate phosphatase C            399   3e-131   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA41515.1|  TPA: hypothetical protein ZEAMMB73_277907              399   3e-131   
ref|XP_008670589.1|  PREDICTED: probable trehalose-phosphate phos...    399   5e-131   
dbj|BAD25928.1|  putative trehalose-phosphatase B                       401   9e-131   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69579.1|  hypothetical protein OsJ_29113                          399   3e-130   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ98055.1|  predicted protein                                      398   3e-130   
ref|XP_002890499.1|  hypothetical protein ARALYDRAFT_313108             397   5e-130   
ref|XP_004984186.1|  PREDICTED: probable trehalose-phosphate phos...    397   6e-130   
ref|XP_009609253.1|  PREDICTED: trehalose-phosphate phosphatase A...    399   7e-130   
ref|XP_009394963.1|  PREDICTED: probable trehalose-phosphate phos...    398   8e-130   
ref|XP_008670588.1|  PREDICTED: probable trehalose-phosphate phos...    396   8e-130   
ref|XP_004964980.1|  PREDICTED: probable trehalose-phosphate phos...    398   9e-130   
ref|XP_009609216.1|  PREDICTED: trehalose-phosphate phosphatase A...    398   1e-129   
tpg|DAA63683.1|  TPA: hypothetical protein ZEAMMB73_677696              397   2e-129   
ref|XP_010662410.1|  PREDICTED: trehalose-phosphate phosphatase A       397   3e-129   
gb|KFK23771.1|  hypothetical protein AALP_AAs53909U000100               395   5e-129   
gb|AAU03490.1|  trehalose-phosphate phosphatase                         395   7e-129   
ref|XP_008652632.1|  PREDICTED: probable trehalose-phosphate phos...    396   8e-129   
ref|NP_001105864.1|  ramosa3                                            394   1e-128   
gb|KFK44322.1|  hypothetical protein AALP_AA1G243200                    392   2e-128   
ref|XP_009794086.1|  PREDICTED: trehalose-phosphate phosphatase A       395   2e-128   
ref|XP_002467773.1|  hypothetical protein SORBIDRAFT_01g033800          394   3e-128   
ref|NP_001141014.1|  uncharacterized protein LOC100273093               393   3e-128   
gb|EEC80247.1|  hypothetical protein OsI_22201                          393   5e-128   
ref|XP_010264217.1|  PREDICTED: probable trehalose-phosphate phos...    394   5e-128   
ref|XP_010259016.1|  PREDICTED: probable trehalose-phosphate phos...    394   6e-128   
ref|XP_008234398.1|  PREDICTED: trehalose-phosphate phosphatase A       394   6e-128   
ref|XP_006656791.1|  PREDICTED: probable trehalose-phosphate phos...    389   1e-127   
ref|XP_008651883.1|  PREDICTED: ramosa3 isoform X1                      392   1e-127   
gb|KDP22419.1|  hypothetical protein JCGZ_26250                         392   1e-127   
gb|EMT08049.1|  Trehalose-phosphate phosphatase                         391   2e-127   
gb|AEI55390.1|  trehalose-6-phosphate phosphatase                       391   3e-127   
ref|XP_010235584.1|  PREDICTED: probable trehalose-phosphate phos...    390   6e-127   
ref|XP_009417373.1|  PREDICTED: probable trehalose-phosphate phos...    387   8e-127   
ref|XP_004958373.1|  PREDICTED: probable trehalose-phosphate phos...    390   8e-127   
ref|XP_007218121.1|  hypothetical protein PRUPE_ppa007023mg             390   1e-126   
ref|XP_007038401.1|  Haloacid dehalogenase-like hydrolase superfa...    390   1e-126   
emb|CBI25779.3|  unnamed protein product                                390   1e-126   
ref|XP_006421675.1|  hypothetical protein CICLE_v10005151mg             390   2e-126   
gb|KDO65466.1|  hypothetical protein CISIN_1g016635mg                   389   2e-126   
gb|ABD92785.1|  sister of ramosa 3                                      384   2e-126   
gb|EMS61117.1|  Trehalose-phosphate phosphatase                         387   2e-126   
ref|XP_002264471.2|  PREDICTED: probable trehalose-phosphate phos...    389   5e-126   
ref|XP_002463212.1|  hypothetical protein SORBIDRAFT_02g039820          387   5e-126   
gb|ACF22728.1|  trehalose-phosphatase family protein                    387   7e-126   
gb|ABD92782.1|  ramosa 3                                                382   9e-126   
ref|XP_006490109.1|  PREDICTED: trehalose-phosphate phosphatase A...    388   9e-126   
ref|XP_003631447.1|  PREDICTED: probable trehalose-phosphate phos...    388   1e-125   
emb|CBI31887.3|  unnamed protein product                                388   1e-125   
gb|ABD92783.1|  sister of ramosa 3                                      382   2e-125   
tpg|DAA61203.1|  TPA: hypothetical protein ZEAMMB73_657005              387   2e-125   
ref|XP_002510945.1|  trehalose-6-phosphate synthase, putative           387   2e-125   
ref|XP_006366166.1|  PREDICTED: trehalose-phosphate phosphatase A...    387   2e-125   
gb|EMS54383.1|  Trehalose-phosphate phosphatase                         384   2e-125   
ref|XP_007038400.1|  Haloacid dehalogenase-like hydrolase superfa...    389   4e-125   
gb|ABD92789.1|  ramosa 3-like protein                                   380   6e-125   
ref|NP_001140586.1|  uncharacterized protein LOC100272656               385   7e-125   
ref|XP_011076341.1|  PREDICTED: trehalose-phosphate phosphatase A...    385   9e-125   
ref|XP_003608755.1|  Trehalose-phosphate phosphatase                    385   1e-124   
dbj|BAD37685.1|  putative trehalose-phosphatase                         389   1e-124   
ref|XP_006304608.1|  hypothetical protein CARUB_v10011681mg             382   2e-124   
ref|XP_010919491.1|  PREDICTED: probable trehalose-phosphate phos...    384   3e-124   
gb|ABD92787.1|  ramosa 3-like protein                                   379   3e-124   
ref|XP_002532578.1|  trehalose-6-phosphate synthase, putative           384   3e-124   
gb|EMT18034.1|  Trehalose-phosphate phosphatase                         382   4e-124   
ref|XP_004148142.1|  PREDICTED: trehalose-phosphate phosphatase A...    383   4e-124   
ref|XP_008439088.1|  PREDICTED: trehalose-phosphate phosphatase A       383   5e-124   
ref|XP_010933707.1|  PREDICTED: probable trehalose-phosphate phos...    383   6e-124   
ref|XP_009374486.1|  PREDICTED: trehalose-phosphate phosphatase A...    382   1e-123   
ref|XP_007131344.1|  hypothetical protein PHAVU_011G006000g             383   1e-123   
ref|XP_006856571.1|  hypothetical protein AMTR_s00046p00190820          382   1e-123   
sp|Q0DDI1.3|TPP8_ORYSJ  RecName: Full=Probable trehalose-phosphat...    386   1e-123   
ref|XP_009402281.1|  PREDICTED: probable trehalose-phosphate phos...    382   1e-123   
ref|NP_001057178.2|  Os06g0222100                                       385   1e-123   
ref|XP_010477481.1|  PREDICTED: probable trehalose-phosphate phos...    380   2e-123   
ref|XP_004307816.1|  PREDICTED: trehalose-phosphate phosphatase A...    382   2e-123   
ref|XP_010693684.1|  PREDICTED: trehalose-phosphate phosphatase A...    382   2e-123   
ref|XP_011029944.1|  PREDICTED: trehalose-phosphate phosphatase A       382   2e-123   
ref|XP_003534412.1|  PREDICTED: trehalose-phosphate phosphatase A...    382   2e-123   
gb|EAZ04762.1|  hypothetical protein OsI_26925                          381   3e-123   
gb|KHN11663.1|  Trehalose-phosphate phosphatase                         381   3e-123   
ref|XP_011018261.1|  PREDICTED: probable trehalose-phosphate phos...    381   3e-123   
ref|XP_008787005.1|  PREDICTED: probable trehalose-phosphate phos...    381   4e-123   
ref|XP_002318886.1|  hypothetical protein POPTR_0012s14700g             381   5e-123   
ref|XP_008343697.1|  PREDICTED: trehalose-phosphate phosphatase A...    380   5e-123   
ref|XP_008376127.1|  PREDICTED: trehalose-phosphate phosphatase A...    380   6e-123   
ref|XP_009370472.1|  PREDICTED: trehalose-phosphate phosphatase A...    380   6e-123   
ref|XP_009372886.1|  PREDICTED: trehalose-phosphate phosphatase A...    380   6e-123   
ref|XP_007155632.1|  hypothetical protein PHAVU_003G218200g             380   7e-123   
ref|NP_001060326.1|  Os07g0624600                                       379   8e-123   
gb|KEH29388.1|  trehalose-phosphate phosphatase                         380   8e-123   
ref|XP_010676172.1|  PREDICTED: probable trehalose-phosphate phos...    380   1e-122   
emb|CDP05325.1|  unnamed protein product                                380   1e-122   
ref|XP_003541164.1|  PREDICTED: trehalose-phosphate phosphatase A...    380   1e-122   
gb|KHN32439.1|  Trehalose-phosphate phosphatase                         380   1e-122   
ref|NP_001063014.1|  Os09g0369400                                       382   2e-122   
ref|XP_010053438.1|  PREDICTED: probable trehalose-phosphate phos...    378   2e-122   
ref|XP_008796838.1|  PREDICTED: probable trehalose-phosphate phos...    379   3e-122   
ref|XP_009128275.1|  PREDICTED: trehalose-phosphate phosphatase B...    378   3e-122   
gb|EPS67838.1|  trehalose 6-phosphate phosphatase                       378   3e-122   
ref|NP_001119501.1|  probable trehalose-phosphate phosphatase J         376   4e-122   
ref|XP_008445346.1|  PREDICTED: probable trehalose-phosphate phos...    377   4e-122   
ref|XP_010933704.1|  PREDICTED: probable trehalose-phosphate phos...    378   4e-122   
ref|XP_008376434.1|  PREDICTED: trehalose-phosphate phosphatase A...    378   5e-122   
sp|Q10KF5.1|TPP9_ORYSJ  RecName: Full=Probable trehalose-phosphat...    378   6e-122   
ref|XP_010053437.1|  PREDICTED: probable trehalose-phosphate phos...    378   6e-122   
ref|XP_006840955.1|  hypothetical protein AMTR_s00085p00016590          378   6e-122   
ref|XP_004514523.1|  PREDICTED: trehalose-phosphate phosphatase A...    378   7e-122   
ref|XP_004516353.1|  PREDICTED: trehalose-phosphate phosphatase A...    378   7e-122   
ref|XP_010534066.1|  PREDICTED: trehalose-phosphate phosphatase B...    377   8e-122   
ref|XP_006368175.1|  trehalose-6-phosphate phosphatase family pro...    377   9e-122   
ref|XP_011000146.1|  PREDICTED: trehalose-phosphate phosphatase A...    377   2e-121   
ref|XP_009400695.1|  PREDICTED: probable trehalose-phosphate phos...    377   2e-121   
ref|XP_010442651.1|  PREDICTED: trehalose-phosphate phosphatase A...    376   3e-121   
ref|XP_002321830.1|  trehalose-6-phosphate phosphatase family pro...    376   3e-121   
ref|XP_011076338.1|  PREDICTED: trehalose-phosphate phosphatase A...    376   3e-121   
ref|XP_006440369.1|  hypothetical protein CICLE_v10020410mg             377   3e-121   
ref|XP_010498684.1|  PREDICTED: probable trehalose-phosphate phos...    374   4e-121   
gb|KDO48367.1|  hypothetical protein CISIN_1g015439mg                   377   4e-121   
ref|XP_010443302.1|  PREDICTED: trehalose-phosphate phosphatase A...    375   6e-121   
ref|XP_009400886.1|  PREDICTED: probable trehalose-phosphate phos...    375   7e-121   
ref|XP_006280627.1|  hypothetical protein CARUB_v10026589mg             375   7e-121   
ref|XP_010093689.1|  Trehalose-phosphate phosphatase                    375   8e-121   
ref|XP_004516846.1|  PREDICTED: probable trehalose-phosphate phos...    375   2e-120   
ref|XP_010536537.1|  PREDICTED: trehalose-phosphate phosphatase A       374   2e-120   
ref|XP_003598212.1|  Trehalose-phosphate phosphatase                    374   2e-120   
ref|XP_006477242.1|  PREDICTED: probable trehalose-phosphate phos...    375   2e-120   
gb|ABD92784.1|  ramosa 3                                                372   2e-120   
gb|EAZ40714.1|  hypothetical protein OsJ_25183                          372   3e-120   
ref|NP_199959.2|  trehalose-phosphate phosphatase A                     374   3e-120   
ref|XP_003522843.1|  PREDICTED: trehalose-phosphate phosphatase A...    374   3e-120   
gb|KHG09887.1|  Trehalose-phosphate phosphatase                         374   3e-120   
ref|XP_002303518.2|  trehalose-6-phosphate phosphatase family pro...    374   3e-120   
ref|XP_010538762.1|  PREDICTED: probable trehalose-phosphate phos...    372   8e-120   
gb|KDP25632.1|  hypothetical protein JCGZ_20788                         372   1e-119   
ref|XP_007210565.1|  hypothetical protein PRUPE_ppa014788mg             372   1e-119   
ref|XP_010442648.1|  PREDICTED: trehalose-phosphate phosphatase A...    372   2e-119   
ref|XP_003560203.1|  PREDICTED: probable trehalose-phosphate phos...    370   3e-119   
ref|XP_010443279.1|  PREDICTED: trehalose-phosphate phosphatase A...    371   3e-119   
ref|XP_010317997.1|  PREDICTED: trehalose-phosphate phosphatase A       370   3e-119   
ref|XP_010482481.1|  PREDICTED: trehalose-phosphate phosphatase A       371   4e-119   
ref|XP_006280628.1|  hypothetical protein CARUB_v10026589mg             370   4e-119   
emb|CDY56658.1|  BnaA02g11230D                                          370   5e-119   
emb|CDY70318.1|  BnaAnng33310D                                          364   6e-119   
ref|XP_010227842.1|  PREDICTED: probable trehalose-phosphate phos...    368   7e-119   
ref|XP_009137266.1|  PREDICTED: probable trehalose-phosphate phos...    369   8e-119   
emb|CDX98760.1|  BnaA03g45450D                                          369   9e-119   
ref|XP_006413641.1|  hypothetical protein EUTSA_v10025482mg             369   1e-118   
ref|XP_003598213.1|  Trehalose-phosphate phosphatase                    367   2e-118   
ref|XP_006401974.1|  hypothetical protein EUTSA_v10013801mg             369   2e-118   
ref|XP_009374488.1|  PREDICTED: trehalose-phosphate phosphatase A...    369   2e-118   
ref|XP_011033929.1|  PREDICTED: probable trehalose-phosphate phos...    369   2e-118   
ref|XP_010529491.1|  PREDICTED: probable trehalose-phosphate phos...    369   2e-118   
ref|NP_851171.1|  trehalose-phosphate phosphatase A                     369   2e-118   
emb|CDY66417.1|  BnaAnng22210D                                          368   3e-118   
ref|XP_004242008.1|  PREDICTED: probable trehalose-phosphate phos...    367   3e-118   
ref|XP_010538763.1|  PREDICTED: probable trehalose-phosphate phos...    365   4e-118   
gb|AAF87852.1|AC073942_6  Contains similarity to trehalose-6-phos...    365   4e-118   
gb|ABO61745.1|  trehalose-phosphatase 1                                 370   5e-118   
ref|XP_006582414.1|  PREDICTED: trehalose-phosphate phosphatase A...    368   5e-118   
gb|ABD92786.1|  sister of ramosa 3                                      362   6e-118   
ref|XP_004298659.1|  PREDICTED: probable trehalose-phosphate phos...    367   7e-118   
ref|XP_009626608.1|  PREDICTED: probable trehalose-phosphate phos...    367   7e-118   
ref|XP_007148713.1|  hypothetical protein PHAVU_005G008300g             367   7e-118   
ref|XP_004957708.1|  PREDICTED: probable trehalose-phosphate phos...    366   8e-118   
ref|XP_007039915.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    367   8e-118   
ref|XP_008343698.1|  PREDICTED: trehalose-phosphate phosphatase A...    367   1e-117   
ref|XP_010062224.1|  PREDICTED: trehalose-phosphate phosphatase A       367   1e-117   
ref|XP_006377097.1|  hypothetical protein POPTR_0012s14700g             366   2e-117   
gb|AFK33570.1|  unknown                                                 364   2e-117   
gb|KHN31363.1|  Trehalose-phosphate phosphatase                         363   2e-117   
ref|XP_008670404.1|  PREDICTED: probable trehalose-phosphate phos...    366   2e-117   
ref|NP_001047645.1|  Os02g0661100                                       365   3e-117   
ref|XP_004150651.1|  PREDICTED: probable trehalose-phosphate phos...    366   3e-117   
ref|XP_002864113.1|  hypothetical protein ARALYDRAFT_495218             365   4e-117   
ref|XP_004167227.1|  PREDICTED: probable trehalose-phosphate phos...    366   4e-117   
ref|XP_008376435.1|  PREDICTED: trehalose-phosphate phosphatase A...    365   4e-117   
emb|CDX94103.1|  BnaC07g37370D                                          365   4e-117   
ref|XP_006600830.1|  PREDICTED: probable trehalose-phosphate phos...    363   5e-117   
ref|XP_006647637.1|  PREDICTED: probable trehalose-phosphate phos...    365   5e-117   
ref|XP_009127308.1|  PREDICTED: trehalose-phosphate phosphatase A...    365   5e-117   
ref|XP_006662038.1|  PREDICTED: probable trehalose-phosphate phos...    365   5e-117   
ref|XP_008681270.1|  PREDICTED: uncharacterized protein LOC100216...    365   5e-117   
ref|XP_006657703.1|  PREDICTED: probable trehalose-phosphate phos...    364   6e-117   
emb|CDX82953.1|  BnaC01g14030D                                          364   8e-117   
ref|XP_009788659.1|  PREDICTED: probable trehalose-phosphate phos...    365   9e-117   
ref|XP_010106223.1|  hypothetical protein L484_003381                   366   9e-117   
ref|XP_001761263.1|  predicted protein                                  363   1e-116   
ref|XP_009136013.1|  PREDICTED: probable trehalose-phosphate phos...    364   1e-116   
gb|EEC82042.1|  hypothetical protein OsI_26016                          363   1e-116   
ref|XP_009625717.1|  PREDICTED: probable trehalose-phosphate phos...    363   1e-116   
ref|XP_006366751.1|  PREDICTED: probable trehalose-phosphate phos...    363   1e-116   
ref|XP_009387887.1|  PREDICTED: probable trehalose-phosphate phos...    364   1e-116   
ref|XP_011070095.1|  PREDICTED: probable trehalose-phosphate phos...    364   1e-116   
ref|XP_009387895.1|  PREDICTED: trehalose-phosphate phosphatase A...    364   2e-116   
ref|XP_010455685.1|  PREDICTED: probable trehalose-phosphate phos...    362   2e-116   
emb|CAA18763.1|  puative protein                                        360   2e-116   
ref|XP_010539763.1|  PREDICTED: probable trehalose-phosphate phos...    364   2e-116   
ref|XP_001776166.1|  predicted protein                                  363   2e-116   
ref|NP_001050255.1|  Os03g0386500                                       361   2e-116   
ref|XP_010455684.1|  PREDICTED: probable trehalose-phosphate phos...    363   2e-116   
ref|XP_009625712.1|  PREDICTED: probable trehalose-phosphate phos...    363   2e-116   
emb|CDY00477.1|  BnaA10g07960D                                          363   3e-116   
gb|KEH29389.1|  trehalose-phosphate phosphatase                         365   4e-116   
ref|XP_008448886.1|  PREDICTED: probable trehalose-phosphate phos...    363   5e-116   
ref|XP_004953370.1|  PREDICTED: probable trehalose-phosphate phos...    362   6e-116   
ref|XP_010434016.1|  PREDICTED: probable trehalose-phosphate phos...    362   6e-116   
gb|EYU30313.1|  hypothetical protein MIMGU_mgv1a007850mg                363   6e-116   
ref|XP_008376433.1|  PREDICTED: trehalose-phosphate phosphatase A...    363   8e-116   
gb|EAZ16924.1|  hypothetical protein OsJ_32406                          361   9e-116   
emb|CDX99919.1|  BnaC09g27860D                                          362   9e-116   
gb|EEC75381.1|  hypothetical protein OsI_11847                          359   1e-115   
ref|XP_001771735.1|  predicted protein                                  358   1e-115   
ref|NP_001065336.1|  Os10g0553300                                       361   2e-115   
ref|XP_009127300.1|  PREDICTED: trehalose-phosphate phosphatase A...    361   2e-115   
ref|NP_001059655.1|  Os07g0485000                                       360   3e-115   
gb|EAY79464.1|  hypothetical protein OsI_34594                          362   4e-115   
ref|XP_002438079.1|  hypothetical protein SORBIDRAFT_10g007770          362   5e-115   
ref|XP_006837441.1|  hypothetical protein AMTR_s00107p00077150          358   6e-115   
ref|XP_006283937.1|  hypothetical protein CARUB_v10005056mg             359   7e-115   
ref|XP_010439311.1|  PREDICTED: probable trehalose-phosphate phos...    359   9e-115   
ref|XP_004245739.1|  PREDICTED: probable trehalose-phosphate phos...    359   1e-114   
gb|EMT19261.1|  Putative glycosyl hydrolase                             358   1e-114   
ref|XP_006396759.1|  hypothetical protein EUTSA_v10029220mg             358   1e-114   
ref|XP_010448868.1|  PREDICTED: probable trehalose-phosphate phos...    358   2e-114   
ref|NP_193990.1|  trehalose-phosphate phosphatase G                     358   2e-114   
ref|XP_002464965.1|  hypothetical protein SORBIDRAFT_01g029590          358   2e-114   
ref|XP_004983712.1|  PREDICTED: probable trehalose-phosphate phos...    358   2e-114   
ref|XP_002867759.1|  hypothetical protein ARALYDRAFT_492609             358   2e-114   
gb|KHG07067.1|  otsB                                                    358   3e-114   



>ref|XP_004237406.1| PREDICTED: probable trehalose-phosphate phosphatase J [Solanum 
lycopersicum]
Length=388

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/396 (77%), Positives = 330/396 (83%), Gaps = 29/396 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR------------------FPTAGHKPPVVPGGYINFDVTSGKELLQ  348
             MT+ NVV VSDP                    F TA  KPP  PG  I     S K LL+
Sbjct  1     MTQQNVV-VSDPKSGINLTIPVKVPVSNSSALFTTAAQKPPPGPGSCITI---SRKTLLE  56

Query  349   NLDVNGA-AAKVSSWVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKG  519
                +NG  +A+++SWV+SMRASSPT  KS+P LSDD  +WM+QHPSALDMFEQII ASKG
Sbjct  57    ---INGNNSARINSWVESMRASSPTHHKSSPALSDDLNSWMVQHPSALDMFEQIISASKG  113

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV+DPD AFMSD MRATVRKLA YFPTAIVSGRC DKVYSFVRLA
Sbjct  114   KQIVMFLDYDGTLSPIVEDPDQAFMSDSMRATVRKLARYFPTAIVSGRCRDKVYSFVRLA  173

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGPS+GSKYKKGA+  VLFQPASEFLPMIDEVYK L++ T ST GV+V
Sbjct  174   ELYYAGSHGMDIKGPSKGSKYKKGAQA-VLFQPASEFLPMIDEVYKELVDITKSTEGVRV  232

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC SVHFRCVDE KWGELAQQVRSVLKEYPKL+LTQGRKVLEIRP I+WDKGKALE
Sbjct  233   ENNKFCASVHFRCVDEKKWGELAQQVRSVLKEYPKLQLTQGRKVLEIRPTIKWDKGKALE  292

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLGYAN TDVFPVYIGDDRTDEDAFKVLRE  QGFGILVSK PKDTHASYSLQEPS
Sbjct  293   FLLESLGYANCTDVFPVYIGDDRTDEDAFKVLRERDQGFGILVSKTPKDTHASYSLQEPS  352

Query  1240  EVMLFLRRLVEWKrlalrrqsrlrrqlEEIKATLKN  1347
             EVM+FLRRLVEWK+L+LRRQ R+RRQ+EE+KA+L+N
Sbjct  353   EVMVFLRRLVEWKKLSLRRQFRIRRQIEEMKASLRN  388



>ref|XP_011097592.1| PREDICTED: probable trehalose-phosphate phosphatase J [Sesamum 
indicum]
Length=386

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/371 (79%), Positives = 319/371 (86%), Gaps = 9/371 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             VAVS  + F +A  KPP VPG YI     S K+LLQNLD+N   A++++WVDSMRASSPT
Sbjct  21    VAVSGSSLFSSAAQKPPAVPGTYITI---SKKKLLQNLDIN-TGARINAWVDSMRASSPT  76

Query  421   --QKSTP-LSDDHR-TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSA  588
               + S+P LSDDH  +W M HPSALDMFEQI  ASKGK IVMFLDYDGTLSPIVDDPD A
Sbjct  77    HIKSSSPHLSDDHHNSWTMHHPSALDMFEQITNASKGKQIVMFLDYDGTLSPIVDDPDRA  136

Query  589   FMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKK  768
             FMSD MRATVRK+A YFPTAIVSGRC DKVYSFVRLAELYYAGSHGMDIKGPS+GSKYKK
Sbjct  137   FMSDSMRATVRKVARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPSKGSKYKK  196

Query  769   GAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELA  948
             GAE  VLFQPASE+LPMIDEVYK LLE T  TPG KVENNKFC+SVHFRCVDE KW ELA
Sbjct  197   GAEA-VLFQPASEYLPMIDEVYKALLEVTKDTPGAKVENNKFCLSVHFRCVDEKKWSELA  255

Query  949   QQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDR  1128
             +QV SVL+ YP LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN TDVFPVYIGDDR
Sbjct  256   KQVGSVLEMYPSLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCTDVFPVYIGDDR  315

Query  1129  TDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWKrlalrrqsrl  1308
             TDEDAFKVLRE  QGFGILVSK PKDT+ASYSLQEPSEVM FLRRLV+WK+L+LRRQ R+
Sbjct  316   TDEDAFKVLRERGQGFGILVSKTPKDTNASYSLQEPSEVMAFLRRLVDWKKLSLRRQFRI  375

Query  1309  rrqlEEIKATL  1341
             RR+LEE+K +L
Sbjct  376   RRRLEEMKMSL  386



>ref|XP_009595324.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nicotiana 
tomentosiformis]
Length=390

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/396 (76%), Positives = 324/396 (82%), Gaps = 27/396 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR-------------------FPTAGHKPPVVPGGYINFDVTSGKELL  345
             MT+ NVV VSDP                     F TA  KPP  PG  I    T  ++ L
Sbjct  1     MTQQNVV-VSDPKSGINLAISVKLQVPSNSPALFTTAVQKPPPAPGSCI----TISRKTL  55

Query  346   QNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKG  519
               ++ N   A+++SWVDSMRASSPT  KSTP LSDD  +W +QHPSALDMFEQII ASKG
Sbjct  56    VEINGNNNGARINSWVDSMRASSPTHHKSTPPLSDDINSWTVQHPSALDMFEQIITASKG  115

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV+DPD AFMS+ MRATVRKLA YFPTAIVSGRC DKVY+FVRLA
Sbjct  116   KQIVMFLDYDGTLSPIVEDPDQAFMSEAMRATVRKLARYFPTAIVSGRCRDKVYNFVRLA  175

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGPS+GSKYKKGAE  VL QPASEFLPMIDEVYK L++ T ST GV V
Sbjct  176   ELYYAGSHGMDIKGPSKGSKYKKGAEA-VLCQPASEFLPMIDEVYKALIDATKSTEGVIV  234

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC SVHFRCVDE KWGELAQ VRSVLKEYPKLRLTQGRKV EIRP I+WDKGKALE
Sbjct  235   ENNKFCASVHFRCVDEKKWGELAQVVRSVLKEYPKLRLTQGRKVFEIRPTIKWDKGKALE  294

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLGYAN TDVFPVYIGDDRTDEDAFKVLRE  QGFGILVSK+PKDTHASYSLQEPS
Sbjct  295   FLLESLGYANCTDVFPVYIGDDRTDEDAFKVLRERGQGFGILVSKIPKDTHASYSLQEPS  354

Query  1240  EVMLFLRRLVEWKrlalrrqsrlrrqlEEIKATLKN  1347
             EVM+FLRRLVEWK+L+LRRQ R+RRQ+EEIKA+L+N
Sbjct  355   EVMVFLRRLVEWKKLSLRRQFRIRRQIEEIKASLRN  390



>ref|XP_006355362.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Solanum 
tuberosum]
Length=386

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/392 (77%), Positives = 329/392 (84%), Gaps = 23/392 (6%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR--------------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDV  360
             MT+ NVV VSDP                F TA  KPP  PG      + S K L++   +
Sbjct  1     MTQQNVV-VSDPKSGINLTIPVSNSSALFTTAAQKPPPGPGPGSCITI-SRKTLVE---I  55

Query  361   NGA-AAKVSSWVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIV  531
             NG  +A+++SWV+SMRASSPT  KS+P LSDD  +WM+QHPSALDMFEQII ASKGK IV
Sbjct  56    NGNNSARINSWVESMRASSPTHHKSSPALSDDLNSWMVQHPSALDMFEQIISASKGKQIV  115

Query  532   MFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYY  711
             MFLDYDGTLSPIV+DPD AFMSD MRATVRKLA YFPTAIVSGRC DKVYSFVRLAELYY
Sbjct  116   MFLDYDGTLSPIVEDPDQAFMSDAMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYY  175

Query  712   AGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNK  891
             AGSHGMDIKGPS+GSKYKKGA+  VLFQPASEFLPMIDEVYK L++ T ST GV+VENNK
Sbjct  176   AGSHGMDIKGPSKGSKYKKGAQA-VLFQPASEFLPMIDEVYKKLVDITKSTEGVRVENNK  234

Query  892   FCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLE  1071
             FC SVHFRCVDE KWGELAQ VRSVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLE
Sbjct  235   FCASVHFRCVDEKKWGELAQVVRSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLE  294

Query  1072  SLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVML  1251
             SLGYAN TDVFPVYIGDDRTDEDAFKVLRE  QGFGILVSK PKDTHASYSLQEPSEVM+
Sbjct  295   SLGYANCTDVFPVYIGDDRTDEDAFKVLRERDQGFGILVSKTPKDTHASYSLQEPSEVMV  354

Query  1252  FLRRLVEWKrlalrrqsrlrrqlEEIKATLKN  1347
             FLRRLVEWK+L+LRRQ R+RRQ+EE+KA+L+N
Sbjct  355   FLRRLVEWKKLSLRRQFRIRRQIEEMKASLRN  386



>ref|XP_009775195.1| PREDICTED: probable trehalose-phosphate phosphatase H [Nicotiana 
sylvestris]
Length=380

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/389 (76%), Positives = 323/389 (83%), Gaps = 23/389 (6%)
 Frame = +1

Query  223   MTRHNVVAVSDP------------NRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT+ NVV VSDP            +  P    KPP  PG  I     S K L++   +N 
Sbjct  1     MTQQNVV-VSDPKSGINLTIPVKVSNSPALFTKPPPAPGSCITI---SRKTLVE---IN-  52

Query  367   AAAKVSSWVDSMRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
             +  +++SWVDSMRASSPT  + ++PLSDD  +WM+QHPSALDMFEQII ASKGK IVMFL
Sbjct  53    SGPRINSWVDSMRASSPTRHKSTSPLSDDINSWMVQHPSALDMFEQIISASKGKQIVMFL  112

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV+DPD AFMSD MRATVRKLA YFPTAIVSGRC DKVY+FVRLAELYYAGS
Sbjct  113   DYDGTLSPIVEDPDQAFMSDAMRATVRKLARYFPTAIVSGRCRDKVYNFVRLAELYYAGS  172

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDIKGPS+GSKYKKGAE  VL QPASEFLPMIDEVYK L++ T ST GV VENNKFC 
Sbjct  173   HGMDIKGPSKGSKYKKGAEA-VLCQPASEFLPMIDEVYKALIDATKSTEGVTVENNKFCA  231

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVHFR VDE KWGELAQ VRSVLKEYPKLRLTQGRKV EIRP I+WDKGKALEFLLESLG
Sbjct  232   SVHFRRVDEKKWGELAQVVRSVLKEYPKLRLTQGRKVFEIRPTIKWDKGKALEFLLESLG  291

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             YAN TDVFPVYIGDDRTDEDAFKVLRE  QGFGILVSK+PKDTHASYSLQEPSEVM+FLR
Sbjct  292   YANCTDVFPVYIGDDRTDEDAFKVLRERGQGFGILVSKIPKDTHASYSLQEPSEVMVFLR  351

Query  1261  RLVEWKrlalrrqsrlrrqlEEIKATLKN  1347
             RLVEWK+L+LRRQ R+RRQ+EEIKA+L+N
Sbjct  352   RLVEWKKLSLRRQFRIRRQIEEIKASLRN  380



>ref|XP_009613560.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nicotiana 
tomentosiformis]
Length=374

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/383 (77%), Positives = 325/383 (85%), Gaps = 17/383 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR------FPTAG-HKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKV  381
             MT+ NVV VSDPN       F  A   KPP  PG  IN    S K L++   +N +  ++
Sbjct  1     MTKQNVV-VSDPNSGINNATFTAAAVQKPPPAPGSCINI---SRKTLVE---IN-SGPRI  52

Query  382   SSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +SWVDSMRASSPT  K T LS+D+ +WM+ HPSALDMFEQII ASKGK +VMFLDYDGTL
Sbjct  53    NSWVDSMRASSPTHHKCTSLSEDNTSWMVHHPSALDMFEQIISASKGKKMVMFLDYDGTL  112

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMSD MR TVRKLA YFPTAIVSGRC DKVYSFV+LAELYYAGSHGMDI+
Sbjct  113   SPIVDDPDQAFMSDAMRGTVRKLARYFPTAIVSGRCRDKVYSFVQLAELYYAGSHGMDIE  172

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GPS+ SKYKKGA+   LFQPASEFLPMI EVYK LL++T+S  GV+VENNKFCVSVHFRC
Sbjct  173   GPSKDSKYKKGAQA-ALFQPASEFLPMIVEVYKELLDKTNSINGVRVENNKFCVSVHFRC  231

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KWGELAQQV+SVLKEYPKLRL+QGRKVLEIRP I+WDKGKALEFLLESLGYAN TD
Sbjct  232   VDEKKWGELAQQVKSVLKEYPKLRLSQGRKVLEIRPTIKWDKGKALEFLLESLGYANCTD  291

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDDRTDEDAFKVLRE  QGFGILVSK PKDT+ASYSL EPSEVM+FLRRLVEWK
Sbjct  292   VFPVYIGDDRTDEDAFKVLRERGQGFGILVSKTPKDTYASYSLLEPSEVMIFLRRLVEWK  351

Query  1279  rlalrrqsrlrrqlEEIKATLKN  1347
             RL+LRRQS++++QLEEIKA+LKN
Sbjct  352   RLSLRRQSKIQKQLEEIKASLKN  374



>ref|XP_002533145.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF29241.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=373

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/358 (76%), Positives = 304/358 (85%), Gaps = 7/358 (2%)
 Frame = +1

Query  211   AEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSW  390
             A+  +     V VS+ + F TA  KPP  PGGYI+    S K+LL+NL++NG A ++++W
Sbjct  11    AKSTINLATTVHVSNSSIFTTAVQKPPAAPGGYISI---SRKKLLKNLEINGGA-RINAW  66

Query  391   VDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             VDSMRASSPT  KSTP L++D  +W + HPSALDMFEQII ASKGK IVMFLDYDGTLSP
Sbjct  67    VDSMRASSPTHLKSTPSLTEDQGSWTLHHPSALDMFEQIIDASKGKQIVMFLDYDGTLSP  126

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IVDDPD AFMS  MRATVRKLA  FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP
Sbjct  127   IVDDPDRAFMSKKMRATVRKLAKCFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGP  186

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             ++GSKYKKG+E  ++FQPASEFLPMIDEVYK L+E+T STPG  VENNKFCVSVH+RCVD
Sbjct  187   AKGSKYKKGSEA-LIFQPASEFLPMIDEVYKELVEKTKSTPGAFVENNKFCVSVHYRCVD  245

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E KW ELAQ VRSVLK+YPKLRLTQGRKVLEIRP I+WDKGKALEFLLE+LG+ N TDVF
Sbjct  246   EKKWSELAQVVRSVLKDYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLEALGFGNCTDVF  305

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDDRTDEDAFKVLRE  QGFGILVSK PKDT ASYSLQEP++VM FL+RLVEWK
Sbjct  306   PVYIGDDRTDEDAFKVLRERGQGFGILVSKFPKDTSASYSLQEPTQVMDFLQRLVEWK  363



>ref|XP_004288217.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Fragaria 
vesca subsp. vesca]
Length=377

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/350 (76%), Positives = 299/350 (85%), Gaps = 8/350 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKEL--LQNLDVNGAAAKVSSWVDSMRASS  414
             VAVS+ + FP A  KPP+ PGGYI+    S K+L  L+NLD+     +++SWVDSM+ASS
Sbjct  22    VAVSNASVFPAAAEKPPMAPGGYISI---SRKKLMNLKNLDIINGGERITSWVDSMKASS  78

Query  415   PT--QKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSA  588
             PT  Q ST L  D  +WM+QHPSALDMFEQII+AS+GK IVMFLDYDGTLSPIV+DPD A
Sbjct  79    PTHIQSSTCLMKDQSSWMLQHPSALDMFEQIIEASQGKQIVMFLDYDGTLSPIVEDPDRA  138

Query  589   FMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKK  768
             FMSD MR TV++LA  FPTAIVSGRC DKVY FVRLAELYYAGSHGMDIKGP++GSKYKK
Sbjct  139   FMSDSMRKTVKRLARCFPTAIVSGRCRDKVYKFVRLAELYYAGSHGMDIKGPAKGSKYKK  198

Query  769   GAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELA  948
             G +  VL QPASEFLPMIDEVYK L+E+T STPG KVENNKFC+SVHFRCVDE KW ELA
Sbjct  199   GGQ-GVLCQPASEFLPMIDEVYKLLIEKTKSTPGAKVENNKFCLSVHFRCVDEKKWSELA  257

Query  949   QQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDR  1128
              QVRSVLKEYP+LRL+QGRKVLEIRP I+WDKGKALEFLLESLGYAN  DVFPVYIGDDR
Sbjct  258   LQVRSVLKEYPQLRLSQGRKVLEIRPTIKWDKGKALEFLLESLGYANCNDVFPVYIGDDR  317

Query  1129  TDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             TDEDAFKVLRE  QGFGILVSK+PK+T A+YSLQEP+EVM FL+RLVEWK
Sbjct  318   TDEDAFKVLRERGQGFGILVSKIPKETSATYSLQEPAEVMDFLQRLVEWK  367



>ref|XP_002310573.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
 gb|EEE91023.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
Length=374

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 303/348 (87%), Gaps = 7/348 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V V++ + F TA  KPP  PGGYI+    S K+LL+NL++NG A ++++WVDSMRASSPT
Sbjct  21    VHVTNSSIFTTAAQKPPAAPGGYISI---SRKKLLKNLEINGGA-RINAWVDSMRASSPT  76

Query  421   Q-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFM  594
               KSTP +++D  +W++ HPSAL+MFEQII ASKGK IVMFLDYDGTLSPIVDDPD AFM
Sbjct  77    HIKSTPSVNEDQSSWILHHPSALEMFEQIIDASKGKQIVMFLDYDGTLSPIVDDPDKAFM  136

Query  595   SDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA  774
             S  MRATVRKLA +FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP++GSKYKKG 
Sbjct  137   SKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGPAKGSKYKKGG  196

Query  775   EEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQ  954
             +  V+FQ ASEFLPMIDEVY+ L+E+T +TPG KVENNKFC+SVH+RCVDE KW  LAQ 
Sbjct  197   D-GVVFQAASEFLPMIDEVYEELVEKTKTTPGAKVENNKFCLSVHYRCVDEKKWSGLAQV  255

Query  955   VRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTD  1134
             V+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRTD
Sbjct  256   VKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRTD  315

Query  1135  EDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             EDAFKVLRE  QGFGILVSK+PKDT ASYSLQEP++VM FLRRLVEWK
Sbjct  316   EDAFKVLRERGQGFGILVSKIPKDTSASYSLQEPTQVMDFLRRLVEWK  363



>ref|XP_009797815.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Nicotiana sylvestris]
Length=379

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/382 (75%), Positives = 320/382 (84%), Gaps = 13/382 (3%)
 Frame = +1

Query  220   KMTRHNVV-----AVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVS  384
             KMT+ NVV     A  +   F  A  KPP  PG  IN    S K L++   +N      +
Sbjct  5     KMTKQNVVDSDAKAGVNTATFTAAVQKPPPAPGSCINI---SRKTLVE---INSGPRINN  58

Query  385   SWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             +WVDSMRASSPT  K T LS+D+ +WM+ HPSAL+MFEQII ASKGK +VMFLDYDGTLS
Sbjct  59    NWVDSMRASSPTHHKYTSLSEDNTSWMVHHPSALNMFEQIIGASKGKKMVMFLDYDGTLS  118

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIVDDPD AFMSD MR TVRKLA YFPTAIVSGRC DKVYSFV+LAELYYAGSHGMDI+G
Sbjct  119   PIVDDPDQAFMSDAMRGTVRKLARYFPTAIVSGRCRDKVYSFVQLAELYYAGSHGMDIEG  178

Query  742   PSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCV  921
             PS+GSKYKK A+  VLFQPAS+FLPMIDEVYK LL++T    GV+VENNKFCVSVHFRCV
Sbjct  179   PSKGSKYKKEAQA-VLFQPASDFLPMIDEVYKELLDKTKCIEGVRVENNKFCVSVHFRCV  237

Query  922   DELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDV  1101
             DE +WGELAQ VRSVLKEYPKLRL+QGRKVLEIRPII+WDKGKALEFLL+SLGYAN T+V
Sbjct  238   DEKEWGELAQHVRSVLKEYPKLRLSQGRKVLEIRPIIKWDKGKALEFLLDSLGYANCTNV  297

Query  1102  FPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWKr  1281
             FPVYIGDDRTDEDAFKVLRE  QGFGILVSK PKDT+ASYSLQEPSEVM+FLRRLVEWK+
Sbjct  298   FPVYIGDDRTDEDAFKVLRERGQGFGILVSKTPKDTYASYSLQEPSEVMIFLRRLVEWKK  357

Query  1282  lalrrqsrlrrqlEEIKATLKN  1347
             L LRRQS++++Q+EEIKA+LKN
Sbjct  358   LCLRRQSKIQKQIEEIKASLKN  379



>ref|XP_011090521.1| PREDICTED: probable trehalose-phosphate phosphatase J [Sesamum 
indicum]
Length=379

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/372 (76%), Positives = 315/372 (85%), Gaps = 16/372 (4%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPP--VVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASS  414
             +AVS  + F TA  +PP   VPG YI     +          NGA  ++++WVDSMRASS
Sbjct  21    MAVSGSSLFTTAAQRPPPAAVPGPYITISRIN----------NGA--RINAWVDSMRASS  68

Query  415   PTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAF  591
             PT+ K++ LSDD  +W++ HPSALDMFEQI  ASKGK IVMFLDYDGTLSPIVDDPD AF
Sbjct  69    PTRIKASSLSDDQDSWILHHPSALDMFEQITSASKGKQIVMFLDYDGTLSPIVDDPDRAF  128

Query  592   MSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKG  771
             MS+ MRATVRKLA YFPTAIVSGRC DKVYSFVRLAELYYAGSHGMDIKGPS+GSKYKKG
Sbjct  129   MSEAMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPSKGSKYKKG  188

Query  772   AEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQ  951
             A+  VLFQPASEFLPMIDEVYK LLE T STPG +VENNKFCVSVHFRCVDE+KW ELA+
Sbjct  189   AQA-VLFQPASEFLPMIDEVYKALLEVTKSTPGARVENNKFCVSVHFRCVDEMKWSELAK  247

Query  952   QVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRT  1131
             QV +VL++YP LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN TDVFPVYIGDDR+
Sbjct  248   QVGAVLEDYPNLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCTDVFPVYIGDDRS  307

Query  1132  DEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWKrlalrrqsrlr  1311
             DEDAFKVLRE  QGFGILVSK+PK+T+ASYSLQEPSEVM FLRRLV WKR++LRRQ R+R
Sbjct  308   DEDAFKVLRERGQGFGILVSKIPKETNASYSLQEPSEVMAFLRRLVGWKRMSLRRQFRMR  367

Query  1312  rqlEEIKATLKN  1347
             R+LEEIK +L N
Sbjct  368   RRLEEIKVSLPN  379



>ref|XP_009797816.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009797817.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009797818.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Nicotiana sylvestris]
Length=374

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/381 (75%), Positives = 319/381 (84%), Gaps = 13/381 (3%)
 Frame = +1

Query  223   MTRHNVV-----AVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT+ NVV     A  +   F  A  KPP  PG  IN    S K L++   +N      ++
Sbjct  1     MTKQNVVDSDAKAGVNTATFTAAVQKPPPAPGSCINI---SRKTLVE---INSGPRINNN  54

Query  388   WVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             WVDSMRASSPT  K T LS+D+ +WM+ HPSAL+MFEQII ASKGK +VMFLDYDGTLSP
Sbjct  55    WVDSMRASSPTHHKYTSLSEDNTSWMVHHPSALNMFEQIIGASKGKKMVMFLDYDGTLSP  114

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IVDDPD AFMSD MR TVRKLA YFPTAIVSGRC DKVYSFV+LAELYYAGSHGMDI+GP
Sbjct  115   IVDDPDQAFMSDAMRGTVRKLARYFPTAIVSGRCRDKVYSFVQLAELYYAGSHGMDIEGP  174

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             S+GSKYKK A+  VLFQPAS+FLPMIDEVYK LL++T    GV+VENNKFCVSVHFRCVD
Sbjct  175   SKGSKYKKEAQA-VLFQPASDFLPMIDEVYKELLDKTKCIEGVRVENNKFCVSVHFRCVD  233

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +WGELAQ VRSVLKEYPKLRL+QGRKVLEIRPII+WDKGKALEFLL+SLGYAN T+VF
Sbjct  234   EKEWGELAQHVRSVLKEYPKLRLSQGRKVLEIRPIIKWDKGKALEFLLDSLGYANCTNVF  293

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWKrl  1284
             PVYIGDDRTDEDAFKVLRE  QGFGILVSK PKDT+ASYSLQEPSEVM+FLRRLVEWK+L
Sbjct  294   PVYIGDDRTDEDAFKVLRERGQGFGILVSKTPKDTYASYSLQEPSEVMIFLRRLVEWKKL  353

Query  1285  alrrqsrlrrqlEEIKATLKN  1347
              LRRQS++++Q+EEIKA+LKN
Sbjct  354   CLRRQSKIQKQIEEIKASLKN  374



>ref|XP_011022771.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Populus euphratica]
Length=374

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/348 (76%), Positives = 302/348 (87%), Gaps = 7/348 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V V++ + F TA  KPP  PGGYI+    S K+LL+NL++NG A ++++WVDSMRASSPT
Sbjct  21    VHVTNSSIFTTAAQKPPAAPGGYISI---SRKKLLKNLEINGGA-RINAWVDSMRASSPT  76

Query  421   Q-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFM  594
               KSTP +++D  +W++ HPSAL+MFEQII ASKGK IVMFLDYDGTLSPIVDDPD AFM
Sbjct  77    HIKSTPSVNEDQSSWIVHHPSALEMFEQIIDASKGKQIVMFLDYDGTLSPIVDDPDKAFM  136

Query  595   SDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA  774
             S  MRATVRKLA +FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP++GSKYKKG 
Sbjct  137   SKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGPAKGSKYKKGG  196

Query  775   EEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQ  954
             +  V+FQ ASEFLPMIDEVY+ L+E+T +TPG K ENNKFC+SVH+RCVDE KW  LAQ 
Sbjct  197   D-GVVFQAASEFLPMIDEVYEELVEKTKTTPGAKEENNKFCLSVHYRCVDEKKWSGLAQV  255

Query  955   VRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTD  1134
             V+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRTD
Sbjct  256   VKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRTD  315

Query  1135  EDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             EDAFKVLRE  QGFGILVSK+PKDT ASYSLQEP++VM FLRRLVEWK
Sbjct  316   EDAFKVLRERGQGFGILVSKIPKDTSASYSLQEPTQVMDFLRRLVEWK  363



>gb|EYU24005.1| hypothetical protein MIMGU_mgv1a007720mg [Erythranthe guttata]
Length=397

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/380 (75%), Positives = 315/380 (83%), Gaps = 13/380 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-------KVSSWVD  396
               AVS  + F TA  KPP VPG   ++   S K+LLQNLD+N AAA       ++++WVD
Sbjct  21    AAAVSGSSLFTTAAQKPPAVPG--TSYITISKKKLLQNLDINAAAAACGGGGARINAWVD  78

Query  397   SMRASSPTQKSTP--LSDDHRT-WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPI  567
             SMRASSPT   +P  LS DH+T W MQHPSALDMFEQI  ASKGK IVMFLDYDGTLSPI
Sbjct  79    SMRASSPTHMKSPPPLSGDHQTSWTMQHPSALDMFEQITNASKGKQIVMFLDYDGTLSPI  138

Query  568   VDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPS  747
             VDDPD AFMS+ MRATVRKLA YFPTAIVSGRC DKVYSFVRLAELYYAGSHGMDIKGPS
Sbjct  139   VDDPDRAFMSESMRATVRKLARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPS  198

Query  748   RGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDE  927
             +GS +KKGAE  VLFQPASE++PMIDEVYK LLE T +TPG KVENNKFC+SVHFRCVDE
Sbjct  199   KGSIHKKGAEA-VLFQPASEYIPMIDEVYKALLEVTKATPGAKVENNKFCLSVHFRCVDE  257

Query  928   LKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFP  1107
              KW ELA+QV SV++ YP LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN  DVFP
Sbjct  258   KKWIELAKQVGSVMEGYPDLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCADVFP  317

Query  1108  VYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWKrla  1287
             VYIGDDRTDEDAFKVLRE  QGFGILVSK PK+T+ASYSLQEP+EVM FLRRLV+WK+ A
Sbjct  318   VYIGDDRTDEDAFKVLRERGQGFGILVSKTPKETNASYSLQEPTEVMAFLRRLVDWKKSA  377

Query  1288  lrrqsrlrrqlEEIKATLKN  1347
             LR Q R+RR+LEEI   L N
Sbjct  378   LRNQFRMRRRLEEINMFLPN  397



>ref|XP_011022770.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Populus euphratica]
Length=376

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/350 (76%), Positives = 302/350 (86%), Gaps = 9/350 (3%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V V++ + F TA  KPP  PGGYI+    S K+LL+NL++NG A ++++WVDSMRASSPT
Sbjct  21    VHVTNSSIFTTAAQKPPAAPGGYISI---SRKKLLKNLEINGGA-RINAWVDSMRASSPT  76

Query  421   Q-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFM  594
               KSTP +++D  +W++ HPSAL+MFEQII ASKGK IVMFLDYDGTLSPIVDDPD AFM
Sbjct  77    HIKSTPSVNEDQSSWIVHHPSALEMFEQIIDASKGKQIVMFLDYDGTLSPIVDDPDKAFM  136

Query  595   SDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA  774
             S  MRATVRKLA +FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP++GSKYKKG 
Sbjct  137   SKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGPAKGSKYKKGG  196

Query  775   EEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDEL--KWGELA  948
             +  V+FQ ASEFLPMIDEVY+ L+E+T +TPG K ENNKFC+SVH+RCVDE   KW  LA
Sbjct  197   D-GVVFQAASEFLPMIDEVYEELVEKTKTTPGAKEENNKFCLSVHYRCVDEKVGKWSGLA  255

Query  949   QQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDR  1128
             Q V+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDR
Sbjct  256   QVVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDR  315

Query  1129  TDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             TDEDAFKVLRE  QGFGILVSK+PKDT ASYSLQEP++VM FLRRLVEWK
Sbjct  316   TDEDAFKVLRERGQGFGILVSKIPKDTSASYSLQEPTQVMDFLRRLVEWK  365



>ref|XP_002307096.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
 gb|ABK94249.1| unknown [Populus trichocarpa]
 gb|EEE94092.1| trehalose-6-phosphate phosphatase family protein [Populus trichocarpa]
Length=373

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/348 (76%), Positives = 299/348 (86%), Gaps = 7/348 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V V++ + F TA  KPP  PGGYI+    S K+LL+NL+++G A + ++WV+SMR SSPT
Sbjct  21    VHVTNSSIFTTAAQKPPAAPGGYISI---SRKKLLKNLEISGGA-RFNAWVNSMRTSSPT  76

Query  421   Q-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFM  594
               KSTP  +DD  +W++ HPSAL+MFEQII ASKGK IVMFLDYDGTLSPIVDDPD AFM
Sbjct  77    HVKSTPSANDDQSSWILHHPSALEMFEQIIDASKGKQIVMFLDYDGTLSPIVDDPDRAFM  136

Query  595   SDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA  774
             S  MRATVRKLA +FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP++GSKYKKG+
Sbjct  137   SKKMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGPAKGSKYKKGS  196

Query  775   EEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQ  954
             E  V+FQ  SEFLPMIDEVYK L+E+T +TPG KVENNKFC+SVH+RCVDE KW  LAQ 
Sbjct  197   E-GVVFQAGSEFLPMIDEVYKELVEKTKTTPGAKVENNKFCLSVHYRCVDEKKWSGLAQV  255

Query  955   VRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTD  1134
             V+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRTD
Sbjct  256   VKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRTD  315

Query  1135  EDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             EDAFKVLRE  QGFGILVSK PKDT ASYSLQEP++VM FL+RLV+WK
Sbjct  316   EDAFKVLRERGQGFGILVSKFPKDTSASYSLQEPTQVMDFLQRLVQWK  363



>gb|EYU31023.1| hypothetical protein MIMGU_mgv1a008338mg [Erythranthe guttata]
Length=377

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/360 (76%), Positives = 310/360 (86%), Gaps = 8/360 (2%)
 Frame = +1

Query  274   AGHKPPVVP-GGYINFDVTSGKELLQN--LDVNGAAAKVSSWVDSMRASSPTQ-KSTPLS  441
             +G  P   P G YI+      K+LLQN  LD++ + ++ ++WVDSMRASSPT+ KS+P S
Sbjct  20    SGFSPAAAPPGTYISI---PKKKLLQNNNLDISSSNSRTNTWVDSMRASSPTRIKSSPFS  76

Query  442   DDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVR  621
             DD  +WM+QHPSAL++F++I  ASKGK IVMFLDYDGTLSPIVDDPD AFMSD MRATVR
Sbjct  77    DDQNSWMVQHPSALNVFDEITSASKGKQIVMFLDYDGTLSPIVDDPDRAFMSDAMRATVR  136

Query  622   KLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPA  801
             KLA YFPTAIVSGRC DKVYSFVRLAELYYAGSHGMDIKGPS+GSKY KG++  VLFQPA
Sbjct  137   KLARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPSKGSKYTKGSQA-VLFQPA  195

Query  802   SEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYP  981
             SEFLPMIDEVYK LLE T STPG +VENNKFCVSVHFRCVDE +W ELA+QV SVL+ YP
Sbjct  196   SEFLPMIDEVYKALLEVTKSTPGSRVENNKFCVSVHFRCVDEKRWNELARQVGSVLEGYP  255

Query  982   KLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRE  1161
              LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN TDVFPVYIGDDRTDEDAFKVLRE
Sbjct  256   DLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCTDVFPVYIGDDRTDEDAFKVLRE  315

Query  1162  TRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWKrlalrrqsrlrrqlEEIKATL  1341
               QGFGILVSK PK+T+ASYSLQEPSEVM FLRRLV WK+++LRRQ R+RR++EEIK +L
Sbjct  316   RGQGFGILVSKAPKETNASYSLQEPSEVMAFLRRLVSWKKMSLRRQFRMRRRVEEIKMSL  375



>emb|CDP01436.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/352 (77%), Positives = 295/352 (84%), Gaps = 10/352 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSP  417
              VAV++   F TA  KPP VPG Y +    S K+LLQNL++N   AK++SWVDSMRASSP
Sbjct  20    AVAVTNSALFTTASQKPPAVPGTYFSI---SKKKLLQNLEIN-TGAKINSWVDSMRASSP  75

Query  418   TQ-KSTP--LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSA  588
             T  KSTP   SDD  +  + HPSALDMFEQI  ASKGK IVMFLDYDGTLSPIV+DPD A
Sbjct  76    THLKSTPPLSSDDQSSSTLHHPSALDMFEQITNASKGKQIVMFLDYDGTLSPIVEDPDRA  135

Query  589   FMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKK  768
             FMSD MRA VRKLA  FPTAIVSGRC DKVYSFVRLAELYYAGSHGMDIKGPS+GSK+KK
Sbjct  136   FMSDAMRAAVRKLAGCFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPSKGSKHKK  195

Query  769   GAEEDVLFQP--ASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGE  942
             GA+  VLFQP  A+EFLPMIDEVY+ LLE+T ST G KVENNKFCVSVHFRCVDE KW E
Sbjct  196   GAQA-VLFQPDTANEFLPMIDEVYEALLEKTKSTEGAKVENNKFCVSVHFRCVDEKKWVE  254

Query  943   LAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGD  1122
             LAQQV+SVL +YPKLRLTQGR VLEIRP I+WDKGKALEFLLESLGYAN  DVFPVYIGD
Sbjct  255   LAQQVKSVLMDYPKLRLTQGRMVLEIRPTIKWDKGKALEFLLESLGYANRKDVFPVYIGD  314

Query  1123  DRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DRTDEDAFKVL+E RQGFGILVSK PK+T ASYSLQEP EVM FL+RLV+WK
Sbjct  315   DRTDEDAFKVLKERRQGFGILVSKTPKETSASYSLQEPGEVMNFLQRLVQWK  366



>gb|KDP46861.1| hypothetical protein JCGZ_24070 [Jatropha curcas]
Length=374

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/349 (78%), Positives = 302/349 (87%), Gaps = 8/349 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V VS+ N F TA  KPP  P GYI+    S K+LL+NL++NG   ++++WV+SMRASSPT
Sbjct  21    VHVSNSNIFTTAAQKPPAAPAGYISI---SRKKLLKNLEINGGP-RINAWVESMRASSPT  76

Query  421   Q-KSTP--LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAF  591
               KSTP  L+DD R+W++ HPSALDMFEQII ASKGK IVMFLDYDGTLSPIVDDPD AF
Sbjct  77    HLKSTPPSLTDDQRSWILHHPSALDMFEQIIDASKGKQIVMFLDYDGTLSPIVDDPDRAF  136

Query  592   MSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKG  771
             MS  MRATVR+LA  FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP++GSKYKKG
Sbjct  137   MSKKMRATVRRLARCFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGPAKGSKYKKG  196

Query  772   AEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQ  951
               E ++FQPASEFLPMIDEVYK L+E+T ST G KVENNKFCVSVHFRCVDE KW ELAQ
Sbjct  197   -NEGLIFQPASEFLPMIDEVYKELVEKTKSTAGAKVENNKFCVSVHFRCVDEKKWSELAQ  255

Query  952   QVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRT  1131
              VRSVLK+YPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRT
Sbjct  256   VVRSVLKDYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRT  315

Query  1132  DEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DEDAFKVLRE  QGFGILVSK PKDT+ASYSLQEP++VM FL+RLVEWK
Sbjct  316   DEDAFKVLRERGQGFGILVSKFPKDTNASYSLQEPTQVMDFLQRLVEWK  364



>ref|XP_006601938.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=365

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/360 (73%), Positives = 300/360 (83%), Gaps = 13/360 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVS  384
             MT+ NVV VSD         FPT   KPP  PGGYI+      + +L+NL++NG   +++
Sbjct  1     MTQQNVV-VSDTKSGVSLTVFPTTTQKPPAAPGGYISI---PRRRVLKNLEINGGQ-RIN  55

Query  385   SWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             +WV+SMRASSPT  KSTPLS +H +W++ HPSALDMF+QII ASKGK IVMFLDYDGTLS
Sbjct  56    AWVESMRASSPTHHKSTPLSQEHNSWILHHPSALDMFDQIIDASKGKQIVMFLDYDGTLS  115

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIVDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVY+FVRLAELYYAGSHGMDIKG
Sbjct  116   PIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIKG  175

Query  742   PSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             P+R SKY K ++ E +L QPAS+FLP+IDEVY+ L+E+T STPG  VENNKFC+SVHFRC
Sbjct  176   PTRSSKYNKDSKAEAILCQPASDFLPLIDEVYQQLVEKTKSTPGALVENNKFCLSVHFRC  235

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW ELA+QV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG AN +D
Sbjct  236   VDEKKWSELARQVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLANCSD  295

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDDR+DEDAFK LR+  QGFGILVSK PKDT ASYSLQEP+EVM FL+RLVEWK
Sbjct  296   VFPVYIGDDRSDEDAFKKLRDRGQGFGILVSKFPKDTSASYSLQEPNEVMNFLQRLVEWK  355



>ref|XP_011030992.1| PREDICTED: probable trehalose-phosphate phosphatase J [Populus 
euphratica]
Length=373

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/348 (75%), Positives = 296/348 (85%), Gaps = 7/348 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V V++ + F TA  KPP  PGGYI     S  +LL+NL+++G A + ++WV+SMR SSPT
Sbjct  21    VHVTNSSIFTTAKQKPPAAPGGYITI---SRNKLLKNLEISGGA-RFNAWVNSMRTSSPT  76

Query  421   Q-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFM  594
                STP ++DD  +W++ HPSAL+MF QII ASKGK IVMFLDYDGTLSPIVDDPD AFM
Sbjct  77    HVNSTPSVNDDQSSWILHHPSALEMFGQIIDASKGKQIVMFLDYDGTLSPIVDDPDRAFM  136

Query  595   SDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA  774
             S  MRATVRKLA +FPTAIVSGRC DKVY+FVRLAELYYAGSHGMDIKGP++GSKYKKG+
Sbjct  137   SKQMRATVRKLARFFPTAIVSGRCRDKVYNFVRLAELYYAGSHGMDIKGPAKGSKYKKGS  196

Query  775   EEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQ  954
             E  V+FQ  SEFLPMIDEVYK L+E+T +TPG KVENNKFC+SVH+RCVDE KW  LAQ 
Sbjct  197   E-GVVFQAGSEFLPMIDEVYKELVERTKTTPGAKVENNKFCLSVHYRCVDEKKWSGLAQV  255

Query  955   VRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTD  1134
             V+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRTD
Sbjct  256   VKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRTD  315

Query  1135  EDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             EDAFKVLRE  QGFGILVSK PKDT ASYSLQEP++VM FL+RLV+WK
Sbjct  316   EDAFKVLRERGQGFGILVSKFPKDTSASYSLQEPTQVMDFLQRLVQWK  363



>ref|XP_007205367.1| hypothetical protein PRUPE_ppa007221mg [Prunus persica]
 gb|EMJ06566.1| hypothetical protein PRUPE_ppa007221mg [Prunus persica]
Length=377

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/371 (71%), Positives = 302/371 (81%), Gaps = 8/371 (2%)
 Frame = +1

Query  178   LERRSCLFTRLAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELL--QN  351
             + +++ + +    E M     VAVS+ + F     KPPV P GYI+    S K  L  +N
Sbjct  1     MTKQNVVVSDAEAEIMNMAISVAVSNSSIFTAVAEKPPVGPPGYISI---SRKRFLNLKN  57

Query  352   LDVNGAAAKVSSWVDSMRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKN  525
             LD    A +++SWVDSMRASSPT  + S+ L +D  +W++QHPSALDMFEQII ASKGK 
Sbjct  58    LDSINGAERINSWVDSMRASSPTHLKSSSFLKEDQSSWILQHPSALDMFEQIIDASKGKQ  117

Query  526   IVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAEL  705
             IVMF+DYDGTLSPIV+DPD AFMSD MR TV+K+A  FPTAIVSGRC DKVY FV+LAEL
Sbjct  118   IVMFMDYDGTLSPIVEDPDRAFMSDAMRKTVKKVARCFPTAIVSGRCRDKVYKFVKLAEL  177

Query  706   YYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVEN  885
             YYAGSHGMDIKGP++GSKYK G++  VL QPASEFLPMIDEVYK L+E+T STPG KVEN
Sbjct  178   YYAGSHGMDIKGPAKGSKYKTGSQ-GVLCQPASEFLPMIDEVYKLLVEKTKSTPGAKVEN  236

Query  886   NKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFL  1065
             NKFC+SVHFRCVDE KW ELA QVRSVLK+YPKLRLTQGRKVLEIRP I+WDKGKALEFL
Sbjct  237   NKFCLSVHFRCVDEKKWTELALQVRSVLKDYPKLRLTQGRKVLEIRPTIKWDKGKALEFL  296

Query  1066  LESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             LESLGYAN TDVFPVYIGDDRTDEDAFK+LRE  QGFGILVSK PK+T A+YSLQEP+EV
Sbjct  297   LESLGYANCTDVFPVYIGDDRTDEDAFKILRERGQGFGILVSKTPKETTATYSLQEPAEV  356

Query  1246  MLFLRRLVEWK  1278
             M FL+RLVEWK
Sbjct  357   MDFLQRLVEWK  367



>ref|XP_010027843.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Eucalyptus grandis]
Length=374

 Score =   526 bits (1354),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 262/339 (77%), Positives = 294/339 (87%), Gaps = 11/339 (3%)
 Frame = +1

Query  280   HKPPVVP--GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP--LSD  444
              KPPV P  GG+      S ++LL+NL+VN +A ++SSWVDSM+ASSPT  K+ P  L++
Sbjct  37    QKPPVAPAAGGFFKI---SRRKLLKNLEVN-SAERISSWVDSMKASSPTHVKAAPRSLTE  92

Query  445   DHRT-WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVR  621
             DH + WM+ HPSALDMFEQII AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MRATV+
Sbjct  93    DHSSSWMLHHPSALDMFEQIIDASQGKQIVMFLDYDGTLSPIVDDPDQAFMSKKMRATVK  152

Query  622   KLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPA  801
             KLA  FPTAIVSGRC DKVYSFVRL ELYYAGSHGMDIKGP++GSKYKKG ++ VLFQPA
Sbjct  153   KLARCFPTAIVSGRCRDKVYSFVRLGELYYAGSHGMDIKGPAKGSKYKKG-DQSVLFQPA  211

Query  802   SEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYP  981
             SEFLPMIDEVYK L+E+T STPG KVENNKFCVSVHFR VDE +W ELAQQVRSV+KEYP
Sbjct  212   SEFLPMIDEVYKKLVEKTKSTPGAKVENNKFCVSVHFRRVDEKEWTELAQQVRSVIKEYP  271

Query  982   KLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRE  1161
             KLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN T+VFPVYIGDDRTDEDAFK+LR+
Sbjct  272   KLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTNVFPVYIGDDRTDEDAFKILRD  331

Query  1162  TRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
               QGFGI+VSK PK+T+ASYSLQEP EVM FLRRLVEWK
Sbjct  332   RGQGFGIIVSKFPKETNASYSLQEPEEVMNFLRRLVEWK  370



>ref|XP_010519807.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Tarenaya hassleriana]
Length=377

 Score =   524 bits (1350),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 268/369 (73%), Positives = 303/369 (82%), Gaps = 21/369 (6%)
 Frame = +1

Query  217   EKMTRHNVV-----------AVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVN  363
             ++M   NVV           AVS+   F  +  KPP  PG YI+    S K+LL+NLD+N
Sbjct  9     QRMATQNVVVSESKSGIIAMAVSNSAVFTPSAQKPPTAPG-YISI---SRKKLLKNLDIN  64

Query  364   GAAAKVSSWVDSMRASSPTQ-KSTP-LSDDHR-TWMMQHPSALDMFEQIIKASKGKNIVM  534
             G   ++++WVDSMRASSPT  KS P LS D R +W+MQHPSALDMFEQII+AS+GK IVM
Sbjct  65    GGH-RINAWVDSMRASSPTHLKSVPSLSADERNSWIMQHPSALDMFEQIIEASRGKQIVM  123

Query  535   FLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYA  714
             FLDYDGTLSPIV+DPD AFMS  MR TVRK+A  FPTAIVSGRC DKVYSFV+LAELYYA
Sbjct  124   FLDYDGTLSPIVEDPDRAFMSSKMRRTVRKVAKCFPTAIVSGRCRDKVYSFVKLAELYYA  183

Query  715   GSHGMDIKGPSRG-SKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNK  891
             GSHGMDIKGP++G SKYKK  ++ VLFQPASEFLP+IDEVYK L+E T S PG KVENN+
Sbjct  184   GSHGMDIKGPTKGFSKYKKD-KQSVLFQPASEFLPLIDEVYKQLVENTKSVPGAKVENNR  242

Query  892   FCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLE  1071
             FCVSVHFRCVDE KW ELAQ+VRSVLKEYP+LRLTQGRKVLEIRP I+WDKGKALEFLLE
Sbjct  243   FCVSVHFRCVDEQKWSELAQRVRSVLKEYPQLRLTQGRKVLEIRPTIKWDKGKALEFLLE  302

Query  1072  SLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVML  1251
             SLG+ N  +VFPVYIGDDRTDEDAFK+LRE  QGFGILVSK PKDT+ASYSLQEP+EVM 
Sbjct  303   SLGFGNCNNVFPVYIGDDRTDEDAFKMLRERGQGFGILVSKFPKDTNASYSLQEPAEVMD  362

Query  1252  FLRRLVEWK  1278
             FLRRLV+WK
Sbjct  363   FLRRLVDWK  371



>ref|XP_010546407.1| PREDICTED: probable trehalose-phosphate phosphatase J [Tarenaya 
hassleriana]
Length=378

 Score =   524 bits (1350),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 266/377 (71%), Positives = 307/377 (81%), Gaps = 11/377 (3%)
 Frame = +1

Query  166   FVYFLERRSCLFTRLAEEKMTRHNVVAVS--DPNRFPTAGHKPPVVPGGYINFDVTSGKE  339
              V F+E +  + T+       +  ++AVS  +P+ FP +  KPP   G YI+    S K+
Sbjct  1     MVSFIEEKQRMATQNVVVSDAKSGIIAVSVANPSVFPPSAQKPPTALG-YISI---SRKK  56

Query  340   LLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP-LSDDHR-TWMMQHPSALDMFEQIIKA  510
             LL+NL++NG   ++++WVDSMRASSPT  KS P LS + R +W+MQHPSALDMFEQII+A
Sbjct  57    LLKNLEINGGQ-RINAWVDSMRASSPTHLKSVPSLSAEERNSWIMQHPSALDMFEQIIEA  115

Query  511   SKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFV  690
             S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC DKVY FV
Sbjct  116   SRGKRIVMFLDYDGTLSPIVDDPDRAFMSSKMRRTVRKLAKCFPTAIVSGRCGDKVYEFV  175

Query  691   RLAELYYAGSHGMDIKGPSRG-SKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTP  867
             +LAELYYAG HGMDIKGP++G SKY K  +  VLFQPAS+FLPMID VYK L+E+T STP
Sbjct  176   KLAELYYAGRHGMDIKGPTKGLSKYNKDKQPSVLFQPASDFLPMIDGVYKQLMEKTKSTP  235

Query  868   GVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKG  1047
             G KVENNKFCVSVHFRCVDE KW ELAQQVRSVLK YPKLRLTQGRKVLEIRP I+WDKG
Sbjct  236   GAKVENNKFCVSVHFRCVDEKKWSELAQQVRSVLKGYPKLRLTQGRKVLEIRPTIKWDKG  295

Query  1048  KALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSL  1227
             KALEFLLESLG+ +  DVFPVYIGDDRTDEDAF++LRE  QGFGILVSK+PKDT+ASYSL
Sbjct  296   KALEFLLESLGFGDCNDVFPVYIGDDRTDEDAFQILRERGQGFGILVSKIPKDTNASYSL  355

Query  1228  QEPSEVMLFLRRLVEWK  1278
             QEP+EVM FL+RLV+WK
Sbjct  356   QEPAEVMDFLQRLVDWK  372



>ref|XP_010519815.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Tarenaya hassleriana]
Length=367

 Score =   524 bits (1349),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 298/350 (85%), Gaps = 10/350 (3%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             +AVS+   F  +  KPP  PG YI+    S K+LL+NLD+NG   ++++WVDSMRASSPT
Sbjct  18    MAVSNSAVFTPSAQKPPTAPG-YISI---SRKKLLKNLDINGGH-RINAWVDSMRASSPT  72

Query  421   Q-KSTP-LSDDHR-TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAF  591
               KS P LS D R +W+MQHPSALDMFEQII+AS+GK IVMFLDYDGTLSPIV+DPD AF
Sbjct  73    HLKSVPSLSADERNSWIMQHPSALDMFEQIIEASRGKQIVMFLDYDGTLSPIVEDPDRAF  132

Query  592   MSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SKYKK  768
             MS  MR TVRK+A  FPTAIVSGRC DKVYSFV+LAELYYAGSHGMDIKGP++G SKYKK
Sbjct  133   MSSKMRRTVRKVAKCFPTAIVSGRCRDKVYSFVKLAELYYAGSHGMDIKGPTKGFSKYKK  192

Query  769   GAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELA  948
               ++ VLFQPASEFLP+IDEVYK L+E T S PG KVENN+FCVSVHFRCVDE KW ELA
Sbjct  193   D-KQSVLFQPASEFLPLIDEVYKQLVENTKSVPGAKVENNRFCVSVHFRCVDEQKWSELA  251

Query  949   QQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDR  1128
             Q+VRSVLKEYP+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG+ N  +VFPVYIGDDR
Sbjct  252   QRVRSVLKEYPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFGNCNNVFPVYIGDDR  311

Query  1129  TDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             TDEDAFK+LRE  QGFGILVSK PKDT+ASYSLQEP+EVM FLRRLV+WK
Sbjct  312   TDEDAFKMLRERGQGFGILVSKFPKDTNASYSLQEPAEVMDFLRRLVDWK  361



>ref|XP_007047993.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Theobroma cacao]
 gb|EOX92150.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Theobroma cacao]
Length=375

 Score =   523 bits (1348),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 263/337 (78%), Positives = 285/337 (85%), Gaps = 8/337 (2%)
 Frame = +1

Query  274   AGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP-LSDD  447
             +  KPP  P GYI+    S K+LLQNL++N A  ++++WVDSMRASSPT  KSTP L DD
Sbjct  35    SAQKPPA-PPGYISI---SRKKLLQNLEIN-AGGRINAWVDSMRASSPTHIKSTPSLIDD  89

Query  448   HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKL  627
               +W +QHPSAL+MFEQII AS GK IVMFLDYDGTLSPIV+DPD AFMS  MR TVRKL
Sbjct  90    QSSWNLQHPSALEMFEQIIDASTGKQIVMFLDYDGTLSPIVEDPDRAFMSKKMRKTVRKL  149

Query  628   ATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASE  807
             A  FPTAIVSGRC DKVY FV+LAELYYAGSHGMDIKGP + SK  K +E  VLFQPASE
Sbjct  150   AKCFPTAIVSGRCRDKVYKFVKLAELYYAGSHGMDIKGPEKRSKSNKDSES-VLFQPASE  208

Query  808   FLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKL  987
             FLPMIDEVYK L+E T STPG KVENNKFC+SVHFRCVDE KW ELAQQVRSVLKEYPKL
Sbjct  209   FLPMIDEVYKQLVETTKSTPGAKVENNKFCLSVHFRCVDEKKWTELAQQVRSVLKEYPKL  268

Query  988   RLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETR  1167
             RLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRTDEDAFK+LR+  
Sbjct  269   RLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRTDEDAFKILRDRG  328

Query  1168  QGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             QGFGILVSK PKDT ASYSLQEP EVM FLRRLVEWK
Sbjct  329   QGFGILVSKFPKDTSASYSLQEPDEVMDFLRRLVEWK  365



>gb|KHG13010.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=347

 Score =   521 bits (1341),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 262/339 (77%), Positives = 283/339 (83%), Gaps = 8/339 (2%)
 Frame = +1

Query  268   PTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP-LS  441
             P +  KPP  PG    F   S K+LLQNL++N A A+V+SWVDSMRASSPT  KS P  +
Sbjct  5     PKSAQKPPAPPG----FISISRKKLLQNLEIN-AGARVNSWVDSMRASSPTHMKSAPSTA  59

Query  442   DDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVR  621
             DD  +W + HPSALDMFEQII ASKGK IVMFLDYDGTLSPIV DPD AFMS  MR TVR
Sbjct  60    DDQGSWNLNHPSALDMFEQIIDASKGKQIVMFLDYDGTLSPIVADPDRAFMSKKMRKTVR  119

Query  622   KLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPA  801
             KLA  FPTAIVSGRC DKVY+FV+LAELYYAGSHGMDIKGP + SK  K  E  VLFQPA
Sbjct  120   KLAKCFPTAIVSGRCRDKVYNFVKLAELYYAGSHGMDIKGPEKCSKSNKDTES-VLFQPA  178

Query  802   SEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYP  981
             SEFLPMIDEVY  L+E T STPG KVENNKFC+SVHFRCVDE KW ELAQQV+SVLK+YP
Sbjct  179   SEFLPMIDEVYTQLVETTKSTPGAKVENNKFCLSVHFRCVDEKKWSELAQQVKSVLKDYP  238

Query  982   KLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRE  1161
             KLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN TDVFPVYIGDDRTDEDAFK+LR+
Sbjct  239   KLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTDVFPVYIGDDRTDEDAFKILRD  298

Query  1162  TRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
               QGFGILVSK PKDT+ASYSLQEP EVM FLRRLVEWK
Sbjct  299   RGQGFGILVSKFPKDTNASYSLQEPDEVMDFLRRLVEWK  337



>ref|XP_006591511.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=363

 Score =   521 bits (1342),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 263/361 (73%), Positives = 299/361 (83%), Gaps = 15/361 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVS  384
             MT+ NVV VSD         F T   KPP  PGGYI+      + +L+NL++NG   +++
Sbjct  1     MTQQNVV-VSDTKSGVSLTVFSTT-QKPPAAPGGYISI---PRRRVLKNLEINGGQ-RIN  54

Query  385   SWVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +WV+SMRASSPT  KSTP LS +H +W++ HPSALDMF+QII ASKGK IVMFLDYDGTL
Sbjct  55    AWVESMRASSPTHHKSTPSLSQEHNSWILHHPSALDMFDQIIDASKGKQIVMFLDYDGTL  114

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVY+FVRLAELYYAGSHGMDIK
Sbjct  115   SPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIK  174

Query  739   GPSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFR  915
             GP+R SKY K ++ E +L QPAS+FLPMIDEVY+ L+E+T STPG  VENNKFC+SVHFR
Sbjct  175   GPTRSSKYNKDSKAEAILCQPASDFLPMIDEVYQQLVEKTKSTPGALVENNKFCLSVHFR  234

Query  916   CVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANST  1095
             CVDE KW ELA+QV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG AN +
Sbjct  235   CVDEKKWSELARQVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLANCS  294

Query  1096  DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEW  1275
             DVFPVYIGDDR+DEDAFK LR+  QGFGILVSK PKDT ASYSLQEP+EVM FL+RLVEW
Sbjct  295   DVFPVYIGDDRSDEDAFKKLRDRGQGFGILVSKFPKDTSASYSLQEPNEVMNFLQRLVEW  354

Query  1276  K  1278
             K
Sbjct  355   K  355



>ref|XP_007163639.1| hypothetical protein PHAVU_001G251300g [Phaseolus vulgaris]
 gb|ESW35633.1| hypothetical protein PHAVU_001G251300g [Phaseolus vulgaris]
Length=367

 Score =   519 bits (1336),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 262/362 (72%), Positives = 300/362 (83%), Gaps = 15/362 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR------FPT-AGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKV  381
             MT+ NVV VSD         FPT A  KPP  PGGYI+    S + +L+NL++NG   ++
Sbjct  1     MTQQNVV-VSDTKSGVPLTVFPTPAQKKPPAAPGGYISI---SRRRVLKNLEINGDQ-RI  55

Query  382   SSWVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGT  555
             ++WV+SMRASSPT  KSTP  S +  +W++ HPSALDMF+QII ASKGK IVMFLDYDGT
Sbjct  56    NAWVESMRASSPTHLKSTPSFSQEQNSWILHHPSALDMFDQIIDASKGKQIVMFLDYDGT  115

Query  556   LSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDI  735
             LSPIV+DPD AFMS  MR TVRKLA  FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDI
Sbjct  116   LSPIVEDPDRAFMSHSMRKTVRKLARCFPTAIVTGRCKDKVYNFVQLAELYYAGSHGMDI  175

Query  736   KGPSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHF  912
             KGP+R SKY K A+ E +LFQPAS+FLPMIDEVY+ L+E+T STPG  VENNKFC+SVHF
Sbjct  176   KGPTRSSKYNKDAKAEAILFQPASDFLPMIDEVYQQLVEKTKSTPGAMVENNKFCLSVHF  235

Query  913   RCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANS  1092
             RCVDE KW +LA+QV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG AN 
Sbjct  236   RCVDEKKWSDLARQVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLANC  295

Query  1093  TDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVE  1272
             +DVFPVYIGDDR+DEDAFK LR+  QGFGILVSK PKDT ASYSLQEP+EVM FL+RLVE
Sbjct  296   SDVFPVYIGDDRSDEDAFKKLRDRGQGFGILVSKFPKDTSASYSLQEPNEVMNFLQRLVE  355

Query  1273  WK  1278
             WK
Sbjct  356   WK  357



>ref|XP_007159639.1| hypothetical protein PHAVU_002G254600g [Phaseolus vulgaris]
 gb|ESW31633.1| hypothetical protein PHAVU_002G254600g [Phaseolus vulgaris]
Length=366

 Score =   516 bits (1330),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 258/358 (72%), Positives = 292/358 (82%), Gaps = 10/358 (3%)
 Frame = +1

Query  223   MTRHNVV---AVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWV  393
             MT+ NVV     S  NR  T   KPP  PGGYI       + +L+NL++NG   ++++WV
Sbjct  1     MTQQNVVLSKTKSGINRDLTVAQKPPAAPGGYIPI---PRRRVLKNLEINGGQ-RINAWV  56

Query  394   DSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPI  567
             DSMRASSPTQ KST   +++H +W+++HPSALDMFEQI+ AS+GK IVMFLDYDGTLSPI
Sbjct  57    DSMRASSPTQAKSTSSFAEEHSSWILRHPSALDMFEQIMDASRGKQIVMFLDYDGTLSPI  116

Query  568   VDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPS  747
             VDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVY+FVRLAELYYAGSHGMDI+GP+
Sbjct  117   VDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIQGPT  176

Query  748   RGSKY-KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             R SKY  K   E +LFQPASEFLPMIDEVY  L+E+  S PG +VENNKFC SVHFRCVD
Sbjct  177   RDSKYSNKDKGEPLLFQPASEFLPMIDEVYNQLVEKMKSIPGARVENNKFCASVHFRCVD  236

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E KW ELAQ+VRSVLKEYPKLRL QGRKVLEIRP I+WDKGKALEFLLESLG+AN  DVF
Sbjct  237   EKKWSELAQEVRSVLKEYPKLRLNQGRKVLEIRPSIKWDKGKALEFLLESLGFANCNDVF  296

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDD+TDEDAF  LR+  QGFGILVSK PKDT ASYSLQEP+EVM FL+RLVEWK
Sbjct  297   PVYIGDDKTDEDAFMKLRDRGQGFGILVSKFPKDTTASYSLQEPNEVMDFLQRLVEWK  354



>ref|XP_004502438.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X2 [Cicer arietinum]
Length=365

 Score =   516 bits (1329),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 257/360 (71%), Positives = 302/360 (84%), Gaps = 13/360 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR----FPTAGHKPPVVPGG-YINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT+ NV+ VSD       FPT   KPP  PGG YI+      + +L++L++NG   ++++
Sbjct  1     MTQQNVL-VSDTKSGVTVFPTTSQKPPPAPGGGYISI---QRRWVLKDLEINGGQ-RINA  55

Query  388   WVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             W++SMRASSPT  KSTP  +++  +W++ HPSALDMF+QII+ASKGK IVMFLDYDGTLS
Sbjct  56    WLESMRASSPTHLKSTPSFAEEQTSWILHHPSALDMFDQIIEASKGKQIVMFLDYDGTLS  115

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIV+DPD AFMSD MR TVRKLA YFPTAIV+GRC DKVY+FVRLAELYYAGSHGMDIKG
Sbjct  116   PIVEDPDRAFMSDSMRKTVRKLARYFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIKG  175

Query  742   PSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             P+R SKY KG++ + VL+QPASEFLPMIDEVYK L+++T STPG KVENNKFCVSVHFRC
Sbjct  176   PTRSSKYNKGSKAQAVLYQPASEFLPMIDEVYKQLVDKTKSTPGAKVENNKFCVSVHFRC  235

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW ELA QV+SVLK++PKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG  N +D
Sbjct  236   VDEKKWSELAHQVKSVLKDHPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLGNCSD  295

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFP+YIGDDR+DEDAFK LR+  QGFGILVSK  KDT+ASYSLQEP+EVM FL+RLVEWK
Sbjct  296   VFPIYIGDDRSDEDAFKKLRDRGQGFGILVSKFAKDTNASYSLQEPNEVMKFLQRLVEWK  355



>gb|KHG28413.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=369

 Score =   516 bits (1328),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 267/372 (72%), Positives = 293/372 (79%), Gaps = 10/372 (3%)
 Frame = +1

Query  166   FVYFLERRSCLFTRLAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELL  345
              V FLE R+       +  MT  +  +V + +   T   + P  P GYI+    S K LL
Sbjct  1     MVSFLEERAKNIGGGGQNIMT--DAKSVLNMSITVTVSAQKPPAPHGYISI---STKRLL  55

Query  346   QNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGK  522
              NL++N A A+ S WVDSMRASSPT  KSTP  DD   W + HPSAL+MFEQII ASKGK
Sbjct  56    HNLEIN-AGARASVWVDSMRASSPTHIKSTP--DDQGAWNLHHPSALEMFEQIIDASKGK  112

Query  523   NIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAE  702
              I+MFLDYDGTLSPIV+DPD AFMS+ MR TVRKLA  FPTAIVSGRC DKVY FV+LAE
Sbjct  113   QIIMFLDYDGTLSPIVEDPDRAFMSNKMRKTVRKLAKCFPTAIVSGRCRDKVYKFVKLAE  172

Query  703   LYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVE  882
             LYYAGSHGMDIKGP + SK  K   E VLFQPASEFLPMIDEVYK L+E T STPG KVE
Sbjct  173   LYYAGSHGMDIKGPEKRSKTDK-VTEHVLFQPASEFLPMIDEVYKQLVETTKSTPGAKVE  231

Query  883   NNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEF  1062
             NNKFC+SVHFRCVDE KW  LAQQV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEF
Sbjct  232   NNKFCLSVHFRCVDEKKWSGLAQQVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEF  291

Query  1063  LLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSE  1242
             LLESLG+AN TDVFPVYIGDDRTDEDAFK+LR+  QGFGILVSK PKDT+ASYSLQEP E
Sbjct  292   LLESLGFANCTDVFPVYIGDDRTDEDAFKILRDRGQGFGILVSKYPKDTNASYSLQEPDE  351

Query  1243  VMLFLRRLVEWK  1278
             VM FLRRLVEWK
Sbjct  352   VMDFLRRLVEWK  363



>ref|XP_002263078.1| PREDICTED: probable trehalose-phosphate phosphatase J [Vitis 
vinifera]
 emb|CBI40999.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   512 bits (1319),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 259/367 (71%), Positives = 290/367 (79%), Gaps = 26/367 (7%)
 Frame = +1

Query  223   MTRHNVVA--------------VSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDV  360
             MTR NVV               VS+ + F  A  K     GG IN      K++      
Sbjct  1     MTRQNVVVADSKSGINVAITMTVSNSSLFTKAVQKTRETQGGCINI---PPKKV------  51

Query  361   NGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMF  537
              G  A++++WVDSMRASSPT+ KS     D  +WM++HPSAL+MFEQII+ASKGK IVMF
Sbjct  52    -GGGARINAWVDSMRASSPTRVKSAASLSDQNSWMLRHPSALNMFEQIIEASKGKQIVMF  110

Query  538   LDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAG  717
             LDYDGTLSPIVDDPD AFMSD MRA VR+LA YFPTAIVSGRC DKVY+FVRLAELYYAG
Sbjct  111   LDYDGTLSPIVDDPDRAFMSDAMRAAVRQLARYFPTAIVSGRCRDKVYNFVRLAELYYAG  170

Query  718   SHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFC  897
             SHGMDIKGP++GSKYKK  +  VLFQPASEFLPMIDEVYK LLE+T S PG  VE+NKFC
Sbjct  171   SHGMDIKGPAKGSKYKKETKA-VLFQPASEFLPMIDEVYKALLEKTKSIPGASVEHNKFC  229

Query  898   VSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESL  1077
             +SVH+RCVDE KW  LAQQVRSVL++YPKLRLTQGRKVLEIRP I+WDKGKALEFLLESL
Sbjct  230   LSVHYRCVDEKKWSILAQQVRSVLQQYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESL  289

Query  1078  GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFL  1257
             G+ N TDVFPVYIGDDRTDEDAFK+LR+  QGFGILVSK+PKDT ASYSLQEP EVM FL
Sbjct  290   GFGNCTDVFPVYIGDDRTDEDAFKILRDRGQGFGILVSKIPKDTSASYSLQEPLEVMYFL  349

Query  1258  RRLVEWK  1278
             +RLVEWK
Sbjct  350   QRLVEWK  356



>ref|XP_004146870.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 ref|XP_004167555.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 gb|KGN53223.1| hypothetical protein Csa_4G028470 [Cucumis sativus]
Length=381

 Score =   513 bits (1320),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 259/358 (72%), Positives = 295/358 (82%), Gaps = 21/358 (6%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGG------YINFDVTSGKELLQNLDVNGAAAKVSSWVDSM  402
             VAVS+ + F T   KPP  P G      YI+    S K++L++LDVNG       W++SM
Sbjct  21    VAVSNSSIFATTAQKPPPAPAGAAGGGGYISI---SRKKILKDLDVNGG------WIESM  71

Query  403   RASSPTQ-KSTP---LSDDHR--TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             RASSPT  KS P    SDDHR  +WM  HPSALDMF+QII+ASKGK IVMFLDYDGTLSP
Sbjct  72    RASSPTHVKSLPSFSASDDHRQNSWMHLHPSALDMFDQIIEASKGKQIVMFLDYDGTLSP  131

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IV+DPD AFMS+ MR TV+KLAT FPTAIVSGRC DKVY F+RLAELYYAGSHGMDIKGP
Sbjct  132   IVEDPDKAFMSEAMRKTVKKLATCFPTAIVSGRCRDKVYGFIRLAELYYAGSHGMDIKGP  191

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             ++ SK+KK   + +LFQPASEFLPMIDEVY+ L+++  STPG KVENNKFC+SVHFRCVD
Sbjct  192   TKSSKFKKAVNQGLLFQPASEFLPMIDEVYQQLVQKMKSTPGAKVENNKFCISVHFRCVD  251

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +W  LAQ+V+SVLKEYP LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN +DVF
Sbjct  252   EKQWNNLAQEVKSVLKEYPMLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCSDVF  311

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             P+YIGDDRTDEDAFKVLRE  QGFGILVSK+PKDTHASYSL+EPSEVM FL+RLV+WK
Sbjct  312   PIYIGDDRTDEDAFKVLRERNQGFGILVSKIPKDTHASYSLREPSEVMYFLQRLVQWK  369



>ref|XP_008453786.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Cucumis melo]
Length=381

 Score =   512 bits (1319),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 258/358 (72%), Positives = 297/358 (83%), Gaps = 21/358 (6%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGG------YINFDVTSGKELLQNLDVNGAAAKVSSWVDSM  402
             VAVS+ + F T   KPP  PGG      YI+    S K++L++LDVNG       W++SM
Sbjct  21    VAVSNSSIFATTAQKPPPAPGGGGGGGGYISI---SRKKILKDLDVNGG------WIESM  71

Query  403   RASSPTQ-KSTP---LSDDHR--TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             RASSPT  KS P    SDDH   +WM+ HPSALDMF+QII+ASKGK IVMFLDYDGTLSP
Sbjct  72    RASSPTHVKSLPSLSASDDHHQNSWMLHHPSALDMFDQIIEASKGKQIVMFLDYDGTLSP  131

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IV+DPD AFMS+ MR TV+KLA+ FPTAIVSGRC DKVY F+RLAELYYAGSHGMDIKGP
Sbjct  132   IVEDPDKAFMSEAMRKTVKKLASCFPTAIVSGRCRDKVYGFIRLAELYYAGSHGMDIKGP  191

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             ++ SK+KK   + +LFQPASEFLPMIDEVY+ L+E+  STPG KVENNKFC+SVHFRCVD
Sbjct  192   TKSSKFKKAVNQGLLFQPASEFLPMIDEVYQQLVEKMKSTPGAKVENNKFCISVHFRCVD  251

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +W +LAQ+V+SV+KEYP LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN +DVF
Sbjct  252   EKQWNDLAQEVKSVVKEYPMLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCSDVF  311

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             P+YIGDDRTDEDAFKVLRE  QGFGILVSK+PKDTHASYSL+EPSEVM FL+RLV+WK
Sbjct  312   PIYIGDDRTDEDAFKVLRERNQGFGILVSKIPKDTHASYSLREPSEVMYFLQRLVQWK  369



>gb|KEH20856.1| trehalose-phosphate phosphatase [Medicago truncatula]
Length=366

 Score =   511 bits (1315),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 249/360 (69%), Positives = 297/360 (83%), Gaps = 12/360 (3%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAG-----HKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT+ NVV          +G      KPP  PGGY++      + +L+NL++NG   ++++
Sbjct  1     MTQKNVVVSETKTGINGSGTITVAQKPPAAPGGYVHI---PRRRILKNLEINGGQ-RINT  56

Query  388   WVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             W+DSMRASSPT  KS+P L++++ +W+++HPSALDMFEQI+ A+KGK IVMFLDYDGTLS
Sbjct  57    WIDSMRASSPTHVKSSPSLAEEYNSWILRHPSALDMFEQIMDAAKGKQIVMFLDYDGTLS  116

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIVDDPD AFMS+ MR TV+KLA  FPTAIV+GRC DKVY+FVRL ELYYAGSHGMDIKG
Sbjct  117   PIVDDPDRAFMSESMRKTVKKLARCFPTAIVTGRCIDKVYNFVRLDELYYAGSHGMDIKG  176

Query  742   PSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             P++ SKY K  + E+VLFQPA EF+PMI+EVY+ L+E+T STPG +VEN+KFC SVHFRC
Sbjct  177   PTKESKYNKNNKAEEVLFQPAREFVPMINEVYEQLVEKTKSTPGARVENHKFCTSVHFRC  236

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE +W ELAQQV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN  D
Sbjct  237   VDEKRWVELAQQVKSVLKEYPKLRLTQGRKVLEIRPAIKWDKGKALEFLLESLGFANCND  296

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDDRTDEDAFK LR+  QGFGILVSK PKDT A+YSLQEP+EVM FL+RLVEWK
Sbjct  297   VFPVYIGDDRTDEDAFKKLRDIDQGFGILVSKFPKDTAAAYSLQEPNEVMEFLQRLVEWK  356



>ref|XP_010680570.1| PREDICTED: probable trehalose-phosphate phosphatase I [Beta vulgaris 
subsp. vulgaris]
Length=364

 Score =   510 bits (1313),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 259/360 (72%), Positives = 292/360 (81%), Gaps = 14/360 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAG-----HKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSS  387
             MTR ++V+VS      T+      HKPP VPG Y+       + LLQ+LD+NG      S
Sbjct  1     MTRQDIVSVSSTMNNMTSNSAILSHKPPPVPGKYMLNLPMCERHLLQDLDINGV-----S  55

Query  388   WVDSMRASSPTQ-KSTP--LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             WVDSMRASSPT  KS P  ++      M++ PSALDMFEQIIKASKGK IVMFLDYDGTL
Sbjct  56    WVDSMRASSPTHLKSIPSSITSSDSLAMLKQPSALDMFEQIIKASKGKQIVMFLDYDGTL  115

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMSD MR TVRKLA YFPTAIVSGRC DKVY+FV+LAELYYAGSHGMDIK
Sbjct  116   SPIVDDPDRAFMSDAMRRTVRKLARYFPTAIVSGRCRDKVYNFVKLAELYYAGSHGMDIK  175

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GP++GSK+ KG++  VLFQPAS+F+PMIDEVYK LLE+T S  G  VE+NKFC+SVHFRC
Sbjct  176   GPAKGSKHLKGSQA-VLFQPASKFVPMIDEVYKALLEKTKSILGATVEHNKFCLSVHFRC  234

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW ELA +VRSVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG  N TD
Sbjct  235   VDEKKWNELAHEVRSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLTNCTD  294

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDDRTDEDAFKVLR+  QGFGILVSK+ K+T+ASY LQEPSEVM FL+RLV+W+
Sbjct  295   VFPVYIGDDRTDEDAFKVLRDRGQGFGILVSKIAKETNASYYLQEPSEVMNFLQRLVKWR  354



>ref|XP_008345555.1| PREDICTED: probable trehalose-phosphate phosphatase J [Malus 
domestica]
Length=374

 Score =   509 bits (1311),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 258/370 (70%), Positives = 295/370 (80%), Gaps = 9/370 (2%)
 Frame = +1

Query  178   LERRSCLFTRLAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKEL--LQN  351
             + +++ + +    E M     VAV++ + F     KPPV P GYI     S K    L+N
Sbjct  1     MTKQNVVVSEADAEIMNMAISVAVANSSLFTAVAEKPPVGPPGYIXI---SRKRFMNLKN  57

Query  352   LDVNGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNI  528
             LD    A +++SWVDSMRASSPT  KS+    ++  W++QHPSALDMFEQII ASKGK I
Sbjct  58    LDSFNGAERMNSWVDSMRASSPTHIKSSSFLKEN--WILQHPSALDMFEQIIDASKGKQI  115

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIV+DPD AFMSD MR TV+K+A  FPTAIVSGRC DKVY FVRLAELY
Sbjct  116   VMFLDYDGTLSPIVEDPDRAFMSDAMRKTVKKVARCFPTAIVSGRCRDKVYKFVRLAELY  175

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGP++GSKY K   + VL QPASEFLPMIDEVY+ L+++T STPG KVENN
Sbjct  176   YAGSHGMDIKGPAKGSKYMK-VSQGVLCQPASEFLPMIDEVYRLLVDKTKSTPGAKVENN  234

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFC+SVHFRCVDE KW EL  QVRS+LKEY  L+LTQGRKVLEIRP I+WDKGKALEFLL
Sbjct  235   KFCLSVHFRCVDEKKWNELFLQVRSILKEYSMLKLTQGRKVLEIRPTIKWDKGKALEFLL  294

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             ESLGYAN TDVFPVYIGDDRTDEDAFKVLRE  QGFGILVSK PK+T+A+YSLQEP+EVM
Sbjct  295   ESLGYANCTDVFPVYIGDDRTDEDAFKVLRERGQGFGILVSKGPKETNATYSLQEPAEVM  354

Query  1249  LFLRRLVEWK  1278
              FL+RLVEWK
Sbjct  355   DFLQRLVEWK  364



>ref|XP_008453785.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Cucumis melo]
Length=382

 Score =   508 bits (1308),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 258/359 (72%), Positives = 297/359 (83%), Gaps = 22/359 (6%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGG------YINFDVTSGKELLQNLDVNGAAAKVSSWVDSM  402
             VAVS+ + F T   KPP  PGG      YI+    S K++L++LDVNG       W++SM
Sbjct  21    VAVSNSSIFATTAQKPPPAPGGGGGGGGYISI---SRKKILKDLDVNGG------WIESM  71

Query  403   RASSPTQ-KSTP---LSDDHR--TWM-MQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             RASSPT  KS P    SDDH   +WM + HPSALDMF+QII+ASKGK IVMFLDYDGTLS
Sbjct  72    RASSPTHVKSLPSLSASDDHHQNSWMQLHHPSALDMFDQIIEASKGKQIVMFLDYDGTLS  131

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIV+DPD AFMS+ MR TV+KLA+ FPTAIVSGRC DKVY F+RLAELYYAGSHGMDIKG
Sbjct  132   PIVEDPDKAFMSEAMRKTVKKLASCFPTAIVSGRCRDKVYGFIRLAELYYAGSHGMDIKG  191

Query  742   PSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCV  921
             P++ SK+KK   + +LFQPASEFLPMIDEVY+ L+E+  STPG KVENNKFC+SVHFRCV
Sbjct  192   PTKSSKFKKAVNQGLLFQPASEFLPMIDEVYQQLVEKMKSTPGAKVENNKFCISVHFRCV  251

Query  922   DELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDV  1101
             DE +W +LAQ+V+SV+KEYP LRLTQGRKVLEIRP I+WDKGKALEFLLESLGYAN +DV
Sbjct  252   DEKQWNDLAQEVKSVVKEYPMLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANCSDV  311

Query  1102  FPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             FP+YIGDDRTDEDAFKVLRE  QGFGILVSK+PKDTHASYSL+EPSEVM FL+RLV+WK
Sbjct  312   FPIYIGDDRTDEDAFKVLRERNQGFGILVSKIPKDTHASYSLREPSEVMYFLQRLVQWK  370



>ref|XP_010261265.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nelumbo 
nucifera]
Length=382

 Score =   508 bits (1307),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 256/370 (69%), Positives = 294/370 (79%), Gaps = 23/370 (6%)
 Frame = +1

Query  223   MTRHNVVA-------------VSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVN  363
             MT+ NVV              V   + FP+ G KPP  P GY++    S  + L+ L+  
Sbjct  1     MTKQNVVVSDVKCGINDMISVVPKGSLFPSTGQKPPKAPDGYVSI---SRNKFLKKLE-T  56

Query  364   GAAAKVSSWVDSMRASSPTQ-KSTPL--SDDHR--TWMMQHPSALDMFEQIIKASKGKNI  528
             G  A+++ WV+SMRASSPT  KS P   S  H+  +W++ HPSAL+MFEQI+ ASKGK I
Sbjct  57    GGGARINPWVESMRASSPTHIKSNPSLSSTVHQEDSWILDHPSALNMFEQIMSASKGKQI  116

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIVDDPD AFMS  MRA V+ +A YFPTAIVSGRC DKVYSFVRLAELY
Sbjct  117   VMFLDYDGTLSPIVDDPDRAFMSRAMRAAVKAVARYFPTAIVSGRCRDKVYSFVRLAELY  176

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGP++G +Y KG  E VLFQPASEFLPMIDEVYK L+E+  S PG KVE+N
Sbjct  177   YAGSHGMDIKGPAKGPRYSKG-NEPVLFQPASEFLPMIDEVYKALVEKIKSIPGAKVEHN  235

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             +FCVSVHFRCVDE KWG LA+QVR+VLKEYPKLRL+QGRKVLEIRP I+WDKG+ALEFLL
Sbjct  236   RFCVSVHFRCVDEKKWGSLAEQVRAVLKEYPKLRLSQGRKVLEIRPTIKWDKGRALEFLL  295

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             ESLGYAN ++V PVYIGDDRTDEDAFKVLR+   GFGILVSK+PKDT+ASYSLQEPSEVM
Sbjct  296   ESLGYANCSNVLPVYIGDDRTDEDAFKVLRDKGLGFGILVSKIPKDTNASYSLQEPSEVM  355

Query  1249  LFLRRLVEWK  1278
             LFL RLVEW+
Sbjct  356   LFLHRLVEWQ  365



>ref|XP_010547623.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Tarenaya hassleriana]
Length=374

 Score =   506 bits (1302),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 255/374 (68%), Positives = 302/374 (81%), Gaps = 9/374 (2%)
 Frame = +1

Query  166   FVYFLERRSCLFTRLAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELL  345
              V F+E+R  + ++       +  ++ V+     P+A  KPP  PG YI+    S K+LL
Sbjct  1     MVSFVEKRERMASQNVVASEAKSGIITVTVAVANPSA-QKPPTAPG-YISI---SRKKLL  55

Query  346   QNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP-LSDDHR-TWMMQHPSALDMFEQIIKASK  516
              NL++NG   ++++WVDSMRASSPT  KS P LS + R +W++QHPSALDMFEQII+AS+
Sbjct  56    HNLEINGGH-RINAWVDSMRASSPTHLKSVPSLSPEERNSWIIQHPSALDMFEQIIEASR  114

Query  517   GKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRL  696
             GK IVMFLDYDGTLSPIVDDP+ AFMS  MR TVRKLA  FPTAIVSGRC DKVY+FV+L
Sbjct  115   GKQIVMFLDYDGTLSPIVDDPERAFMSSKMRRTVRKLAKCFPTAIVSGRCRDKVYNFVKL  174

Query  697   AELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVK  876
             AELYYAGSHGMDIKGP++GS   +     V+FQPASEFLP+IDEVYK L+++T STPG  
Sbjct  175   AELYYAGSHGMDIKGPTKGSSKYQKDNPSVVFQPASEFLPIIDEVYKELVDKTKSTPGAM  234

Query  877   VENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKAL  1056
             VENNKFC+SVHFRCVDE KW ELA QVRSV+KEYPKLRLTQGRKVLEIRP I+WDKGKAL
Sbjct  235   VENNKFCLSVHFRCVDEKKWSELALQVRSVIKEYPKLRLTQGRKVLEIRPTIKWDKGKAL  294

Query  1057  EFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEP  1236
             EFLLESLG+ +  +VFPVYIGDDRTDEDAFK+LRE  QGFGILVSK PK+T+ASYSLQEP
Sbjct  295   EFLLESLGFGDCNNVFPVYIGDDRTDEDAFKMLRERGQGFGILVSKFPKETNASYSLQEP  354

Query  1237  SEVMLFLRRLVEWK  1278
             ++VM FLRRLV+WK
Sbjct  355   TQVMDFLRRLVDWK  368



>gb|KCW54475.1| hypothetical protein EUGRSUZ_I00423 [Eucalyptus grandis]
Length=368

 Score =   504 bits (1297),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/328 (77%), Positives = 283/328 (86%), Gaps = 11/328 (3%)
 Frame = +1

Query  280   HKPPVVP--GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP--LSD  444
              KPPV P  GG+      S ++LL+NL+VN +A ++SSWVDSM+ASSPT  K+ P  L++
Sbjct  37    QKPPVAPAAGGFFKI---SRRKLLKNLEVN-SAERISSWVDSMKASSPTHVKAAPRSLTE  92

Query  445   DHRT-WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVR  621
             DH + WM+ HPSALDMFEQII AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MRATV+
Sbjct  93    DHSSSWMLHHPSALDMFEQIIDASQGKQIVMFLDYDGTLSPIVDDPDQAFMSKKMRATVK  152

Query  622   KLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPA  801
             KLA  FPTAIVSGRC DKVYSFVRL ELYYAGSHGMDIKGP++GSKYKKG ++ VLFQPA
Sbjct  153   KLARCFPTAIVSGRCRDKVYSFVRLGELYYAGSHGMDIKGPAKGSKYKKG-DQSVLFQPA  211

Query  802   SEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYP  981
             SEFLPMIDEVYK L+E+T STPG KVENNKFCVSVHFR VDE +W ELAQQVRSV+KEYP
Sbjct  212   SEFLPMIDEVYKKLVEKTKSTPGAKVENNKFCVSVHFRRVDEKEWTELAQQVRSVIKEYP  271

Query  982   KLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRE  1161
             KLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN T+VFPVYIGDDRTDEDAFK+LR+
Sbjct  272   KLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTNVFPVYIGDDRTDEDAFKILRD  331

Query  1162  TRQGFGILVSKLPKDTHASYSLQEPSEV  1245
               QGFGI+VSK PK+T+ASYSLQEP E 
Sbjct  332   RGQGFGIIVSKFPKETNASYSLQEPEEA  359



>ref|XP_010027842.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X1 [Eucalyptus grandis]
Length=376

 Score =   504 bits (1298),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/328 (77%), Positives = 283/328 (86%), Gaps = 11/328 (3%)
 Frame = +1

Query  280   HKPPVVP--GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTP--LSD  444
              KPPV P  GG+      S ++LL+NL+VN +A ++SSWVDSM+ASSPT  K+ P  L++
Sbjct  45    QKPPVAPAAGGFFKI---SRRKLLKNLEVN-SAERISSWVDSMKASSPTHVKAAPRSLTE  100

Query  445   DHRT-WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVR  621
             DH + WM+ HPSALDMFEQII AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MRATV+
Sbjct  101   DHSSSWMLHHPSALDMFEQIIDASQGKQIVMFLDYDGTLSPIVDDPDQAFMSKKMRATVK  160

Query  622   KLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPA  801
             KLA  FPTAIVSGRC DKVYSFVRL ELYYAGSHGMDIKGP++GSKYKKG ++ VLFQPA
Sbjct  161   KLARCFPTAIVSGRCRDKVYSFVRLGELYYAGSHGMDIKGPAKGSKYKKG-DQSVLFQPA  219

Query  802   SEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYP  981
             SEFLPMIDEVYK L+E+T STPG KVENNKFCVSVHFR VDE +W ELAQQVRSV+KEYP
Sbjct  220   SEFLPMIDEVYKKLVEKTKSTPGAKVENNKFCVSVHFRRVDEKEWTELAQQVRSVIKEYP  279

Query  982   KLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRE  1161
             KLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN T+VFPVYIGDDRTDEDAFK+LR+
Sbjct  280   KLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCTNVFPVYIGDDRTDEDAFKILRD  339

Query  1162  TRQGFGILVSKLPKDTHASYSLQEPSEV  1245
               QGFGI+VSK PK+T+ASYSLQEP E 
Sbjct  340   RGQGFGIIVSKFPKETNASYSLQEPEEA  367



>ref|XP_010547624.1| PREDICTED: probable trehalose-phosphate phosphatase J isoform 
X2 [Tarenaya hassleriana]
Length=364

 Score =   503 bits (1295),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 252/349 (72%), Positives = 292/349 (84%), Gaps = 13/349 (4%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             VAV++P     +  KPP  PG YI+    S K+LL NL++NG   ++++WVDSMRASSPT
Sbjct  20    VAVANP-----SAQKPPTAPG-YISI---SRKKLLHNLEINGGH-RINAWVDSMRASSPT  69

Query  421   Q-KSTP-LSDDHR-TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAF  591
               KS P LS + R +W++QHPSALDMFEQII+AS+GK IVMFLDYDGTLSPIVDDP+ AF
Sbjct  70    HLKSVPSLSPEERNSWIIQHPSALDMFEQIIEASRGKQIVMFLDYDGTLSPIVDDPERAF  129

Query  592   MSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKG  771
             MS  MR TVRKLA  FPTAIVSGRC DKVY+FV+LAELYYAGSHGMDIKGP++GS   + 
Sbjct  130   MSSKMRRTVRKLAKCFPTAIVSGRCRDKVYNFVKLAELYYAGSHGMDIKGPTKGSSKYQK  189

Query  772   AEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQ  951
                 V+FQPASEFLP+IDEVYK L+++T STPG  VENNKFC+SVHFRCVDE KW ELA 
Sbjct  190   DNPSVVFQPASEFLPIIDEVYKELVDKTKSTPGAMVENNKFCLSVHFRCVDEKKWSELAL  249

Query  952   QVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRT  1131
             QVRSV+KEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+ +  +VFPVYIGDDRT
Sbjct  250   QVRSVIKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFGDCNNVFPVYIGDDRT  309

Query  1132  DEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DEDAFK+LRE  QGFGILVSK PK+T+ASYSLQEP++VM FLRRLV+WK
Sbjct  310   DEDAFKMLRERGQGFGILVSKFPKETNASYSLQEPTQVMDFLRRLVDWK  358



>ref|XP_006366536.1| PREDICTED: probable trehalose-phosphate phosphatase 6-like [Solanum 
tuberosum]
Length=375

 Score =   503 bits (1296),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 262/349 (75%), Positives = 293/349 (84%), Gaps = 7/349 (2%)
 Frame = +1

Query  301   GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQK-STPLSDDHRTWMMQHPS  477
             G YIN    S K L++   +NG    ++SWVDSMRASSPT   ST L +D  +WM+ HPS
Sbjct  32    GSYINN--ISRKTLVK---INGDPRIMTSWVDSMRASSPTHHMSTNLYEDKTSWMVHHPS  86

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             A+DMFE II  SKGK IVMFLDYDGTLSPIVDDPD AFMSD MR TVRKLA YFPTAIVS
Sbjct  87    AVDMFEDIISVSKGKKIVMFLDYDGTLSPIVDDPDQAFMSDDMRGTVRKLARYFPTAIVS  146

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC DKVY+FV+LAELYYAGSHGMDIKGPS+GSK  K   + VLFQPAS+FLPMI EVYK
Sbjct  147   GRCRDKVYNFVQLAELYYAGSHGMDIKGPSKGSKNSKKGTQAVLFQPASKFLPMIIEVYK  206

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              LL++T S  GV+VENNKFCVSVHFRCVDE KWGEL+QQV  VLKEYPKL+L QGRKVLE
Sbjct  207   ELLDKTKSIEGVRVENNKFCVSVHFRCVDEKKWGELSQQVSLVLKEYPKLKLCQGRKVLE  266

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRPII+WDKGKAL+FLL+SLGYA   DVFP+YIGDDRTDEDAFKVLRE RQG GILVSK 
Sbjct  267   IRPIIKWDKGKALQFLLQSLGYAKCNDVFPIYIGDDRTDEDAFKVLRERRQGLGILVSKT  326

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWKrlalrrqsrlrrqlEEIKATLK  1344
             PKDTHASYSLQEPSEVM FL  LVEWKRL+LR+QS++++QLE+I A+LK
Sbjct  327   PKDTHASYSLQEPSEVMKFLLLLVEWKRLSLRKQSKIQKQLEDI-ASLK  374



>ref|XP_003532832.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=366

 Score =   501 bits (1289),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/317 (75%), Positives = 273/317 (86%), Gaps = 3/317 (1%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIK  507
             + +L+NL++NG   ++++WVDSMRASSPT  + ++ L+++H +W+++HPSALDMFEQI+ 
Sbjct  39    RRVLKNLEINGGQ-RINAWVDSMRASSPTNSKSTSSLAEEHSSWILRHPSALDMFEQIMD  97

Query  508   ASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSF  687
             AS+GK IVMFLDYDGTLSPIVDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVYSF
Sbjct  98    ASRGKQIVMFLDYDGTLSPIVDDPDHAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYSF  157

Query  688   VRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTP  867
             VRLAELYYAGSHGMDI+GP+R  KY K   E VLFQPASEFLPMIDEV+  L+E+  S P
Sbjct  158   VRLAELYYAGSHGMDIQGPTRDCKYSKDKGEPVLFQPASEFLPMIDEVHHQLVEKMKSIP  217

Query  868   GVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKG  1047
             G KVENNKFC SVHFRCVDE KW ELAQ+VRSVLKEYPKLRL QGRKVLEIRP I+WDKG
Sbjct  218   GAKVENNKFCCSVHFRCVDEKKWSELAQEVRSVLKEYPKLRLNQGRKVLEIRPSIKWDKG  277

Query  1048  KALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSL  1227
             KALEFLLESLG+AN  DVFPVYIGDD+TDEDAFK LR+  QG GILVSK PKDT ASYSL
Sbjct  278   KALEFLLESLGFANCNDVFPVYIGDDKTDEDAFKKLRDRGQGSGILVSKFPKDTSASYSL  337

Query  1228  QEPSEVMLFLRRLVEWK  1278
             QEP+EVM FL+RLVEWK
Sbjct  338   QEPNEVMDFLQRLVEWK  354



>ref|XP_002284201.1| PREDICTED: probable trehalose-phosphate phosphatase J [Vitis 
vinifera]
 emb|CBI19142.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   497 bits (1280),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 252/351 (72%), Positives = 279/351 (79%), Gaps = 13/351 (4%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSS--WVDSMRASS  414
             V VS+ + F  A  KPP VPGGYI          L+ L+  GA        WVDSMRASS
Sbjct  21    VIVSNSSFFSPAVRKPPTVPGGYITIS-------LKKLETGGAGGAGRVGAWVDSMRASS  73

Query  415   PTQ-KSTPLSDDH--RTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDS  585
             PT  KSTPLSD     +WM+ HPSAL  FEQI  AS+GK IVMFLDYDGTLSPIV+DPD 
Sbjct  74    PTHIKSTPLSDSEALSSWMLHHPSALRTFEQITNASEGKQIVMFLDYDGTLSPIVEDPDQ  133

Query  586   AFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYK  765
             AFMS  MRA V+ +A YFPTAIVSGRC DKVY FV+L+ELYYAGSHGMDIKGP++G KYK
Sbjct  134   AFMSKEMRAAVKDVARYFPTAIVSGRCRDKVYRFVKLSELYYAGSHGMDIKGPAKGRKYK  193

Query  766   KGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGEL  945
             KG ++ +L QPASEFLPMIDEVYK LLE+T STPG KVENNKFC+SVHFRCVDE +W  L
Sbjct  194   KG-DQSLLCQPASEFLPMIDEVYKALLEKTKSTPGAKVENNKFCLSVHFRCVDEQRWTAL  252

Query  946   AQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDD  1125
             A+QVR VL +YPKLRLTQGRKVLEIRP I+WDKG ALEFLLESLGYANS DVFP+YIGDD
Sbjct  253   AEQVRLVLNQYPKLRLTQGRKVLEIRPTIKWDKGNALEFLLESLGYANSNDVFPIYIGDD  312

Query  1126  RTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             RTDEDAFKVLR   QGFGILVSK PK+T ASYSLQEP+EVM FL+ LVEWK
Sbjct  313   RTDEDAFKVLRNRGQGFGILVSKFPKETSASYSLQEPTEVMNFLQLLVEWK  363



>ref|XP_010269219.1| PREDICTED: probable trehalose-phosphate phosphatase J [Nelumbo 
nucifera]
Length=374

 Score =   496 bits (1278),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 254/370 (69%), Positives = 288/370 (78%), Gaps = 23/370 (6%)
 Frame = +1

Query  223   MTRHNVVA-------------VSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVN  363
             MT+ NVV              V + + FP+AG KPP  PGGYI     S K+ L+ L+  
Sbjct  1     MTKQNVVVPDVKSGINDMITVVPNASLFPSAGQKPPAAPGGYIGI---SRKKFLKKLE-T  56

Query  364   GAAAKVSSWVDSMRASSPTQ-KSTP-LS---DDHRTWMMQHPSALDMFEQIIKASKGKNI  528
             G  AKV+ WVDSM+ SSPT  KSTP LS   D   +W++ HPSAL+MFEQI+ ASKGK I
Sbjct  57    GGGAKVNPWVDSMKVSSPTHAKSTPSLSPNVDQIESWILSHPSALNMFEQIMAASKGKQI  116

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIVD+PD AFMS+ MR  V+ +A  FPTAIVSGRC DKVYSFVRLAELY
Sbjct  117   VMFLDYDGTLSPIVDNPDEAFMSESMRRAVKAVARCFPTAIVSGRCRDKVYSFVRLAELY  176

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGP+ G    K   + VLFQPASEFLPMIDEVYK L+E+T    G  VE+N
Sbjct  177   YAGSHGMDIKGPAEGVICSK-VNQPVLFQPASEFLPMIDEVYKALVEKTRCIRGANVEHN  235

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFCVSVHFRCV+E KWG LA+QVRSV+KEYPKLR+TQGR VLEIRPII WDKG+ALEFLL
Sbjct  236   KFCVSVHFRCVEEKKWGALAEQVRSVMKEYPKLRVTQGRMVLEIRPIIAWDKGRALEFLL  295

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             ESLG+ANS DV PVYIGDD+TDEDAFKVLRE   GFGILVSK+PK T+ASYSLQEP+EVM
Sbjct  296   ESLGFANSKDVLPVYIGDDQTDEDAFKVLREKGLGFGILVSKIPKKTNASYSLQEPAEVM  355

Query  1249  LFLRRLVEWK  1278
             LFL RLVEW+
Sbjct  356   LFLHRLVEWE  365



>ref|XP_004502437.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X1 [Cicer arietinum]
Length=366

 Score =   496 bits (1276),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 247/349 (71%), Positives = 291/349 (83%), Gaps = 13/349 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR----FPTAGHKPPVVPGG-YINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT+ NV+ VSD       FPT   KPP  PGG YI+      + +L++L++NG   ++++
Sbjct  1     MTQQNVL-VSDTKSGVTVFPTTSQKPPPAPGGGYISI---QRRWVLKDLEINGGQ-RINA  55

Query  388   WVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             W++SMRASSPT  KSTP  +++  +W++ HPSALDMF+QII+ASKGK IVMFLDYDGTLS
Sbjct  56    WLESMRASSPTHLKSTPSFAEEQTSWILHHPSALDMFDQIIEASKGKQIVMFLDYDGTLS  115

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIV+DPD AFMSD MR TVRKLA YFPTAIV+GRC DKVY+FVRLAELYYAGSHGMDIKG
Sbjct  116   PIVEDPDRAFMSDSMRKTVRKLARYFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIKG  175

Query  742   PSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             P+R SKY KG++ + VL+QPASEFLPMIDEVYK L+++T STPG KVENNKFCVSVHFRC
Sbjct  176   PTRSSKYNKGSKAQAVLYQPASEFLPMIDEVYKQLVDKTKSTPGAKVENNKFCVSVHFRC  235

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW ELA QV+SVLK++PKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG  N +D
Sbjct  236   VDEKKWSELAHQVKSVLKDHPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLGNCSD  295

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             VFP+YIGDDR+DEDAFK LR+  QGFGILVSK  KDT+ASYSLQEP+E 
Sbjct  296   VFPIYIGDDRSDEDAFKKLRDRGQGFGILVSKFAKDTNASYSLQEPNEA  344



>ref|XP_003524269.1| PREDICTED: probable trehalose-phosphate phosphatase J [Glycine 
max]
Length=362

 Score =   494 bits (1271),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 252/360 (70%), Positives = 287/360 (80%), Gaps = 18/360 (5%)
 Frame = +1

Query  223   MTRHNVVAV--SDPNRFPTAGHKP---PVVPGGYINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT++ +V+   S  NR  T   KP       GGYI       + +L+NL++N       +
Sbjct  1     MTQNAIVSKTKSGINRDITVPQKPLAAAAAAGGYIPI---PRRRVLKNLEIN-------A  50

Query  388   WVDSMRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             WVDSMR+SSPT  + ++ L+++H TW+++HPSALDMFEQI+ AS+GK IVMFLDYDGTLS
Sbjct  51    WVDSMRSSSPTNSKSTSSLAEEHSTWILRHPSALDMFEQIMDASRGKQIVMFLDYDGTLS  110

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIVDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVY+FVRLAELYYAGSHGMDI+G
Sbjct  111   PIVDDPDRAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIQG  170

Query  742   PSRGSKY-KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             P+R SKY  K   E VLFQPASEFLPMIDEVY  L+E+  S PG  VENNKFC SVHFRC
Sbjct  171   PTRTSKYSNKDKGEPVLFQPASEFLPMIDEVYHQLVEKMKSIPGAMVENNKFCCSVHFRC  230

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW ELAQ+VRSVLKEYPKLRL QGRKVLEIRP I+WDKGKALEFLLESLG+AN  D
Sbjct  231   VDEKKWSELAQEVRSVLKEYPKLRLNQGRKVLEIRPSIKWDKGKALEFLLESLGFANCND  290

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDD+TDEDAFK LR+  QGFGILVSK PKDT ASYSLQEP+EVM FL+RLVEWK
Sbjct  291   VFPVYIGDDKTDEDAFKKLRDRGQGFGILVSKFPKDTTASYSLQEPNEVMDFLQRLVEWK  350



>gb|KHN44334.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=361

 Score =   493 bits (1270),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 253/361 (70%), Positives = 291/361 (81%), Gaps = 17/361 (5%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVS  384
             MT+ NVV VSD         F T   KPP  PGGYI+      + +L+NL++NG   +++
Sbjct  1     MTQQNVV-VSDTKSGVSLTVFSTT-QKPPAAPGGYISI---PRRRVLKNLEINGGQ-RIN  54

Query  385   SWVDSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +WV+SMRASSPT  KSTP LS +H +W+++  S ++       ASKGK IVMFLDYDGTL
Sbjct  55    AWVESMRASSPTHHKSTPSLSQEHNSWIVRRTSLIN--SHFFDASKGKQIVMFLDYDGTL  112

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVY+FVRLAELYYAGSHGMDIK
Sbjct  113   SPIVDDPDRAFMSDSMRKTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIK  172

Query  739   GPSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFR  915
             GP+R SKY K ++ E +L QPAS+FLPMIDEVY+ L+E+T STPG  VENNKFC+SVHFR
Sbjct  173   GPTRSSKYNKDSKAEAILCQPASDFLPMIDEVYQQLVEKTKSTPGALVENNKFCLSVHFR  232

Query  916   CVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANST  1095
             CVDE KW ELA+QV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG AN +
Sbjct  233   CVDEKKWSELARQVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGLANCS  292

Query  1096  DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEW  1275
             DVFPVYIGDDR+DEDAFK LR+  QGFGILVSK PKDT ASYSLQEP+EVM FL+RLVEW
Sbjct  293   DVFPVYIGDDRSDEDAFKKLRDRGQGFGILVSKFPKDTSASYSLQEPNEVMNFLQRLVEW  352

Query  1276  K  1278
             K
Sbjct  353   K  353



>ref|XP_004143475.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 ref|XP_004160134.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 gb|KGN48762.1| hypothetical protein Csa_6G500540 [Cucumis sativus]
Length=385

 Score =   494 bits (1272),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 247/358 (69%), Positives = 285/358 (80%), Gaps = 17/358 (5%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVP-----GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSM  402
              V VS+ + F     KPP  P     GGYI+  ++   +L+Q  D     A++ +WVDSM
Sbjct  21    TVTVSNSSIFQATAQKPPAGPSSTTGGGYIS--ISRSTKLVQQPD---GRARIKTWVDSM  75

Query  403   RASSPTQ-KSTPLSDDH-----RTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             RASSP++ K TP   DH      +WM+ HPSALDMF+QII ASKGK IVMFLDYDGTLSP
Sbjct  76    RASSPSRIKPTPSLSDHDHDNNSSWMLHHPSALDMFDQIIDASKGKQIVMFLDYDGTLSP  135

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IVDDPD AFMSD MR TV+ +A  FPTAIVSGR  DKVY FVRL ELYYAGSHGMDIKGP
Sbjct  136   IVDDPDRAFMSDAMRKTVKTVARSFPTAIVSGRRRDKVYGFVRLGELYYAGSHGMDIKGP  195

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             ++ S YKK   + VLFQPASEFLPMID+VYK L+E+T STPG KVENNKFC+SVH+RCV+
Sbjct  196   TKDSNYKK-CTQSVLFQPASEFLPMIDQVYKELVEKTKSTPGAKVENNKFCLSVHYRCVE  254

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E KW ELAQQV+SVLK++P+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG+ N +DVF
Sbjct  255   EKKWSELAQQVKSVLKDFPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFNNCSDVF  314

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDDRTDEDAFK++RE  QGFGILVSK PK+T ASYSL+EPSEVM FL+RL EWK
Sbjct  315   PVYIGDDRTDEDAFKIIRERGQGFGILVSKFPKETSASYSLREPSEVMNFLQRLAEWK  372



>ref|XP_010484318.1| PREDICTED: probable trehalose-phosphate phosphatase J [Camelina 
sativa]
Length=369

 Score =   491 bits (1264),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 292/354 (82%), Gaps = 11/354 (3%)
 Frame = +1

Query  235   NVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVSSWVDSMRAS  411
              V AVS+ + F  +  KPP  PG YI+    S K+LL+NL++NGA + +++SWVDSMRAS
Sbjct  17    TVSAVSNSSVFTPSAQKPPTAPG-YISI---SKKKLLKNLEINGAQSQRLTSWVDSMRAS  72

Query  412   SPTQ-KSTP---LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT  KS P     ++  +W+ +HPSALDMFE+II+A++GK IVMFLDYDGTLSPIVDDP
Sbjct  73    SPTHLKSLPSLSAQEELNSWIKRHPSALDMFERIIEAARGKQIVMFLDYDGTLSPIVDDP  132

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AFMS  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  133   DRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  192

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDEVYK L+E+T  T G KVENNKFC+SVHFRCVDE KW
Sbjct  193   RYNKD-KPSVLYQPAGDFLPMIDEVYKQLVEKTKPTAGAKVENNKFCLSVHFRCVDEKKW  251

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV+++YP L+L+QGRKV EIRP+++WDKGKALEFLLESLG+ NS +VFP+YI
Sbjct  252   SELALKVRSVVQKYPTLKLSQGRKVFEIRPMVKWDKGKALEFLLESLGFENSNEVFPIYI  311

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GDD+TDEDAFK+LRE  QGFGILVSK PKDT ASYSLQ+P EVM FLRRLVEWK
Sbjct  312   GDDKTDEDAFKLLREREQGFGILVSKFPKDTSASYSLQDPPEVMDFLRRLVEWK  365



>ref|XP_006280660.1| hypothetical protein CARUB_v10026620mg [Capsella rubella]
 gb|EOA13558.1| hypothetical protein CARUB_v10026620mg [Capsella rubella]
Length=369

 Score =   491 bits (1264),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 243/363 (67%), Positives = 294/363 (81%), Gaps = 11/363 (3%)
 Frame = +1

Query  208   LAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVS  384
             +A+ K     V  VS+ + F  +  KPP  PG YI+    S K+LL+NL++NGA + +++
Sbjct  8     VADAKTGIITVSTVSNSSVFTPSAQKPPTAPG-YISI---SNKKLLKNLEINGAQSQRLT  63

Query  385   SWVDSMRASSPTQ-KSTP---LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDG  552
             SWVDSMRASSPT  KS P     ++  +W+ +HPSALDMFE+II+A+ GK IVMFLDYDG
Sbjct  64    SWVDSMRASSPTHLKSLPSLSAQEELNSWIKRHPSALDMFERIIEAASGKQIVMFLDYDG  123

Query  553   TLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMD  732
             TLSPIVDDPD AFMS  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMD
Sbjct  124   TLSPIVDDPDRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMD  183

Query  733   IKGPSRG-SKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVH  909
             IKGP++G S+Y K  +  +L+QPA +FLPMIDEVYK L+E+T ST G KVENNKFC+SVH
Sbjct  184   IKGPTKGFSRYNKD-KPSILYQPAGDFLPMIDEVYKQLVEKTKSTAGAKVENNKFCLSVH  242

Query  910   FRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYAN  1089
             FRCVDE KW ELA  VRSV+K+YP L+L+QGRKV EIRP+++WDKGKALEFLLESLG+ N
Sbjct  243   FRCVDEKKWSELALNVRSVVKKYPTLKLSQGRKVFEIRPMVKWDKGKALEFLLESLGFEN  302

Query  1090  STDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLV  1269
             S +VFP+YIGDD+TDEDAFKVLRE  QGFGILVSK PKDT ASYSLQ+P +VM FL+RLV
Sbjct  303   SNEVFPIYIGDDKTDEDAFKVLRERGQGFGILVSKFPKDTSASYSLQDPPQVMDFLKRLV  362

Query  1270  EWK  1278
             EWK
Sbjct  363   EWK  365



>ref|XP_004504060.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X1 [Cicer arietinum]
Length=364

 Score =   490 bits (1262),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/358 (69%), Positives = 289/358 (81%), Gaps = 10/358 (3%)
 Frame = +1

Query  223   MTRHNVVAV---SDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWV  393
             MT+ NVV     S  N   T   KPP  P GYI       + +L+NL++N A  ++++ +
Sbjct  1     MTQQNVVVSETKSGINAAITMTQKPPAPPAGYIPI---PRRRILKNLEIN-AGQRINTCI  56

Query  394   DSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPI  567
             DSMRASSPT  KSTP  ++++ +W+++HPSALDMFEQI  ASKGK IVMFLDYDGTLSPI
Sbjct  57    DSMRASSPTHVKSTPSFAEEYNSWILRHPSALDMFEQIKDASKGKQIVMFLDYDGTLSPI  116

Query  568   VDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPS  747
             VDDPD AFMS+ MR TVRKLA  FPTAIV+GRC DKVY+F+RLAELYYAGSHGMDIKGP+
Sbjct  117   VDDPDRAFMSESMRKTVRKLARCFPTAIVTGRCIDKVYNFIRLAELYYAGSHGMDIKGPT  176

Query  748   RGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             + SKY K  + E +LFQPA EF+PMI+EVY+ L+E+T STPGV VEN+KFC SVHFRCVD
Sbjct  177   KESKYNKNNKAEALLFQPAREFVPMINEVYQKLVEKTKSTPGVIVENHKFCASVHFRCVD  236

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +W ELAQQV+SVLKEYPKL LT GRKVLEIRP I+WDKGKALEFLLE+LG+AN  DVF
Sbjct  237   EKRWIELAQQVKSVLKEYPKLHLTHGRKVLEIRPSIKWDKGKALEFLLETLGFANCNDVF  296

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDD+TDEDAFK L +  QGFGILVSK PK+T ASYSLQEP+EVM FL+RLV WK
Sbjct  297   PVYIGDDKTDEDAFKKLSDRGQGFGILVSKFPKETTASYSLQEPNEVMEFLQRLVVWK  354



>ref|XP_006399500.1| hypothetical protein EUTSA_v10013874mg [Eutrema salsugineum]
 gb|ESQ40953.1| hypothetical protein EUTSA_v10013874mg [Eutrema salsugineum]
Length=369

 Score =   489 bits (1260),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 240/333 (72%), Positives = 273/333 (82%), Gaps = 8/333 (2%)
 Frame = +1

Query  295   VPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLS----DDHRTW  459
              P G I+    S K+LL+NLDV     ++++WVDSMRASSPT  KS P S        +W
Sbjct  34    APPGLISI---SKKKLLKNLDVINGGQRINAWVDSMRASSPTHLKSLPSSIYSQQQLNSW  90

Query  460   MMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYF  639
             +M HPSALDMFEQI++AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  F
Sbjct  91    IMHHPSALDMFEQIMEASGGKQIVMFLDYDGTLSPIVDDPDRAFMSSKMRRTVKKLAKCF  150

Query  640   PTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPM  819
             PTAIV+GRC DKVY+FV+LAELYYAGSHGMDIKGPS+G   +K  ++ +L+QPAS++LPM
Sbjct  151   PTAIVTGRCIDKVYNFVKLAELYYAGSHGMDIKGPSKGVSRQKRLKQSLLYQPASDYLPM  210

Query  820   IDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQ  999
             IDEVY+ LLE T STPG KVEN+KFC SVHFRCVDE KW EL QQVRSVL+EYP L+LTQ
Sbjct  211   IDEVYRKLLETTKSTPGAKVENHKFCASVHFRCVDEKKWSELVQQVRSVLQEYPTLKLTQ  270

Query  1000  GRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFG  1179
             GRKV EIRP+IEWDKGKALEFLLESLG  NS DVFPVYIGDDRTDEDAFK+LR+  +GFG
Sbjct  271   GRKVFEIRPMIEWDKGKALEFLLESLGLGNSNDVFPVYIGDDRTDEDAFKMLRDRGEGFG  330

Query  1180  ILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             ILVSK PKDT ASYSL +PS+VM FLRRLVEWK
Sbjct  331   ILVSKFPKDTDASYSLHDPSQVMDFLRRLVEWK  363



>gb|KHF97975.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=368

 Score =   489 bits (1260),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 236/319 (74%), Positives = 265/319 (83%), Gaps = 7/319 (2%)
 Frame = +1

Query  340   LLQNLDVNGAAAKVSSWVDSMRASSPTQ------KSTPLSDDHRTWMMQHPSALDMFEQI  501
             L++  +     AK+S+WVDSMRASSPT+       S P +DD  +W++ HPSAL MFEQI
Sbjct  41    LMKRFEAENGGAKISAWVDSMRASSPTRIKSSTTASLPETDDTSSWIVHHPSALSMFEQI  100

Query  502   IKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVY  681
             +  SKGK IVMFLDYDGTLSPIV+DPD AFM   MRATVR +A YFPTAIV+GRC DKVY
Sbjct  101   VAGSKGKQIVMFLDYDGTLSPIVEDPDQAFMPKEMRATVRDVARYFPTAIVTGRCRDKVY  160

Query  682   SFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSS  861
             SFV+LA LYYAGSHGMDIKGPS+  KYKKG  + VLFQ ASEFLPMIDEVYK L+E+T S
Sbjct  161   SFVKLAGLYYAGSHGMDIKGPSKSCKYKKG-NQGVLFQAASEFLPMIDEVYKDLVEKTKS  219

Query  862   TPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWD  1041
              PG KVENNKFCVSVHFRCVDE  W  LA+QVRSVL  YPKL+LTQGRKVLEIRP I+WD
Sbjct  220   IPGTKVENNKFCVSVHFRCVDEKSWAALAEQVRSVLNHYPKLKLTQGRKVLEIRPTIKWD  279

Query  1042  KGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASY  1221
             KG+ALEFLLESLGYANST+V PVYIGDDR+DEDAF VLRE  QGFGILVSKLPK+T+ASY
Sbjct  280   KGRALEFLLESLGYANSTNVLPVYIGDDRSDEDAFMVLRERGQGFGILVSKLPKETNASY  339

Query  1222  SLQEPSEVMLFLRRLVEWK  1278
             SLQEPSEV  FL+RLV+WK
Sbjct  340   SLQEPSEVKEFLKRLVDWK  358



>ref|XP_004504061.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X2 [Cicer arietinum]
Length=362

 Score =   489 bits (1259),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 288/357 (81%), Gaps = 10/357 (3%)
 Frame = +1

Query  223   MTRHNVVAV---SDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWV  393
             MT+ NVV     S  N   T   KPP  P GYI       + +L+NL++N A  ++++ +
Sbjct  1     MTQQNVVVSETKSGINAAITMTQKPPAPPAGYIPI---PRRRILKNLEIN-AGQRINTCI  56

Query  394   DSMRASSPTQ-KSTP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPI  567
             DSMRASSPT  KSTP  ++++ +W+++HPSALDMFEQI  ASKGK IVMFLDYDGTLSPI
Sbjct  57    DSMRASSPTHVKSTPSFAEEYNSWILRHPSALDMFEQIKDASKGKQIVMFLDYDGTLSPI  116

Query  568   VDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPS  747
             VDDPD AFMS+ MR TVRKLA  FPTAIV+GRC DKVY+F+RLAELYYAGSHGMDIKGP+
Sbjct  117   VDDPDRAFMSESMRKTVRKLARCFPTAIVTGRCIDKVYNFIRLAELYYAGSHGMDIKGPT  176

Query  748   RGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDE  927
             + SKY K   E +LFQPA EF+PMI+EVY+ L+E+T STPGV VEN+KFC SVHFRCVDE
Sbjct  177   KESKYNK-VTEALLFQPAREFVPMINEVYQKLVEKTKSTPGVIVENHKFCASVHFRCVDE  235

Query  928   LKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFP  1107
              +W ELAQQV+SVLKEYPKL LT GRKVLEIRP I+WDKGKALEFLLE+LG+AN  DVFP
Sbjct  236   KRWIELAQQVKSVLKEYPKLHLTHGRKVLEIRPSIKWDKGKALEFLLETLGFANCNDVFP  295

Query  1108  VYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VYIGDD+TDEDAFK L +  QGFGILVSK PK+T ASYSLQEP+EVM FL+RLV WK
Sbjct  296   VYIGDDKTDEDAFKKLSDRGQGFGILVSKFPKETTASYSLQEPNEVMEFLQRLVVWK  352



>ref|XP_010444490.1| PREDICTED: probable trehalose-phosphate phosphatase J [Camelina 
sativa]
Length=369

 Score =   489 bits (1259),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 241/354 (68%), Positives = 290/354 (82%), Gaps = 11/354 (3%)
 Frame = +1

Query  235   NVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVSSWVDSMRAS  411
              V  VS+ + F  +  KPP  PG YI+    S K+LL+NL++NGA + +++SWVDSMRAS
Sbjct  17    TVSTVSNSSVFTPSAQKPPTAPG-YISI---SKKKLLKNLEINGAQSQRLTSWVDSMRAS  72

Query  412   SPTQ-KSTP---LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT  KS P     ++  +W+ +HPSALDMFE+II+A++GK IVMFLDYDGTLSPIVDDP
Sbjct  73    SPTHLKSLPSLSAQEELNSWIKRHPSALDMFERIIEAARGKQIVMFLDYDGTLSPIVDDP  132

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AFMS  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  133   DRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  192

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDEVYK L+E+T ST G KVENNKFC+SVHFRCVDE KW
Sbjct  193   RYNKD-KPSVLYQPAGDFLPMIDEVYKQLVEKTKSTAGAKVENNKFCLSVHFRCVDEKKW  251

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV++ YP L+L+QGRKV EIRP+++WDKGKALEFLLESLG+ N  +VFP+YI
Sbjct  252   SELALKVRSVVQNYPTLKLSQGRKVFEIRPMVKWDKGKALEFLLESLGFENCNEVFPIYI  311

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GDD+TDEDAFK+LRE  QGFGILVSK PKDT ASYSLQ+P EVM FLRRLVEWK
Sbjct  312   GDDKTDEDAFKLLREREQGFGILVSKFPKDTSASYSLQDPPEVMDFLRRLVEWK  365



>ref|XP_010462232.1| PREDICTED: probable trehalose-phosphate phosphatase J [Camelina 
sativa]
Length=369

 Score =   488 bits (1257),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 240/354 (68%), Positives = 289/354 (82%), Gaps = 11/354 (3%)
 Frame = +1

Query  235   NVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVSSWVDSMRAS  411
              V  VS+ + F  +  KPP  PG YI+    S K+LL+NL++NGA + +++SWVDSMRAS
Sbjct  17    TVSTVSNSSVFTPSAQKPPTAPG-YISI---SKKKLLKNLEINGAQSQRLTSWVDSMRAS  72

Query  412   SPTQ-KSTP---LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT  KS P     ++  +W+ +HPSALDMFE++ +A++GK IVMFLDYDGTLSPIVDDP
Sbjct  73    SPTHLKSLPSLSAQEELNSWIKRHPSALDMFERVTEAARGKQIVMFLDYDGTLSPIVDDP  132

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AFMS  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  133   DRAFMSSKMRRTVKKMAKSFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  192

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDEVYK L+E+T ST G KVENNKFC+SVHFRCVDE KW
Sbjct  193   RYNKD-KPSVLYQPAGDFLPMIDEVYKQLVEKTKSTAGAKVENNKFCLSVHFRCVDEKKW  251

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV+K YP L+L+QGRKV EIRP+++WDKGKALEFLLESLG+ N  +VFP+YI
Sbjct  252   SELALKVRSVVKNYPTLKLSQGRKVFEIRPMVKWDKGKALEFLLESLGFENCNEVFPIYI  311

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GDD+TDEDAFK+LRE  QGFGILVSK PKDT ASYSLQ+P EVM FLRRLVEWK
Sbjct  312   GDDKTDEDAFKLLREREQGFGILVSKFPKDTSASYSLQDPPEVMDFLRRLVEWK  365



>ref|XP_010939628.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=379

 Score =   489 bits (1258),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 239/325 (74%), Positives = 270/325 (83%), Gaps = 12/325 (4%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQK-------STP---LSDDHRTWMMQHPSAL  483
             K+ L  LD+ G   + ++WV+SM+ASSPT         +TP     D++ TW+M+HPSAL
Sbjct  47    KKYLSQLDLGGR--RTNTWVESMKASSPTHSKAVAALAATPSVGAQDEYATWIMRHPSAL  104

Query  484   DMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGR  663
             + FEQII ASKGK IVMFLDYDGTLSPIVDDPDSAFMSD MRA VR +A +FPTAIVSGR
Sbjct  105   NKFEQIISASKGKQIVMFLDYDGTLSPIVDDPDSAFMSDAMRAAVRDVARFFPTAIVSGR  164

Query  664   CTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTL  843
             C DKVY+FVRLAELYYAGSHGMDIKGP+RG +YKK   + VLFQPASEFLPMIDEVYK L
Sbjct  165   CRDKVYNFVRLAELYYAGSHGMDIKGPARGPRYKKAKAKAVLFQPASEFLPMIDEVYKAL  224

Query  844   LEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIR  1023
             LE+T S PG KVENNKFC+SVHFRCVDE  W  LA++V +VLKEYPKLRLTQGRKVLEI+
Sbjct  225   LEKTKSVPGAKVENNKFCLSVHFRCVDEKSWSGLAEEVMAVLKEYPKLRLTQGRKVLEIK  284

Query  1024  PIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPK  1203
             P I+WDKGKALEFLLESLG+A+  DV PVYIGDDRTDEDAFKVL +  QGFGILVSK PK
Sbjct  285   PTIKWDKGKALEFLLESLGFADCNDVLPVYIGDDRTDEDAFKVLCDRGQGFGILVSKFPK  344

Query  1204  DTHASYSLQEPSEVMLFLRRLVEWK  1278
             +T+ASYSLQEPSEVM FL RLVEWK
Sbjct  345   ETNASYSLQEPSEVMDFLLRLVEWK  369



>ref|XP_008440611.1| PREDICTED: probable trehalose-phosphate phosphatase J [Cucumis 
melo]
Length=387

 Score =   488 bits (1257),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 246/360 (68%), Positives = 285/360 (79%), Gaps = 19/360 (5%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVP-----GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSM  402
              V VS+ + F     KPP  P     GGYI+  ++   +L+Q  D     A++ +WVDSM
Sbjct  21    TVTVSNSSIFQATAQKPPAGPSSTTGGGYIS--ISRSTKLVQQPD---GRARIKTWVDSM  75

Query  403   RASSPTQ-KSTP-------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             RASSP++ K TP         D + +WM+ HPSALDMF+QII ASKGK IVMFLDYDGTL
Sbjct  76    RASSPSRIKPTPSLSDHDHDHDHNSSWMLHHPSALDMFDQIIDASKGKQIVMFLDYDGTL  135

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMSD MR TV+ +A  FPTAIVSGR  DKVY FVRL ELYYAGSHGMDIK
Sbjct  136   SPIVDDPDRAFMSDAMRKTVKMVARSFPTAIVSGRRRDKVYGFVRLGELYYAGSHGMDIK  195

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GP++ S YKK   + VLFQPASEFLPMID+VYK L+E+T STPG KVENNKFC+SVH+RC
Sbjct  196   GPTKDSNYKK-CTQSVLFQPASEFLPMIDQVYKQLVEKTKSTPGAKVENNKFCLSVHYRC  254

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             V+E KW ELAQQV+SVLK++P+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG+ N +D
Sbjct  255   VEEKKWSELAQQVKSVLKDFPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFNNCSD  314

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDDRTDEDAFK++RE  QGFGILVSK PK+T ASYSL+EPSEVM FL+RL EWK
Sbjct  315   VFPVYIGDDRTDEDAFKIIRERGQGFGILVSKFPKETSASYSLREPSEVMDFLQRLAEWK  374



>ref|XP_010321465.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Solanum lycopersicum]
Length=348

 Score =   486 bits (1252),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 231/302 (76%), Positives = 259/302 (86%), Gaps = 1/302 (0%)
 Frame = +1

Query  352   LDVNGAAAKVSSWVDSMRASSPTQK-STPLSDDHRTWMMQHPSALDMFEQIIKASKGKNI  528
             +++NG    + SW+DSMRASSPT   ST L +D  +WM+ HPSA+DMFE II  SKGK I
Sbjct  45    VEINGDPKIMKSWIDSMRASSPTHHMSTTLYEDKTSWMVHHPSAVDMFEDIISVSKGKKI  104

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA YFPTAIVSGRC DKVY+FV+L+ELY
Sbjct  105   VMFLDYDGTLSPIVDDPDQAFMSHDMRGTVRKLARYFPTAIVSGRCRDKVYNFVQLSELY  164

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGPS+GSKY K   + +LFQPAS+FLPMI EVYK LL++T S  GV+VENN
Sbjct  165   YAGSHGMDIKGPSKGSKYSKKGTQAILFQPASKFLPMIIEVYKELLDKTKSIEGVRVENN  224

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFCVSVHFRCVDE KWGEL+Q+VR VLKEYPKL+L QGRKVLEIRPII+WDKGKAL+FLL
Sbjct  225   KFCVSVHFRCVDEKKWGELSQEVRLVLKEYPKLKLCQGRKVLEIRPIIKWDKGKALQFLL  284

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             +SLGYA   DVFP+YIGDDRTDEDAFKVLRE RQG GILVSK PK+THASYSLQEPSEV 
Sbjct  285   QSLGYAKCNDVFPIYIGDDRTDEDAFKVLRERRQGLGILVSKTPKETHASYSLQEPSEVR  344

Query  1249  LF  1254
             +F
Sbjct  345   IF  346



>ref|XP_006394074.1| hypothetical protein EUTSA_v10004405mg [Eutrema salsugineum]
 gb|ESQ31360.1| hypothetical protein EUTSA_v10004405mg [Eutrema salsugineum]
Length=379

 Score =   486 bits (1251),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 241/353 (68%), Positives = 292/353 (83%), Gaps = 11/353 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVSSWVDSMRASS  414
             V  VS+ + F  +  KPP  PG +I+    S K++L+NL++NGA + +++SWVDSMRASS
Sbjct  18    VSTVSNSSVFTPSAQKPPTAPG-HISI---SKKKILKNLEINGAQSQRLNSWVDSMRASS  73

Query  415   PTQ-KSTPL---SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPD  582
             PT  KS P     ++  +W+ +HPSALDMFE+II+AS+GK IVMFLDYDGTLSPIVDDPD
Sbjct  74    PTHLKSLPSLSSQEELNSWIKRHPSALDMFERIIEASRGKQIVMFLDYDGTLSPIVDDPD  133

Query  583   SAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SK  759
              AF+S  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S+
Sbjct  134   RAFISSKMRRTVKKVAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFSR  193

Query  760   YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWG  939
             Y K  +  VL+QPA +FLPMIDEV+K L+E+T ST G KVENNKFC+SVHFRCVDE KW 
Sbjct  194   YNKD-KPSVLYQPAGDFLPMIDEVFKQLVERTKSTAGAKVENNKFCLSVHFRCVDEKKWS  252

Query  940   ELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIG  1119
             ELA +VRSV++ YP L+L+QGRKV EIRP+I+WDKGKALEFLLESLG+ NS DVFP+YIG
Sbjct  253   ELALKVRSVVQNYPTLKLSQGRKVFEIRPMIKWDKGKALEFLLESLGFENSNDVFPIYIG  312

Query  1120  DDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DDRTDEDAFK+L+E  QGFGILVSK PKDT+ASYSLQ+P EVM FLRRLVEWK
Sbjct  313   DDRTDEDAFKLLQERGQGFGILVSKFPKDTNASYSLQDPPEVMDFLRRLVEWK  365



>ref|XP_007018810.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY16035.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
1 [Theobroma cacao]
Length=364

 Score =   485 bits (1248),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 235/318 (74%), Positives = 268/318 (84%), Gaps = 6/318 (2%)
 Frame = +1

Query  340   LLQNLDVNGAAAKVSSWVDSMRASSPTQ-KST----PLSDDHRTWMMQHPSALDMFEQII  504
             L++  +   A AK+++WVDSMRASSPT+ KST    P +D+  +W++ HPSAL MFEQI+
Sbjct  41    LMKRFETEKAGAKINAWVDSMRASSPTRIKSTASLPPETDEKSSWIVHHPSALSMFEQIV  100

Query  505   KASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYS  684
              ASKGK IVMFLDYDGTLSPIV+DPD AFM   MRA +R +A YFPTAIV+GRC DKVYS
Sbjct  101   AASKGKQIVMFLDYDGTLSPIVEDPDQAFMPREMRAALRDVARYFPTAIVTGRCRDKVYS  160

Query  685   FVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSST  864
             FV+LA LYYAGSHGMDIKGPS+  KYKKG  + VLFQPASEFLPMID+VYK L+E+T S 
Sbjct  161   FVKLAGLYYAGSHGMDIKGPSKSCKYKKG-NQGVLFQPASEFLPMIDKVYKALVEKTKSI  219

Query  865   PGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDK  1044
             PG KVENNKFCVSVHFRCVDE  W  LA+QVRSVL EYPKL+LTQGR VLEIRP I+WDK
Sbjct  220   PGAKVENNKFCVSVHFRCVDEKSWAALAEQVRSVLNEYPKLKLTQGRLVLEIRPTIKWDK  279

Query  1045  GKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYS  1224
             G+ALEFLLE+LGYANS DV PVYIGDDRTDEDAFKVLR+  QGFGILVSK+PK+T+A YS
Sbjct  280   GRALEFLLEALGYANSNDVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKVPKETNAFYS  339

Query  1225  LQEPSEVMLFLRRLVEWK  1278
             LQEPSEV  FLRRLV+WK
Sbjct  340   LQEPSEVKEFLRRLVDWK  357



>ref|XP_009109445.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X2 [Brassica rapa]
Length=334

 Score =   483 bits (1244),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 271/327 (83%), Gaps = 5/327 (2%)
 Frame = +1

Query  301   GGYINFDVTS-GKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+  K++LQ+L +N     V+SWVDSMRA SPT   + +     +W+ +HPS
Sbjct  6     GNISNTDVTTLTKKVLQDLSINNGGGFVNSWVDSMRACSPTHLKSLMK--QSSWLTEHPS  63

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  64    ALDMFEEILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLAICFPTAIVS  123

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP++GSKYK+G  + +L QPA+EFLPMIDEVY+
Sbjct  124   GRCREKVYNFVKLTELYYAGSHGMDIKGPAQGSKYKEG--KSLLCQPATEFLPMIDEVYQ  181

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+E+T  TPG  VENNKFC SVHFR VDE  W +LA QV SV+KEYPKLR+TQGRKVLE
Sbjct  182   KLVEKTKVTPGANVENNKFCASVHFRRVDEKNWSDLANQVGSVIKEYPKLRITQGRKVLE  241

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK 
Sbjct  242   IRPIIKWDKGKALEFLLESLGYANCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKF  301

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP EVM FL+RLVEW+
Sbjct  302   PKETNASYSLQEPDEVMDFLQRLVEWE  328



>ref|XP_010422893.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Camelina sativa]
Length=375

 Score =   484 bits (1247),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/335 (71%), Positives = 279/335 (83%), Gaps = 10/335 (3%)
 Frame = +1

Query  295   VPGGYINFDVTSGKELLQNLDV--NGAAAKVSSWVDSMRASSPTQ-KSTP--LSDDHR--  453
             +P G I+    S K LL+N+D+   G   ++++WVDSMRASSPT  KS P  +S  H+  
Sbjct  38    LPPGLISI---SKKNLLKNIDIINGGGGHRINAWVDSMRASSPTHLKSLPSSISSQHQLN  94

Query  454   TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLAT  633
             +W+MQHPSAL+MFE+II+AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA 
Sbjct  95    SWIMQHPSALEMFERIIEASGGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAK  154

Query  634   YFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFL  813
              FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDI GP++G    K  ++ +L+QPA+++L
Sbjct  155   CFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDIIGPAKGFSRHKRVKQSLLYQPANDYL  214

Query  814   PMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRL  993
             PMIDEVYK LLE+T STPGVKVEN+KFC SVHFRCVDE KW EL  QVRSVLK++P L+L
Sbjct  215   PMIDEVYKQLLEKTKSTPGVKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKKFPTLKL  274

Query  994   TQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQG  1173
             TQGRKV EIRP+IEWDKGKALEFLLESLG+ NS +VFPVYIGDDRTDEDAFK+LR+  +G
Sbjct  275   TQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTDEDAFKMLRDRGEG  334

Query  1174  FGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             FGILVSK PKDT ASYSLQ+PSEVM FLRRLVEWK
Sbjct  335   FGILVSKFPKDTDASYSLQDPSEVMDFLRRLVEWK  369



>ref|XP_009373162.1| PREDICTED: probable trehalose-phosphate phosphatase D [Pyrus 
x bretschneideri]
Length=375

 Score =   484 bits (1247),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/352 (69%), Positives = 281/352 (80%), Gaps = 8/352 (2%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT  420
             V V+    F  +  KP    GG   F +    ++L+ +D  G AA+V++WVDS+RASSPT
Sbjct  18    VTVAKKAMFSQSVPKPMTEGGGGGCFTIPMNIKVLK-VDTEGGAARVNAWVDSLRASSPT  76

Query  421   --QKSTP--LSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPD  582
               + +TP  LS+  D+ +W + HPSA+ MFEQI  ASKGK IVMFLDYDGTLSPIV+DPD
Sbjct  77    RVKSATPQSLSETVDYNSWTIHHPSAMSMFEQITNASKGKQIVMFLDYDGTLSPIVEDPD  136

Query  583   SAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKY  762
              AFMS+ MR  VR  A YFPTAIVSGRC DKVYSFV+L ELYYAGSHGMDI+GPS+ SKY
Sbjct  137   RAFMSNEMRKAVRATARYFPTAIVSGRCRDKVYSFVKLGELYYAGSHGMDIRGPSKSSKY  196

Query  763   KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGE  942
             K    + VLFQPASEF+PMIDEVYKTLLE+T S  G +VENNKFC+SVHFRCVDE  W  
Sbjct  197   KND-NQAVLFQPASEFVPMIDEVYKTLLEKTRSISGARVENNKFCLSVHFRCVDEKSWAA  255

Query  943   LAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGD  1122
             LA+QVR VL EYPKLRLTQGRKVLE+RP I+WDKGKALEFLLESLGYANS +VFPVYIGD
Sbjct  256   LAEQVRLVLNEYPKLRLTQGRKVLEVRPTIKWDKGKALEFLLESLGYANSNEVFPVYIGD  315

Query  1123  DRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DRTDEDAFKVLR+  QGFGILVSK+PK+T+ASY+LQEP+EV  FL RLV+WK
Sbjct  316   DRTDEDAFKVLRDRGQGFGILVSKVPKETNASYTLQEPAEVKDFLLRLVKWK  367



>ref|XP_009109444.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Brassica rapa]
Length=345

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 271/327 (83%), Gaps = 5/327 (2%)
 Frame = +1

Query  301   GGYINFDVTS-GKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+  K++LQ+L +N     V+SWVDSMRA SPT   + +     +W+ +HPS
Sbjct  17    GNISNTDVTTLTKKVLQDLSINNGGGFVNSWVDSMRACSPTHLKSLMK--QSSWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEEILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLAICFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP++GSKYK+G  + +L QPA+EFLPMIDEVY+
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPAQGSKYKEG--KSLLCQPATEFLPMIDEVYQ  192

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+E+T  TPG  VENNKFC SVHFR VDE  W +LA QV SV+KEYPKLR+TQGRKVLE
Sbjct  193   KLVEKTKVTPGANVENNKFCASVHFRRVDEKNWSDLANQVGSVIKEYPKLRITQGRKVLE  252

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK 
Sbjct  253   IRPIIKWDKGKALEFLLESLGYANCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKF  312

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP EVM FL+RLVEW+
Sbjct  313   PKETNASYSLQEPDEVMDFLQRLVEWE  339



>ref|NP_195687.2| probable trehalose-phosphate phosphatase H [Arabidopsis thaliana]
 sp|Q8GWG2.1|TPPH_ARATH RecName: Full=Probable trehalose-phosphate phosphatase H; Short=AtTPPH; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 dbj|BAC43453.1| putative protein [Arabidopsis thaliana]
 gb|AAO63975.1| unknown protein [Arabidopsis thaliana]
 gb|AEE87117.1| probable trehalose-phosphate phosphatase H [Arabidopsis thaliana]
Length=349

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/329 (72%), Positives = 271/329 (82%), Gaps = 5/329 (2%)
 Frame = +1

Query  301   GGYINFDVTS-GKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+  K+ LQ++ +N     ++SWVDSMRA SPT   + L     +W+ +HPS
Sbjct  17    GNKSNNDVTTTKKKALQDIIINNGVGLINSWVDSMRACSPTHLKSLLK--QSSWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEEILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSRKMRRTVRKLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEED--VLFQPASEFLPMIDEV  831
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +GSKY++  ++   +L QPA+EFLPMIDEV
Sbjct  135   GRCIEKVYNFVKLTELYYAGSHGMDIKGPEQGSKYEQILQDSKSLLCQPATEFLPMIDEV  194

Query  832   YKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKV  1011
             Y  L+E+T STPG +VENNKFCVSVHFR VDE  W +LA QVRSV+K+YPKLRLTQGRKV
Sbjct  195   YHKLVEKTKSTPGAQVENNKFCVSVHFRRVDENNWSDLANQVRSVMKDYPKLRLTQGRKV  254

Query  1012  LEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVS  1191
             LE+RPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFKVLRE RQG GILVS
Sbjct  255   LEVRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKVLRERRQGLGILVS  314

Query  1192  KLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             K PK+T ASYSLQEP EVM FL+RLVEWK
Sbjct  315   KFPKETSASYSLQEPDEVMEFLQRLVEWK  343



>emb|CDX90361.1| BnaA08g16230D [Brassica napus]
Length=354

 Score =   483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 271/327 (83%), Gaps = 5/327 (2%)
 Frame = +1

Query  301   GGYINFDVTS-GKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+  K++LQ+L +N     V+SWVDSMRA SPT   + +     +W+ +HPS
Sbjct  26    GNISNTDVTTLKKKVLQDLSINNGGGFVNSWVDSMRACSPTHLKSLMK--QSSWLTEHPS  83

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  84    ALDMFEEILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLAICFPTAIVS  143

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP++GSKYK+G  + +L QPA+EFLPMIDEVY+
Sbjct  144   GRCREKVYNFVKLTELYYAGSHGMDIKGPAQGSKYKEG--KSLLCQPATEFLPMIDEVYQ  201

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+E+T  TPG  VENNKFC SVHFR VDE  W +LA QV SV+KEYPKLR+TQGRKVLE
Sbjct  202   KLVEKTKVTPGANVENNKFCASVHFRRVDEKNWSDLANQVGSVIKEYPKLRITQGRKVLE  261

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK 
Sbjct  262   IRPIIKWDKGKALEFLLESLGYANCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKF  321

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP EVM FL+RLVEW+
Sbjct  322   PKETNASYSLQEPDEVMDFLQRLVEWE  348



>ref|XP_008391072.1| PREDICTED: LOW QUALITY PROTEIN: probable trehalose-phosphate 
phosphatase D [Malus domestica]
Length=376

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/344 (70%), Positives = 279/344 (81%), Gaps = 8/344 (2%)
 Frame = +1

Query  265   FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTP-  435
             F  +  KP    GG   F +    ++L+ +D  G AA+V++WVDS+RASSPT  + +TP 
Sbjct  27    FSQSVPKPMTEGGGGGCFTIPMNIKVLK-VDTEGGAARVNAWVDSLRASSPTRVKSATPQ  85

Query  436   -LSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPM  606
              LS+  D+ +W + HPSA+ MFEQI  ASKGK IVMFLDYDGTLSPIV+DPDSAFMS+ M
Sbjct  86    SLSETVDYNSWTIHHPSAMSMFEQITNASKGKQIVMFLDYDGTLSPIVEDPDSAFMSNEM  145

Query  607   RATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDV  786
             R  VR  A YFPTAIVSGRC DKVYSFV+L ELYYAGSHGMDI+GPS+ SKYK    + V
Sbjct  146   RKAVRDAARYFPTAIVSGRCRDKVYSFVQLGELYYAGSHGMDIRGPSKSSKYKND-NQAV  204

Query  787   LFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSV  966
             LFQPASEF+PMIDEVYKTLLE+T S  G +VENNKF +SVHFRCVDE  W  LA+QVR V
Sbjct  205   LFQPASEFVPMIDEVYKTLLEKTRSISGSRVENNKFSLSVHFRCVDEKSWAALAEQVRLV  264

Query  967   LKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAF  1146
             L EYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLGYANS +VFPVYIGDDRTDEDAF
Sbjct  265   LNEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANSNEVFPVYIGDDRTDEDAF  324

Query  1147  KVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             KVLR+  QGFGILVSK+PK+T+ASY+LQEP+EV  FLRRLV+WK
Sbjct  325   KVLRDRGQGFGILVSKVPKETNASYTLQEPAEVKDFLRRLVKWK  368



>ref|XP_006287992.1| hypothetical protein CARUB_v10001225mg [Capsella rubella]
 gb|EOA20890.1| hypothetical protein CARUB_v10001225mg [Capsella rubella]
Length=366

 Score =   484 bits (1245),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 237/348 (68%), Positives = 283/348 (81%), Gaps = 13/348 (4%)
 Frame = +1

Query  256   PNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDV--NGAAAKVSSWVDSMRASSPTQ-K  426
             PN   ++  K   +P G I     S K+LL+N+D+   GA  ++++WVDSMRASSPT  +
Sbjct  19    PNNNNSSSQK---LPPGLIP---VSKKQLLKNIDIINGGAGQRINAWVDSMRASSPTHLR  72

Query  427   STPLSDDHR----TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFM  594
             S P S   +    +W+MQHPSAL+MFE+I++AS GK IVMFLDYDGTLSPIVDDPD A+M
Sbjct  73    SLPSSISSQQQLNSWIMQHPSALEMFERIMEASGGKQIVMFLDYDGTLSPIVDDPDKAYM  132

Query  595   SDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA  774
             S  MR TV+KLA  FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDIKGP++G    K  
Sbjct  133   SSKMRTTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDIKGPAKGFPRHKRV  192

Query  775   EEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQ  954
             ++ +L+QPAS++LPMIDEVY+ LLE+T STPG +VEN+KFC SVHFRCVDE KW EL  Q
Sbjct  193   KQSLLYQPASDYLPMIDEVYRQLLEKTKSTPGARVENHKFCASVHFRCVDEKKWSELVLQ  252

Query  955   VRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTD  1134
             VRSVLK +P L+LTQGRKV EIRP+IEWDKGKALEFLLESLG+ NS +VFPVYIGDDRTD
Sbjct  253   VRSVLKNFPTLKLTQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTD  312

Query  1135  EDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             EDAFK+LR+  +GFGILVSK PKDT+ASYSLQ+PSEVM FLRRLVEWK
Sbjct  313   EDAFKMLRDRGEGFGILVSKFPKDTNASYSLQDPSEVMEFLRRLVEWK  360



>ref|NP_196572.2| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
 sp|F4KFG5.1|TPPI_ARATH RecName: Full=Probable trehalose-phosphate phosphatase I; Short=AtTPPI; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 gb|AED91493.1| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
Length=369

 Score =   483 bits (1244),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 273/323 (85%), Gaps = 6/323 (2%)
 Frame = +1

Query  328   SGKELLQNLDV-NGAAAKVSSWVDSMRASSPTQ-KSTPLS----DDHRTWMMQHPSALDM  489
             S K+LL+N+D+ NG   ++++WVDSMRASSPT  KS P S        +W+MQHPSAL+ 
Sbjct  41    SKKKLLKNIDIINGGGQRINAWVDSMRASSPTHLKSLPSSISTQQQLNSWIMQHPSALEK  100

Query  490   FEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCT  669
             FEQI++AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC 
Sbjct  101   FEQIMEASRGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCI  160

Query  670   DKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLE  849
             DKVY+FV+LAELYYAGSHGMDIKGP++G    K  ++ +L+QPA+++LPMIDEVY+ LLE
Sbjct  161   DKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLE  220

Query  850   QTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPI  1029
             +T STPG KVEN+KFC SVHFRCVDE KW EL  QVRSVLK++P L+LTQGRKV EIRP+
Sbjct  221   KTKSTPGAKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKKFPTLQLTQGRKVFEIRPM  280

Query  1030  IEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDT  1209
             IEWDKGKALEFLLESLG+ N+ +VFPVYIGDDRTDEDAFK+LR+  +GFGILVSK PKDT
Sbjct  281   IEWDKGKALEFLLESLGFGNTNNVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDT  340

Query  1210  HASYSLQEPSEVMLFLRRLVEWK  1278
              ASYSLQ+PSEVM FLRRLVEWK
Sbjct  341   DASYSLQDPSEVMDFLRRLVEWK  363



>ref|XP_009127222.1| PREDICTED: probable trehalose-phosphate phosphatase H [Brassica 
rapa]
Length=345

 Score =   482 bits (1241),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 272/327 (83%), Gaps = 5/327 (2%)
 Frame = +1

Query  301   GGYINFDVTSG-KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+  K++LQ+L +N     ++SWVDSMRA SPT   + +     +W+ +HPS
Sbjct  17    GNKSNTDVTTATKKVLQDLIINNGGGLINSWVDSMRACSPTHLKSLMK--QSSWLKEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             AL+MFE+I+ AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVR LA  FPTAIVS
Sbjct  75    ALEMFEEILHASEGKQIVMFLDYDGTLSPIVDDPDRAFMSKQMRRTVRNLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +GSKY+  A++ +L QPA+EFLPMIDEVY+
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSKYE--ADKSLLCQPATEFLPMIDEVYQ  192

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+E+T STPG  VENNKFCVSVHFR VDE  W +LA QVRSV+K+YPKLRLTQGRKVLE
Sbjct  193   RLMEKTKSTPGANVENNKFCVSVHFRRVDEKNWSDLANQVRSVMKDYPKLRLTQGRKVLE  252

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRPII+WDKG ALEFLLESLGYAN T+VFP+YIGDDRTDEDAFK+LRE RQG GILVSK 
Sbjct  253   IRPIIKWDKGNALEFLLESLGYANCTNVFPLYIGDDRTDEDAFKILRERRQGLGILVSKS  312

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP EVM FL+RLV+WK
Sbjct  313   PKETNASYSLQEPDEVMDFLQRLVKWK  339



>ref|XP_010491663.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Camelina sativa]
Length=378

 Score =   483 bits (1244),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 236/335 (70%), Positives = 278/335 (83%), Gaps = 10/335 (3%)
 Frame = +1

Query  295   VPGGYINFDVTSGKELLQNLDV--NGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHR----  453
             +P G I+    S K+LL+N+D+  NG   ++++WVDSMRASSPT  KS P S   +    
Sbjct  41    LPPGLISI---SKKKLLKNIDIINNGGGQRINAWVDSMRASSPTHLKSLPSSISSQQQLN  97

Query  454   TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLAT  633
             +W+MQHPSAL+MFE+II+AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KL  
Sbjct  98    SWIMQHPSALEMFERIIEASGGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLGK  157

Query  634   YFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFL  813
              FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDI GP++G    K  ++ +L+QPA+++L
Sbjct  158   CFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDIIGPAKGFSRHKRVKQSLLYQPANDYL  217

Query  814   PMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRL  993
             PMIDEVYK LLE+T STPGVKVEN+KFC SVHFRCVDE +W EL  QVRSVLK++P L+L
Sbjct  218   PMIDEVYKQLLEKTKSTPGVKVENHKFCASVHFRCVDEKRWSELVLQVRSVLKKFPTLKL  277

Query  994   TQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQG  1173
             TQGRKV EIRP+IEWDKGKALEFLLESLG+ NS +VFPVYIGDDRTDEDAFK+LR+  +G
Sbjct  278   TQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTDEDAFKMLRDRGEG  337

Query  1174  FGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             FGILVSK PKDT ASYSLQ+PSEVM FLRRLVEWK
Sbjct  338   FGILVSKFPKDTDASYSLQDPSEVMDFLRRLVEWK  372



>ref|XP_002868927.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=349

 Score =   482 bits (1241),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 271/329 (82%), Gaps = 5/329 (2%)
 Frame = +1

Query  301   GGYINFDVTS-GKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+  K++LQ+L +N     ++SWVDSMRA SPT   + L     +W+ +HPS
Sbjct  17    GNKSNNDVTTTKKKVLQDLSINNGGGLINSWVDSMRACSPTHLKSLLK--QSSWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEEILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYK--KGAEEDVLFQPASEFLPMIDEV  831
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +GSK++  +   + +L QPA+EFLPMIDEV
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSKFEEVRFDSKSLLCQPATEFLPMIDEV  194

Query  832   YKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKV  1011
             YK L+E+T  TPG +VENNKFCVSVHFR VDE  W +LA QVRSV+K+YPKLRLTQGRKV
Sbjct  195   YKKLVEKTKFTPGAQVENNKFCVSVHFRRVDENNWSDLANQVRSVMKDYPKLRLTQGRKV  254

Query  1012  LEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVS  1191
             LE+RPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVS
Sbjct  255   LEVRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVS  314

Query  1192  KLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             K PK+T ASYSLQEP EVM FL+RLVEWK
Sbjct  315   KFPKETSASYSLQEPDEVMEFLQRLVEWK  343



>ref|XP_008790818.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=374

 Score =   483 bits (1243),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 238/325 (73%), Positives = 265/325 (82%), Gaps = 12/325 (4%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQK----------STPLSDDHRTWMMQHPSAL  483
             K+    LD+ G   + ++WV+SM+ASSPT            S    D++ TW+M+HPSAL
Sbjct  42    KKYPSQLDLGGR--RTNTWVESMKASSPTHSKAAAALVAAPSVGAQDEYATWIMRHPSAL  99

Query  484   DMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGR  663
               FEQII ASKGK IVMFLDYDGTLSPIVDDPDSAFMSD MRA VR  A +FPTAIVSGR
Sbjct  100   SKFEQIISASKGKQIVMFLDYDGTLSPIVDDPDSAFMSDAMRAAVRDAARFFPTAIVSGR  159

Query  664   CTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTL  843
             C DKVYSFV LAELYYAGSHGMDIKGP+RG +YKK   + VLFQPASEFLPMIDEVYK L
Sbjct  160   CRDKVYSFVGLAELYYAGSHGMDIKGPARGPRYKKAKAKAVLFQPASEFLPMIDEVYKAL  219

Query  844   LEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIR  1023
             LE+T S PG KVENNKFCVSVHFRCVDE  W  LA++V SVLKEYP+LRLT GRKVLEI+
Sbjct  220   LEKTKSVPGAKVENNKFCVSVHFRCVDEKSWSGLAEEVMSVLKEYPRLRLTHGRKVLEIK  279

Query  1024  PIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPK  1203
             P I+WDKGKALEFLLESLG+A+  DV PVYIGDDRTDEDAFKVLR+  QGFGILVSKLPK
Sbjct  280   PTIKWDKGKALEFLLESLGFADCNDVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKLPK  339

Query  1204  DTHASYSLQEPSEVMLFLRRLVEWK  1278
             +T+ASYSL+EPSEVM FL RLVEWK
Sbjct  340   ETNASYSLREPSEVMDFLLRLVEWK  364



>ref|XP_006411773.1| hypothetical protein EUTSA_v10025622mg [Eutrema salsugineum]
 gb|ESQ53226.1| hypothetical protein EUTSA_v10025622mg [Eutrema salsugineum]
Length=346

 Score =   481 bits (1239),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 235/328 (72%), Positives = 273/328 (83%), Gaps = 6/328 (2%)
 Frame = +1

Query  301   GGYINFDV-TSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DV T+ K++LQ+L +N     ++SWVDSMRA SPT   + +     +W+ +HPS
Sbjct  17    GNKSNTDVATAKKKVLQDLIINDGGGLINSWVDSMRACSPTHLKSLMK--QSSWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEEILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SKYKKGAEEDVLFQPASEFLPMIDEVY  834
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +G SKYK+  ++ +L QPA+EFLPM+DEVY
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPEQGGSKYKE--DQSLLCQPATEFLPMVDEVY  192

Query  835   KTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVL  1014
             + L+E+T  TPG KVENNKFCVSVHFR VDE  W +LA QVRSV+K+YPKLRLTQGRKVL
Sbjct  193   QKLIEKTRLTPGAKVENNKFCVSVHFRRVDEKNWSDLADQVRSVMKDYPKLRLTQGRKVL  252

Query  1015  EIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSK  1194
             E+RPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK
Sbjct  253   EVRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSK  312

Query  1195  LPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              PK+T+ASYSLQEP EVM FL+RLVEWK
Sbjct  313   FPKETNASYSLQEPDEVMDFLQRLVEWK  340



>ref|XP_010437099.1| PREDICTED: probable trehalose-phosphate phosphatase H [Camelina 
sativa]
Length=346

 Score =   481 bits (1238),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 273/327 (83%), Gaps = 4/327 (1%)
 Frame = +1

Query  301   GGYINFDVTSGKE-LLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+ K+ +LQ+L +N     ++SWVDSMRA SPT   + L  +  +W+ +HPS
Sbjct  17    GNKSNNDVTTAKKKVLQDLVINHGGGLINSWVDSMRACSPTHLKSLLKQN--SWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEDILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +GSKY++ ++  +L QPA+EFLPMIDEVY+
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSKYEEDSKS-LLCQPATEFLPMIDEVYQ  193

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+++T  TPG +VENNKFCVSVHFR V+E  W +LA QVRSV+K+YPKLRLTQGRKVLE
Sbjct  194   KLVQKTKLTPGAQVENNKFCVSVHFRRVNENNWSDLANQVRSVMKDYPKLRLTQGRKVLE  253

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             +RPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK 
Sbjct  254   VRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSKF  313

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP EVM FL+RLVEWK
Sbjct  314   PKETNASYSLQEPDEVMDFLQRLVEWK  340



>ref|XP_008782128.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=383

 Score =   482 bits (1240),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/341 (70%), Positives = 273/341 (80%), Gaps = 12/341 (4%)
 Frame = +1

Query  286   PPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPL------S  441
             PP    G +N+   S K LL  L++NG + ++++WVDSMRASSPT  +  +PL      S
Sbjct  34    PPRGNSGNVNY--ASYKRLLSQLELNGGSGRLNAWVDSMRASSPTHIKSDSPLASPVVAS  91

Query  442   DD--HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRAT  615
             DD  +  W  QHPSALD F++I  ASKGK IVMFLDYDGTLSPIVDDPD AFMSD MR+ 
Sbjct  92    DDEEYENWKKQHPSALDKFDEITAASKGKQIVMFLDYDGTLSPIVDDPDRAFMSDNMRSA  151

Query  616   VRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQ  795
             VR++A  FPTAIVSGRC DKVYSFV+L ELYYAGSHGMDIKGP++  K+ K     +LFQ
Sbjct  152   VREVARSFPTAIVSGRCRDKVYSFVQLRELYYAGSHGMDIKGPAKQPKHTKAKANALLFQ  211

Query  796   PASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKE  975
             PASEFLPMID VY+ L+E+T STPG KVENNKFCVSVHFRCVDE KW  LA+QVR VLK+
Sbjct  212   PASEFLPMIDAVYEALVEKTESTPGAKVENNKFCVSVHFRCVDEKKWSALAEQVRLVLKD  271

Query  976   YPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVL  1155
             YP+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG+A+  DVFP+YIGDDRTDEDAFKVL
Sbjct  272   YPRLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFADCNDVFPIYIGDDRTDEDAFKVL  331

Query  1156  RETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             R+  QG GILVSK PK+T ASYSL+EP+EVM FL RLV WK
Sbjct  332   RDRGQGIGILVSKFPKETSASYSLREPAEVMDFLHRLVNWK  372



>ref|XP_010431963.1| PREDICTED: probable trehalose-phosphate phosphatase H [Camelina 
sativa]
Length=346

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 272/327 (83%), Gaps = 4/327 (1%)
 Frame = +1

Query  301   GGYINFDVTSGKE-LLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+ K+ +LQ+L +N     ++SWVDSMRA SPT   + L  +  +W+ +HPS
Sbjct  17    GNKSNNDVTTAKKKVLQDLIINHGGGLINSWVDSMRACSPTHLKSLLKQN--SWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEDILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +GSKY++ ++  +L QPA+EFLPMIDEVY+
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSKYEEDSKS-LLCQPATEFLPMIDEVYQ  193

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+++T  TPG +VENNKFCVSVHFR V+E  W +LA QVRSV+K+YPKLRLTQGRKVLE
Sbjct  194   KLVQKTKLTPGAQVENNKFCVSVHFRRVNENNWSDLANQVRSVMKDYPKLRLTQGRKVLE  253

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             +RPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK 
Sbjct  254   VRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSKF  313

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T ASYSLQEP EVM FL+RLVEWK
Sbjct  314   PKETSASYSLQEPDEVMDFLQRLVEWK  340



>ref|XP_002866651.1| hypothetical protein ARALYDRAFT_919840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42910.1| hypothetical protein ARALYDRAFT_919840 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   481 bits (1238),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/353 (68%), Positives = 289/353 (82%), Gaps = 11/353 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVSSWVDSMRASS  414
             V  VS+ + F  +  KPP  PG YI+    S K+LL+NL++NGA + +++SWVDSMRASS
Sbjct  18    VSTVSNSSVFTPSAQKPPTAPG-YISI---SKKKLLKNLEINGAQSQRLNSWVDSMRASS  73

Query  415   PTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPD  582
             PT      S    ++H +W+ +HPSALDMFE+II+ ++GK IVMFLDYDGTLSPIVDDPD
Sbjct  74    PTHLKSLSSFSSEEEHNSWIKRHPSALDMFERIIEEARGKQIVMFLDYDGTLSPIVDDPD  133

Query  583   SAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SK  759
              AFM+  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S+
Sbjct  134   RAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFSR  193

Query  760   YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWG  939
             Y K  +  VL+QPA +FLPMIDEVYK L+E+T STPG KVENNKFC+SVHFRCVDE KW 
Sbjct  194   YNKD-KPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKWS  252

Query  940   ELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIG  1119
             ELA +VRSV+K YP L+L+QGRKV EIRP+I+WDKGKALEFLLESLG+ N  DVFP+YIG
Sbjct  253   ELALKVRSVVKNYPTLKLSQGRKVFEIRPMIKWDKGKALEFLLESLGFENCNDVFPIYIG  312

Query  1120  DDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DD+TDEDAFK+LRE  QGFGILVSK PKDT ASYSLQ+P +VM FL+RLV+WK
Sbjct  313   DDKTDEDAFKLLRERGQGFGILVSKFPKDTSASYSLQDPPQVMNFLQRLVDWK  365



>gb|KHN29076.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=352

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/306 (75%), Positives = 263/306 (86%), Gaps = 3/306 (1%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIK  507
             + +L+NL++NG   ++++WVDSMRASSPT  + ++ L+++H +W+++HPSALDMFEQI+ 
Sbjct  39    RRVLKNLEINGGQ-RINAWVDSMRASSPTNSKSTSSLAEEHSSWILRHPSALDMFEQIMD  97

Query  508   ASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSF  687
             AS+GK IVMFLDYDGTLSPIVDDPD AFMSD MR TVRKLA  FPTAIV+GRC DKVYSF
Sbjct  98    ASRGKQIVMFLDYDGTLSPIVDDPDHAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYSF  157

Query  688   VRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTP  867
             VRLAELYYAGSHGMDI+GP+R  KY K   E VLFQPASEFLPMIDEV++ L+E+  S P
Sbjct  158   VRLAELYYAGSHGMDIQGPTRDCKYSKDKGEPVLFQPASEFLPMIDEVHQQLVEKMKSIP  217

Query  868   GVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKG  1047
             G KVENNKFC SVHFRCVDE KW ELAQ+VRSVLKEYPKLRL QGRKVLEIRP I+WDKG
Sbjct  218   GAKVENNKFCCSVHFRCVDEKKWSELAQEVRSVLKEYPKLRLNQGRKVLEIRPSIKWDKG  277

Query  1048  KALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSL  1227
             KALEFLLESLG+AN  DVFPVYIGDD+TDEDAFK LR+  QG GILVSK PKDT ASYSL
Sbjct  278   KALEFLLESLGFANCNDVFPVYIGDDKTDEDAFKKLRDRGQGSGILVSKFPKDTSASYSL  337

Query  1228  QEPSEV  1245
             QEP+E 
Sbjct  338   QEPNEA  343



>ref|XP_009150597.1| PREDICTED: probable trehalose-phosphate phosphatase J [Brassica 
rapa]
Length=367

 Score =   481 bits (1237),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 238/354 (67%), Positives = 289/354 (82%), Gaps = 11/354 (3%)
 Frame = +1

Query  235   NVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG-AAAKVSSWVDSMRAS  411
              V  VS+ + F  +  KPP  PG +I+    S K+LL++L++NG  + +++SWVDSMRAS
Sbjct  17    TVSTVSNSSVFTPSAQKPPTAPG-HISI---SKKKLLKSLEINGDQSQRLNSWVDSMRAS  72

Query  412   SPTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT      ST   ++  +WM +HPSALDMFE+II+AS+GK IVMFLDYDGTLSPIV DP
Sbjct  73    SPTHLKSLPSTSSEEELNSWMKRHPSALDMFERIIEASRGKEIVMFLDYDGTLSPIVADP  132

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AF+S  MR TV+KLA  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  133   DRAFISSKMRRTVKKLAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  192

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDE +K L+E+T STPG KVENNKFC+SVHFRCVDE KW
Sbjct  193   RYNKD-KPSVLYQPAGDFLPMIDEAFKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKW  251

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV+K YP L+L+QGRKV EIRP+I+WDKGKALEFLLESLG+ NS+DVFP+YI
Sbjct  252   SELALKVRSVVKNYPTLKLSQGRKVFEIRPMIKWDKGKALEFLLESLGFDNSSDVFPIYI  311

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GDDRTDEDAFK+L+E  QG G+LV+K PKDT+ASYSLQ+P EVM FLRRLVEWK
Sbjct  312   GDDRTDEDAFKLLQERGQGLGLLVTKFPKDTNASYSLQDPLEVMDFLRRLVEWK  365



>ref|XP_010937497.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=382

 Score =   481 bits (1237),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 265/328 (81%), Gaps = 15/328 (5%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQK-------------STPLSDDHRTWMMQHP  474
             K+ L  L++ GA  ++++WV+SM+ASSPT               +    D+H TW+M+HP
Sbjct  47    KKYLSQLELGGA--RINAWVESMKASSPTHAKAAAALAVAPSVGAVGAQDEHATWIMRHP  104

Query  475   SALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIV  654
             SAL  FEQII ASKGK I MFLDYDGTLSPIVDDPD AFMSD MR  VR LA YFPTAIV
Sbjct  105   SALSKFEQIISASKGKQIAMFLDYDGTLSPIVDDPDLAFMSDAMRDAVRNLARYFPTAIV  164

Query  655   SGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVY  834
             SGRC DKVY+FVRLAELYYAGSHGMDIKGP+ G +Y K   + V FQPASEFLPMI EVY
Sbjct  165   SGRCRDKVYNFVRLAELYYAGSHGMDIKGPATGPRYMKAKAKAVHFQPASEFLPMIYEVY  224

Query  835   KTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVL  1014
             K LLE+T STPG KVENNKFCVSVH+RCVDE  W  LA+QV+SVLKEYPKLRLT+GRKVL
Sbjct  225   KVLLEKTKSTPGAKVENNKFCVSVHYRCVDEKSWSGLAEQVKSVLKEYPKLRLTEGRKVL  284

Query  1015  EIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSK  1194
             EIRP I+WDKGKALEFLLESLG+A+  +V PVYIGDDRTDEDAFKVLR+  QGFGILVSK
Sbjct  285   EIRPTIKWDKGKALEFLLESLGFADCNEVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSK  344

Query  1195  LPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              PK+T+ASYSLQEPSEVM FL RLVEWK
Sbjct  345   FPKETNASYSLQEPSEVMDFLLRLVEWK  372



>ref|XP_011016253.1| PREDICTED: probable trehalose-phosphate phosphatase C isoform 
X1 [Populus euphratica]
Length=367

 Score =   480 bits (1235),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 272/335 (81%), Gaps = 14/335 (4%)
 Frame = +1

Query  289   PVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPLSD--DHRT  456
             P  PGGY  F +T  +   +      A  K+SSWVDSMR SSPT  + +T LS+  +  +
Sbjct  37    PAAPGGY--FTITRNRFSKKT----EAGGKISSWVDSMRDSSPTRVKSTTSLSETEEKNS  90

Query  457   WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATY  636
             W++ HPSAL+MFEQI+K SKGK IVMFLDYDGTLSPIV+DPD AFM++ MR  VR +A Y
Sbjct  91    WIVNHPSALNMFEQIVKGSKGKQIVMFLDYDGTLSPIVEDPDRAFMTNEMREAVRDVARY  150

Query  637   FPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGS-KYKKGAEEDVLFQPASEFL  813
             FPTAIV+GRC +KVYSFVRLA LYYAGSHGMDIKGPS+ + KY+KG    VLFQPASEFL
Sbjct  151   FPTAIVTGRCRNKVYSFVRLAGLYYAGSHGMDIKGPSKNNCKYQKGG---VLFQPASEFL  207

Query  814   PMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRL  993
             PMIDEVY  LLE+T S PG +VENNKFCVSVHFRCV+E  W  L +QVRSVL +YPKLRL
Sbjct  208   PMIDEVYNVLLERTKSIPGAQVENNKFCVSVHFRCVEEKMWALLVEQVRSVLNDYPKLRL  267

Query  994   TQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQG  1173
             TQGRKVLEIRP I+WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLR   QG
Sbjct  268   TQGRKVLEIRPTIKWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRNRGQG  327

Query  1174  FGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              GILVSK+PK+T+ASYSLQEP EV  FLRRLVEWK
Sbjct  328   LGILVSKVPKETNASYSLQEPKEVKDFLRRLVEWK  362



>ref|XP_009369663.1| PREDICTED: probable trehalose-phosphate phosphatase D [Pyrus 
x bretschneideri]
Length=376

 Score =   480 bits (1236),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 247/373 (66%), Positives = 283/373 (76%), Gaps = 24/373 (6%)
 Frame = +1

Query  223   MTRHNVVAVSDP-------------NRFPTAGHKPPVVPG-GYINFDVTSGKELLQNLDV  360
             MT  NVV VSD              N F  +  KP    G G   F +    ++L N+D 
Sbjct  1     MTNQNVV-VSDAKGVAITVTVAAKQNMFSQSVPKPMTEAGRGGGCFTIPMNIKVL-NVDK  58

Query  361   NGAAAKVSSWVDSMRASSP-------TQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKG  519
              G AA+V++WVDS+RASSP       T +S   + D+ +W  +HPSA+ MFEQI  ASKG
Sbjct  59    EGGAARVNAWVDSLRASSPPRVKSAATPQSLSETVDNNSWSSRHPSAMSMFEQITNASKG  118

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IV+FLDYDGTLSPIV+DPD AFMS+ MR  V+  A YFPTAIVSGRC DKVYSFV+L 
Sbjct  119   KQIVLFLDYDGTLSPIVEDPDRAFMSNEMRKAVKAAARYFPTAIVSGRCRDKVYSFVKLG  178

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGPS+ SKYK G  + VLFQPASEF+PMIDEVYK LLE+T S  G +V
Sbjct  179   ELYYAGSHGMDIKGPSKSSKYKNG-NQAVLFQPASEFVPMIDEVYKILLEKTRSISGARV  237

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC+SVHFRCVDE  W  LA+QVR VL EYPKLRLTQGRKVLEIRP I+WDKGKALE
Sbjct  238   ENNKFCLSVHFRCVDEKSWAALAEQVRLVLNEYPKLRLTQGRKVLEIRPTIKWDKGKALE  297

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLGYANS +V PVYIGDDRTDEDAFKVLR+  QGFGILVSK+PK+T+ASY+LQEP+
Sbjct  298   FLLESLGYANSNEVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKVPKETNASYTLQEPA  357

Query  1240  EVMLFLRRLVEWK  1278
             EV  FLRRLV+WK
Sbjct  358   EVKDFLRRLVKWK  370



>ref|XP_010446535.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Camelina sativa]
Length=346

 Score =   479 bits (1233),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 232/327 (71%), Positives = 272/327 (83%), Gaps = 4/327 (1%)
 Frame = +1

Query  301   GGYINFDVTSGKE-LLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G   N DVT+ K+ +LQ+L +N     ++SWVDSMRA SPT   + L  +  +W+ +HPS
Sbjct  17    GNKSNNDVTTAKKKVLQDLVINHGGGLINSWVDSMRACSPTHLKSLLKQN--SWLTEHPS  74

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             ALDMFE I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  75    ALDMFEDILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVS  134

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KVY+FV+L ELYYAGSHGMDIKGP +GSKY++ ++  +L QPA+EFLPMIDEVY+
Sbjct  135   GRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSKYEEDSKS-LLCQPATEFLPMIDEVYQ  193

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+++T  TPG +VENNKFCVSVHFR V+E  W +LA QVRSV+K+YPKLRLTQGRKVLE
Sbjct  194   KLVQKTKLTPGAQVENNKFCVSVHFRRVNENNWSDLANQVRSVMKDYPKLRLTQGRKVLE  253

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             +RPII+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE +QG GILVSK 
Sbjct  254   VRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERKQGLGILVSKF  313

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T ASYSLQEP EVM FL+RLVEWK
Sbjct  314   PKETSASYSLQEPDEVMDFLQRLVEWK  340



>ref|XP_009131141.1| PREDICTED: probable trehalose-phosphate phosphatase I [Brassica 
rapa]
Length=369

 Score =   479 bits (1234),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 239/360 (66%), Positives = 285/360 (79%), Gaps = 14/360 (4%)
 Frame = +1

Query  220   KMTRHNVVAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWV  393
             +M+    V VS+  R   P     PP    G+I+    S K+LL+NL++     ++++WV
Sbjct  11    RMSESQNVVVSEAARSIIPNNSSAPP----GFISI---SKKKLLKNLEIINDGERINAWV  63

Query  394   DSMRASSPTQ-KSTP--LSDDHR--TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             DSMRASSPT  KS P  +S + +  +W+MQHPSAL+MFE+I +AS GK IV+FLDYDGTL
Sbjct  64    DSMRASSPTHPKSLPSSISSEQQLSSWIMQHPSALEMFEKITEASGGKQIVIFLDYDGTL  123

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC DKVYSFV+LAELYYAGSHGMDIK
Sbjct  124   SPIVDDPDRAFMSSKMRRTVKKLAKCFPTAIVTGRCLDKVYSFVKLAELYYAGSHGMDIK  183

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GP++G    K  ++ +L+QPAS++LPMIDEVY+ LLE+T STPGV VENNKFC SVHFRC
Sbjct  184   GPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYRQLLEKTKSTPGVIVENNKFCASVHFRC  243

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW EL  QVRSVLKEYP+L+L QGRKV EIRP+IEWDKGKALEFLLESLG+ NS +
Sbjct  244   VDEKKWSELVLQVRSVLKEYPRLKLNQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNN  303

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             VFPVYIGDDRTDEDAFK+LR+  +G G+LVSK PKDT ASY LQ+PSEVM FL+RLV WK
Sbjct  304   VFPVYIGDDRTDEDAFKLLRDRGEGCGVLVSKFPKDTDASYYLQDPSEVMNFLQRLVAWK  363



>ref|XP_010453031.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X2 [Camelina sativa]
Length=378

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 279/335 (83%), Gaps = 10/335 (3%)
 Frame = +1

Query  295   VPGGYINFDVTSGKELLQNLDV--NGAAAKVSSWVDSMRASSPTQ-KSTP--LSDDHR--  453
             +P G I+    S K LL+N+D+   G+  ++++WVDSMRASSPT  KS P  +S  H+  
Sbjct  41    LPPGLISI---SKKNLLKNIDIINGGSGQRINAWVDSMRASSPTHLKSLPSSISSQHQLN  97

Query  454   TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLAT  633
             +W+MQHPSAL+MF++II+AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA 
Sbjct  98    SWIMQHPSALEMFDRIIEASGGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAK  157

Query  634   YFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFL  813
              FPTAIV+GRC DK+Y+FV+LAELYYAGSHGMDI GP++G    K  ++ +L+QPA+++L
Sbjct  158   CFPTAIVTGRCIDKLYNFVKLAELYYAGSHGMDIIGPAKGFSRHKRVKQSLLYQPANDYL  217

Query  814   PMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRL  993
             PMIDEV+K LLE+T STPGVKVEN+KFC SVHFRCVDE KW EL  QVRSVLK++P L+L
Sbjct  218   PMIDEVHKQLLEKTKSTPGVKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKKFPTLKL  277

Query  994   TQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQG  1173
             TQGRKV EIRP+IEWDKGKALEFLLESLG+ NS +VFPVYIGDDRTDEDAFK+LR   +G
Sbjct  278   TQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTDEDAFKMLRGRGEG  337

Query  1174  FGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             FGILVSK PKDT ASYSLQ+PSEVM FLRRLVEWK
Sbjct  338   FGILVSKFPKDTDASYSLQDPSEVMDFLRRLVEWK  372



>ref|XP_008808174.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=370

 Score =   478 bits (1231),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 230/311 (74%), Positives = 258/311 (83%), Gaps = 10/311 (3%)
 Frame = +1

Query  376   KVSSWVDSMRASSPTQK----------STPLSDDHRTWMMQHPSALDMFEQIIKASKGKN  525
             K+++WV+SM+ASSPT            S    ++H TW+M+HPSAL  FEQII AS+ K 
Sbjct  46    KINAWVESMKASSPTHAKAAAALAAAPSVGAQEEHATWIMRHPSALSKFEQIISASREKQ  105

Query  526   IVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAEL  705
             IVMFLDYDGTLSPIVDDPDSAFMS+ MR  VR LA YFPTAIVSGRC DKVY FV+LAEL
Sbjct  106   IVMFLDYDGTLSPIVDDPDSAFMSEAMRDAVRNLARYFPTAIVSGRCRDKVYKFVKLAEL  165

Query  706   YYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVEN  885
             YYAGSHGMDIKGP+RG +Y+K   + VLFQPAS+FLPMI EVY  L E+T STPG KVEN
Sbjct  166   YYAGSHGMDIKGPARGPRYRKAKAKSVLFQPASDFLPMITEVYNVLFEKTKSTPGAKVEN  225

Query  886   NKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFL  1065
             NKFCVSVH+RCVDE  W  LA+QV+SVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFL
Sbjct  226   NKFCVSVHYRCVDEKSWSVLAEQVKSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFL  285

Query  1066  LESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             LESLG+A+  DV PVYIGDDRTDEDAFKVLR+  QGFGILVSK PK+T+ASYSL+EPSEV
Sbjct  286   LESLGFADCNDVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKFPKETNASYSLREPSEV  345

Query  1246  MLFLRRLVEWK  1278
             M FL RLVEWK
Sbjct  346   MDFLLRLVEWK  356



>ref|XP_008375355.1| PREDICTED: probable trehalose-phosphate phosphatase C isoform 
X1 [Malus domestica]
Length=395

 Score =   479 bits (1232),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 249/381 (65%), Positives = 285/381 (75%), Gaps = 24/381 (6%)
 Frame = +1

Query  199   FTRLAEEKMTRHNVVAVSDP-------------NRFPTAGHKPPVVPG-GYINFDVTSGK  336
             F   A  KMT  NVV VSD              N F  +  KP    G G   F +    
Sbjct  11    FLVCAGRKMTNQNVV-VSDAKGVAITVTVAAKQNMFSQSVPKPITEAGRGGGCFTIPMNI  69

Query  337   ELLQNLDVNGAAAKVSSWVDSMRASSP-------TQKSTPLSDDHRTWMMQHPSALDMFE  495
             ++L N+D  G AA+V++WVDS+RASSP       T +S   + D+ +W  +HPSA+ MFE
Sbjct  70    KVL-NVDTEGGAARVNAWVDSLRASSPPRVKSAATPQSLSETVDNNSWSSRHPSAMSMFE  128

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             QI  ASKGK IVMFLDYDGTLSPIV+DPD AFMS+ MR  V+  A YFPTAIVSGRC DK
Sbjct  129   QITNASKGKQIVMFLDYDGTLSPIVEDPDRAFMSNEMRRAVKAAAGYFPTAIVSGRCRDK  188

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             VYSFV+L EL YAGSHGMDIKGPS+ SKYK G  + VLFQPASEF+PMIDEVYK LLE+T
Sbjct  189   VYSFVKLGELXYAGSHGMDIKGPSKSSKYKNG-NQAVLFQPASEFVPMIDEVYKILLEKT  247

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
              S  G +VE+NKFC+SVHFRCVDE  W  LA+QVR VL EYPKLRLTQGRKVLEIRP I+
Sbjct  248   RSISGARVEDNKFCLSVHFRCVDEKSWAALAEQVRLVLNEYPKLRLTQGRKVLEIRPTIK  307

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGYANS +V PVYIGDDRTDEDAFKVLR+  QGFGILVSK+PK+T+A
Sbjct  308   WDKGKALEFLLESLGYANSNEVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKVPKETNA  367

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             SY+LQEP+EV  FLRRLV+WK
Sbjct  368   SYTLQEPAEVKDFLRRLVKWK  388



>ref|XP_009101850.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X1 [Brassica rapa]
Length=346

 Score =   476 bits (1226),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 269/321 (84%), Gaps = 4/321 (1%)
 Frame = +1

Query  319   DVTSGK-ELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFE  495
             D T+ K ++LQ+L +N     ++SWVDSMRA SPT   + +     +W+ +HPSALDMFE
Sbjct  23    DATTVKTKVLQDLIINNGGGLINSWVDSMRACSPTHLKSLMK--QSSWLTEHPSALDMFE  80

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAI+SGRC +K
Sbjct  81    EILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIISGRCREK  140

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             VY+FV+L ELYYAGSHGMDIKGP +GSKYK   ++ +L QPA+EFLPMIDEVY+ L+E+T
Sbjct  141   VYNFVKLTELYYAGSHGMDIKGPEQGSKYK-DQDKSLLCQPATEFLPMIDEVYQKLVEKT  199

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
             + TPG  +ENNKFCVSVHFR VDE  W +LA QVRSV+K+YP+LRLTQGRKVLEIRPII+
Sbjct  200   NLTPGANIENNKFCVSVHFRRVDEKNWSDLANQVRSVMKDYPELRLTQGRKVLEIRPIIK  259

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK+PK+T+A
Sbjct  260   WDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSKIPKETNA  319

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
              YSLQEP EVM FL+RLVEWK
Sbjct  320   FYSLQEPDEVMDFLQRLVEWK  340



>ref|XP_009101851.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X2 [Brassica rapa]
Length=345

 Score =   476 bits (1226),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 269/321 (84%), Gaps = 5/321 (2%)
 Frame = +1

Query  319   DVTSGK-ELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFE  495
             D T+ K ++LQ+L +N     ++SWVDSMRA SPT   + +     +W+ +HPSALDMFE
Sbjct  23    DATTVKTKVLQDLIINNGGGLINSWVDSMRACSPTHLKSLMK--QSSWLTEHPSALDMFE  80

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAI+SGRC +K
Sbjct  81    EILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIISGRCREK  140

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             VY+FV+L ELYYAGSHGMDIKGP +GSKYK   ++ +L QPA+EFLPMIDEVY+ L+E+T
Sbjct  141   VYNFVKLTELYYAGSHGMDIKGPEQGSKYKD--DKSLLCQPATEFLPMIDEVYQKLVEKT  198

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
             + TPG  +ENNKFCVSVHFR VDE  W +LA QVRSV+K+YP+LRLTQGRKVLEIRPII+
Sbjct  199   NLTPGANIENNKFCVSVHFRRVDEKNWSDLANQVRSVMKDYPELRLTQGRKVLEIRPIIK  258

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK+PK+T+A
Sbjct  259   WDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSKIPKETNA  318

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
              YSLQEP EVM FL+RLVEWK
Sbjct  319   FYSLQEPDEVMDFLQRLVEWK  339



>ref|XP_006286088.1| hypothetical protein CARUB_v10007631mg [Capsella rubella]
 gb|EOA18986.1| hypothetical protein CARUB_v10007631mg [Capsella rubella]
Length=347

 Score =   476 bits (1226),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 229/319 (72%), Positives = 267/319 (84%), Gaps = 3/319 (1%)
 Frame = +1

Query  322   VTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQI  501
              T+ K++LQ+L +N     ++SWVDSMRA SPT   + L     +W+ +HPSALDMFE+I
Sbjct  26    TTAKKKVLQDLIINHGGGLINSWVDSMRACSPTHLKSLLK--QSSWLTEHPSALDMFEEI  83

Query  502   IKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVY  681
             +  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC +KVY
Sbjct  84    LLLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVY  143

Query  682   SFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSS  861
             +FV+L ELYYAGSHGMDIKGP +GSKY++ ++  +L QPA+EFLPMIDEVY+ L+++T  
Sbjct  144   NFVKLTELYYAGSHGMDIKGPEQGSKYEEDSK-SLLCQPATEFLPMIDEVYQKLVQKTKL  202

Query  862   TPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWD  1041
             T G +VENNKFCVSVHFR V+E  W ELA QVRSV+K+YPKLRLTQGRKVLE+RPII+WD
Sbjct  203   TSGAQVENNKFCVSVHFRRVNENNWSELANQVRSVMKDYPKLRLTQGRKVLEVRPIIKWD  262

Query  1042  KGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASY  1221
             KGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK PK+T ASY
Sbjct  263   KGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSKFPKETSASY  322

Query  1222  SLQEPSEVMLFLRRLVEWK  1278
             SLQEP EVM FL+RLVEWK
Sbjct  323   SLQEPDEVMDFLQRLVEWK  341



>ref|NP_201319.2| probable trehalose-phosphate phosphatase J [Arabidopsis thaliana]
 sp|Q5HZ05.1|TPPJ_ARATH RecName: Full=Probable trehalose-phosphate phosphatase J; Short=AtTPPJ; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 gb|AAW38967.1| At5g65140 [Arabidopsis thaliana]
 gb|AAW39020.1| At5g65140 [Arabidopsis thaliana]
 dbj|BAD94722.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 gb|AED98007.1| probable trehalose-phosphate phosphatase J [Arabidopsis thaliana]
Length=370

 Score =   477 bits (1228),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 239/354 (68%), Positives = 286/354 (81%), Gaps = 12/354 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGA--AAKVSSWVDSMRAS  411
             V  VS+ + F     KPP  PG YI+    S K+LL+NL++NGA  + +++SWVDSMRAS
Sbjct  18    VSTVSNSSVFTPTAQKPPTAPG-YIS---VSKKKLLKNLEINGADQSQRLNSWVDSMRAS  73

Query  412   SPTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT      S    ++H +W+ +HPSAL+MFE+II+ ++GK IVMFLDYDGTLSPIVDDP
Sbjct  74    SPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERIIEEARGKQIVMFLDYDGTLSPIVDDP  133

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AFM+  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  134   DRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  193

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDEVYK L+E+T STPG KVENNKFC+SVHFRCVDE KW
Sbjct  194   RYNKD-KPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKW  252

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV+K YP L+L+QGRKV EIRPII+W+KGKALEFLLESLG+ N  DVFP+YI
Sbjct  253   SELASKVRSVVKNYPTLKLSQGRKVFEIRPIIKWNKGKALEFLLESLGFENCNDVFPIYI  312

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GDD+TDEDAFK+LR   QGFGILVSK PKDT ASYSLQ+P EVM FL RLVEWK
Sbjct  313   GDDKTDEDAFKLLRGRGQGFGILVSKFPKDTSASYSLQDPPEVMNFLGRLVEWK  366



>ref|XP_008375418.1| PREDICTED: probable trehalose-phosphate phosphatase C isoform 
X2 [Malus domestica]
Length=377

 Score =   476 bits (1225),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 246/373 (66%), Positives = 282/373 (76%), Gaps = 24/373 (6%)
 Frame = +1

Query  223   MTRHNVVAVSDP-------------NRFPTAGHKPPVVPG-GYINFDVTSGKELLQNLDV  360
             MT  NVV VSD              N F  +  KP    G G   F +    ++L N+D 
Sbjct  1     MTNQNVV-VSDAKGVAITVTVAAKQNMFSQSVPKPITEAGRGGGCFTIPMNIKVL-NVDT  58

Query  361   NGAAAKVSSWVDSMRASSP-------TQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKG  519
              G AA+V++WVDS+RASSP       T +S   + D+ +W  +HPSA+ MFEQI  ASKG
Sbjct  59    EGGAARVNAWVDSLRASSPPRVKSAATPQSLSETVDNNSWSSRHPSAMSMFEQITNASKG  118

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV+DPD AFMS+ MR  V+  A YFPTAIVSGRC DKVYSFV+L 
Sbjct  119   KQIVMFLDYDGTLSPIVEDPDRAFMSNEMRRAVKAAAGYFPTAIVSGRCRDKVYSFVKLG  178

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             EL YAGSHGMDIKGPS+ SKYK G  + VLFQPASEF+PMIDEVYK LLE+T S  G +V
Sbjct  179   ELXYAGSHGMDIKGPSKSSKYKNG-NQAVLFQPASEFVPMIDEVYKILLEKTRSISGARV  237

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             E+NKFC+SVHFRCVDE  W  LA+QVR VL EYPKLRLTQGRKVLEIRP I+WDKGKALE
Sbjct  238   EDNKFCLSVHFRCVDEKSWAALAEQVRLVLNEYPKLRLTQGRKVLEIRPTIKWDKGKALE  297

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLGYANS +V PVYIGDDRTDEDAFKVLR+  QGFGILVSK+PK+T+ASY+LQEP+
Sbjct  298   FLLESLGYANSNEVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKVPKETNASYTLQEPA  357

Query  1240  EVMLFLRRLVEWK  1278
             EV  FLRRLV+WK
Sbjct  358   EVKDFLRRLVKWK  370



>ref|XP_002301043.2| hypothetical protein POPTR_0002s09510g [Populus trichocarpa]
 gb|EEE80316.2| hypothetical protein POPTR_0002s09510g [Populus trichocarpa]
Length=371

 Score =   476 bits (1224),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 242/335 (72%), Positives = 271/335 (81%), Gaps = 15/335 (4%)
 Frame = +1

Query  289   PVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPLSD--DHRT  456
             P  PGGY  F +T  K   +  +  G   K+SSWVDSMR SSPT  + +T LS+  +  +
Sbjct  37    PAAPGGY--FTITR-KRFSKKTETGG---KISSWVDSMRDSSPTRVKSTTSLSETEEKNS  90

Query  457   WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATY  636
             W++ HPSAL+MFEQI+K SKGK IVMFLDYDGTLSPIV+DPD AFM++ MR  VR +A Y
Sbjct  91    WIVNHPSALNMFEQIVKGSKGKQIVMFLDYDGTLSPIVEDPDRAFMTNEMREAVRDVARY  150

Query  637   FPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGS-KYKKGAEEDVLFQPASEFL  813
             FPTAIV+GRC  KVYSFVRLA LYYAGSHGMDIKGPS+ + KY+KG    VLFQPASEFL
Sbjct  151   FPTAIVTGRCRKKVYSFVRLAGLYYAGSHGMDIKGPSKNNCKYEKGG---VLFQPASEFL  207

Query  814   PMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRL  993
             PMIDEVY  LLE+T S PG KVENNKFCVSVHFRCV+E  W  L +QVRSVL +YPKLRL
Sbjct  208   PMIDEVYNVLLERTKSIPGAKVENNKFCVSVHFRCVEEKMWAILVEQVRSVLNDYPKLRL  267

Query  994   TQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQG  1173
             TQGRKVLEIRP I+WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLR   QG
Sbjct  268   TQGRKVLEIRPTIKWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRNRGQG  327

Query  1174  FGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              GILVSK+PK+T+ASYSLQEP E   FLRRLVEWK
Sbjct  328   LGILVSKVPKETNASYSLQEPKEAN-FLRRLVEWK  361



>ref|XP_008795570.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Phoenix 
dactylifera]
Length=393

 Score =   476 bits (1225),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 231/335 (69%), Positives = 272/335 (81%), Gaps = 12/335 (4%)
 Frame = +1

Query  304   GYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQK------STPLSDDH----R  453
             G +NF  ++ K+LL  L++NG++ ++  WVDSM+ASSPT        ++P++  H     
Sbjct  40    GSVNF--SNFKKLLTQLEINGSSGRIHGWVDSMKASSPTHIKSGSLLASPVAASHDEEYE  97

Query  454   TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLAT  633
              WM QHPSAL +F++I  AS GK IVMFLDYDGTLSPIVDDPD AFMS+ MR+ VR++A 
Sbjct  98    NWMKQHPSALKIFDEITAASNGKQIVMFLDYDGTLSPIVDDPDLAFMSENMRSAVREVAR  157

Query  634   YFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFL  813
              FPTAIVSGRC DKVYSFV+LAELYYAGSHGMDIKGP++  K+ K   + VLFQPASEFL
Sbjct  158   RFPTAIVSGRCRDKVYSFVQLAELYYAGSHGMDIKGPAKQPKHTKAKAKAVLFQPASEFL  217

Query  814   PMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRL  993
             P ID VYK L+ +T ST G KVENNKFCVSVHFRCVDE KWG LA+QVRSVLK+YP+LRL
Sbjct  218   PTIDSVYKALVTKTESTHGAKVENNKFCVSVHFRCVDEKKWGALAEQVRSVLKDYPELRL  277

Query  994   TQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQG  1173
             TQGRKVLEIRP I+WDKGKALEFLLESLG+A+  DV P+YIGDDRTDEDAFKVLR+  QG
Sbjct  278   TQGRKVLEIRPPIKWDKGKALEFLLESLGFADCNDVLPIYIGDDRTDEDAFKVLRDRGQG  337

Query  1174  FGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              GILVSKLPK+T AS+SL EP+EVM FLRRLV+WK
Sbjct  338   IGILVSKLPKETSASFSLGEPAEVMNFLRRLVDWK  372



>ref|XP_009122088.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Brassica rapa]
Length=360

 Score =   474 bits (1219),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/327 (71%), Positives = 271/327 (83%), Gaps = 5/327 (2%)
 Frame = +1

Query  313   NFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLS---DDH-RTWMMQHPS  477
             N   ++ K LL+NL++     +V++WVDSMRASSPT  KS P S   + H  +W+MQHPS
Sbjct  28    NNSSSAQKTLLKNLEIINGGQRVNAWVDSMRASSPTHLKSLPSSVSSEKHLSSWIMQHPS  87

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             AL+MFE+I +AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIV+
Sbjct  88    ALEMFEKITQASGGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVT  147

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC DKVY+FV+LAELYYAGSHGMDIKGP++G    K  ++ +L+QPAS++LPMIDEVYK
Sbjct  148   GRCIDKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYK  207

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              LLE+T STPGV VEN+KF  SVHFRCV+E KW EL  QVRSVL++YP L+L+QGRKV E
Sbjct  208   QLLEKTKSTPGVIVENHKFTASVHFRCVEEKKWSELVLQVRSVLEKYPTLKLSQGRKVFE  267

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRP+I+WDKGKALEFLLESLG+ NS +VFPVYIGDDRTDEDAFK+LR   +GFGILVSK 
Sbjct  268   IRPMIDWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTDEDAFKMLRVRGEGFGILVSKF  327

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PKDT ASYSLQ+PSEVM FLRRLVEWK
Sbjct  328   PKDTDASYSLQDPSEVMNFLRRLVEWK  354



>ref|XP_010102586.1| putative glycosyl hydrolase [Morus notabilis]
 gb|EXB93689.1| putative glycosyl hydrolase [Morus notabilis]
Length=456

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/313 (72%), Positives = 267/313 (85%), Gaps = 2/313 (1%)
 Frame = +1

Query  346   QNLDVNGAAAKVSSWVDSMRASSPTQKSTP--LSDDHRTWMMQHPSALDMFEQIIKASKG  519
             + L+V    AK+SSWVDSMRASSP + S    L+++ ++W +QHPSAL MF++I++ASKG
Sbjct  134   KKLNVINGGAKISSWVDSMRASSPPRISISPSLTEEEKSWALQHPSALSMFDKIVEASKG  193

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV +P+ AFMSD MR+TV+ LA  FPTAIVSGRC DKVY+FV+LA
Sbjct  194   KKIVMFLDYDGTLSPIVKNPERAFMSDAMRSTVKSLAQCFPTAIVSGRCRDKVYNFVQLA  253

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGP +GSKY KG  + +LFQPA++FLPMIDEVYKTL+ +T ST G  V
Sbjct  254   ELYYAGSHGMDIKGPEKGSKYIKGDAKGILFQPAAKFLPMIDEVYKTLVYETKSTRGAMV  313

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             E+NKFC+SVH+RCVDE  W  +AQQV+SVLKEYPKL+LTQGRKVLEIRP I+WDKGKALE
Sbjct  314   EHNKFCLSVHYRCVDEKNWDLVAQQVKSVLKEYPKLKLTQGRKVLEIRPTIKWDKGKALE  373

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLL++LGYAN  DVF VYIGDDRTDEDAFK+L+   QGFGILVSK PKDT ASYSLQEP+
Sbjct  374   FLLKALGYANRRDVFSVYIGDDRTDEDAFKILKARGQGFGILVSKCPKDTSASYSLQEPT  433

Query  1240  EVMLFLRRLVEWK  1278
             EVM FL++LV+WK
Sbjct  434   EVMTFLQKLVDWK  446


 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = +1

Query  346  QNLDVNGAAAKVSSWVDSMRASSPTQKSTP--LSDDHRTWMMQHPSALDMFEQIIKASKG  519
            + L+V    AK+SSWVDSMRASSP + S    L+++ ++W +QHPSAL MF++I++ASKG
Sbjct  24   KKLNVINGGAKISSWVDSMRASSPPRISISPSLTEEEKSWALQHPSALSMFDKIVEASKG  83

Query  520  KNIVMFLDYDGTLSPI  567
            K IVMFLDYDGTLSPI
Sbjct  84   KKIVMFLDYDGTLSPI  99



>emb|CDY22393.1| BnaA06g37150D [Brassica napus]
Length=371

 Score =   474 bits (1219),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 269/321 (84%), Gaps = 5/321 (2%)
 Frame = +1

Query  319   DVTSGK-ELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFE  495
             D T+ K ++LQ+L +N     ++SWVDSMRA SPT   + +     +W+ +HPSALDMFE
Sbjct  49    DATTVKTKVLQDLIINNGGGLINSWVDSMRACSPTHLKSLMK--QSSWLTEHPSALDMFE  106

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC +K
Sbjct  107   EILHVSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLAKCFPTAIVSGRCREK  166

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             VY+FV+L ELYYAGSHGMDIKGP +GSKYK   ++ +L QPA+EFLPMIDEVY+ L+++T
Sbjct  167   VYNFVKLTELYYAGSHGMDIKGPEQGSKYKD--DKSLLCQPATEFLPMIDEVYQKLVDKT  224

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
             + TPG  +ENNKFCVSVHFR VDE  W +LA QVRSV+K+YP+LRLTQGRKVLEIRPII+
Sbjct  225   NFTPGANIENNKFCVSVHFRRVDEKNWSDLANQVRSVMKDYPELRLTQGRKVLEIRPIIK  284

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE RQG GILVSK+PK+T+A
Sbjct  285   WDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLGILVSKIPKETNA  344

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
              YSLQEP EVM FL+RLVEWK
Sbjct  345   FYSLQEPDEVMDFLQRLVEWK  365



>emb|CDX72676.1| BnaC07g46980D [Brassica napus]
Length=381

 Score =   474 bits (1219),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 274/342 (80%), Gaps = 7/342 (2%)
 Frame = +1

Query  262   RFPTAGHKPPVVPGG---YINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKST  432
             RF     KP  +  G     +  +T   ++LQ+L +N     ++SWVDSMRA SPT   +
Sbjct  38    RFIEENTKPEKIETGDKSKTDATLTVKTKVLQDLIINNGGGLINSWVDSMRACSPTHLKS  97

Query  433   PLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRA  612
              +     +W+ +HPSALDMF++I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR 
Sbjct  98    SMK--QSSWLTEHPSALDMFDEILNVSEGKKIVMFLDYDGTLSPIVDDPDRAFMSKEMRR  155

Query  613   TVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLF  792
             TVRKLA  FPTAIVSGRC +KVY+FV+L ELYYAGSHGMDIKGP +GSKYK   ++ +L 
Sbjct  156   TVRKLAKCFPTAIVSGRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSKYKD--DKSLLC  213

Query  793   QPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLK  972
             QPA+EFLPMIDEVY+ L+++T+ TPG  +ENNKFCVSVHFR VDE  W +LA QVRSV+K
Sbjct  214   QPATEFLPMIDEVYQKLVDKTNFTPGANIENNKFCVSVHFRRVDEKNWSDLANQVRSVMK  273

Query  973   EYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKV  1152
             +YP+LRLTQGRKVLEIRPII+WDKGKA+EFLLESLGYAN TDVFP+YIGDDRTDEDAFK+
Sbjct  274   DYPELRLTQGRKVLEIRPIIKWDKGKAVEFLLESLGYANCTDVFPLYIGDDRTDEDAFKI  333

Query  1153  LRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             LRE RQG GILVSK+PK+T+A YSLQEP EVM FL+RLVEWK
Sbjct  334   LRERRQGLGILVSKIPKETNALYSLQEPDEVMNFLQRLVEWK  375



>ref|XP_009587491.1| PREDICTED: probable trehalose-phosphate phosphatase H [Nicotiana 
tomentosiformis]
Length=365

 Score =   473 bits (1218),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 236/360 (66%), Positives = 281/360 (78%), Gaps = 13/360 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR--------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAK  378
             MT  NV+ VSDP          F  A   P   PG +I       K+  +N++      +
Sbjct  1     MTNQNVI-VSDPRSGLESSFLSFSPAVPGPLPPPGRFI---AVPAKKTFKNIESAAGDHR  56

Query  379   VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +++ +DSMRASSP ++S+  +++ ++W++ HPSALDMFE+II ASKGK I+MFLDYDGTL
Sbjct  57    ITALLDSMRASSPPRRSSE-TENLKSWIVHHPSALDMFEEIINASKGKQIIMFLDYDGTL  115

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFM+  MR  VR  A YFPTAIVSGRC  KV++FV+L+ELYYAGSHGMDIK
Sbjct  116   SPIVDDPDKAFMTAEMREAVRDTAKYFPTAIVSGRCRAKVFNFVKLSELYYAGSHGMDIK  175

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
              P++G KY+ G  + VL QPA EFLPMIDEVYK+L+E+T S PG KVENNKFC+SVHFR 
Sbjct  176   APAKGRKYRNGNNQTVLCQPAREFLPMIDEVYKSLVEKTKSIPGAKVENNKFCLSVHFRR  235

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             V+E +W ELA+QV+SV KEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLGYANS D
Sbjct  236   VEEKRWTELAEQVKSVTKEYPKLRLTQGRKVLEIRPSIKWDKGKALEFLLESLGYANSND  295

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             V P+YIGDDRTDEDAFKVLR+  QGFGILVSK PK+T+ASYSLQEP EVM FL RLVEWK
Sbjct  296   VLPIYIGDDRTDEDAFKVLRDRGQGFGILVSKSPKETNASYSLQEPLEVMYFLNRLVEWK  355



>ref|XP_010472213.1| PREDICTED: probable trehalose-phosphate phosphatase E [Camelina 
sativa]
Length=356

 Score =   473 bits (1216),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 229/322 (71%), Positives = 262/322 (81%), Gaps = 5/322 (2%)
 Frame = +1

Query  319   DVTSGKELLQNLDVN--GAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMF  492
             D + G ++LQN  +N  G    + SWVDSMRA SPT+  +   D    W+ +HPSAL MF
Sbjct  32    DTSPGTKVLQNFQINEEGGGGLIRSWVDSMRACSPTRPKS--LDSQSCWIKEHPSALKMF  89

Query  493   EQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTD  672
             E+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC +
Sbjct  90    EEILHESEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLADCFPTAIVSGRCRE  149

Query  673   KVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQ  852
             KV SFV+L ELYYAGSHGMDIKGP +GSK+KKG  + +L QPA+EFLP+I+EVY+ L+E+
Sbjct  150   KVSSFVKLTELYYAGSHGMDIKGPEQGSKHKKG-NQSLLCQPATEFLPVINEVYEKLVEK  208

Query  853   TSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPII  1032
             T S PG KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLEIRPII
Sbjct  209   TKSVPGAKVENNKFCASVHFRCVEENKWSDLAHQVRSVLKNYPKLMLTQGRKVLEIRPII  268

Query  1033  EWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTH  1212
             +WDKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK   +T+
Sbjct  269   KWDKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKYANETN  328

Query  1213  ASYSLQEPSEVMLFLRRLVEWK  1278
             ASYSLQEP EVM+FL RLVEWK
Sbjct  329   ASYSLQEPDEVMVFLERLVEWK  350



>ref|XP_009130492.1| PREDICTED: probable trehalose-phosphate phosphatase J [Brassica 
rapa]
Length=366

 Score =   473 bits (1217),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 233/352 (66%), Positives = 281/352 (80%), Gaps = 9/352 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSP  417
             ++ VS+ + F  +  KPP VPG   +  ++  K L         + +++SWVDSMRASSP
Sbjct  15    IITVSNSSVFAPSAQKPPTVPG---HISISKKKLLKNLELSGAQSQRLNSWVDSMRASSP  71

Query  418   TQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDS  585
             T      S    D+  +W+ +HPSALDMFE+II+AS+GK IVMFLDYDGTLSPIV DPD 
Sbjct  72    THLKSLSSLSSEDELNSWLKRHPSALDMFERIIEASRGKQIVMFLDYDGTLSPIVADPDR  131

Query  586   AFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SKY  762
             AF++  MR TV+KLA  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S+Y
Sbjct  132   AFITSKMRRTVKKLAKSFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFSRY  191

Query  763   KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGE  942
              K  +  VL+QPA +FLPMIDEV+K L+E+T STPG KVENNKFC+SVHFRCVDE KW +
Sbjct  192   NKD-KPSVLYQPAGDFLPMIDEVFKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKWSD  250

Query  943   LAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGD  1122
             LA +VRSV+K YP L+L+QGRKV EIRP+I+WDKGKALEFLLESLG+ NS DVFP+YIGD
Sbjct  251   LALKVRSVVKNYPTLKLSQGRKVFEIRPMIKWDKGKALEFLLESLGFENSNDVFPIYIGD  310

Query  1123  DRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DRTDEDAFK+L+E  QGFGILVSK PKDT+ASYSLQ+P EVM FLRRLVEWK
Sbjct  311   DRTDEDAFKLLQERGQGFGILVSKFPKDTNASYSLQDPPEVMDFLRRLVEWK  362



>gb|KFK28197.1| hypothetical protein AALP_AA8G485000, partial [Arabis alpina]
Length=350

 Score =   471 bits (1213),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 233/342 (68%), Positives = 280/342 (82%), Gaps = 11/342 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAA-KVSSWVDSMRASS  414
             V+ VS+ + F  +  KPP  PG YI+    S K+LL+NL++NGA + +++SWVDSMRASS
Sbjct  13    VITVSNSSVFTPSAQKPPTAPG-YISI---SKKKLLKNLEINGAQSQRLNSWVDSMRASS  68

Query  415   PTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPD  582
             PT      S    ++  +W+ +HPSALDMFE+II+AS+GK IVMFLDYDGTLSPIVDDPD
Sbjct  69    PTHLKSLSSLSSDEEFNSWIKRHPSALDMFERIIEASRGKQIVMFLDYDGTLSPIVDDPD  128

Query  583   SAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SK  759
              AFMS  MR TVRKLA  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S+
Sbjct  129   RAFMSSKMRRTVRKLAKNFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFSR  188

Query  760   YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWG  939
             Y K  +  VL+QPA +FLPMIDEV+K L+E+T STPG KVENNKFC+SVHFRCVDE KW 
Sbjct  189   YNKD-KPSVLYQPAGDFLPMIDEVFKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKWS  247

Query  940   ELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIG  1119
             ELA +VRSV+K YP L+L+QGRKV EIRP+++WDKGKALEFLLESLG+ N  +VFP+YIG
Sbjct  248   ELALKVRSVVKNYPTLKLSQGRKVFEIRPMVKWDKGKALEFLLESLGFENCNEVFPIYIG  307

Query  1120  DDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             DDRTDEDAFK+LRE  QGFGILVSK PKDT+ASYSLQ+P E 
Sbjct  308   DDRTDEDAFKLLRERGQGFGILVSKFPKDTNASYSLQDPPEA  349



>ref|XP_010926273.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=382

 Score =   473 bits (1216),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 233/341 (68%), Positives = 272/341 (80%), Gaps = 12/341 (4%)
 Frame = +1

Query  286   PPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPL------S  441
             PP      +N+   S K LL  L++N  + ++++WVDSMR+SSPT  +  +P       S
Sbjct  34    PPRGNSSSVNY--ASYKRLLSQLELNCGSGRINAWVDSMRSSSPTHIKSDSPFASPVVAS  91

Query  442   DD--HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRAT  615
             DD  +  WM QHPSAL MF++I  ASKGK IVMFLDYDGTLSPIVDDPD AFMS+ MRA 
Sbjct  92    DDEEYENWMKQHPSALHMFDEITAASKGKQIVMFLDYDGTLSPIVDDPDRAFMSENMRAA  151

Query  616   VRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQ  795
             VR++A  FPTAIVSGRC DKVYSFV+L ELYYAGSHGMDIKGP++  K+ K   + +LFQ
Sbjct  152   VREVARSFPTAIVSGRCRDKVYSFVQLRELYYAGSHGMDIKGPAKQPKHTKAKAKALLFQ  211

Query  796   PASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKE  975
             PASEFLPMIDEVY+ L+++T STPG KVENNKFCVSVHFRCVDE KW  LA+QVR VLK+
Sbjct  212   PASEFLPMIDEVYEALVKKTESTPGAKVENNKFCVSVHFRCVDEKKWSILAEQVRLVLKD  271

Query  976   YPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVL  1155
             YP+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG+A+  DVFP+YIGDDRTDEDAFKVL
Sbjct  272   YPRLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFADCNDVFPIYIGDDRTDEDAFKVL  331

Query  1156  RETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             R+  QG GILVSK PK+T A YSL+EP+EVM FL  LVEWK
Sbjct  332   RDRGQGIGILVSKFPKETSACYSLREPAEVMNFLHCLVEWK  372



>ref|XP_009779130.1| PREDICTED: probable trehalose-phosphate phosphatase H [Nicotiana 
sylvestris]
Length=368

 Score =   472 bits (1214),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 281/360 (78%), Gaps = 10/360 (3%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR--------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAK  378
             MT  NV+ VSDP          F  A   P   PG +I        + +++   +  A +
Sbjct  1     MTNQNVI-VSDPRSGLESSFLSFSPAVPGPLPPPGRFIAVPAKKSFKNIESAAGDHGANR  59

Query  379   VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +++ +DSMRASSP ++S+  +++ ++W++ HPSALDMFE+II ASKGK I+MFLDYDGTL
Sbjct  60    ITALLDSMRASSPPRRSSE-TENLKSWIVHHPSALDMFEEIINASKGKQIIMFLDYDGTL  118

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFM+  MR  VR  A YFPTAIVSGRC  KV++FV+L+ELYYAGSHGMDIK
Sbjct  119   SPIVDDPDKAFMTAEMREAVRDTAKYFPTAIVSGRCRAKVFNFVKLSELYYAGSHGMDIK  178

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
              P++G KY+ G  + VL QPA EFLPMIDEVYK+L+E+T S PG KVENNKFC+SVHFR 
Sbjct  179   APAKGRKYRNGNNQTVLCQPAREFLPMIDEVYKSLVEKTKSIPGAKVENNKFCLSVHFRR  238

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             V+E +W ELA+QV+SV KEYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLGYANS D
Sbjct  239   VEEKRWTELAEQVKSVTKEYPKLRLTQGRKVLEIRPSIKWDKGKALEFLLESLGYANSND  298

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             V P+YIGDDRTDEDAFKVLR+  QGFGILVSK PK+T+ASYSLQEP EVM FL RLVEWK
Sbjct  299   VLPIYIGDDRTDEDAFKVLRDRGQGFGILVSKAPKETNASYSLQEPLEVMYFLNRLVEWK  358



>ref|XP_010916894.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Elaeis 
guineensis]
Length=384

 Score =   472 bits (1215),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/342 (67%), Positives = 271/342 (79%), Gaps = 13/342 (4%)
 Frame = +1

Query  286   PPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPL--------  438
             PP    G +NF   + K++L  LD+NG+  ++++WVDSM+ASSPT  KS+ L        
Sbjct  33    PPRGNSGSVNF--ANYKKILTQLDLNGSGGRINAWVDSMKASSPTHIKSSSLLVSPIAAS  90

Query  439   --SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRA  612
                +++   M Q PSAL MF++I  ASKGK IVMFLDYDGTLSPIVDDPD AFMS+ MR+
Sbjct  91    HDDEEYENSMKQQPSALKMFDEITAASKGKQIVMFLDYDGTLSPIVDDPDRAFMSENMRS  150

Query  613   TVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLF  792
              VR++A  FPTAIVSGRC DKVY+FV+LAELYYAGSHGMDI+GP++  KY K   + VLF
Sbjct  151   AVREVARRFPTAIVSGRCRDKVYNFVQLAELYYAGSHGMDIEGPAKQPKYTKAKAKAVLF  210

Query  793   QPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLK  972
             QPASEFLPMID VYK L+ +T STPG +VENNKFC SVH+RCVDE KWG LA+QVRSVLK
Sbjct  211   QPASEFLPMIDAVYKALVTKTESTPGARVENNKFCASVHYRCVDEKKWGALAEQVRSVLK  270

Query  973   EYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKV  1152
             +YPKLRLTQGRKVLEIRP I+WDKGKALEFLL+SLG+A+  DV P+YIGDDRTDEDAFKV
Sbjct  271   DYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLDSLGFADCNDVLPIYIGDDRTDEDAFKV  330

Query  1153  LRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             LR+  QG GILVSK PK+T ASYSL EP+EVM FL  L +WK
Sbjct  331   LRDRGQGIGILVSKFPKETSASYSLSEPAEVMDFLHHLADWK  372



>ref|XP_010416975.1| PREDICTED: probable trehalose-phosphate phosphatase E [Camelina 
sativa]
Length=355

 Score =   471 bits (1212),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/321 (71%), Positives = 261/321 (81%), Gaps = 4/321 (1%)
 Frame = +1

Query  319   DVTSGKELLQNLDVNG-AAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFE  495
             D + G ++LQN  +N      + SWVDSMRA SPT+  +   +    W+ +HPSAL MFE
Sbjct  32    DTSPGTKVLQNFQINEEGGGLIRSWVDSMRACSPTRPKS--FNSQACWIKEHPSALKMFE  89

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC +K
Sbjct  90    EILHESEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLADCFPTAIVSGRCREK  149

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             V SFV+L ELYYAGSHGMDIKGP +GSKYKKG  + +L QPA+EFLP+I+EVY+ L+E+T
Sbjct  150   VSSFVKLTELYYAGSHGMDIKGPEQGSKYKKG-NQSLLCQPATEFLPVINEVYEKLVEET  208

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
              S PG KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLEIRPII+
Sbjct  209   KSVPGAKVENNKFCASVHFRCVEENKWSDLAHQVRSVLKTYPKLMLTQGRKVLEIRPIIK  268

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK  K+T+A
Sbjct  269   WDKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKYAKETNA  328

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             SYSLQEP EVM FL RLVEWK
Sbjct  329   SYSLQEPDEVMFFLERLVEWK  349



>emb|CDP01035.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   471 bits (1212),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/347 (67%), Positives = 284/347 (82%), Gaps = 3/347 (1%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSP  417
             VV++ +P  F  A  KP   PGG     +   K  L+ L+  G   ++++WVDSMR+SSP
Sbjct  20    VVSMREPVLFAQAVPKPLAAPGG--GTPIIWTKPSLKVLETAGGGGRINAWVDSMRSSSP  77

Query  418   TQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMS  597
              ++S+   + +++WM+ HPSAL MFE+II+ SKGK IVMFLDYDGTLSPIV+DPD AF+S
Sbjct  78    PRRSSESEEVNKSWMLHHPSALSMFEEIIEVSKGKQIVMFLDYDGTLSPIVEDPDRAFIS  137

Query  598   DPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAE  777
             + MR  VR +A +FPTAIV+GRC  KVY+FV+L+ELYYAGSHGMDIKGP++G +Y+KG  
Sbjct  138   NEMRDAVRDIAHHFPTAIVTGRCRAKVYNFVKLSELYYAGSHGMDIKGPTQGHRYRKG-N  196

Query  778   EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQV  957
             + VL QPA EFLPMIDEVYKTLLE+T S PG KVENNKFC+SVH+RCV+E +W ELA QV
Sbjct  197   QTVLCQPAREFLPMIDEVYKTLLEKTKSIPGAKVENNKFCLSVHYRCVEEKRWAELAVQV  256

Query  958   RSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDE  1137
             ++VLK+YPKL+LTQGRKVLEIRP I+WDKG ALEFLLESLGYANS DV P+YIGDDRTDE
Sbjct  257   KTVLKDYPKLKLTQGRKVLEIRPTIKWDKGNALEFLLESLGYANSDDVLPIYIGDDRTDE  316

Query  1138  DAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DAFKVLR+  QGFGILVSK+PK+T+ASY+LQEP EVM FL+RLVEWK
Sbjct  317   DAFKVLRKRGQGFGILVSKVPKETNASYTLQEPYEVMCFLKRLVEWK  363



>ref|XP_002513897.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF48480.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=369

 Score =   471 bits (1211),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/364 (65%), Positives = 275/364 (76%), Gaps = 17/364 (5%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR--------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAK  378
             MT  NVV+     R         P +   P VVP   +        +L   ++      +
Sbjct  1     MTNQNVVSTEAKLRIDIRIRVLLPKSLFSPAVVPKPLL----LPAPKLANKMETRVTGVR  56

Query  379   VSSWVDSMRASSPTQKSTPLS----DDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDY  546
              S+WVDSMR SSPT+  +  S    ++  +W++ HPSAL +FEQI+ ASKGK IVMFLDY
Sbjct  57    TSTWVDSMRDSSPTRVKSTASLSEIEEKSSWIVNHPSALSVFEQIVNASKGKQIVMFLDY  116

Query  547   DGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHG  726
             DGTLSPIV+DPD AFM++ MR  VR +A YFPTAIV+GRC DKVYSFV+LA LYYAGSHG
Sbjct  117   DGTLSPIVEDPDRAFMTNEMRDAVRDVARYFPTAIVTGRCRDKVYSFVKLAGLYYAGSHG  176

Query  727   MDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSV  906
             MDIKGPS+  KY+K   + VLFQPAS+FLPMIDEVYK L+E+T S PG KVENNKFC+SV
Sbjct  177   MDIKGPSKSHKYRKD-HQSVLFQPASKFLPMIDEVYKVLMEKTKSIPGAKVENNKFCLSV  235

Query  907   HFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYA  1086
             HFRCV+E  W  LA++VRSVL +YPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLGYA
Sbjct  236   HFRCVEEQMWAALAEEVRSVLNDYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYA  295

Query  1087  NSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRL  1266
             NSTDV PVYIGDDR+DEDAFKVLR   QG GILVSK PK+T+ASYSLQ+P+EV  FLRRL
Sbjct  296   NSTDVLPVYIGDDRSDEDAFKVLRNRGQGLGILVSKFPKETNASYSLQDPAEVKDFLRRL  355

Query  1267  VEWK  1278
             VEWK
Sbjct  356   VEWK  359



>ref|XP_011099372.1| PREDICTED: probable trehalose-phosphate phosphatase D [Sesamum 
indicum]
Length=364

 Score =   470 bits (1209),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 274/347 (79%), Gaps = 9/347 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSP  417
              VA+ +   F  A   P V P GY      S K+L + L+ NG  A++++ +DSMRASSP
Sbjct  20    AVALKESGHFSPA--MPVVSPNGYF-----SRKKLHKKLEANGNGARMNALLDSMRASSP  72

Query  418   TQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMS  597
             T++ T  ++DH +W++ HPSAL MFE+I++AS+GK IV+FLDYDGTLSPIV DPD AF++
Sbjct  73    TRRPTD-TEDHTSWILHHPSALSMFEEIMRASQGKQIVVFLDYDGTLSPIVQDPDRAFIT  131

Query  598   DPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAE  777
               MR  VR +A  FPTAIVSGRC  KVY+FVRL+ELYYAGSHGMDIKGP++G  ++ G  
Sbjct  132   TEMREAVRAVANLFPTAIVSGRCRAKVYNFVRLSELYYAGSHGMDIKGPAKGHTHRTG-N  190

Query  778   EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQV  957
             + VL QPA EFLPMI+EVY+ L+E+    PG KVENNKFC+SVH+RCV+E KWGEL  QV
Sbjct  191   QTVLCQPAREFLPMINEVYRALMEKIKHIPGAKVENNKFCLSVHYRCVEEKKWGELGDQV  250

Query  958   RSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDE  1137
             + V+KEYP+LRLTQGRKVLEIRP I+WDKG ALEFLLE+LGYA S DV P+YIGDDRTDE
Sbjct  251   KMVIKEYPQLRLTQGRKVLEIRPTIKWDKGNALEFLLEALGYAESNDVLPIYIGDDRTDE  310

Query  1138  DAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DAF VLRE +QG GILVSK PKDT+ASYSLQEP EVM FL+RLVEWK
Sbjct  311   DAFSVLRERKQGLGILVSKTPKDTNASYSLQEPLEVMKFLQRLVEWK  357



>gb|ACK44515.1| AT5G10100-like protein [Arabidopsis arenosa]
Length=362

 Score =   470 bits (1209),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 231/352 (66%), Positives = 278/352 (79%), Gaps = 12/352 (3%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR---FPTAGHKPPVVPGGYINFDVTSGKELLQNLDV-NGAAAKVSSW  390
             M+    V VS+  R    P        +P G I+    S K+LL+N+D+ NG   ++++W
Sbjct  12    MSASQNVVVSETTRSSIIPNNNSSSQKLPPGLISI---SKKKLLKNIDIINGGGQRINAW  68

Query  391   VDSMRASSPTQ-KSTPLSDDHR----TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGT  555
             VDSMRASSPT  KS P S   +    +W+MQHPSAL+MFEQI++AS+GK IVMFLDYDGT
Sbjct  69    VDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFEQIMEASRGKQIVMFLDYDGT  128

Query  556   LSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDI  735
             LSPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDI
Sbjct  129   LSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDI  188

Query  736   KGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFR  915
             KGP++G    K  ++ +L+QPA+++LPMI+EVY+ LLE+T STPG KVEN+KFC SVHFR
Sbjct  189   KGPAKGFSRHKRVKQSLLYQPANDYLPMINEVYRQLLEKTKSTPGAKVENHKFCASVHFR  248

Query  916   CVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANST  1095
             CVDE KW EL  QVRSVLKE+P L+LTQGRKV EIRP+IEWDKGKALEFLLE+LG+ N+ 
Sbjct  249   CVDEKKWSELVLQVRSVLKEFPTLKLTQGRKVFEIRPMIEWDKGKALEFLLEALGFGNTN  308

Query  1096  DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVML  1251
             +VFPVYIGDDRTDEDAFK+LR+  +GFGILVSK PKDT ASYSLQ+PSE  L
Sbjct  309   NVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDTDASYSLQDPSEASL  360



>ref|XP_008234617.1| PREDICTED: probable trehalose-phosphate phosphatase J [Prunus 
mume]
Length=344

 Score =   469 bits (1207),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 268/328 (82%), Gaps = 6/328 (2%)
 Frame = +1

Query  178   LERRSCLFTRLAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKEL-LQNL  354
             + +++ + +    E M     VAVS+ + F     KPPV P GYI+  ++  + L L+NL
Sbjct  1     MTKQNVVVSDAEAEIMNMAISVAVSNSSIFTAVAEKPPVGPPGYIS--ISRKRFLNLKNL  58

Query  355   DVNGAAAKVSSWVDSMRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNI  528
             D    A +++SWVDSMRASSPT  + S+ L +D  +W++QHPSALDMFEQII ASKGK I
Sbjct  59    DSINGAERINSWVDSMRASSPTHLKSSSFLKEDQSSWILQHPSALDMFEQIIDASKGKQI  118

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMF+DYDGTLSPIV+DPD AFMSD MR TV+K+A  FPTAIVSGRC DKVY FVRLAELY
Sbjct  119   VMFMDYDGTLSPIVEDPDQAFMSDAMRETVKKVARCFPTAIVSGRCRDKVYKFVRLAELY  178

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGP++GSKYKKG++  VL QPASEFLPMIDEVYK L+E+T STPG KVENN
Sbjct  179   YAGSHGMDIKGPAKGSKYKKGSQ-GVLCQPASEFLPMIDEVYKLLVEKTKSTPGAKVENN  237

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFC+SVHFRCVDE KW ELA QVRSVLKEYPKLRLTQGRKVLEIRP I+WDKGKALEFLL
Sbjct  238   KFCLSVHFRCVDEKKWSELALQVRSVLKEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLL  297

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKV  1152
             ESLGYAN TDVFPVYIGDDRTDEDAFKV
Sbjct  298   ESLGYANCTDVFPVYIGDDRTDEDAFKV  325



>ref|XP_009122089.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X2 [Brassica rapa]
Length=357

 Score =   469 bits (1208),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/328 (71%), Positives = 273/328 (83%), Gaps = 10/328 (3%)
 Frame = +1

Query  313   NFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLS---DDH-RTWMMQHPS  477
             N   ++ K LL+NL++     +V++WVDSMRASSPT  KS P S   + H  +W+MQHPS
Sbjct  28    NNSSSAQKTLLKNLEIINGGQRVNAWVDSMRASSPTHLKSLPSSVSSEKHLSSWIMQHPS  87

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             AL+MFE+I +AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIV+
Sbjct  88    ALEMFEKITQASGGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVT  147

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SKYKKGAEEDVLFQPASEFLPMIDEVY  834
             GRC DKVY+FV+LAELYYAGSHGMDIKGP++G S++K+     +L+QPAS++LPMIDEVY
Sbjct  148   GRCIDKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRS----LLYQPASDYLPMIDEVY  203

Query  835   KTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVL  1014
             K LLE+T STPGV VEN+KF  SVHFRCV+E KW EL  QVRSVL++YP L+L+QGRKV 
Sbjct  204   KQLLEKTKSTPGVIVENHKFTASVHFRCVEEKKWSELVLQVRSVLEKYPTLKLSQGRKVF  263

Query  1015  EIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSK  1194
             EIRP+I+WDKGKALEFLLESLG+ NS +VFPVYIGDDRTDEDAFK+LR   +GFGILVSK
Sbjct  264   EIRPMIDWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTDEDAFKMLRVRGEGFGILVSK  323

Query  1195  LPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              PKDT ASYSLQ+PSEVM FLRRLVEWK
Sbjct  324   FPKDTDASYSLQDPSEVMNFLRRLVEWK  351



>ref|XP_004299611.1| PREDICTED: probable trehalose-phosphate phosphatase D-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   470 bits (1210),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 222/321 (69%), Positives = 263/321 (82%), Gaps = 9/321 (3%)
 Frame = +1

Query  343   LQNLDVNGAAAKVSSWVDSMRASSPTQ---------KSTPLSDDHRTWMMQHPSALDMFE  495
             ++  +V G AA+V++WVDS+RASSP +           +   D+  +W ++HPSA++MFE
Sbjct  57    VETAEVGGGAARVNAWVDSLRASSPPRVKSTTTSPSTLSQTGDEENSWNLRHPSAINMFE  116

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I  ASKGK IVMFLDYDGTLSPIV DPD AFMS+ MR  VR +A YFPTAIVSGRC DK
Sbjct  117   EITNASKGKQIVMFLDYDGTLSPIVQDPDRAFMSNEMRKAVRAVARYFPTAIVSGRCRDK  176

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             VYSFV+LAELYYAGSHGMDIKGPS+ +KYK   ++ VL QPASEF+PMIDEV+K L+E+T
Sbjct  177   VYSFVKLAELYYAGSHGMDIKGPSKSNKYKNANQQAVLCQPASEFVPMIDEVFKILVEKT  236

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
              S  G +VENNKFC+SVHFRCV+E  W  LA+QV  VL EYPKL+LTQGRKVLEIRP I+
Sbjct  237   KSISGARVENNKFCLSVHFRCVEEKSWAALAEQVSLVLNEYPKLKLTQGRKVLEIRPTIK  296

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGYANS +V PVYIGDDRTDEDAFK+LR+  QGFGILVSK+PK+T+A
Sbjct  297   WDKGKALEFLLESLGYANSNEVLPVYIGDDRTDEDAFKLLRDRGQGFGILVSKVPKETNA  356

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             SYSLQEP+EV  FLRRLV+WK
Sbjct  357   SYSLQEPAEVKDFLRRLVKWK  377



>ref|NP_179809.2| probable trehalose-phosphate phosphatase E [Arabidopsis thaliana]
 sp|Q67X99.1|TPPE_ARATH RecName: Full=Probable trehalose-phosphate phosphatase E; Short=AtTPPE; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 dbj|BAD44683.1| putative trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 gb|AEC07276.1| probable trehalose-phosphate phosphatase E [Arabidopsis thaliana]
Length=354

 Score =   469 bits (1206),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 260/321 (81%), Gaps = 5/321 (2%)
 Frame = +1

Query  319   DVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLS-DDHRTWMMQHPSALDMFE  495
             D +   ++L +  +N     + SWVDSMRA SPT+   P S +    W+ +HPSAL+MFE
Sbjct  32    DTSPTTKVLHDFQINSGGGLIRSWVDSMRACSPTR---PKSFNSQSCWIKEHPSALNMFE  88

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC +K
Sbjct  89    EILHKSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREK  148

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             V SFV+L ELYYAGSHGMDIKGP +GSKYKK   + +L QPA+EFLP+I+EVYK L+E T
Sbjct  149   VSSFVKLTELYYAGSHGMDIKGPEQGSKYKK-ENQSLLCQPATEFLPVINEVYKKLVENT  207

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
              S PG KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLEIRPII+
Sbjct  208   QSIPGAKVENNKFCASVHFRCVEENKWSDLAHQVRSVLKNYPKLMLTQGRKVLEIRPIIK  267

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ +QG GILVSK  K+T+A
Sbjct  268   WDKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKKQGLGILVSKYAKETNA  327

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             SYSLQEP EVM+FL RLVEWK
Sbjct  328   SYSLQEPDEVMVFLERLVEWK  348



>ref|XP_010555351.1| PREDICTED: probable trehalose-phosphate phosphatase H [Tarenaya 
hassleriana]
Length=337

 Score =   467 bits (1201),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 231/318 (73%), Positives = 260/318 (82%), Gaps = 5/318 (2%)
 Frame = +1

Query  322   VTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQI  501
             + + KE+LQ+L +N     +SSWV SMR SSPT   +       +WM +HPSALD FE+I
Sbjct  18    LITDKEILQDLQIN-CGGLISSWVGSMRDSSPTHLKSFAK--QCSWMTEHPSALDTFEEI  74

Query  502   IKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVY  681
             I+AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVR LA  FPTAIVSGRC +KVY
Sbjct  75    IQASDGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRNLAKCFPTAIVSGRCREKVY  134

Query  682   SFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSS  861
             +FV+L ELYYAGSHGMDIKGP + S+      E +L QPA+EFLPMIDEVYK L+E+T S
Sbjct  135   NFVKLTELYYAGSHGMDIKGPEKESECMNN--ESLLCQPATEFLPMIDEVYKQLVEKTKS  192

Query  862   TPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWD  1041
             TPG KVENNKFCVSVHFRCVDE  W ELAQQVRSVLK+YPKLRLTQGRKVLEIRPII+WD
Sbjct  193   TPGSKVENNKFCVSVHFRCVDENMWNELAQQVRSVLKDYPKLRLTQGRKVLEIRPIIKWD  252

Query  1042  KGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASY  1221
             KGKALEFLLESLG+AN  DVFP+YIGDDRTDEDAF+VLRE   G GILVSK PK+T+A+Y
Sbjct  253   KGKALEFLLESLGFANCADVFPLYIGDDRTDEDAFRVLREKGLGLGILVSKFPKETNAAY  312

Query  1222  SLQEPSEVMLFLRRLVEW  1275
             SLQEP EVM FL+RLVEW
Sbjct  313   SLQEPDEVMDFLQRLVEW  330



>ref|XP_006472627.1| PREDICTED: probable trehalose-phosphate phosphatase D-like [Citrus 
sinensis]
 gb|KDO80922.1| hypothetical protein CISIN_1g017025mg [Citrus sinensis]
Length=379

 Score =   468 bits (1205),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 240/375 (64%), Positives = 279/375 (74%), Gaps = 26/375 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR----------------FPTAGHKPPVVPGGYINFDVTSGKELLQNL  354
             MT  NVV  SD                   F  A  K    PGG   F   S K +L+  
Sbjct  1     MTNQNVVVASDRKSSNIGLKITVTLTNSTLFSGADSKALPAPGG--GFITISRKNILRKP  58

Query  355   D--VNGAAAKVSSWVDSMRASSPTQ-KST----PLSDDHRTWMMQHPSALDMFEQIIKAS  513
                 +    K+++WV+S+RASSPT+ KS+    P +++  +W+ +HPSAL  FE+I+ AS
Sbjct  59    TDTTDQGGNKINAWVNSLRASSPTRLKSSIAFSPQTEEQTSWIARHPSALSKFEEIVNAS  118

Query  514   KGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVR  693
             KGK IVMFLDYDGTL+PIV+DPD AFM++ MR  VR +A YFPTAIV+GRC DKV+SFV+
Sbjct  119   KGKKIVMFLDYDGTLAPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVFSFVK  178

Query  694   LAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGV  873
             LA LYYAGSHGMDI+GPS+  +YKKG    VL QPASEFLPMI+EVY+TLLE+T S PG 
Sbjct  179   LAGLYYAGSHGMDIEGPSKKRRYKKG-NHGVLCQPASEFLPMINEVYQTLLEKTKSIPGA  237

Query  874   KVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKA  1053
             KVENNKFC+SVHFRCVDE  WG LA+QVR VL +YPKL LTQGR VLEIRP I+WDKGKA
Sbjct  238   KVENNKFCLSVHFRCVDENSWGTLAEQVRVVLDKYPKLTLTQGRMVLEIRPTIKWDKGKA  297

Query  1054  LEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQE  1233
             LEFLLE+LGYANS DV PVYIGDDRTDEDAFKVLR   QGFGILVSK PK+THASYSLQE
Sbjct  298   LEFLLEALGYANSKDVVPVYIGDDRTDEDAFKVLRNRGQGFGILVSKTPKETHASYSLQE  357

Query  1234  PSEVMLFLRRLVEWK  1278
             PSEV  FLRRLV+WK
Sbjct  358   PSEVKDFLRRLVQWK  372



>ref|XP_008219665.1| PREDICTED: probable trehalose-phosphate phosphatase D [Prunus 
mume]
Length=376

 Score =   468 bits (1204),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 266/327 (81%), Gaps = 3/327 (1%)
 Frame = +1

Query  301   GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPS  477
             GG   F +    +LL+ ++  G AA+V++WVDS+RASSP + KS   + D+ +W + HPS
Sbjct  44    GGAGCFTIPRNIKLLK-VETEGGAARVNAWVDSLRASSPPRVKSATETVDYSSWNLHHPS  102

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             A+ MFE+I   SKGK IV+FLDYDGTLSPIV+DPD AFMS  MR  V+  A YFPTAIVS
Sbjct  103   AMSMFEEITNYSKGKQIVLFLDYDGTLSPIVEDPDRAFMSREMRNAVKAAARYFPTAIVS  162

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC DKV+SFV+L ELYYAGSHGMDIKGPS+ SKYK G  + VLFQPASEF+PMIDEV K
Sbjct  163   GRCRDKVHSFVKLGELYYAGSHGMDIKGPSKSSKYKNG-NQAVLFQPASEFVPMIDEVCK  221

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+E+T S  G +VENNKFC+SVHFRCVDE  W  LA+QVR VL EYPKLRLTQGRKVLE
Sbjct  222   ILVEKTRSISGARVENNKFCLSVHFRCVDEKSWAALAEQVRLVLNEYPKLRLTQGRKVLE  281

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRP I+WDKGKALEFLLESLGYANS +V PVYIGDDRTDEDAFKVLR+  QGFGILVSK+
Sbjct  282   IRPTIKWDKGKALEFLLESLGYANSNEVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKV  341

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP+EV  FL RLVEWK
Sbjct  342   PKETNASYSLQEPAEVKDFLWRLVEWK  368



>ref|XP_006434015.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
 gb|ESR47255.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
Length=379

 Score =   468 bits (1204),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 242/376 (64%), Positives = 282/376 (75%), Gaps = 28/376 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV-----------------PGGYINFDVTSGKELLQN  351
             MT  NVV  SD  +F   G K  V                  PGG   F   S K +L+ 
Sbjct  1     MTNQNVVVASD-RKFSNIGLKITVTLTNSTLFSGADSKALPAPGG--GFITISRKNILRK  57

Query  352   -LDVNGAAA-KVSSWVDSMRASSPTQ-KST----PLSDDHRTWMMQHPSALDMFEQIIKA  510
               D +     K+++WV+S+RASSPT+ KS+    P +++  +W+ +HPSAL  FE+I+ A
Sbjct  58    PTDTSDQGGNKINAWVNSLRASSPTRLKSSVAFSPQTEEQTSWIARHPSALSKFEEIVNA  117

Query  511   SKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFV  690
             SKGK IVMFLDYDGTL+PIV+DPD AFM++ MR  VR +A YFPTAIV+GRC DKV+SFV
Sbjct  118   SKGKKIVMFLDYDGTLAPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVFSFV  177

Query  691   RLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPG  870
             +LA LYYAGSHGMDI+GPS+  +YKKG    VL QPASEFLPMI+EVY+TLLE+T S PG
Sbjct  178   KLAGLYYAGSHGMDIEGPSKKRRYKKG-NHGVLCQPASEFLPMINEVYQTLLEKTKSIPG  236

Query  871   VKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGK  1050
              KVENNKFC+SVHFRCVDE  WG LA+QVR VL +YPKL LTQGR VLEIRP I+WDKGK
Sbjct  237   AKVENNKFCLSVHFRCVDENSWGTLAEQVRVVLDKYPKLTLTQGRMVLEIRPTIKWDKGK  296

Query  1051  ALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQ  1230
             ALEFLLE+LGYANS DV PVYIGDDRTDEDAFKVLR   QGFGILVSK PK+THASYSLQ
Sbjct  297   ALEFLLEALGYANSKDVVPVYIGDDRTDEDAFKVLRNRGQGFGILVSKTPKETHASYSLQ  356

Query  1231  EPSEVMLFLRRLVEWK  1278
             EPSEV  FLRRLV+WK
Sbjct  357   EPSEVKDFLRRLVQWK  372



>ref|XP_007224341.1| hypothetical protein PRUPE_ppa020645mg [Prunus persica]
 gb|EMJ25540.1| hypothetical protein PRUPE_ppa020645mg [Prunus persica]
Length=376

 Score =   467 bits (1202),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 266/327 (81%), Gaps = 3/327 (1%)
 Frame = +1

Query  301   GGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPS  477
             GG   F +    +LL+ ++  G AA+V++WVDS+RASSP + KS   + D+ +W + HPS
Sbjct  44    GGGGCFTIPRNIKLLK-VETEGGAARVNAWVDSLRASSPPRVKSATETVDYSSWNLHHPS  102

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             A+ MFE+I   SKGK IV+FLDYDGTLSPIV+DPD AFMS  MR  V+  A YFPTAIVS
Sbjct  103   AMSMFEEITNYSKGKQIVLFLDYDGTLSPIVEDPDRAFMSREMRNAVKAAARYFPTAIVS  162

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC DKV+SFV+L ELYYAGSHGMDIKGPS+ SKYK G  + VLFQPASEF+PMIDEV K
Sbjct  163   GRCRDKVHSFVKLGELYYAGSHGMDIKGPSKSSKYKNG-NQAVLFQPASEFVPMIDEVCK  221

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L+E+T S  G +VENNKFC+SVHFRCVDE  W  LA+QVR VL EYPKLRLTQGRKVLE
Sbjct  222   ILVEKTRSISGARVENNKFCLSVHFRCVDEKSWAALAEQVRLVLNEYPKLRLTQGRKVLE  281

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRP I+WDKGKALEFLLESLGYANS +V PVYIGDDRTDEDAFKVLR+  QGFGILVSK+
Sbjct  282   IRPTIKWDKGKALEFLLESLGYANSNEVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKV  341

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PK+T+ASYSLQEP+EV  FL RLVEWK
Sbjct  342   PKETNASYSLQEPAEVKDFLWRLVEWK  368



>ref|XP_006428167.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
 gb|ESR41407.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
Length=425

 Score =   469 bits (1207),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 301/422 (71%), Gaps = 29/422 (7%)
 Frame = +1

Query  76    IGYYSLLLFVSGNRTKPHFLSPFWGNRAFCFVYFLERRSCLFTRLAE-EKMTRHNVVAVS  252
             +G +   +  SG   K HFLS   G    CF  F       F   AE E M   NV+ V 
Sbjct  1     MGKFHFRISQSGFIRKKHFLSTS-GKLKSCF--FTSSSIVSFNIEAERENMGNQNVLIVD  57

Query  253   ------------DPNRFPTAGH--KPPVVP-GGYINFDVTSGKELLQNLDVNGAAAKV--  381
                         +P+ +  A    +PPVVP GGY N      K +LQNL+ N AA     
Sbjct  58    AFNLTLSTEGLPNPSIYSIASQQKRPPVVPCGGYTN----KKKLMLQNLETNAAAGARPN  113

Query  382   SSWVDSMRASSPTQKS--TP-LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDG  552
             + WV+S+RASSPT     TP L ++ R W+++HPSALDMF +I +ASKGK IVMFLDYDG
Sbjct  114   NCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDG  173

Query  553   TLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMD  732
             TLSPIV++PD AFMS  MR  VR+LA YFPTAIV+GRC DKVY FV+LAELYYAGSHGMD
Sbjct  174   TLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMD  233

Query  733   IKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHF  912
             IKGP++G KY + ++  V FQPASEFLP+ID+VYK L+E+T STPG +VENNKFC+SVHF
Sbjct  234   IKGPTKGLKYNQKSKV-VNFQPASEFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHF  292

Query  913   RCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANS  1092
             RCVDE KW +LAQ+V+ V+ EYP+L   QGR V+EIRP IEWDKGKALEFLLE LG+A+ 
Sbjct  293   RCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADC  352

Query  1093  TDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVE  1272
             ++VFPVY+GDD TDEDAFK+LR+  QGFGILVSK PK T ASYSL+EP EVM FL++LV 
Sbjct  353   SNVFPVYMGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVR  412

Query  1273  WK  1278
             WK
Sbjct  413   WK  414



>ref|XP_002871404.1| hypothetical protein ARALYDRAFT_350217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47663.1| hypothetical protein ARALYDRAFT_350217 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/350 (65%), Positives = 277/350 (79%), Gaps = 12/350 (3%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR---FPTAGHKPPVVPGGYINFDVTSGKELLQNLDV-NGAAAKVSSW  390
             M+    V VS+  R    P        +P G I+    S K+LL+N+D+ NG   ++++W
Sbjct  1     MSATQNVVVSETTRSSIIPNNNSSSQKLPPGLISI---SKKKLLKNIDIINGGGQRINAW  57

Query  391   VDSMRASSPTQ-KSTPLSDDHR----TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGT  555
             VDSMRASSPT  KS P S   +    +W+MQHPSAL+MFEQI++AS+GK IVMFLDYDGT
Sbjct  58    VDSMRASSPTHLKSLPSSISSQQQLNSWIMQHPSALEMFEQIMEASRGKQIVMFLDYDGT  117

Query  556   LSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDI  735
             LSPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDI
Sbjct  118   LSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKVYNFVKLAELYYAGSHGMDI  177

Query  736   KGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFR  915
             KGP++G    K  ++ +L+QPA+++LPMI+EVY+ LLE+T STPG KVEN+KFC SVHFR
Sbjct  178   KGPAKGFSRHKRVKQSLLYQPANDYLPMINEVYRQLLEKTKSTPGAKVENHKFCASVHFR  237

Query  916   CVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANST  1095
             CVDE KW EL  QVRSVLKE+P L+LTQGRKV EIRP+IEWDKGKALEFLLE+LG+ ++ 
Sbjct  238   CVDEKKWSELVLQVRSVLKEFPTLKLTQGRKVFEIRPMIEWDKGKALEFLLEALGFGSTN  297

Query  1096  DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             +VFPVYIGDDRTDEDAFK+LR+  +GFGILVSK PKDT ASYSLQ+PSE 
Sbjct  298   NVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDTDASYSLQDPSEA  347



>ref|XP_010429136.1| PREDICTED: probable trehalose-phosphate phosphatase E [Camelina 
sativa]
Length=356

 Score =   466 bits (1198),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 228/323 (71%), Positives = 263/323 (81%), Gaps = 7/323 (2%)
 Frame = +1

Query  319   DVTSGKELLQNLDVN--GAAAKVSSWVDSMRASSPTQKSTPLS-DDHRTWMMQHPSALDM  489
             D + G ++LQ+  +N  G    + SWVDSMRA SPT+   P S +    W+ +HPSAL M
Sbjct  32    DTSPGTKVLQDFQINEEGGGGLIRSWVDSMRACSPTR---PKSFNSQACWIKEHPSALKM  88

Query  490   FEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCT  669
             FE+I+  S+GK IVMFLDYDGTLSPIVDDPD AF+S  MR TVRKLA  FPTAIVSGRC 
Sbjct  89    FEEILLESEGKQIVMFLDYDGTLSPIVDDPDRAFISKKMRNTVRKLAECFPTAIVSGRCR  148

Query  670   DKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLE  849
             +KV SFV+L ELYYAGSHGMDIKGP +GSKYKKG  + +L QPA+EFLP+I+EVY+ L++
Sbjct  149   EKVSSFVKLTELYYAGSHGMDIKGPEQGSKYKKG-NQSLLCQPATEFLPVINEVYEKLVD  207

Query  850   QTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPI  1029
             +T S  G KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLEIRPI
Sbjct  208   KTKSVTGAKVENNKFCASVHFRCVEENKWSDLAHQVRSVLKNYPKLMLTQGRKVLEIRPI  267

Query  1030  IEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDT  1209
             I+WDKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK  K+T
Sbjct  268   IKWDKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKYAKET  327

Query  1210  HASYSLQEPSEVMLFLRRLVEWK  1278
             +ASYSLQEP EVM+FL RLVEWK
Sbjct  328   NASYSLQEPDEVMVFLERLVEWK  350



>gb|KFK30542.1| hypothetical protein AALP_AA7G275800 [Arabis alpina]
Length=347

 Score =   464 bits (1194),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 267/330 (81%), Gaps = 9/330 (3%)
 Frame = +1

Query  301   GGYINFDVTS----GKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQ  468
             G   N DVT+     K++LQ  D+N     ++S VDSMRA SPT   + +     +W+ +
Sbjct  17    GNKSNNDVTTTTKNKKQVLQ--DINNGGGLINSLVDSMRACSPTHLKSLMK--QTSWLTE  72

Query  469   HPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTA  648
             +PSALDMFE+I+ AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTA
Sbjct  73    YPSALDMFEEILHASQGKQIVMFLDYDGTLSPIVDDPDRAFMSRKMRRTVKKLANCFPTA  132

Query  649   IVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDE  828
             IVSGRC +KVY+FV+L ELYYAGSHGMDIKGP +GS Y + ++  +L QPA+EFLPMIDE
Sbjct  133   IVSGRCREKVYNFVKLTELYYAGSHGMDIKGPEQGSIYMEDSKS-LLCQPATEFLPMIDE  191

Query  829   VYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRK  1008
             V + L++QT  TPG KVENNKFCVSVHFR VDE  W +LA QVRSV+K+YPKLRL +GRK
Sbjct  192   VCQKLIKQTKLTPGAKVENNKFCVSVHFRRVDENNWSDLANQVRSVMKDYPKLRLCEGRK  251

Query  1009  VLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILV  1188
             VLEIRPII+WDKGKALEFLLESLGYAN  DVFP+YIGDDRTDEDAFK+LRE RQG GILV
Sbjct  252   VLEIRPIIKWDKGKALEFLLESLGYANCADVFPLYIGDDRTDEDAFKILRERRQGLGILV  311

Query  1189  SKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             SK PK+T+ASYSLQ+P EVM FLRRLVEWK
Sbjct  312   SKFPKETNASYSLQDPDEVMDFLRRLVEWK  341



>ref|XP_009387126.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/323 (70%), Positives = 262/323 (81%), Gaps = 11/323 (3%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLS--------DDHRTWMMQHPSALDM  489
             ++ L  L++ G   ++ +WV+SM+ASSPT      +        D+   W+++HPSAL+ 
Sbjct  38    RKYLSQLELGGG--RIGAWVESMKASSPTHAKATAALPSGDAAVDEQSAWVVRHPSALNK  95

Query  490   FEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCT  669
             FEQI+ ASKGK IVMF+DYDGTLSPIVDDPDSAFMSD MR  VR +A YFPTAIVSGRC 
Sbjct  96    FEQIMSASKGKQIVMFMDYDGTLSPIVDDPDSAFMSDAMREAVRDVARYFPTAIVSGRCL  155

Query  670   DKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLE  849
             DKV +FVRLA+LYYAGSHGMDIKGP++  ++ K   + VLFQPASEFLPMID V+K LLE
Sbjct  156   DKVINFVRLADLYYAGSHGMDIKGPTK-PRHDKARAKPVLFQPASEFLPMIDAVHKALLE  214

Query  850   QTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPI  1029
             +T STPG +VENNKFCVSVHFRCVDE  W  L +QVR VLKEYPKLRLTQGRKVLEIRP 
Sbjct  215   RTKSTPGARVENNKFCVSVHFRCVDEKSWSSLFEQVRCVLKEYPKLRLTQGRKVLEIRPT  274

Query  1030  IEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDT  1209
             I+WDKGKALEFLLESLG+AN T+V PVYIGDDRTDEDAFKVLR+  QGFGILVSK PK+T
Sbjct  275   IKWDKGKALEFLLESLGFANCTNVMPVYIGDDRTDEDAFKVLRDRGQGFGILVSKFPKET  334

Query  1210  HASYSLQEPSEVMLFLRRLVEWK  1278
             +A+YSLQEPSEV  FL RLVEWK
Sbjct  335   NATYSLQEPSEVKDFLVRLVEWK  357



>ref|XP_007018811.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY16036.1| Haloacid dehalogenase-like hydrolase superfamily protein isoform 
2 [Theobroma cacao]
Length=351

 Score =   462 bits (1189),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/307 (74%), Positives = 258/307 (84%), Gaps = 7/307 (2%)
 Frame = +1

Query  340   LLQNLDVNGAAAKVSSWVDSMRASSPTQ-KST----PLSDDHRTWMMQHPSALDMFEQII  504
             L++  +   A AK+++WVDSMRASSPT+ KST    P +D+  +W++ HPSAL MFEQI+
Sbjct  41    LMKRFETEKAGAKINAWVDSMRASSPTRIKSTASLPPETDEKSSWIVHHPSALSMFEQIV  100

Query  505   KASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYS  684
              ASKGK IVMFLDYDGTLSPIV+DPD AFM   MRA +R +A YFPTAIV+GRC DKVYS
Sbjct  101   AASKGKQIVMFLDYDGTLSPIVEDPDQAFMPREMRAALRDVARYFPTAIVTGRCRDKVYS  160

Query  685   FVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSST  864
             FV+LA LYYAGSHGMDIKGPS+  KYKKG  + VLFQPASEFLPMID+VYK L+E+T S 
Sbjct  161   FVKLAGLYYAGSHGMDIKGPSKSCKYKKG-NQGVLFQPASEFLPMIDKVYKALVEKTKSI  219

Query  865   PGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDK  1044
             PG KVENNKFCVSVHFRCVDE  W  LA+QVRSVL EYPKL+LTQGR VLEIRP I+WDK
Sbjct  220   PGAKVENNKFCVSVHFRCVDEKSWAALAEQVRSVLNEYPKLKLTQGRLVLEIRPTIKWDK  279

Query  1045  GKALEFLLESL-GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASY  1221
             G+ALEFLLE+L GYANS DV PVYIGDDRTDEDAFKVLR+  QGFGILVSK+PK+T+A Y
Sbjct  280   GRALEFLLEALVGYANSNDVLPVYIGDDRTDEDAFKVLRDRGQGFGILVSKVPKETNAFY  339

Query  1222  SLQEPSE  1242
             SLQEPSE
Sbjct  340   SLQEPSE  346



>ref|XP_011043568.1| PREDICTED: probable trehalose-phosphate phosphatase C [Populus 
euphratica]
Length=374

 Score =   463 bits (1191),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 259/334 (78%), Gaps = 10/334 (3%)
 Frame = +1

Query  289   PVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLS---DDHRT  456
             P  PGGY      S K   +  +  G   K + W DSMR SSPT+ KST  S   ++   
Sbjct  37    PAAPGGYFTI---SRKMFAKKTETGG---KTNFWADSMRDSSPTRVKSTTSSSEIEEKNN  90

Query  457   WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATY  636
             W++ HPSAL+MFEQI+  SKGK IVMFLDYDGTLSPIV+DPD AFM++ MR  VR +A Y
Sbjct  91    WIVNHPSALNMFEQIVNVSKGKQIVMFLDYDGTLSPIVEDPDRAFMTNEMREAVRDVARY  150

Query  637   FPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLP  816
             FPTAIV+GRC DKVYSFVRLA LYYAGSHGMDIKGPS+     K   + VLFQPASEFLP
Sbjct  151   FPTAIVTGRCRDKVYSFVRLAGLYYAGSHGMDIKGPSKNGCRNKKDYQGVLFQPASEFLP  210

Query  817   MIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLT  996
             MIDEVY  LLE+    PG +VE+NKFC+SVHFRCV+E  W  L +QVRSVL  YPKLRLT
Sbjct  211   MIDEVYNVLLERIKYIPGARVEDNKFCLSVHFRCVEEKMWAALVEQVRSVLNGYPKLRLT  270

Query  997   QGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGF  1176
             QGRKVLEIRP I+WDKGKALEFLLESLGYANSTDV PVYIGDDRTDEDAFKVLR   QG 
Sbjct  271   QGRKVLEIRPTIKWDKGKALEFLLESLGYANSTDVLPVYIGDDRTDEDAFKVLRNRGQGL  330

Query  1177  GILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GILVSK+PK+T+ASYSLQEP+EV  FLRRLVEWK
Sbjct  331   GILVSKVPKETNASYSLQEPTEVKDFLRRLVEWK  364



>ref|XP_006464217.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Citrus 
sinensis]
Length=390

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/338 (67%), Positives = 272/338 (80%), Gaps = 11/338 (3%)
 Frame = +1

Query  283   KPPVVP-GGYINFDVTSGKELLQNLDVNGAAAKV--SSWVDSMRASSPTQKS--TP-LSD  444
             +PPVVP GGY N      K +LQNL+ N AA     + WV+S+RASSPT     TP L +
Sbjct  47    RPPVVPCGGYTN----KKKLMLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLE  102

Query  445   DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRK  624
             + R W+++HPSALDMF +I +ASKGK IVMFLDYDGTLSPIV++PD AFMS  MR  VR+
Sbjct  103   EKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQ  162

Query  625   LATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPAS  804
             LA YFPTAIV+GRC DKVY FV+LAELYYAGSHGMDIKGP++G KY + ++  V FQPAS
Sbjct  163   LAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKV-VNFQPAS  221

Query  805   EFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPK  984
             EFLP+ID+VYK L+E+T STPG +VENNKFC+SVHFRCVDE KW +LAQ+V+ V+ EYP+
Sbjct  222   EFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQ  281

Query  985   LRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRET  1164
             L   QGR V+EIRP IEWDKGKALEFLLE LG+A+ ++VFPVYIGDD TDEDAFK+LR+ 
Sbjct  282   LNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKR  341

Query  1165  RQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              QGFGILVSK PK T ASYSL+EP EVM FL++LV WK
Sbjct  342   EQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWK  379



>ref|NP_001190271.1| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
 gb|AED91494.1| probable trehalose-phosphate phosphatase I [Arabidopsis thaliana]
Length=343

 Score =   462 bits (1188),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 222/314 (71%), Positives = 263/314 (84%), Gaps = 6/314 (2%)
 Frame = +1

Query  328   SGKELLQNLDV-NGAAAKVSSWVDSMRASSPTQ-KSTPLS----DDHRTWMMQHPSALDM  489
             S K+LL+N+D+ NG   ++++WVDSMRASSPT  KS P S        +W+MQHPSAL+ 
Sbjct  28    SKKKLLKNIDIINGGGQRINAWVDSMRASSPTHLKSLPSSISTQQQLNSWIMQHPSALEK  87

Query  490   FEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCT  669
             FEQI++AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC 
Sbjct  88    FEQIMEASRGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCI  147

Query  670   DKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLE  849
             DKVY+FV+LAELYYAGSHGMDIKGP++G    K  ++ +L+QPA+++LPMIDEVY+ LLE
Sbjct  148   DKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLE  207

Query  850   QTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPI  1029
             +T STPG KVEN+KFC SVHFRCVDE KW EL  QVRSVLK++P L+LTQGRKV EIRP+
Sbjct  208   KTKSTPGAKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKKFPTLQLTQGRKVFEIRPM  267

Query  1030  IEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDT  1209
             IEWDKGKALEFLLESLG+ N+ +VFPVYIGDDRTDEDAFK+LR+  +GFGILVSK PKDT
Sbjct  268   IEWDKGKALEFLLESLGFGNTNNVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDT  327

Query  1210  HASYSLQEPSEVML  1251
              ASYSLQ+PSE  L
Sbjct  328   DASYSLQDPSEASL  341



>emb|CAB92051.1| trehalose-6-phosphate phosphatase-like protein [Arabidopsis thaliana]
Length=372

 Score =   462 bits (1190),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 262/312 (84%), Gaps = 6/312 (2%)
 Frame = +1

Query  328   SGKELLQNLDV-NGAAAKVSSWVDSMRASSPTQ-KSTPLS----DDHRTWMMQHPSALDM  489
             S K+LL+N+D+ NG   ++++WVDSMRASSPT  KS P S        +W+MQHPSAL+ 
Sbjct  41    SKKKLLKNIDIINGGGQRINAWVDSMRASSPTHLKSLPSSISTQQQLNSWIMQHPSALEK  100

Query  490   FEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCT  669
             FEQI++AS+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC 
Sbjct  101   FEQIMEASRGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCI  160

Query  670   DKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLE  849
             DKVY+FV+LAELYYAGSHGMDIKGP++G    K  ++ +L+QPA+++LPMIDEVY+ LLE
Sbjct  161   DKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPANDYLPMIDEVYRQLLE  220

Query  850   QTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPI  1029
             +T STPG KVEN+KFC SVHFRCVDE KW EL  QVRSVLK++P L+LTQGRKV EIRP+
Sbjct  221   KTKSTPGAKVENHKFCASVHFRCVDEKKWSELVLQVRSVLKKFPTLQLTQGRKVFEIRPM  280

Query  1030  IEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDT  1209
             IEWDKGKALEFLLESLG+ N+ +VFPVYIGDDRTDEDAFK+LR+  +GFGILVSK PKDT
Sbjct  281   IEWDKGKALEFLLESLGFGNTNNVFPVYIGDDRTDEDAFKMLRDRGEGFGILVSKFPKDT  340

Query  1210  HASYSLQEPSEV  1245
              ASYSLQ+PSE 
Sbjct  341   DASYSLQDPSEA  352



>ref|XP_004237894.1| PREDICTED: probable trehalose-phosphate phosphatase J [Solanum 
lycopersicum]
Length=365

 Score =   462 bits (1189),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 231/357 (65%), Positives = 280/357 (78%), Gaps = 8/357 (2%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR-FPTAGHK-PPVVPGGYIN---FDVTSGKELLQNLDVNGAAAKVSS  387
             MT  NV+ +SDP   F ++     P VPG       F     K   +N+D +  AA++++
Sbjct  1     MTNQNVI-ISDPRSGFDSSLLSLSPAVPGPLPQPGRFIAVPAKRSFKNID-STDAARITA  58

Query  388   WVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPI  567
              +DSMRASSPT++S+  +++  +W++ HPSAL+MF++II +SKGK IV+FLDYDGTLSPI
Sbjct  59    LLDSMRASSPTRRSSE-TENLNSWIVHHPSALNMFDEIINSSKGKQIVVFLDYDGTLSPI  117

Query  568   VDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPS  747
             VDDPD AFM+  MR  VR  + YFPTAIVSGRC  KV++FV+L+ELYYAGSHGMDIK P 
Sbjct  118   VDDPDKAFMTCEMREAVRNTSKYFPTAIVSGRCRAKVFNFVKLSELYYAGSHGMDIKAPV  177

Query  748   RGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDE  927
             +G  Y+KG  + VL QPA EFLPMI EVYK+L+E+T S PG KVENNKFC+SVHFR V+E
Sbjct  178   KGRNYRKGNNQTVLCQPAREFLPMISEVYKSLVEKTKSIPGAKVENNKFCLSVHFRRVEE  237

Query  928   LKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFP  1107
              +W ELA+QV+SV KEYP LRLTQGRKVLEIRP I+WDKG ALEFLLESLGYANS DV P
Sbjct  238   KRWTELAEQVKSVTKEYPTLRLTQGRKVLEIRPSIKWDKGNALEFLLESLGYANSNDVLP  297

Query  1108  VYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             +YIGDDRTDEDAFKVLR+  QGFGILVSK PK+T+A+YSLQEP EVM FL RLVEWK
Sbjct  298   IYIGDDRTDEDAFKVLRDRGQGFGILVSKSPKETNATYSLQEPLEVMYFLNRLVEWK  354



>ref|XP_006428166.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
 gb|ESR41406.1| hypothetical protein CICLE_v10025685mg [Citrus clementina]
Length=390

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 272/338 (80%), Gaps = 11/338 (3%)
 Frame = +1

Query  283   KPPVVP-GGYINFDVTSGKELLQNLDVNGAAAKV--SSWVDSMRASSPTQKS--TP-LSD  444
             +PPVVP GGY N      K +LQNL+ N AA     + WV+S+RASSPT     TP L +
Sbjct  47    RPPVVPCGGYTN----KKKLMLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLE  102

Query  445   DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRK  624
             + R W+++HPSALDMF +I +ASKGK IVMFLDYDGTLSPIV++PD AFMS  MR  VR+
Sbjct  103   EKRAWIIRHPSALDMFHEITEASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQ  162

Query  625   LATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPAS  804
             LA YFPTAIV+GRC DKVY FV+LAELYYAGSHGMDIKGP++G KY + ++  V FQPAS
Sbjct  163   LAKYFPTAIVTGRCRDKVYDFVKLAELYYAGSHGMDIKGPTKGLKYNQKSKV-VNFQPAS  221

Query  805   EFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPK  984
             EFLP+ID+VYK L+E+T STPG +VENNKFC+SVHFRCVDE KW +LAQ+V+ V+ EYP+
Sbjct  222   EFLPLIDKVYKVLVEKTKSTPGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQ  281

Query  985   LRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRET  1164
             L   QGR V+EIRP IEWDKGKALEFLLE LG+A+ ++VFPVY+GDD TDEDAFK+LR+ 
Sbjct  282   LNWRQGRMVMEIRPKIEWDKGKALEFLLECLGFADCSNVFPVYMGDDTTDEDAFKILRKR  341

Query  1165  RQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              QGFGILVSK PK T ASYSL+EP EVM FL++LV WK
Sbjct  342   EQGFGILVSKFPKKTSASYSLREPDEVMDFLQKLVRWK  379



>ref|XP_006353999.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Solanum 
tuberosum]
Length=365

 Score =   461 bits (1186),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/360 (63%), Positives = 280/360 (78%), Gaps = 14/360 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNR--------FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAK  378
             MT  NV+ +SDP          F  A   P   PG +I       K+  +N+D +  A +
Sbjct  1     MTNQNVI-ISDPRSGFDSSLLSFSPAVPGPLPQPGRFI---AVPAKKSFKNID-STDATR  55

Query  379   VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +++ +DSMRASSPT++S+  +++ ++W+  HPSAL+MF++II +SKGK IV+FLDYDGTL
Sbjct  56    ITALLDSMRASSPTRRSSE-TENLKSWIDHHPSALNMFDEIINSSKGKQIVVFLDYDGTL  114

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFM+  MR  V+  + YFPTAIVSGRC  KV++FV+L++LYYAGSHGMDIK
Sbjct  115   SPIVDDPDKAFMTSEMREAVKNTSKYFPTAIVSGRCRAKVFNFVKLSQLYYAGSHGMDIK  174

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
              P +G  Y+KG  + VL QPA EFLPMI EVYK+L+E+T S PG KVENNKFC+SVHFR 
Sbjct  175   APVKGRNYRKGNNQTVLCQPAREFLPMISEVYKSLVEKTKSIPGAKVENNKFCLSVHFRR  234

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             V+E +W ELA+QV+SV KEYP+LRLTQGRKVLEIRP I+WDKG ALEFLLESLGYANS D
Sbjct  235   VEEKRWTELAEQVKSVTKEYPRLRLTQGRKVLEIRPSIKWDKGNALEFLLESLGYANSND  294

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             V P+YIGDDRTDEDAFKVLR+  QGFGILVSK PK+T+A+YSLQEP EVM FL RLVEWK
Sbjct  295   VLPIYIGDDRTDEDAFKVLRDRGQGFGILVSKSPKETNATYSLQEPLEVMYFLNRLVEWK  354



>dbj|BAB11650.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
Length=381

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 230/354 (65%), Positives = 280/354 (79%), Gaps = 12/354 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGA--AAKVSSWVDSMRAS  411
             V  VS+ + F     KPP  PG YI+    S K+LL+NL++NGA  + +++SWVDSMRAS
Sbjct  18    VSTVSNSSVFTPTAQKPPTAPG-YIS---VSKKKLLKNLEINGADQSQRLNSWVDSMRAS  73

Query  412   SPTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT      S    ++H +W+ +HPSAL+MFE+II+ ++GK IVMFLDYDGTLSPIVDDP
Sbjct  74    SPTHLKSLSSFSSEEEHNSWIKRHPSALNMFERIIEEARGKQIVMFLDYDGTLSPIVDDP  133

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AFM+  MR TV+K+A  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  134   DRAFMTSKMRRTVKKMAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  193

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDEVYK L+E+T STPG KVENNKFC+SVHFRCVDE KW
Sbjct  194   RYNKD-KPSVLYQPAGDFLPMIDEVYKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKW  252

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV+K YP L+L+QGRKV EIRPII+W+KGKALEFLLESLG+ N  DVFP+YI
Sbjct  253   SELASKVRSVVKNYPTLKLSQGRKVFEIRPIIKWNKGKALEFLLESLGFENCNDVFPIYI  312

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GDD+TDEDAFK+LR   QGFGILVSK PKDT ASYSLQ+P E   +  R +  +
Sbjct  313   GDDKTDEDAFKLLRGRGQGFGILVSKFPKDTSASYSLQDPPEASTYTNRYINLR  366



>ref|XP_003527912.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X1 [Glycine max]
Length=370

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/366 (63%), Positives = 279/366 (76%), Gaps = 21/366 (6%)
 Frame = +1

Query  223   MTRHNVV-------------AVSDPNRFPTAG-HKPPVVPGGYINFDVTSGKELLQNLDV  360
             MT  NVV             ++S+    P+A   +   V GG+  + +   K L++ L+ 
Sbjct  2     MTNQNVVTHEVINTLIAMAASISNSTVLPSATVPESMAVLGGF--WGLPHNKNLVKRLE-  58

Query  361   NGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
                 AKVS+W+DSMRASSPT+  +  S + R+W++ HPSAL+ FEQI+ ++KGK IV+FL
Sbjct  59    ---GAKVSAWIDSMRASSPTRAKSE-SQEKRSWILYHPSALNTFEQIVYSAKGKQIVVFL  114

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV DP+ AFM+  MRAT++ +A +FPTAIV+GRC DKVY+FV+LAELYYAGS
Sbjct  115   DYDGTLSPIVADPNKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGS  174

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDI GP++  K      + VLFQPAS+FLPMIDEVYK LLE+T + PG KVENNKFC+
Sbjct  175   HGMDITGPTKSPKQGNNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGAKVENNKFCL  234

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVHFRCVDE  W  LA++VR VL EYP+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG
Sbjct  235   SVHFRCVDEKSWAALAEKVRLVLIEYPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESLG  294

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             Y NS DVFP+YIGDDRTDEDAF+VLR   QG GILVS++ K+T ASYSLQ+PSEV  FLR
Sbjct  295   YENSNDVFPIYIGDDRTDEDAFRVLRSRGQGIGILVSRVAKETDASYSLQDPSEVEQFLR  354

Query  1261  RLVEWK  1278
             RLVEWK
Sbjct  355   RLVEWK  360



>emb|CDY08815.1| BnaA06g24090D [Brassica napus]
Length=363

 Score =   460 bits (1183),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 279/345 (81%), Gaps = 11/345 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG-AAAKVSSWVDSMRASS  414
             V  VS+ + F  +  KPP  PG +I+    S K+LL++L++NG  + +++SWVDSMRASS
Sbjct  18    VSTVSNSSVFTPSAQKPPTAPG-HISI---SKKKLLKSLEINGDQSQRLNSWVDSMRASS  73

Query  415   PTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPD  582
             PT      ST   ++  +WM +HPSALDMFE+II+AS+GK IVMFLDYDGTLSPIV DPD
Sbjct  74    PTHLKSLPSTSSEEELNSWMKRHPSALDMFERIIEASRGKEIVMFLDYDGTLSPIVADPD  133

Query  583   SAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SK  759
              AF+S  MR TV+KLA  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S+
Sbjct  134   RAFISSKMRRTVKKLAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFSR  193

Query  760   YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWG  939
             Y K  +  VL+QPA +FLPMIDE +K L+E+T STPG KVENNKFC+SVHFRCVDE KW 
Sbjct  194   YNKD-KPSVLYQPAGDFLPMIDEAFKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKWS  252

Query  940   ELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIG  1119
             ELA +VRSV+K YP L+L+QGRKV EIRP+I+WDKGKALEFLLESLG+ NS+DVFP+YIG
Sbjct  253   ELALKVRSVVKNYPTLKLSQGRKVFEIRPMIKWDKGKALEFLLESLGFDNSSDVFPIYIG  312

Query  1120  DDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLF  1254
             DDRTDEDAFK+L+E  QG G+LV+K PKDT+ASYSLQ+P E   +
Sbjct  313   DDRTDEDAFKLLQERGQGLGLLVTKFPKDTNASYSLQDPLEASTY  357



>ref|XP_006826948.1| hypothetical protein AMTR_s00010p00186780 [Amborella trichopoda]
 gb|ERM94185.1| hypothetical protein AMTR_s00010p00186780 [Amborella trichopoda]
Length=392

 Score =   461 bits (1185),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/333 (68%), Positives = 262/333 (79%), Gaps = 11/333 (3%)
 Frame = +1

Query  268   PTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDD  447
             P++ + PP +P    +    S ++ LQ LD     ++++ W+DSM+ASSPT   +  S D
Sbjct  52    PSSAYPPPQMPPA-ASIITISRRKPLQKLDTT---SRINGWIDSMKASSPTHIKSSPSLD  107

Query  448   HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKL  627
               +W + HPSAL MFEQ++ ASK K IVMFLDYDGTLSPIVDDPD A+MSD MR+ VR +
Sbjct  108   PSSWTVHHPSALSMFEQMMNASKEKQIVMFLDYDGTLSPIVDDPDRAYMSDSMRSAVRAV  167

Query  628   ATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKY-------KKGAEEDV  786
             A YFPTAIVSGRC DKVY FVRLAELYYAGSHGMDIKGP+R  +        K G  + V
Sbjct  168   ARYFPTAIVSGRCRDKVYRFVRLAELYYAGSHGMDIKGPARRPRSQRNWALDKTGKNKAV  227

Query  787   LFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSV  966
             LFQPASEFLPMID VYK L+E T   PG KVENNKFC+SVHFRCVDE +W  LA++VR+V
Sbjct  228   LFQPASEFLPMIDVVYKALVETTKGIPGAKVENNKFCLSVHFRCVDEKRWSTLAEEVRTV  287

Query  967   LKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAF  1146
             L+EYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG+AN  DVFPVYIGDDRTDEDAF
Sbjct  288   LREYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGFANCEDVFPVYIGDDRTDEDAF  347

Query  1147  KVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             KVLR+  QGFGILVSK+PKDT+A+YSLQEPSE 
Sbjct  348   KVLRDRGQGFGILVSKIPKDTNATYSLQEPSEA  380



>ref|XP_003523824.2| PREDICTED: probable trehalose-phosphate phosphatase J-like [Glycine 
max]
Length=371

 Score =   459 bits (1182),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 229/367 (62%), Positives = 280/367 (76%), Gaps = 22/367 (6%)
 Frame = +1

Query  223   MTRHNVV-------------AVSDPNRFPTAG-HKPPVVPGGYINFDVTSGKELLQNLDV  360
             MT  NVV             ++S+    P+A   +   V GG+  + +   K L++ L+ 
Sbjct  2     MTNQNVVTHEVINTLIAVAASISNSTALPSATVPESMAVLGGF--WGLPHNKNLVKRLE-  58

Query  361   NGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
                 AKVS+W+DSMRASSPT+  +  S + R+W++ HPSAL+ FEQI+ ++KGK +V+FL
Sbjct  59    ---GAKVSAWIDSMRASSPTRAKSE-SQEKRSWILYHPSALNTFEQIVCSAKGKQVVVFL  114

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV DPD AFM+  MRAT++ +A +FPTAIV+GRC DKVY+FV+LAELYYAGS
Sbjct  115   DYDGTLSPIVADPDKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGS  174

Query  721   HGMDIKGPSRGSKYKKGAEED-VLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFC  897
             HGMDIKGP++    K+G     VLFQPAS+FLPMIDEVYK LLE+T + PG  VENNKFC
Sbjct  175   HGMDIKGPTKSQSPKQGNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGANVENNKFC  234

Query  898   VSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESL  1077
             +SVHFRCVDE  W  LA++VR VL +YP+LRLTQGRKVLEIRP I+WDKGKALEFLLESL
Sbjct  235   LSVHFRCVDEKSWAALAEKVRLVLNDYPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESL  294

Query  1078  GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFL  1257
             GY NS DVFP+YIGDDRTDEDAFKVLR   QG GILVS++ K+T ASY+LQ+PSEV  FL
Sbjct  295   GYENSNDVFPIYIGDDRTDEDAFKVLRSRGQGIGILVSRVAKETDASYTLQDPSEVEQFL  354

Query  1258  RRLVEWK  1278
             RRLVEWK
Sbjct  355   RRLVEWK  361



>ref|XP_009380850.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   459 bits (1181),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 257/321 (80%), Gaps = 9/321 (3%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQK------STPLSDDHRTWMMQHPSALDMFE  495
             K+ L  LD  G   ++ +WV+SM+ASSPT          P+ +    W+M+HPSAL  FE
Sbjct  38    KKYLSQLDFAGG--RIGTWVESMKASSPTHTKAVGAIGVPVDEQSAAWIMRHPSALTKFE  95

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             QI+ ASKGK IVMFLDYDGTLSPIV+DPDSAFM+D MRA VR +A YFPTAIV+GRC +K
Sbjct  96    QIMSASKGKQIVMFLDYDGTLSPIVEDPDSAFMTDAMRAAVRNVARYFPTAIVTGRCLEK  155

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             V  FV L ELYYAGSHGMDIKGP++  ++ K   + VLFQPA EFLPMID VY++LLE+T
Sbjct  156   VIDFVGLTELYYAGSHGMDIKGPAK-PRHTKAKAKSVLFQPAREFLPMIDGVYRSLLERT  214

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
              ST G KVENNKFCVSVHFRCVDE  WG L +QVRSVLKEYPKLRLTQGRKVLEIRP I+
Sbjct  215   KSTAGAKVENNKFCVSVHFRCVDEKSWGALIEQVRSVLKEYPKLRLTQGRKVLEIRPTIK  274

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLG+A+  DV PVYIGDDRTDEDAFKVLR+  QG GILVSK PK+T+A
Sbjct  275   WDKGKALEFLLESLGFADCKDVMPVYIGDDRTDEDAFKVLRDRGQGLGILVSKFPKETNA  334

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             +YSLQEP+EV  FL RLVEWK
Sbjct  335   TYSLQEPTEVKDFLVRLVEWK  355



>gb|AAZ66928.1| 117M18_9 [Brassica rapa]
Length=371

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/349 (65%), Positives = 274/349 (79%), Gaps = 14/349 (4%)
 Frame = +1

Query  220   KMTRHNVVAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWV  393
             +M+    V VS+  R   P     PP    G+I+    S K+LL+NL++     ++++WV
Sbjct  6     RMSESQNVVVSEAARSIIPNNSSAPP----GFISI---SKKKLLKNLEIINDGERINAWV  58

Query  394   DSMRASSPTQ-KSTP--LSDDHR--TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             DSMRASSPT  KS P  +S + +  +W+MQHPSAL+MFE+I +AS GK IV+FLDYDGTL
Sbjct  59    DSMRASSPTHPKSLPSSISSEQQLSSWIMQHPSALEMFEKITEASGGKQIVIFLDYDGTL  118

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIVDDPD AFMS  MR TV+KLA  FPTAIV+GRC DKVY+FV+LAELYYAGSHGMDIK
Sbjct  119   SPIVDDPDRAFMSSKMRRTVKKLAKCFPTAIVTGRCLDKVYNFVKLAELYYAGSHGMDIK  178

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GP++G    K  ++ +L+QPAS++LPMIDEVY+ LLE+T STPGV VENNKFC SVHFRC
Sbjct  179   GPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYRQLLEKTKSTPGVIVENNKFCASVHFRC  238

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE KW EL  QVRSVL EYP+L+L QGRKV EIRP+IEWDKGKALEFLLESLG+ NS +
Sbjct  239   VDEKKWSELVLQVRSVLNEYPRLKLNQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNN  298

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             VFPVYIGDDRTDEDAFK+LR+  +G G+LVSK PKDT ASY LQ+PSE 
Sbjct  299   VFPVYIGDDRTDEDAFKLLRDRGEGCGVLVSKFPKDTDASYYLQDPSEA  347



>sp|Q6ZAL2.1|TPP6_ORYSJ RecName: Full=Probable trehalose-phosphate phosphatase 6; Short=OsTPP6; 
AltName: Full=Trehalose 6-phosphate phosphatase [Oryza 
sativa Japonica Group]
 dbj|BAC99626.1| putative trehalose-phosphatase [Oryza sativa Japonica Group]
 dbj|BAH01631.1| unnamed protein product [Oryza sativa Japonica Group]
Length=370

 Score =   457 bits (1177),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 271/366 (74%), Gaps = 19/366 (5%)
 Frame = +1

Query  223   MTRHNVVAVS-----DPNRFPTAGHKPPVVPGGYINFDVTSGKELLQ-NLDVNGAAAKVS  384
             MT+ +VV         PN  P   + PP    G     V   K+ LQ  LD+      ++
Sbjct  1     MTKQSVVVPEVAVPMPPNSAPLLPYPPPRAAPG-----VAVRKKYLQAQLDLGAGLPLIN  55

Query  385   SWVDSMRASSPTQKSTP--------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
              WV+SMRASSPT             + D+   WM++HPSAL  FEQI+ ASKGK IVMFL
Sbjct  56    GWVESMRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVMFL  115

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIVDDPDSAFMSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGS
Sbjct  116   DYDGTLSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGS  175

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDIKGP++ S++ K   + VLFQPASEFLPMI++V+ +L+E+T   PG KVENNKFCV
Sbjct  176   HGMDIKGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKFCV  235

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVHFRCVDE  W  LA  V++ LK+YPKL+LTQGR V EIRP I+WDKGKALEFLLESLG
Sbjct  236   SVHFRCVDEKSWSTLADIVKAELKDYPKLKLTQGRMVFEIRPTIKWDKGKALEFLLESLG  295

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             +A+ T+V PVYIGDDRTDEDAFKVLR+  QG GILVSK PKDT+ASYSLQEP+EVM FL 
Sbjct  296   FADCTNVLPVYIGDDRTDEDAFKVLRKRGQGIGILVSKYPKDTNASYSLQEPAEVMEFLL  355

Query  1261  RLVEWK  1278
             RLVEW+
Sbjct  356   RLVEWE  361



>gb|EAZ06967.1| hypothetical protein OsI_29208 [Oryza sativa Indica Group]
Length=370

 Score =   457 bits (1177),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 233/366 (64%), Positives = 273/366 (75%), Gaps = 19/366 (5%)
 Frame = +1

Query  223   MTRHNVV----AVS-DPNRFPTAGHKPPVVPGGYINFDVTSGKELLQ-NLDVNGAAAKVS  384
             MT+ +VV    AV   PN  P   + PP    G     V   K+ LQ  LD+      ++
Sbjct  1     MTKQSVVLPEVAVPVPPNSAPLLPYPPPRAAPG-----VAVRKKYLQAQLDLGAGLPLIN  55

Query  385   SWVDSMRASSPTQKSTP--------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
              WV+SMRASSPT             + D+   WM++HPSAL  FEQI+ ASKGK IVMFL
Sbjct  56    GWVESMRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVMFL  115

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIVDDPDSAFMSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGS
Sbjct  116   DYDGTLSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGS  175

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDIKGP++ S++ K   + VLFQPASEFLPMI++V+ +L+E+T   PG KVENNKFCV
Sbjct  176   HGMDIKGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKFCV  235

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVHFRCVDE  W  LA  V++ LK+YPKL+LTQGR V EIRP I+WDKGKALEFLLESLG
Sbjct  236   SVHFRCVDEKSWSTLADIVKAELKDYPKLKLTQGRMVFEIRPTIKWDKGKALEFLLESLG  295

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             +A+ T+V PVYIGDDRTDEDAFKVLR+  QG GILVSK PKDT+ASYSLQEP+EVM FL 
Sbjct  296   FADCTNVLPVYIGDDRTDEDAFKVLRKRGQGIGILVSKYPKDTNASYSLQEPAEVMEFLL  355

Query  1261  RLVEWK  1278
             RLVEW+
Sbjct  356   RLVEWE  361



>gb|KHN06593.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=294

 Score =   454 bits (1169),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 221/285 (78%), Positives = 245/285 (86%), Gaps = 3/285 (1%)
 Frame = +1

Query  400   MRASSPT--QKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVD  573
             MR+SSPT  + ++ L+++H TW+++HPSALDMFEQI+ AS+GK IVMFLDYDGTLSPIVD
Sbjct  1     MRSSSPTNSKSTSSLAEEHSTWILRHPSALDMFEQIMDASRGKQIVMFLDYDGTLSPIVD  60

Query  574   DPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG  753
             DPD AFMSD MR TVRKLA  FPTAIV+GRC DKVY+FVRLAELYYAGSHGMDI+GP+R 
Sbjct  61    DPDRAFMSDSMRRTVRKLARCFPTAIVTGRCKDKVYNFVRLAELYYAGSHGMDIQGPTRT  120

Query  754   SKY-KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDEL  930
             SKY  K   E VLFQPASEFLPMIDEVY  L+E+  S PG  VENNKFC SVHFRCVDE 
Sbjct  121   SKYSNKDKGEPVLFQPASEFLPMIDEVYHQLVEKMKSIPGAMVENNKFCCSVHFRCVDEK  180

Query  931   KWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPV  1110
             KW ELAQ+VRSVLKEYPKLRL QGRKVLEIRP I+WDKGKALEFLLESLG+AN  DVFPV
Sbjct  181   KWSELAQEVRSVLKEYPKLRLNQGRKVLEIRPSIKWDKGKALEFLLESLGFANCNDVFPV  240

Query  1111  YIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             YIGDD+TDEDAFK LR+  QGFGILVSK PKDT ASYSLQEP+E 
Sbjct  241   YIGDDKTDEDAFKKLRDRGQGFGILVSKFPKDTTASYSLQEPNEA  285



>ref|XP_010453030.1| PREDICTED: probable trehalose-phosphate phosphatase I isoform 
X1 [Camelina sativa]
Length=304

 Score =   454 bits (1167),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 255/298 (86%), Gaps = 5/298 (2%)
 Frame = +1

Query  400   MRASSPTQ-KSTP--LSDDHR--TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             MRASSPT  KS P  +S  H+  +W+MQHPSAL+MF++II+AS GK IVMFLDYDGTLSP
Sbjct  1     MRASSPTHLKSLPSSISSQHQLNSWIMQHPSALEMFDRIIEASGGKQIVMFLDYDGTLSP  60

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IVDDPD AFMS  MR TV+KLA  FPTAIV+GRC DK+Y+FV+LAELYYAGSHGMDI GP
Sbjct  61    IVDDPDKAFMSSKMRRTVKKLAKCFPTAIVTGRCIDKLYNFVKLAELYYAGSHGMDIIGP  120

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             ++G    K  ++ +L+QPA+++LPMIDEV+K LLE+T STPGVKVEN+KFC SVHFRCVD
Sbjct  121   AKGFSRHKRVKQSLLYQPANDYLPMIDEVHKQLLEKTKSTPGVKVENHKFCASVHFRCVD  180

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E KW EL  QVRSVLK++P L+LTQGRKV EIRP+IEWDKGKALEFLLESLG+ NS +VF
Sbjct  181   EKKWSELVLQVRSVLKKFPTLKLTQGRKVFEIRPMIEWDKGKALEFLLESLGFGNSNNVF  240

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDDRTDEDAFK+LR   +GFGILVSK PKDT ASYSLQ+PSEVM FLRRLVEWK
Sbjct  241   PVYIGDDRTDEDAFKMLRGRGEGFGILVSKFPKDTDASYSLQDPSEVMDFLRRLVEWK  298



>ref|XP_006404674.1| hypothetical protein EUTSA_v10000217mg [Eutrema salsugineum]
 gb|ESQ46127.1| hypothetical protein EUTSA_v10000217mg [Eutrema salsugineum]
Length=354

 Score =   456 bits (1172),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 255/324 (79%), Gaps = 7/324 (2%)
 Frame = +1

Query  319   DVTSGKELLQNLDVNG----AAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALD  486
             D ++  ++L +  +N         + SWVDSMRA SPT  ++   ++   W+ +HPSAL+
Sbjct  28    DTSAATKVLHDFQINDENVVGGGLIRSWVDSMRACSPTHLNS--FNNQSCWIEEHPSALN  85

Query  487   MFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRC  666
             MFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIVSGR 
Sbjct  86    MFEEIVHESEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVKKLAMCFPTAIVSGRS  145

Query  667   TDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLL  846
              +KVY FV+L ELYYAGSHGMDIKGP +GSKY+K     +L QPA+EFLP+I EVYK L+
Sbjct  146   REKVYGFVKLTELYYAGSHGMDIKGPEKGSKYQK-KNRSLLCQPATEFLPVITEVYKNLV  204

Query  847   EQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRP  1026
             E+T S PG KVENNKFC  VHFRCVDE KW  LA  VRSVLK YPKL L+QGRKVLEIRP
Sbjct  205   EKTKSIPGAKVENNKFCACVHFRCVDENKWSYLAHLVRSVLKNYPKLMLSQGRKVLEIRP  264

Query  1027  IIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKD  1206
             +IEWDKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK  K+
Sbjct  265   VIEWDKGKALEFLLESLGYTNCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKYAKE  324

Query  1207  THASYSLQEPSEVMLFLRRLVEWK  1278
             T+ASYSLQEP EVM FL RLVEWK
Sbjct  325   TNASYSLQEPDEVMDFLERLVEWK  348



>gb|KDP41360.1| hypothetical protein JCGZ_15767 [Jatropha curcas]
Length=375

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 266/329 (81%), Gaps = 10/329 (3%)
 Frame = +1

Query  322   VTSGKELLQNLDVNGAAAKVSS----WVDSMRASSPTQ-KSTPLS----DDHRTWMMQHP  474
             +T+   L++ ++  G  A   +    WVDSMR SSPT+ KST  S    ++ ++WM+ HP
Sbjct  37    LTASPRLVKKMETAGGEAVTKTNNAYWVDSMRDSSPTRVKSTASSLSETEERKSWMINHP  96

Query  475   SALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIV  654
             SAL MFEQI+ ASKGK IVMFLDYDGTLSPIV+DPD AFM+  MR  VR +A YFPTAIV
Sbjct  97    SALSMFEQILNASKGKQIVMFLDYDGTLSPIVEDPDRAFMTSEMREAVRDVARYFPTAIV  156

Query  655   SGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAE-EDVLFQPASEFLPMIDEV  831
             +GRC DKVYSFV+LA LYYAGSHGMDIKGPS  S+  K  + E +LFQPAS+FLPMIDEV
Sbjct  157   TGRCRDKVYSFVKLAGLYYAGSHGMDIKGPSSKSRKYKKKDHEALLFQPASKFLPMIDEV  216

Query  832   YKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKV  1011
             Y+ L+E+T + PG KVENNKFC+SVHFRCVDE  W  LA+QV+SVL +YPKLRLTQGRKV
Sbjct  217   YEVLIEKTKTIPGAKVENNKFCLSVHFRCVDEKMWDTLAEQVKSVLNDYPKLRLTQGRKV  276

Query  1012  LEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVS  1191
             LEIRP I+WDKGKALEFLLE+LGYANS DV PVYIGDDR+DEDAFKVLR   QG GILVS
Sbjct  277   LEIRPTIKWDKGKALEFLLEALGYANSKDVLPVYIGDDRSDEDAFKVLRNRDQGLGILVS  336

Query  1192  KLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             K+PK+T+ASYSLQ+P+EV  FLRRLVEWK
Sbjct  337   KVPKETNASYSLQDPAEVKEFLRRLVEWK  365



>ref|XP_002880434.1| trehalose-phosphatase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56693.1| trehalose-phosphatase [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   455 bits (1171),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 260/327 (80%), Gaps = 5/327 (2%)
 Frame = +1

Query  304   GYINFDVTSGKELLQNLDVNGAAAK--VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPS  477
             G  + D +   + L +  +NG      + SWVDSMRA SPT+  +   ++   W+ +HPS
Sbjct  27    GRDDGDTSPSTKALHDFQINGGGGGGLIRSWVDSMRACSPTRPKS--FNNQSCWIKEHPS  84

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             AL+MFE+I+  S+GK +VMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVS
Sbjct  85    ALNMFEEILNKSEGKQVVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVS  144

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC +KV SFV+L ELYYAGSHGMDIKGP +G KYKK   + +L QPA+EFLP+I+EV+K
Sbjct  145   GRCREKVSSFVKLTELYYAGSHGMDIKGPEQGPKYKK-ENQSLLCQPATEFLPVINEVFK  203

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              LLE+T S PG KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLE
Sbjct  204   KLLEKTKSIPGAKVENNKFCASVHFRCVEENKWSDLANQVRSVLKNYPKLMLTQGRKVLE  263

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRPII+WDKGKALEFLLESLGY N TDVFP+YIGDD TDEDAFK+LR+ +QG GILVSK 
Sbjct  264   IRPIIKWDKGKALEFLLESLGYNNCTDVFPIYIGDDLTDEDAFKILRDKKQGLGILVSKY  323

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              K+T+ASYSLQEP EVM FL RLV+WK
Sbjct  324   AKETNASYSLQEPDEVMDFLERLVDWK  350



>gb|EPS68990.1| hypothetical protein M569_05778, partial [Genlisea aurea]
Length=289

 Score =   451 bits (1161),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 231/290 (80%), Positives = 256/290 (88%), Gaps = 1/290 (0%)
 Frame = +1

Query  472   PSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAI  651
             PSALDMF+QI  ASKGK IVMFLDYDGTLSPIV+DPD AFMS+ MRATVRKLA YFPTAI
Sbjct  1     PSALDMFDQITNASKGKQIVMFLDYDGTLSPIVEDPDQAFMSESMRATVRKLARYFPTAI  60

Query  652   VSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEV  831
             VSGRC DKVY+FVRLAELYYAGSHGMDIKGPS+G K KK   + VLFQPASE+LPMID+V
Sbjct  61    VSGRCRDKVYNFVRLAELYYAGSHGMDIKGPSKGYKNKK-ETQGVLFQPASEYLPMIDQV  119

Query  832   YKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKV  1011
             Y  LLE   STPG KVENNKFCVSVHFRCVDE KW ELA+QV +VL+ YP LR+TQGRKV
Sbjct  120   YNALLEVVKSTPGAKVENNKFCVSVHFRCVDEKKWSELAKQVGTVLEAYPSLRVTQGRKV  179

Query  1012  LEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVS  1191
             LEIRP I+WDKGKALEFLLESLGY N+ DVFP+Y+GDDRTDEDAFKVLRE  QGFGILVS
Sbjct  180   LEIRPTIKWDKGKALEFLLESLGYGNNDDVFPIYMGDDRTDEDAFKVLRERGQGFGILVS  239

Query  1192  KLPKDTHASYSLQEPSEVMLFLRRLVEWKrlalrrqsrlrrqlEEIKATL  1341
             K PK+T+ASYSL+EPSEVM FLRRLVE +RL+LRRQ R+RR+++EIK TL
Sbjct  240   KAPKETYASYSLREPSEVMAFLRRLVESRRLSLRRQLRMRRRVQEIKVTL  289



>ref|XP_006434014.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
 gb|ESR47254.1| hypothetical protein CICLE_v10001513mg [Citrus clementina]
Length=373

 Score =   454 bits (1169),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 236/372 (63%), Positives = 276/372 (74%), Gaps = 28/372 (8%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV-----------------PGGYINFDVTSGKELLQN  351
             MT  NVV  SD  +F   G K  V                  PGG   F   S K +L+ 
Sbjct  1     MTNQNVVVASD-RKFSNIGLKITVTLTNSTLFSGADSKALPAPGG--GFITISRKNILRK  57

Query  352   -LDVNGAAA-KVSSWVDSMRASSPTQ-KST----PLSDDHRTWMMQHPSALDMFEQIIKA  510
               D +     K+++WV+S+RASSPT+ KS+    P +++  +W+ +HPSAL  FE+I+ A
Sbjct  58    PTDTSDQGGNKINAWVNSLRASSPTRLKSSVAFSPQTEEQTSWIARHPSALSKFEEIVNA  117

Query  511   SKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFV  690
             SKGK IVMFLDYDGTL+PIV+DPD AFM++ MR  VR +A YFPTAIV+GRC DKV+SFV
Sbjct  118   SKGKKIVMFLDYDGTLAPIVEDPDRAFMTNEMREAVRDVARYFPTAIVTGRCRDKVFSFV  177

Query  691   RLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPG  870
             +LA LYYAGSHGMDI+GPS+  +YKKG    VL QPASEFLPMI+EVY+TLLE+T S PG
Sbjct  178   KLAGLYYAGSHGMDIEGPSKKRRYKKG-NHGVLCQPASEFLPMINEVYQTLLEKTKSIPG  236

Query  871   VKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGK  1050
              KVENNKFC+SVHFRCVDE  WG LA+QVR VL +YPKL LTQGR VLEIRP I+WDKGK
Sbjct  237   AKVENNKFCLSVHFRCVDENSWGTLAEQVRVVLDKYPKLTLTQGRMVLEIRPTIKWDKGK  296

Query  1051  ALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQ  1230
             ALEFLLE+LGYANS DV PVYIGDDRTDEDAFKVLR   QGFGILVSK PK+THASYSLQ
Sbjct  297   ALEFLLEALGYANSKDVVPVYIGDDRTDEDAFKVLRNRGQGFGILVSKTPKETHASYSLQ  356

Query  1231  EPSEVMLFLRRL  1266
             EPSEV+L    L
Sbjct  357   EPSEVILIYSML  368



>ref|XP_007141163.1| hypothetical protein PHAVU_008G172400g [Phaseolus vulgaris]
 gb|ESW13157.1| hypothetical protein PHAVU_008G172400g [Phaseolus vulgaris]
Length=369

 Score =   453 bits (1166),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 257/317 (81%), Gaps = 3/317 (1%)
 Frame = +1

Query  334   KELLQNL-DVNG-AAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIK  507
             K LL+ L D +G    KV++W+DSMRASSPT+  +  + D   W + HPSAL++F+QII 
Sbjct  45    KLLLKTLEDGSGKGGTKVNTWIDSMRASSPTRVKSTQNQDPSPWTLYHPSALNLFDQIIC  104

Query  508   ASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSF  687
              SKGK IV FLDYDGTLSPIV DPD A+MS  MRAT++ +A +FPTAIVSGRC DKVYSF
Sbjct  105   ESKGKQIVTFLDYDGTLSPIVADPDKAYMSQKMRATLKDIARHFPTAIVSGRCIDKVYSF  164

Query  688   VRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTP  867
             VRLAELYYAGSHGMDIKGP+     KKG  E VLFQPASEFLPMI+EVY  L+++T   P
Sbjct  165   VRLAELYYAGSHGMDIKGPTNRRSTKKG-NEAVLFQPASEFLPMINEVYNILVDKTKPVP  223

Query  868   GVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKG  1047
             G KVENNKFC+SVHFRCVDE  W  LA+QV  VL+ YPKL+LTQGRKVLEIRP I+WDKG
Sbjct  224   GAKVENNKFCLSVHFRCVDEKSWASLAEQVSLVLEHYPKLKLTQGRKVLEIRPTIKWDKG  283

Query  1048  KALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSL  1227
             KALEFLLESLGY NS +VFP+YIGDDRTDEDAFKVLR+  QG GILVSK+PK+T ASY+L
Sbjct  284   KALEFLLESLGYGNSDNVFPIYIGDDRTDEDAFKVLRKRGQGIGILVSKIPKETDASYTL  343

Query  1228  QEPSEVMLFLRRLVEWK  1278
             Q+P+EV  FLR LVEWK
Sbjct  344   QDPTEVGQFLRHLVEWK  360



>ref|XP_006581545.1| PREDICTED: probable trehalose-phosphate phosphatase J-like isoform 
X2 [Glycine max]
Length=380

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 229/376 (61%), Positives = 279/376 (74%), Gaps = 31/376 (8%)
 Frame = +1

Query  223   MTRHNVV-------------AVSDPNRFPTAG-HKPPVVPGGYINFDVTSGKELLQNLDV  360
             MT  NVV             ++S+    P+A   +   V GG+  + +   K L++ L+ 
Sbjct  2     MTNQNVVTHEVINTLIAMAASISNSTVLPSATVPESMAVLGGF--WGLPHNKNLVKRLE-  58

Query  361   NGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
                 AKVS+W+DSMRASSPT+  +  S + R+W++ HPSAL+ FEQI+ ++KGK IV+FL
Sbjct  59    ---GAKVSAWIDSMRASSPTRAKSE-SQEKRSWILYHPSALNTFEQIVYSAKGKQIVVFL  114

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV DP+ AFM+  MRAT++ +A +FPTAIV+GRC DKVY+FV+LAELYYAGS
Sbjct  115   DYDGTLSPIVADPNKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGS  174

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDI GP++  K      + VLFQPAS+FLPMIDEVYK LLE+T + PG KVENNKFC+
Sbjct  175   HGMDITGPTKSPKQGNNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGAKVENNKFCL  234

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVHFRCVDE  W  LA++VR VL EYP+LRLTQGRKVLEIRP I+WDKGKALEFLLESLG
Sbjct  235   SVHFRCVDEKSWAALAEKVRLVLIEYPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESLG  294

Query  1081  YANSTDVFPVYIGDDRTDEDAFK----------VLRETRQGFGILVSKLPKDTHASYSLQ  1230
             Y NS DVFP+YIGDDRTDEDAF+          VLR   QG GILVS++ K+T ASYSLQ
Sbjct  295   YENSNDVFPIYIGDDRTDEDAFRVTNAATPSLLVLRSRGQGIGILVSRVAKETDASYSLQ  354

Query  1231  EPSEVMLFLRRLVEWK  1278
             +PSEV  FLRRLVEWK
Sbjct  355   DPSEVEQFLRRLVEWK  370



>ref|XP_009140332.1| PREDICTED: probable trehalose-phosphate phosphatase E [Brassica 
rapa]
Length=359

 Score =   453 bits (1165),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 259/337 (77%), Gaps = 8/337 (2%)
 Frame = +1

Query  283   KPPVVPGGYINFDVTSGKELLQNL-----DVNGAAAKVSSWVDSMRASSPTQKSTPLSDD  447
             K  V+  G  + D +   ++ Q+      DV      + SWVDSMRA SPT    P  D+
Sbjct  20    KSEVLYAGGDDGDTSPATKIFQDFQINEEDVGRGGGLIRSWVDSMRACSPTH-LKPF-DN  77

Query  448   HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKL  627
               +W+ +HPSAL+MFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS+ MR TVRKL
Sbjct  78    QSSWIKEHPSALNMFEEILHESEGKQIVMFLDYDGTLSPIVDDPDRAFMSNKMRNTVRKL  137

Query  628   ATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASE  807
             A  FPT IVSGR  +KVYSFV+L ELYYAGSHGMDIKGP + SKYKK  +  +L QPA+E
Sbjct  138   AMCFPTVIVSGRSREKVYSFVKLTELYYAGSHGMDIKGPEQNSKYKKKTQ-SLLCQPATE  196

Query  808   FLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKL  987
             FLP+I EVY  L+E+T S  G KVENNKFC SVHFRCVDE KW +LA  VRSVLK YPKL
Sbjct  197   FLPVISEVYMKLVEKTKSIQGAKVENNKFCASVHFRCVDENKWSDLAHLVRSVLKNYPKL  256

Query  988   RLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETR  1167
              LTQGRKVLEIRPII+WDKGKALEFLLESLGY N T VFP+YIGDDRTDEDAFK+LR+ R
Sbjct  257   MLTQGRKVLEIRPIIKWDKGKALEFLLESLGYENCTHVFPIYIGDDRTDEDAFKILRDKR  316

Query  1168  QGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             QG GILVSK  K+T+ASYSLQEP EVM FL RLVEWK
Sbjct  317   QGLGILVSKYAKETNASYSLQEPDEVMDFLERLVEWK  353



>gb|KDO56609.1| hypothetical protein CISIN_1g020273mg [Citrus sinensis]
 gb|KDO56610.1| hypothetical protein CISIN_1g020273mg [Citrus sinensis]
Length=328

 Score =   451 bits (1161),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 261/318 (82%), Gaps = 6/318 (2%)
 Frame = +1

Query  340   LLQNLDVNGAAAKV--SSWVDSMRASSPTQKS--TP-LSDDHRTWMMQHPSALDMFEQII  504
             +LQNL+ N AA     + WV+S+RASSPT     TP L ++ R W+++HPSALDMF +I 
Sbjct  1     MLQNLETNAAAGARPNNCWVESIRASSPTHMKSITPSLLEEKRAWIIRHPSALDMFHEIT  60

Query  505   KASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYS  684
             +ASKGK IVMFLDYDGTLSPIV++PD AFMS  MR  VR+LA YFPTAIV+GRC DKVY 
Sbjct  61    EASKGKQIVMFLDYDGTLSPIVENPDRAFMSGKMRRAVRQLAKYFPTAIVTGRCRDKVYD  120

Query  685   FVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSST  864
             FV+LAELYYAGSHGMDIKGP++G KY + ++  V FQPASEFLP+ID+VYK L+E+T ST
Sbjct  121   FVKLAELYYAGSHGMDIKGPTKGLKYNQKSKV-VNFQPASEFLPLIDKVYKVLVEKTKST  179

Query  865   PGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDK  1044
             PG +VENNKFC+SVHFRCVDE KW +LAQ+V+ V+ EYP+L   QGR V+EIRP IEWDK
Sbjct  180   PGARVENNKFCISVHFRCVDEKKWNDLAQKVKEVVNEYPQLNWRQGRMVMEIRPKIEWDK  239

Query  1045  GKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYS  1224
             GKALEFLLE LG+A+ ++VFPVYIGDD TDEDAFK+LR+  QGFGILVSK PK T ASYS
Sbjct  240   GKALEFLLECLGFADCSNVFPVYIGDDTTDEDAFKILRKREQGFGILVSKFPKKTSASYS  299

Query  1225  LQEPSEVMLFLRRLVEWK  1278
             L+EP EVM FL++LV WK
Sbjct  300   LREPDEVMDFLQKLVRWK  317



>ref|XP_009398164.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 281/379 (74%), Gaps = 31/379 (8%)
 Frame = +1

Query  223   MTRHNVV-------------AVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDV-  360
             MT+ NVV             A+++P+  P   + PP   G   N+  T   +L   LD+ 
Sbjct  1     MTKQNVVMQEELAVAVPTSAAIAEPS--PCFSYPPPRAAGSGTNY--TRYTKLSCRLDLA  56

Query  361   --NGAAAKVSSWVDSMRASSPTQKSTPL-----------SDDHRTWMMQHPSALDMFEQI  501
                G     +SW++SM+A SPTQ  +              +++ +WMM HPSALD FE++
Sbjct  57    SCGGGGRAANSWIESMKALSPTQAKSAAPREVPSLASREEEEYDSWMMLHPSALDNFEEV  116

Query  502   IKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVY  681
             + A+KGK IVMFLDYDGTLSPIVDDPD AFMSD MR  VR++A++FPTAIVSGRCT+KV 
Sbjct  117   MTAAKGKQIVMFLDYDGTLSPIVDDPDRAFMSDEMREAVREVASHFPTAIVSGRCTEKVS  176

Query  682   SFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSS  861
             SFV+L+EL+YAGSHGMDIKGP+ G K+ K   ++VLFQPASEFLPMI EVYK+L+E T S
Sbjct  177   SFVKLSELHYAGSHGMDIKGPNNGPKHPKAMAQNVLFQPASEFLPMIHEVYKSLVETTKS  236

Query  862   TPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWD  1041
              PG +VENNKFC+SVHFRCVDE KW  LA++VRSV+ +YPKLRLT GRKVLEIRP I+WD
Sbjct  237   IPGSRVENNKFCLSVHFRCVDEKKWCLLAEKVRSVIMDYPKLRLTHGRKVLEIRPTIKWD  296

Query  1042  KGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASY  1221
             KGKALEFLLESLG+    DVFP YIGDDRTDEDAFKVLR+  QG GILV+K+ K+T+AS+
Sbjct  297   KGKALEFLLESLGFDGCHDVFPFYIGDDRTDEDAFKVLRDRGQGLGILVTKIAKETNASF  356

Query  1222  SLQEPSEVMLFLRRLVEWK  1278
             SL+EP+EV+ FLRRL EWK
Sbjct  357   SLREPAEVLKFLRRLEEWK  375



>tpg|DAA49101.1| TPA: hypothetical protein ZEAMMB73_457766 [Zea mays]
Length=367

 Score =   452 bits (1164),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 265/349 (76%), Gaps = 17/349 (5%)
 Frame = +1

Query  256   PNRFPTAGHKPP-VVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKST  432
             PN  P   + PP   PG      V   K+ LQ   +   A ++  WV+SMRASSPT    
Sbjct  19    PNSAPLFQYPPPRAAPG------VAVRKKCLQ---MGAGAGRIGGWVESMRASSPTHAKA  69

Query  433   PL-------SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAF  591
                       + +  WM++HPSAL MF+Q++ ASKGK IV+FLDYDGTLSPIVDDPD+A+
Sbjct  70    AAALAAGVEEERYAAWMVKHPSALAMFDQLVAASKGKQIVVFLDYDGTLSPIVDDPDAAY  129

Query  592   MSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKG  771
             MSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGMDIKGP++GS++ K 
Sbjct  130   MSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDIKGPAKGSRHTKA  189

Query  772   AEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQ  951
                 VLFQPAS+FLPMI++V+ +L+E+T   PG KVENNKFCVSVHFRCVDE  W  LA 
Sbjct  190   KGGGVLFQPASQFLPMIEQVHDSLVEKTKCIPGAKVENNKFCVSVHFRCVDEKSWITLAD  249

Query  952   QVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRT  1131
              V+SVLK+YPKL+LTQGR V E+RP I+WDKGKALEFLLESLGYA+ TDV PVYIGDDRT
Sbjct  250   MVKSVLKDYPKLKLTQGRMVFEVRPTIKWDKGKALEFLLESLGYADCTDVLPVYIGDDRT  309

Query  1132  DEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DEDAFKVLR+  QG GILVSK PKDT ASYSLQEP+EVM FL RLVEW+
Sbjct  310   DEDAFKVLRKRGQGVGILVSKHPKDTCASYSLQEPAEVMEFLLRLVEWE  358



>ref|XP_010531388.1| PREDICTED: probable trehalose-phosphate phosphatase H [Tarenaya 
hassleriana]
Length=329

 Score =   451 bits (1160),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 221/299 (74%), Positives = 247/299 (83%), Gaps = 11/299 (4%)
 Frame = +1

Query  379   VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +SSWVDSMR+SSPT   +       +WM +HPSAL+MFE+II AS+GK IVMFLDYDGTL
Sbjct  35    ISSWVDSMRSSSPTHLKS--FGRQSSWMTEHPSALEMFEEIIHASEGKQIVMFLDYDGTL  92

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIV+DPD AFMS  MR TVR LA  F TAIVSGRC +KVY+FV+L ELYYAGSHGMDIK
Sbjct  93    SPIVNDPDRAFMSKKMRRTVRNLAKCFFTAIVSGRCREKVYNFVKLTELYYAGSHGMDIK  152

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GP  GS         +L QPA+EFLPMIDEVYK L+E+T +TPG KVENNKFCVSVHFRC
Sbjct  153   GPENGS---------LLCQPATEFLPMIDEVYKKLVEKTKTTPGSKVENNKFCVSVHFRC  203

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE  W ELA QVRSVLK+YPKLRLTQGRKV EIRPII+WDKGKALEFLLESLG+AN  D
Sbjct  204   VDENMWSELAHQVRSVLKDYPKLRLTQGRKVFEIRPIIKWDKGKALEFLLESLGFANCKD  263

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEW  1275
             VFP+YIGDDRTDEDAFK LRE  QG GILVSK PK+T A+YSLQ+P+EVM FL+RLVEW
Sbjct  264   VFPLYIGDDRTDEDAFKKLRERGQGLGILVSKFPKETSATYSLQDPNEVMDFLQRLVEW  322



>ref|XP_003543766.1| PREDICTED: probable trehalose-phosphate phosphatase I [Glycine 
max]
 gb|KHN19585.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=372

 Score =   452 bits (1163),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 252/314 (80%), Gaps = 3/314 (1%)
 Frame = +1

Query  343   LQNLDVNGAAAKV-SSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASK  516
             L++  VN    KV ++W+DSMRASSPT+ KST   D    W + HPSAL MF+QI+  SK
Sbjct  51    LEDGSVNKGGTKVINTWIDSMRASSPTRVKSTQNQDPTSPWTLYHPSALSMFDQIVCESK  110

Query  517   GKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRL  696
             GK IV FLDYDGTLSPIV DPD A+MS  MR T++ LA +FPTAIVSGRC DKVY+FVRL
Sbjct  111   GKQIVTFLDYDGTLSPIVADPDKAYMSKKMRTTLKDLARHFPTAIVSGRCLDKVYNFVRL  170

Query  697   AELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVK  876
             AELYYAGSHGMDIKGP+     KK   E VLFQPASEFLPMI+EVY  L+E+T S PG K
Sbjct  171   AELYYAGSHGMDIKGPTNKRSTKK-ENEQVLFQPASEFLPMINEVYNILVEKTKSVPGAK  229

Query  877   VENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKAL  1056
             VENNKFC+SVHFRCVDE  W  LA+QV  VL EYPKL+LTQGRKVLEIRP I+WDKGKAL
Sbjct  230   VENNKFCLSVHFRCVDEKSWVSLAEQVSFVLNEYPKLKLTQGRKVLEIRPTIKWDKGKAL  289

Query  1057  EFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEP  1236
             EFLLESLGYANS +VFP+YIGDDRTDEDAFKVLR    G GILVSK+PK+T ASY+LQ+P
Sbjct  290   EFLLESLGYANSDNVFPIYIGDDRTDEDAFKVLRRRGHGVGILVSKIPKETDASYTLQDP  349

Query  1237  SEVMLFLRRLVEWK  1278
             +EV  FLR LVEWK
Sbjct  350   TEVGQFLRHLVEWK  363



>gb|AAZ67593.1| 80A08_8 [Brassica rapa subsp. pekinensis]
Length=365

 Score =   452 bits (1162),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 220/315 (70%), Positives = 260/315 (83%), Gaps = 5/315 (2%)
 Frame = +1

Query  313   NFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLS---DDH-RTWMMQHPS  477
             N   ++ K LL+NL++     +V++WVDSMRASSPT  KS P S   + H  +W+MQHPS
Sbjct  28    NNSSSAQKTLLKNLEIINGGQRVNAWVDSMRASSPTHLKSLPSSVSSEKHLSSWIMQHPS  87

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             AL+MFE+I +AS GK IVMFLDYDGTLSPIVDDPD AFMS  MR TV+KLA  FPTAIV+
Sbjct  88    ALEMFEKITQASGGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFPTAIVT  147

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC DKVY+FV+LAELYYAGSHGMDIKGP++G    K  ++ +L+QPAS++LPMIDEVYK
Sbjct  148   GRCIDKVYNFVKLAELYYAGSHGMDIKGPAKGFSRHKRVKQSLLYQPASDYLPMIDEVYK  207

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              LLE+T STPGV VEN+KF  SVHFRCV+E KW EL  QVRSVL++YP L+L+QGRKV E
Sbjct  208   QLLEKTKSTPGVIVENHKFTASVHFRCVEEKKWSELVLQVRSVLEKYPTLKLSQGRKVFE  267

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRP+I+WDKGKALEFLLESLG+ NS +VFPVYIGDDRTDEDAFK+LR   +GFGILVSK 
Sbjct  268   IRPMIDWDKGKALEFLLESLGFGNSNNVFPVYIGDDRTDEDAFKMLRVRGEGFGILVSKF  327

Query  1198  PKDTHASYSLQEPSE  1242
             PKDT ASYSLQ+PSE
Sbjct  328   PKDTDASYSLQDPSE  342



>ref|XP_010321466.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X2 [Solanum lycopersicum]
Length=329

 Score =   450 bits (1158),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 219/302 (73%), Positives = 245/302 (81%), Gaps = 20/302 (7%)
 Frame = +1

Query  352   LDVNGAAAKVSSWVDSMRASSPTQK-STPLSDDHRTWMMQHPSALDMFEQIIKASKGKNI  528
             +++NG    + SW+DSMRASSPT   ST L +D  +WM+ HPSA+DMFE II  SKGK I
Sbjct  45    VEINGDPKIMKSWIDSMRASSPTHHMSTTLYEDKTSWMVHHPSAVDMFEDIISVSKGKKI  104

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA YFPTAIVSGRC DKVY+FV+L+ELY
Sbjct  105   VMFLDYDGTLSPIVDDPDQAFMSHDMRGTVRKLARYFPTAIVSGRCRDKVYNFVQLSELY  164

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGPS+GSKY K                   +VYK LL++T S  GV+VENN
Sbjct  165   YAGSHGMDIKGPSKGSKYSK-------------------KVYKELLDKTKSIEGVRVENN  205

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFCVSVHFRCVDE KWGEL+Q+VR VLKEYPKL+L QGRKVLEIRPII+WDKGKAL+FLL
Sbjct  206   KFCVSVHFRCVDEKKWGELSQEVRLVLKEYPKLKLCQGRKVLEIRPIIKWDKGKALQFLL  265

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             +SLGYA   DVFP+YIGDDRTDEDAFKVLRE RQG GILVSK PK+THASYSLQEPSEV 
Sbjct  266   QSLGYAKCNDVFPIYIGDDRTDEDAFKVLRERRQGLGILVSKTPKETHASYSLQEPSEVR  325

Query  1249  LF  1254
             +F
Sbjct  326   IF  327



>ref|XP_010105898.1| Trehalose-phosphate phosphatase [Morus notabilis]
 gb|EXC06717.1| Trehalose-phosphate phosphatase [Morus notabilis]
Length=358

 Score =   451 bits (1160),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 231/347 (67%), Positives = 263/347 (76%), Gaps = 29/347 (8%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSP  417
              VAV++ + F +A       PGG I    T  +  LQ L+  G  A++S+WVDSMRASSP
Sbjct  17    AVAVANQSLFSSA-------PGGCI----TISRNKLQRLETGGGGARISAWVDSMRASSP  65

Query  418   --TQKSTPLSD------DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVD  573
               T KS   S+      +  +W ++HPSAL MFEQI  ASKGK IVMFLDYDGTLSPIV+
Sbjct  66    PRTTKSITSSNLISQDEEKSSWTLRHPSALSMFEQITNASKGKQIVMFLDYDGTLSPIVE  125

Query  574   DPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG  753
             DPD A+MS+ MR  VR +A YFPTAIVSGRC DKVYSFVRLAELYYAGSHGMDIKGPS+ 
Sbjct  126   DPDRAYMSNEMRKAVRAVARYFPTAIVSGRCRDKVYSFVRLAELYYAGSHGMDIKGPSKC  185

Query  754   SKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELK  933
             SKYK G  E VL QPA+EFLPM+DEVYK LLE+T S PG +VE+NKFC+S          
Sbjct  186   SKYKNG-NESVLCQPATEFLPMVDEVYKILLEKTKSIPGSRVEHNKFCIS---------S  235

Query  934   WGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVY  1113
             W  LA+QVR V+ EYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLGYANS +V PVY
Sbjct  236   WAALAEQVRLVINEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYANSNEVLPVY  295

Query  1114  IGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLF  1254
             IGDDRTDEDAFKVLRE  QGFGILVSK+PK+T ASYSLQEPSE  + 
Sbjct  296   IGDDRTDEDAFKVLRERGQGFGILVSKVPKETSASYSLQEPSEARIL  342



>gb|EYU23217.1| hypothetical protein MIMGU_mgv1a023678mg [Erythranthe guttata]
Length=340

 Score =   450 bits (1157),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/332 (66%), Positives = 265/332 (80%), Gaps = 7/332 (2%)
 Frame = +1

Query  283   KPPV-VPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTW  459
             KP + V GGY+     + K+LL+NL+  G  A +++ +DSMRASSPT+     + DH +W
Sbjct  7     KPAIPVAGGYL-----TRKKLLKNLETIGNGAMINALLDSMRASSPTRGGPYDAQDHNSW  61

Query  460   MMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYF  639
             +++HPSAL  FE+I  ASKGK IV+FLDYDGTLSPIV+DPD AF+++ MR  V+ +A  F
Sbjct  62    IVRHPSALTEFEEITSASKGKQIVVFLDYDGTLSPIVNDPDRAFITNEMREAVKNVAENF  121

Query  640   PTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPM  819
             PTAIVSGRC  KVY+FVRL+ELYYAGSHGMDIKGPS+G +  KG  + V+ QPA EFLPM
Sbjct  122   PTAIVSGRCRTKVYNFVRLSELYYAGSHGMDIKGPSKGHRQTKG-NQTVMCQPAREFLPM  180

Query  820   IDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQ  999
             IDEVYK+L+E+    PG  VE+NKFC+SVH+RCV+E +W ELA QV+ V+K YP LRL+Q
Sbjct  181   IDEVYKSLVEKVRYIPGSNVEHNKFCLSVHYRCVEEKRWCELADQVKRVVKNYPMLRLSQ  240

Query  1000  GRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFG  1179
             GRKV EIRP I+WDKG ALEFLLESLGYA S DVFPVYIGDDRTDEDAFKVLR   QG G
Sbjct  241   GRKVFEIRPTIKWDKGNALEFLLESLGYAESDDVFPVYIGDDRTDEDAFKVLRVREQGVG  300

Query  1180  ILVSKLPKDTHASYSLQEPSEVMLFLRRLVEW  1275
             ILVSK PK+T+A+YSLQEPSEVM FL+RLVEW
Sbjct  301   ILVSKAPKETNATYSLQEPSEVMHFLKRLVEW  332



>ref|XP_003574465.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Brachypodium 
distachyon]
Length=365

 Score =   451 bits (1160),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/362 (63%), Positives = 272/362 (75%), Gaps = 18/362 (5%)
 Frame = +1

Query  223   MTRHNVVA-----VSDPNRFPTAGHKPP-VVPGGYINFDVTSGKELLQNLDVNGAAAKVS  384
             MT+ +VV         PN      + PP  +PG      V   K+ LQ   +   +  ++
Sbjct  1     MTKQSVVVPELALAMPPNSAALYPYPPPRAMPG------VAVRKKYLQA-QMELGSGLIN  53

Query  385   SWVDSMRASSPTQKSTP-----LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYD  549
              WV+SMRASSPT          + DDH  WM++HPSAL  F+QI+ ASKGK IVMFLDYD
Sbjct  54    GWVESMRASSPTHAKAAAALAAVDDDHTAWMVKHPSALSKFDQIVAASKGKRIVMFLDYD  113

Query  550   GTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGM  729
             GTLSPIVDDPD+AFMSD MR  VR +A  FPTAIVSGRC DKV+ FV+LAELYYAGSHGM
Sbjct  114   GTLSPIVDDPDAAFMSDTMRLAVRSVARQFPTAIVSGRCRDKVFDFVKLAELYYAGSHGM  173

Query  730   DIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVH  909
             DIKGP++ S++ K   + VLFQPASEFLPMI++V+++L+E+T    G KVENNKFCVSVH
Sbjct  174   DIKGPAKASRHTKAKAKGVLFQPASEFLPMIEQVHESLMEKTKCIAGSKVENNKFCVSVH  233

Query  910   FRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYAN  1089
             FRCVDE  W  LA  V++VLK+YPKL+LTQGRKVLEIRP I+WDKGKALEFLLESLG+A+
Sbjct  234   FRCVDEKDWSPLADIVKAVLKDYPKLKLTQGRKVLEIRPTIKWDKGKALEFLLESLGFAD  293

Query  1090  STDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLV  1269
              ++V PVYIGDDRTDEDAFKVLR+  QG GILVSK  KDT+ASYSLQEP+EVM FL RLV
Sbjct  294   CSNVLPVYIGDDRTDEDAFKVLRKRGQGIGILVSKHAKDTNASYSLQEPAEVMEFLLRLV  353

Query  1270  EW  1275
             EW
Sbjct  354   EW  355



>emb|CDY14544.1| BnaC03g49150D [Brassica napus]
Length=454

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 225/342 (66%), Positives = 278/342 (81%), Gaps = 11/342 (3%)
 Frame = +1

Query  235   NVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG-AAAKVSSWVDSMRAS  411
              V  VS+ + F  +  KPP  PG +I+    S K+LL++L+++G  + +++SWVDSMRAS
Sbjct  84    TVSTVSNSSVFTPSAQKPPTAPG-HISI---SKKKLLKSLEISGDQSQRLNSWVDSMRAS  139

Query  412   SPTQ-KSTPL---SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT  KS P     ++  +WM +HPSALDMFE+I +AS+GK IVMFLDYDGTLSPIV DP
Sbjct  140   SPTHLKSLPSLSSQEELNSWMKRHPSALDMFERITEASRGKEIVMFLDYDGTLSPIVADP  199

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-S  756
             D AF+S  MR TV+KLA  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S
Sbjct  200   DRAFISSKMRRTVKKLAKCFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFS  259

Query  757   KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKW  936
             +Y K  +  VL+QPA +FLPMIDE +K L+E+T STPG KVENNKFC+SVHFRCVDE KW
Sbjct  260   RYNKD-KPSVLYQPAGDFLPMIDEAFKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKW  318

Query  937   GELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYI  1116
              ELA +VRSV+K YP L+L+QGRKV EIRP+++WDKGKALEFLLESLG+ NS+DVFP+YI
Sbjct  319   SELALKVRSVVKNYPTLKLSQGRKVFEIRPMVKWDKGKALEFLLESLGFDNSSDVFPIYI  378

Query  1117  GDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSE  1242
             GDDRTDEDAFK+L+E  QG G+LV+K PKDT+ASYSLQ+P E
Sbjct  379   GDDRTDEDAFKLLQERGQGLGLLVTKFPKDTNASYSLQDPLE  420



>emb|CDY31283.1| BnaA02g34580D [Brassica napus]
Length=375

 Score =   450 bits (1158),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/341 (65%), Positives = 270/341 (79%), Gaps = 9/341 (3%)
 Frame = +1

Query  238   VVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSP  417
             ++ VS+ + F  +  KPP VPG   +  ++  K L         + +++SWVDSMRASSP
Sbjct  15    IITVSNSSVFAPSAQKPPTVPG---HISISKKKLLKNLELSGAQSQRLNSWVDSMRASSP  71

Query  418   TQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDS  585
             T      S    D+  +W+ +HPSALDMFE+II+AS+GK IVMFLDYDGTLSPIV DPD 
Sbjct  72    THLKSLSSLSSEDELNSWLKRHPSALDMFERIIEASRGKQIVMFLDYDGTLSPIVADPDR  131

Query  586   AFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SKY  762
             AF++  MR TV+KLA  FPT+IV+GRC DKVYSFV+LAELYYAGSHGMDIKGP++G S+Y
Sbjct  132   AFITSKMRRTVKKLAKSFPTSIVTGRCIDKVYSFVKLAELYYAGSHGMDIKGPTKGFSRY  191

Query  763   KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGE  942
              K  +  VL+QPA +FLPMIDEV+K L+E+T STPG KVENNKFC+SVHFRCVDE KW +
Sbjct  192   NKD-KPSVLYQPAGDFLPMIDEVFKQLVEKTKSTPGAKVENNKFCLSVHFRCVDEKKWSD  250

Query  943   LAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGD  1122
             LA +VRSV+K YP L+L+QGRKV EIRP+I+WDKGKALEFLLESLG+ NS DVFP+YIGD
Sbjct  251   LALKVRSVVKNYPTLKLSQGRKVFEIRPMIKWDKGKALEFLLESLGFENSNDVFPIYIGD  310

Query  1123  DRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             DRTDEDAFK+L+E  QGFGILVS+ PKDT+ASYSLQ+P E 
Sbjct  311   DRTDEDAFKLLQERGQGFGILVSEFPKDTNASYSLQDPPEA  351



>ref|XP_006294548.1| hypothetical protein CARUB_v10023582mg [Capsella rubella]
 gb|EOA27446.1| hypothetical protein CARUB_v10023582mg [Capsella rubella]
Length=336

 Score =   447 bits (1150),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/320 (70%), Positives = 254/320 (79%), Gaps = 5/320 (2%)
 Frame = +1

Query  322   VTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLS-DDHRTWMMQHPSALDMFEQ  498
             V  G +  ++   N     + SWV+SMRA SPT+   P S +    W+ +HPSAL+MFE 
Sbjct  15    VVGGDDGDKSPGTNERGGLIKSWVNSMRACSPTR---PKSFNSQSCWIKEHPSALNMFED  71

Query  499   IIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKV  678
             I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC +KV
Sbjct  72    ILHQSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREKV  131

Query  679   YSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTS  858
              SFV+L ELYYAGSHGMDIKGP +GSKY K   + +L QPA+EFLP+I+EVY+ L+E+T 
Sbjct  132   SSFVKLTELYYAGSHGMDIKGPEKGSKYIK-ENQSLLCQPATEFLPVINEVYEKLVEKTK  190

Query  859   STPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEW  1038
             S  G KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLEIRPII+W
Sbjct  191   SIQGAKVENNKFCASVHFRCVEEDKWSDLAHQVRSVLKNYPKLMLTQGRKVLEIRPIIKW  250

Query  1039  DKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHAS  1218
             DKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ RQG GILVSK  K+T+AS
Sbjct  251   DKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKRQGLGILVSKYAKETNAS  310

Query  1219  YSLQEPSEVMLFLRRLVEWK  1278
             YSLQEP EVM FL RLVE K
Sbjct  311   YSLQEPDEVMDFLERLVESK  330



>ref|NP_001048143.1| Os02g0753000 [Oryza sativa Japonica Group]
 sp|Q6ZGP8.1|TPP4_ORYSJ RecName: Full=Probable trehalose-phosphate phosphatase 4; Short=OsTPP4; 
AltName: Full=Trehalose 6-phosphate phosphatase [Oryza 
sativa Japonica Group]
 dbj|BAD15563.1| putative trehalose-6-phosphate phosphatase [Oryza sativa Japonica 
Group]
 dbj|BAF10057.1| Os02g0753000 [Oryza sativa Japonica Group]
 dbj|BAH00277.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57820.1| hypothetical protein OsJ_08413 [Oryza sativa Japonica Group]
Length=367

 Score =   448 bits (1152),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 247/302 (82%), Gaps = 9/302 (3%)
 Frame = +1

Query  379   VSSWVDSMRASSPTQKSTPLSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDG  552
              +SW D+MRASSPT+ S   SD  +   W+ +HPSAL  FE+I   S+GK IVMF+DYDG
Sbjct  59    CTSWADAMRASSPTRSSRSASDVDEFTAWVRKHPSALSKFEEIAAKSRGKKIVMFMDYDG  118

Query  553   TLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMD  732
             TLSPIV DPD+A+MSD MRA VR++A  FPTAIVSGRC DKV +FV L++LYYAGSHGMD
Sbjct  119   TLSPIVADPDTAYMSDAMRAAVREVAKTFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMD  178

Query  733   IKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHF  912
             IKGPS          E  L QPASEFLPMIDEVYKTL+E+T STPG KVENNKFC+SVHF
Sbjct  179   IKGPSSNP-------ESALCQPASEFLPMIDEVYKTLVEKTKSTPGAKVENNKFCLSVHF  231

Query  913   RCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANS  1092
             RCVDE +W  L +QV++V+KEYPKL+LTQGRKVLEIRP IEWDKGKALEFLLESLG+AN 
Sbjct  232   RCVDEKRWNALGEQVKAVIKEYPKLKLTQGRKVLEIRPSIEWDKGKALEFLLESLGFANC  291

Query  1093  TDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVE  1272
              DV PVYIGDDRTDEDAFKVLR+  QG GILVSK PKDT+ASYSLQ+P+EVM FL RLVE
Sbjct  292   GDVMPVYIGDDRTDEDAFKVLRKRGQGLGILVSKCPKDTNASYSLQDPTEVMEFLLRLVE  351

Query  1273  WK  1278
             WK
Sbjct  352   WK  353



>ref|XP_003544198.1| PREDICTED: probable trehalose-phosphate phosphatase 4-like [Glycine 
max]
 gb|KHN21829.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=379

 Score =   448 bits (1152),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 254/321 (79%), Gaps = 7/321 (2%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKV-SSWVDSMRASSPTQKSTPLSDDHRT-----WMMQHPSALDMFE  495
             ++ L++  VN    KV ++W+DSMRASSPT+ +    ++        W + HPSAL MF+
Sbjct  48    RKTLEDGSVNKGGNKVINTWIDSMRASSPTRSAKSTQNNQNQDPTSPWTLYHPSALSMFD  107

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
              I+  SKGK IV FLDYDGTLSPIV DPD A+MS  MRAT++ LA +FPTAIVSGRC DK
Sbjct  108   HIVCESKGKQIVTFLDYDGTLSPIVADPDKAYMSKKMRATLKDLARHFPTAIVSGRCLDK  167

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             VY+FVRLAELYYAGSHGMDIKGP+     KKG E+ VLFQPASEFLPMI+EVY  L+E+T
Sbjct  168   VYNFVRLAELYYAGSHGMDIKGPTNKRSTKKGNEQ-VLFQPASEFLPMINEVYNILVEKT  226

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
              S PG KVENNKFC+SVHFRCVDE  W  L +QV  VL EYPKL+LTQGRKVLEIRP I+
Sbjct  227   KSVPGAKVENNKFCLSVHFRCVDEKNWASLGEQVSLVLNEYPKLKLTQGRKVLEIRPAIK  286

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLGYANS +VFP++IGDDRTDEDAFKVLR   QG GILVSK+ K+T A
Sbjct  287   WDKGKALEFLLESLGYANSDNVFPIFIGDDRTDEDAFKVLRRRGQGIGILVSKITKETDA  346

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             SY+LQ+P+EV  FLR +VEWK
Sbjct  347   SYTLQDPTEVGQFLRHMVEWK  367



>ref|XP_002454258.1| hypothetical protein SORBIDRAFT_04g027650 [Sorghum bicolor]
 gb|EES07234.1| hypothetical protein SORBIDRAFT_04g027650 [Sorghum bicolor]
Length=359

 Score =   446 bits (1148),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 216/299 (72%), Positives = 247/299 (83%), Gaps = 8/299 (3%)
 Frame = +1

Query  385   SWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             +WVD+MRASSPT+ ++    D+   WM +HPSAL  FEQI  ASKGK +VMFLDYDGTLS
Sbjct  55    TWVDAMRASSPTRSRAAADVDEFTAWMRKHPSALAKFEQIASASKGKKVVMFLDYDGTLS  114

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIV DPD+A+MSD MRA VR +A +FPTAIVSGRC DKV +FV L+ELYYAGSHGMDIKG
Sbjct  115   PIVADPDAAYMSDAMRAAVRDVAKHFPTAIVSGRCRDKVRNFVDLSELYYAGSHGMDIKG  174

Query  742   PSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCV  921
             PS          E VL QPASEFLP+IDEVYK L+E+T STPG KVENNKFC+SVHFRCV
Sbjct  175   PSSNP-------ESVLCQPASEFLPVIDEVYKALVEKTKSTPGAKVENNKFCLSVHFRCV  227

Query  922   DELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDV  1101
             DE +W  LA+QV++V+K+YPKL+LTQGRKVLEIRP I WDKGKALEFLLESLG+AN +DV
Sbjct  228   DEKRWNALAEQVKAVIKDYPKLKLTQGRKVLEIRPSIMWDKGKALEFLLESLGFANCSDV  287

Query  1102  FPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              PVYIGDDRTDEDAFKVLR+  QG GILVSK PK+T+ASYSLQ+P EVM FL RL EWK
Sbjct  288   LPVYIGDDRTDEDAFKVLRKRGQGIGILVSKCPKETNASYSLQDPGEVMDFLLRLAEWK  346



>gb|EEC71779.1| hypothetical protein OsI_04393 [Oryza sativa Indica Group]
Length=367

 Score =   446 bits (1148),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 216/302 (72%), Positives = 247/302 (82%), Gaps = 9/302 (3%)
 Frame = +1

Query  379   VSSWVDSMRASSPTQKSTPLSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDG  552
              +SW D+MRASSPT+ S   SD  +   W+ +HPSAL  FE+I   S+GK IVMF+DYDG
Sbjct  59    CTSWADAMRASSPTRSSRSASDVDEFTAWVRKHPSALSKFEEIAAKSRGKKIVMFMDYDG  118

Query  553   TLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMD  732
             TLSPIV DPD+A+MSD MRA VR++A  FPTAIVSGRC DKV +FV L++LYYAGSHGMD
Sbjct  119   TLSPIVADPDTAYMSDAMRAAVREVAKTFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMD  178

Query  733   IKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHF  912
             IKGPS          E  L QPASEFLPMIDEVYKTL+E+T STPG KVENNKFC+SVHF
Sbjct  179   IKGPSSNP-------ESALCQPASEFLPMIDEVYKTLVEKTKSTPGAKVENNKFCLSVHF  231

Query  913   RCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANS  1092
             RCVDE +W  L +QV++V+KEYPKL+LTQGRKVLEIRP I+WDKGKALEFLLESLG+AN 
Sbjct  232   RCVDEKRWNALGEQVKAVIKEYPKLKLTQGRKVLEIRPSIKWDKGKALEFLLESLGFANC  291

Query  1093  TDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVE  1272
              DV PVYIGDDRTDEDAFKVLR+  QG GILVSK PKDT+ASYSLQ+P+EVM FL RLVE
Sbjct  292   GDVLPVYIGDDRTDEDAFKVLRKRGQGLGILVSKCPKDTNASYSLQDPTEVMEFLLRLVE  351

Query  1273  WK  1278
             WK
Sbjct  352   WK  353



>ref|XP_011074162.1| PREDICTED: probable trehalose-phosphate phosphatase H [Sesamum 
indicum]
Length=364

 Score =   446 bits (1148),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 262/315 (83%), Gaps = 4/315 (1%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKAS  513
             K+LL+ L+  G  A +++++DSMRASSPT++S+  ++   +W ++HPSAL MFE+I+ AS
Sbjct  40    KKLLKKLESYGNDAGINAFLDSMRASSPTRRSSD-AEHQDSWTLRHPSALSMFEEIMDAS  98

Query  514   KGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVR  693
             KGK IV+FLDYDGTLSPIVDDPD AFM+  MR  VR +A  FPTAIVSGRC  KVY+FV+
Sbjct  99    KGKQIVVFLDYDGTLSPIVDDPDRAFMTSEMREAVRDVAKLFPTAIVSGRCRAKVYNFVK  158

Query  694   LAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGV  873
             L+ELYYAGSHGMDIKGP++G  ++KG  + VL QPA +FLPMIDEVYK L+E+    PG 
Sbjct  159   LSELYYAGSHGMDIKGPAKG--HRKG-NQTVLCQPARKFLPMIDEVYKCLIEKIEHIPGA  215

Query  874   KVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKA  1053
             KVENNKFC+SVH+RCV+E +WGELA QV+SV+K+Y +LRL+QGRKVLEIRP I+WDKG A
Sbjct  216   KVENNKFCLSVHYRCVEEKRWGELADQVKSVIKDYQQLRLSQGRKVLEIRPTIKWDKGNA  275

Query  1054  LEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQE  1233
             LEFLLESLGYA + DVFPVYIGDDRTDEDAFKVLR   QG GILVSK PK+T+A Y+L+E
Sbjct  276   LEFLLESLGYAETNDVFPVYIGDDRTDEDAFKVLRNRGQGIGILVSKSPKETNAPYTLKE  335

Query  1234  PSEVMLFLRRLVEWK  1278
             PSEVM FL+ LVEWK
Sbjct  336   PSEVMQFLKGLVEWK  350



>ref|XP_004973406.1| PREDICTED: probable trehalose-phosphate phosphatase 6-like [Setaria 
italica]
Length=384

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 251/305 (82%), Gaps = 8/305 (3%)
 Frame = +1

Query  388   WVDSMRASSPTQKSTPLS-------DDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDY  546
             WV+SMRASSPT      +       + H +WM++HPSAL  F+Q++ ASKGK IV+FLDY
Sbjct  71    WVESMRASSPTHARAAAALAAGVDVERHASWMVEHPSALSKFDQVVAASKGKQIVVFLDY  130

Query  547   DGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHG  726
             DGTLSPIVDDPD+A+MSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHG
Sbjct  131   DGTLSPIVDDPDAAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHG  190

Query  727   MDIKGPSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVS  903
             MDIKGP +GS++ K A+ + VLFQPAS+FLPMI++V+++L+E+T S PG KVENNKFCVS
Sbjct  191   MDIKGPVKGSRHTKAAKAKGVLFQPASQFLPMIEQVHESLVEKTKSIPGAKVENNKFCVS  250

Query  904   VHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGY  1083
             VHFRCVDE  W  LA  V+SVLK+YPKL+LTQGR V E+RP I+WDKGKALEFLLESLG+
Sbjct  251   VHFRCVDEKSWSALADTVKSVLKDYPKLKLTQGRMVFEVRPTIKWDKGKALEFLLESLGF  310

Query  1084  ANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRR  1263
             A+  DV PVYIGDDRTDEDAFKVLR   QG GILVSK PKDT ASYSLQEP+EVM FL R
Sbjct  311   ADCADVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKDTSASYSLQEPAEVMEFLLR  370

Query  1264  LVEWK  1278
             LVEW+
Sbjct  371   LVEWE  375



>ref|XP_004953949.1| PREDICTED: probable trehalose-phosphate phosphatase 4-like [Setaria 
italica]
Length=363

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/299 (72%), Positives = 247/299 (83%), Gaps = 8/299 (3%)
 Frame = +1

Query  385   SWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             +W D+MRASSPT+ ++    D+   WM +HPSAL  FEQI  +SKGK IVMFLDYDGTLS
Sbjct  55    TWADAMRASSPTRSRAAADVDEFTAWMRKHPSALGKFEQIASSSKGKKIVMFLDYDGTLS  114

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIV DPD+A+MSD MR+ VR +A YFPTAIVSGRC DKV +FV L+ELYYAGSHGMDIKG
Sbjct  115   PIVADPDAAYMSDAMRSAVRDVAKYFPTAIVSGRCRDKVRNFVGLSELYYAGSHGMDIKG  174

Query  742   PSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCV  921
             PS          E VL QPASEFLP+IDEVYK L+E+T STPG KVENNKFC+SVHFRCV
Sbjct  175   PSSNP-------ESVLCQPASEFLPVIDEVYKLLVEKTKSTPGAKVENNKFCLSVHFRCV  227

Query  922   DELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDV  1101
             DE +W  LA+QV++V+K+YPKL+LTQGRKVLEIRP I WDKGKALEFLLESLG+AN +DV
Sbjct  228   DEKRWNALAEQVKAVIKDYPKLKLTQGRKVLEIRPSIMWDKGKALEFLLESLGFANCSDV  287

Query  1102  FPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              PVYIGDDRTDEDAFKVLR+  QG GILVSK PK+T+ASYSLQ+P EVM FL RLVEWK
Sbjct  288   LPVYIGDDRTDEDAFKVLRKRGQGLGILVSKCPKETNASYSLQDPGEVMDFLLRLVEWK  346



>ref|NP_001142999.1| uncharacterized protein LOC100275460 [Zea mays]
 gb|ACG28191.1| hypothetical protein [Zea mays]
Length=372

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 269/352 (76%), Gaps = 18/352 (5%)
 Frame = +1

Query  256   PNRFPTAGHKPP-VVPGGYINFDVTSGKELLQ---NLDVNGAAAKVSSWVDSMRASSPTQ  423
             PN  P   + PP   PG      V   K+ LQ    + V   A ++  WV+SMRASSPT 
Sbjct  19    PNSAPLFQYPPPRAAPG------VAVRKKCLQMGAGVGVGAGAGRIGGWVESMRASSPTH  72

Query  424   KSTPL-------SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPD  582
                          + +  WM++HPSAL MF+Q+++ASKGK IV+FLDYDGTLSPIVDDPD
Sbjct  73    AKAAAALAAGVEEERYAAWMVKHPSALAMFDQLVEASKGKQIVVFLDYDGTLSPIVDDPD  132

Query  583   SAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKY  762
             +A+MSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGMDIKGP++GS++
Sbjct  133   AAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDIKGPAKGSRH  192

Query  763   KKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGE  942
              K A+  VLFQPAS+FLPMI++V+ +L+E+T   PG KVENNKFCVSVHFRCVDE  W  
Sbjct  193   TK-AKGGVLFQPASQFLPMIEQVHDSLVEKTKCIPGAKVENNKFCVSVHFRCVDEKSWIT  251

Query  943   LAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGD  1122
             LA  V+SVLK+YPKL+LTQGR V E+RP I+WDKGKALEFLLESLGYA+ TDV PVYIGD
Sbjct  252   LADMVKSVLKDYPKLKLTQGRMVFEVRPTIKWDKGKALEFLLESLGYADCTDVLPVYIGD  311

Query  1123  DRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DRTDEDAFKVLR+  QG GILVSK PKDT ASYSLQEP+EVM FL RLVEW+
Sbjct  312   DRTDEDAFKVLRKRGQGVGILVSKHPKDTCASYSLQEPAEVMEFLLRLVEWE  363



>ref|XP_010544184.1| PREDICTED: probable trehalose-phosphate phosphatase D [Tarenaya 
hassleriana]
Length=367

 Score =   445 bits (1144),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 229/364 (63%), Positives = 278/364 (76%), Gaps = 16/364 (4%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVVPG----GYINFDVTSGKELLQNLDVNGAAAKVSSW  390
             MT  NVV     +    A   P   P     GYI+      K+LL+ L+ +    +++SW
Sbjct  1     MTNRNVVMSDAKSGIGFAVKVPVTNPSSSLCGYISI---PRKKLLKKLEADPTRTRINSW  57

Query  391   VDSMRASSPTQK-------STPLSD-DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDY  546
             V+SMRASSPT+        + P S+ +  +W+  HPSAL+MF+ I  ASKGK +VMFLDY
Sbjct  58    VESMRASSPTRSRPGSGNFTIPESEVEEDSWVAHHPSALNMFDDIAHASKGKKVVMFLDY  117

Query  547   DGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHG  726
             DGTLSPIV+DPD AFM++ MR  V+ +A YFPTAIV+GRC DKV SFV+LA LYYAGSHG
Sbjct  118   DGTLSPIVEDPDRAFMTNEMRDAVKDVARYFPTAIVTGRCQDKVRSFVKLAGLYYAGSHG  177

Query  727   MDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSV  906
             MDIKGPS+  K+ K + + VLFQPASEFLPMIDEV+K+L+E+  + PG KVENNKFCVSV
Sbjct  178   MDIKGPSKKKKHNK-SNQGVLFQPASEFLPMIDEVFKSLVEKMKTIPGAKVENNKFCVSV  236

Query  907   HFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYA  1086
             HFRCVD+  WG + ++V S+LKEYPKLR+TQGRKVLEIRP I+WDKGKALEFLLESLG+ 
Sbjct  237   HFRCVDQNHWGVMVEEVGSILKEYPKLRVTQGRKVLEIRPTIKWDKGKALEFLLESLGFT  296

Query  1087  NSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRL  1266
             +S DV P+YIGDDRTDEDAFKVLR+  QGFGILVSK+PK+T A+YSLQEPSEV  FLRRL
Sbjct  297   HSNDVLPIYIGDDRTDEDAFKVLRDRGQGFGILVSKVPKETSATYSLQEPSEVGEFLRRL  356

Query  1267  VEWK  1278
             VEWK
Sbjct  357   VEWK  360



>gb|EMT32785.1| Trehalose-phosphate phosphatase [Aegilops tauschii]
Length=337

 Score =   443 bits (1139),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 214/321 (67%), Positives = 251/321 (78%), Gaps = 9/321 (3%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFE  495
             ++ L+       A  +S  V+SMRASSPT           + D+H  WM +HPSAL  FE
Sbjct  5     RKCLRAAQAELGAGMLSGLVESMRASSPTHARAAAALSAGVDDEHAAWMARHPSALGKFE  64

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+ ASKGK IVMFLDYDGTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DK
Sbjct  65    EIVAASKGKQIVMFLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDK  124

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             V+ FV+LAELYYAGSHGMDIKGP++ SK K    + VLFQPASEFLPMI+EV++ L+E+T
Sbjct  125   VFDFVKLAELYYAGSHGMDIKGPAKSSKSKA---KGVLFQPASEFLPMIEEVHQRLIEET  181

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
                 G KVENNKFCVSVHFRCVDE  WG LA+ V+ V++EYPKLR++QGR V E+RP I+
Sbjct  182   KHVAGAKVENNKFCVSVHFRCVDEKSWGALAETVKGVMREYPKLRMSQGRMVFEVRPTIK  241

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLG+A+  +V PVYIGDDRTDEDAFKVLR   QG GILVSK PKDT A
Sbjct  242   WDKGKALEFLLESLGFADCPNVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKDTSA  301

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             S+SLQEP+EVM FL RLVEWK
Sbjct  302   SFSLQEPAEVMEFLLRLVEWK  322



>ref|XP_004513754.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cicer 
arietinum]
Length=379

 Score =   444 bits (1142),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 250/305 (82%), Gaps = 1/305 (0%)
 Frame = +1

Query  367   AAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLD  543
                KV++W+DSMRASSPT+ K++  + D   W + HPSAL+MF QII  S  K IV+FLD
Sbjct  66    GTTKVNTWIDSMRASSPTRVKNSSENRDQSYWTIFHPSALNMFNQIIYKSNEKQIVVFLD  125

Query  544   YDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSH  723
             YDGTLSPIV DP+ A+MS  MRAT++ ++ +FPTAIVSGRC DK++SFVRLAELYYAGSH
Sbjct  126   YDGTLSPIVADPNRAYMSKKMRATLKNISRHFPTAIVSGRCLDKLFSFVRLAELYYAGSH  185

Query  724   GMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVS  903
             GMDIKGP+     ++G+ + VL QPASEFLPMI+EVYK L+E+T S PG  VENNKFC+S
Sbjct  186   GMDIKGPTNRRSTERGSNDGVLLQPASEFLPMINEVYKILVEKTKSVPGAMVENNKFCLS  245

Query  904   VHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGY  1083
             VHFRCVDE  W  LA+QV  VL EYPKL+LTQGRKVLEIRP I+WDKG+ALEFLLESLG+
Sbjct  246   VHFRCVDEKSWATLAEQVSLVLNEYPKLKLTQGRKVLEIRPTIKWDKGRALEFLLESLGF  305

Query  1084  ANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRR  1263
             ANS +VFP+YIGDDRTDEDAFKVLR   QG GILVSK+ K+T+ASY+LQ+P+EV  FLR 
Sbjct  306   ANSNNVFPIYIGDDRTDEDAFKVLRNKGQGIGILVSKIAKETNASYTLQDPTEVGQFLRH  365

Query  1264  LVEWK  1278
             LV+WK
Sbjct  366   LVDWK  370



>gb|EAZ42700.1| hypothetical protein OsJ_27268 [Oryza sativa Japonica Group]
Length=310

 Score =   441 bits (1134),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/301 (70%), Positives = 244/301 (81%), Gaps = 8/301 (3%)
 Frame = +1

Query  400   MRASSPTQKSTP--------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGT  555
             MRASSPT             + D+   WM++HPSAL  FEQI+ ASKGK IVMFLDYDGT
Sbjct  1     MRASSPTHAKAAAALAAAGAVDDERAAWMVRHPSALSKFEQIVAASKGKKIVMFLDYDGT  60

Query  556   LSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDI  735
             LSPIVDDPDSAFMSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGMDI
Sbjct  61    LSPIVDDPDSAFMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDI  120

Query  736   KGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFR  915
             KGP++ S++ K   + VLFQPASEFLPMI++V+ +L+E+T   PG KVENNKFCVSVHFR
Sbjct  121   KGPAKASRHNKAKAKGVLFQPASEFLPMIEQVHDSLIERTKCIPGAKVENNKFCVSVHFR  180

Query  916   CVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANST  1095
             CVDE  W  LA  V++ LK+YPKL+LTQGR V EIRP I+WDKGKALEFLLESLG+A+ T
Sbjct  181   CVDEKSWSTLADIVKAELKDYPKLKLTQGRMVFEIRPTIKWDKGKALEFLLESLGFADCT  240

Query  1096  DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEW  1275
             +V PVYIGDDRTDEDAFKVLR+  QG GILVSK PKDT+ASYSLQEP+EVM FL RLVEW
Sbjct  241   NVLPVYIGDDRTDEDAFKVLRKRGQGIGILVSKYPKDTNASYSLQEPAEVMEFLLRLVEW  300

Query  1276  K  1278
             +
Sbjct  301   E  301



>ref|XP_010059987.1| PREDICTED: probable trehalose-phosphate phosphatase C [Eucalyptus 
grandis]
 gb|KCW66492.1| hypothetical protein EUGRSUZ_F00298 [Eucalyptus grandis]
Length=384

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 235/371 (63%), Positives = 271/371 (73%), Gaps = 24/371 (6%)
 Frame = +1

Query  202   TRLAEEKMTRHNVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKV  381
              R++   +   NV  V DP   P    +       ++  +   G  L++        A+V
Sbjct  18    VRVSNPTLNFINVPIVRDPKLIPRGLPR-----NKHLKIESNGGGHLVRE-------ARV  65

Query  382   SSWVDSMRASSPTQKSTP--------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMF  537
             S+ +DSMRASSP +            L D+ ++W+ +HPSAL MFEQI +AS GK IVMF
Sbjct  66    STLLDSMRASSPARARPASAATRAASLDDEQKSWIQRHPSALSMFEQITRASVGKKIVMF  125

Query  538   LDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAG  717
             LDYDGTLSPIV+DPD AFMSD MR  VR  A++FPTAIVSGRC DKVYSFV+L ELYYAG
Sbjct  126   LDYDGTLSPIVEDPDRAFMSDEMREAVRDTASFFPTAIVSGRCRDKVYSFVKLTELYYAG  185

Query  718   SHGMDIKGPSRGSK---YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             SHGMDIKGP  GS+    +    E VL QPASEFLPMIDEVYKTL+E T S PG KVE N
Sbjct  186   SHGMDIKGPPPGSRCNGNRMNNGESVLCQPASEFLPMIDEVYKTLVESTKSIPGAKVETN  245

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFC+SVHFRCVDE  W +LA+QV+ VL EYPKL+LT GRKVLEIRP IEWDKGKALEFLL
Sbjct  246   KFCLSVHFRCVDEKSWDDLAKQVKLVLSEYPKLKLTYGRKVLEIRPTIEWDKGKALEFLL  305

Query  1069  ESLGYANST-DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             E+LGYANS  DV P+YIGDDRTDEDAFKVLRE  QG GILVSK+PK+T+ASYSLQEPSEV
Sbjct  306   EALGYANSNDDVLPIYIGDDRTDEDAFKVLRERGQGLGILVSKVPKETNASYSLQEPSEV  365

Query  1246  MLFLRRLVEWK  1278
             M FLRRL EWK
Sbjct  366   MSFLRRLAEWK  376



>dbj|BAJ88024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   443 bits (1139),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 252/322 (78%), Gaps = 7/322 (2%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFE  495
             ++ L+       A  +S  V+SMRASSPT           + D+H  WM +HPSAL  FE
Sbjct  43    RKCLRAAQAELGAGMLSGLVESMRASSPTHARAAAALAAGVDDEHAAWMARHPSALAKFE  102

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+ ASKGK IVMFLDYDGTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DK
Sbjct  103   EIVAASKGKQIVMFLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDK  162

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSK-YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQ  852
             V+ FV+LAELYYAGSHGMDIKGP++ S  + K   + VLFQPASEFLPMI+EV++ L+E+
Sbjct  163   VFEFVKLAELYYAGSHGMDIKGPAKSSSGHAKSKAKGVLFQPASEFLPMIEEVHQRLIEE  222

Query  853   TSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPII  1032
             T    G KVENNKFCVSVHFRCVDE  WG LA+ V+ V++EYPKLR++QGR V E+RP I
Sbjct  223   TKHVAGAKVENNKFCVSVHFRCVDEKSWGALAETVKGVMREYPKLRMSQGRMVFEVRPTI  282

Query  1033  EWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTH  1212
             +WDKGKALEFLLESLG+A+ ++V PVYIGDDRTDEDAFKVLR   QG GILVSK PKDT 
Sbjct  283   KWDKGKALEFLLESLGFADCSNVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKDTS  342

Query  1213  ASYSLQEPSEVMLFLRRLVEWK  1278
             AS+SLQEP+EVM FL RLVEWK
Sbjct  343   ASFSLQEPAEVMEFLLRLVEWK  364



>dbj|BAJ96268.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   443 bits (1139),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 252/322 (78%), Gaps = 7/322 (2%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFE  495
             ++ L+       A  +S  V+SMRASSPT           + D+H  WM +HPSAL  FE
Sbjct  43    RKCLRAAQAELGAGMLSGLVESMRASSPTHARAAAAPAAGVDDEHAAWMARHPSALAKFE  102

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+ ASKGK IVMFLDYDGTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DK
Sbjct  103   EIVAASKGKQIVMFLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDK  162

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSK-YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQ  852
             V+ FV+LAELYYAGSHGMDIKGP++ S  + K   + VLFQPASEFLPMI+EV++ L+E+
Sbjct  163   VFEFVKLAELYYAGSHGMDIKGPAKSSSGHAKSKAKGVLFQPASEFLPMIEEVHQRLIEE  222

Query  853   TSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPII  1032
             T    G KVENNKFCVSVHFRCVDE  WG LA+ V+ V++EYPKLR++QGR V E+RP I
Sbjct  223   TKHVAGAKVENNKFCVSVHFRCVDEKSWGALAETVKGVMREYPKLRMSQGRMVFEVRPTI  282

Query  1033  EWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTH  1212
             +WDKGKALEFLLESLG+A+ ++V PVYIGDDRTDEDAFKVLR   QG GILVSK PKDT 
Sbjct  283   KWDKGKALEFLLESLGFADCSNVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKDTS  342

Query  1213  ASYSLQEPSEVMLFLRRLVEWK  1278
             AS+SLQEP+EVM FL RLVEWK
Sbjct  343   ASFSLQEPAEVMEFLLRLVEWK  364



>ref|XP_002307388.2| hypothetical protein POPTR_0005s16910g [Populus trichocarpa]
 gb|EEE94384.2| hypothetical protein POPTR_0005s16910g [Populus trichocarpa]
Length=347

 Score =   441 bits (1135),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 252/334 (75%), Gaps = 17/334 (5%)
 Frame = +1

Query  289   PVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPLSD--DHRT  456
             P  PGGY      S K   +  +  G   K +SW DSMR SSPT  + +T LS+  +  T
Sbjct  17    PAAPGGYFTI---SRKMFAKKTETGG---KTNSWADSMRDSSPTRVKSTTSLSEIEEKNT  70

Query  457   WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATY  636
             W++ HPSAL+MFEQI+  SKGK IVMFLDYDGTLSPIV+DPD AFM++ MR  VR +A Y
Sbjct  71    WIVNHPSALNMFEQIVNGSKGKQIVMFLDYDGTLSPIVEDPDRAFMTNEMREAVRDVARY  130

Query  637   FPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLP  816
             FPTAIV+GRC DKVYSFVRLA LYYAGSHGMDIKGPS+     K   + VLFQPAS+FLP
Sbjct  131   FPTAIVTGRCRDKVYSFVRLAGLYYAGSHGMDIKGPSKNCCINKKDYQGVLFQPASDFLP  190

Query  817   MIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLT  996
             MIDEVY  LLE+T   PG +VE+NKFC+SVHFRCV+E  W  L +QVRSVL  YPKLRLT
Sbjct  191   MIDEVYNALLERTKYIPGARVEDNKFCISVHFRCVEEKMWAALVEQVRSVLNGYPKLRLT  250

Query  997   QGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGF  1176
             QGRKVLEIRP I+WDK K L        YANSTDV PVYIGDDRTDEDAFKVLR   QG 
Sbjct  251   QGRKVLEIRPTIKWDKAKLLR-------YANSTDVLPVYIGDDRTDEDAFKVLRNRGQGL  303

Query  1177  GILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             GILVSK+PK+T+ASYSLQEP+EV  FLRRLVEWK
Sbjct  304   GILVSKVPKETNASYSLQEPTEVKDFLRRLVEWK  337



>ref|XP_002444320.1| hypothetical protein SORBIDRAFT_07g020100 [Sorghum bicolor]
 gb|EES13815.1| hypothetical protein SORBIDRAFT_07g020100 [Sorghum bicolor]
Length=376

 Score =   442 bits (1137),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 252/305 (83%), Gaps = 8/305 (3%)
 Frame = +1

Query  388   WVDSMRASSPTQKSTPLS-----DDHR--TWMMQHPSALDMFEQIIKASKGKNIVMFLDY  546
             WV+SMRASSPT      +     D+ R   WM++HPSAL MF+Q++ ASKGK IV+FLDY
Sbjct  62    WVESMRASSPTHARAAAALAAGVDEERYAEWMVKHPSALGMFDQVVAASKGKQIVVFLDY  121

Query  547   DGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHG  726
             DGTLSPIVDDPD+A+MSD MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHG
Sbjct  122   DGTLSPIVDDPDAAYMSDTMRRAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHG  181

Query  727   MDIKGPSRGSKYKKGAE-EDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVS  903
             MDIKGP++GS++ K A+ + VLFQPAS+FLPMI++V+ +L+E+T   PG KVENNKFCVS
Sbjct  182   MDIKGPAKGSRHTKAAKAKGVLFQPASQFLPMIEQVHDSLVEKTKCIPGAKVENNKFCVS  241

Query  904   VHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGY  1083
             VHFRCVDE  W  LA  V+SVL +YPKL+LTQGR V E+RP I+WDKGKALEFLLESLG+
Sbjct  242   VHFRCVDEKSWSTLADLVKSVLTDYPKLKLTQGRMVFEVRPTIKWDKGKALEFLLESLGF  301

Query  1084  ANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRR  1263
             A+ TDV PVYIGDDRTDEDAFKVLR+  QG GILVSK PKDT ASYSLQEP+EVM FL R
Sbjct  302   ADCTDVLPVYIGDDRTDEDAFKVLRKRGQGVGILVSKHPKDTSASYSLQEPAEVMEFLLR  361

Query  1264  LVEWK  1278
             LVEW+
Sbjct  362   LVEWE  366



>gb|EMS59182.1| Trehalose-phosphate phosphatase [Triticum urartu]
Length=373

 Score =   442 bits (1137),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 214/321 (67%), Positives = 251/321 (78%), Gaps = 9/321 (3%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFE  495
             ++ L+       A  +S  V+SMRASSPT           + D+H  WM +HPSAL  FE
Sbjct  41    RKCLRAAQAELGAGMLSGLVESMRASSPTHARAAAALAAGVDDEHAAWMAKHPSALGKFE  100

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+ ASKGK IVMFLDYDGTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DK
Sbjct  101   EIVAASKGKQIVMFLDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDK  160

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQT  855
             V+ FV+LAELYYAGSHGMDIKGP++ SK K    + VLFQPASEFLPMI+EV++ L+E+T
Sbjct  161   VFDFVKLAELYYAGSHGMDIKGPAKSSKSKA---KGVLFQPASEFLPMIEEVHQRLIEET  217

Query  856   SSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIE  1035
                 G KVENNKFCVSVHFRCVDE  WG LA+ V+ V++EYPKLR++QGR V E+RP I+
Sbjct  218   KHVAGAKVENNKFCVSVHFRCVDEKSWGALAETVKGVMREYPKLRMSQGRMVFEVRPTIK  277

Query  1036  WDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHA  1215
             WDKGKALEFLLESLG+A+  +V PVYIGDDRTDEDAFKVLR   QG GILVSK PKDT A
Sbjct  278   WDKGKALEFLLESLGFADCPNVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKDTSA  337

Query  1216  SYSLQEPSEVMLFLRRLVEWK  1278
             S+SLQEP+EVM FL RLVEWK
Sbjct  338   SFSLQEPAEVMEFLLRLVEWK  358



>ref|XP_009406609.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   442 bits (1136),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 221/326 (68%), Positives = 254/326 (78%), Gaps = 15/326 (5%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLS------------DDHRTWMMQHPS  477
             K+ L  L++ G   ++S+WVDSM+ASSPT     ++            D+   W+M+HPS
Sbjct  35    KKYLSQLELRGG--RISAWVDSMKASSPTHDKGVVALSGAPPSVDACLDEQSAWVMRHPS  92

Query  478   ALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVS  657
             AL  FE I+ ASKGK IVMFLDYDGTLSPIVDDPDSAFMSD MRA VR +A YFPTAIVS
Sbjct  93    ALTKFEHIMSASKGKQIVMFLDYDGTLSPIVDDPDSAFMSDAMRAAVRDVARYFPTAIVS  152

Query  658   GRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYK  837
             GRC DKV +FVRLA LYYAGSHGMDIKGP +  ++ K   + V+FQ ASEFLPMI   YK
Sbjct  153   GRCLDKVINFVRLANLYYAGSHGMDIKGPKK-PRHTKARAKPVVFQAASEFLPMIQAAYK  211

Query  838   TLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLE  1017
              L E+T ST GVKVE+NKFCVSVHFRCVDE  W  L +QVRSVLKEYPKL LTQGRKVLE
Sbjct  212   ALSERTKSTAGVKVEDNKFCVSVHFRCVDEKSWSLLFEQVRSVLKEYPKLWLTQGRKVLE  271

Query  1018  IRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKL  1197
             IRP I WDKGKALEFLLESLG+A+  +V P+YIGDDRTDEDAFKVLR+  QGFGILVS+ 
Sbjct  272   IRPTINWDKGKALEFLLESLGFADCKNVMPIYIGDDRTDEDAFKVLRDRGQGFGILVSRF  331

Query  1198  PKDTHASYSLQEPSEVMLFLRRLVEW  1275
             PK+T+A+YSL+EPSEV  FL RLVEW
Sbjct  332   PKETNATYSLKEPSEVKDFLVRLVEW  357



>ref|XP_010534065.1| PREDICTED: trehalose-phosphate phosphatase B-like isoform X1 
[Tarenaya hassleriana]
Length=378

 Score =   442 bits (1136),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 274/353 (78%), Gaps = 13/353 (4%)
 Frame = +1

Query  241   VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG---AAAKVSSWVDSMRAS  411
             V+VSD   FP       ++P     F +    + L+ ++ +     AAK++SWVDS+RAS
Sbjct  21    VSVSDTPLFPEK-----LLPSPPSYFSIKPRIKFLKRIESDNNKLGAAKIASWVDSLRAS  75

Query  412   SPTQ----KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDP  579
             SPT+     S   +D+  +WM++ PSAL+ F +I+  +KGK IVMFLDYDGTLSPIV+DP
Sbjct  76    SPTRLRSSGSVSENDEKISWMVRFPSALNRFNEIMSRAKGKKIVMFLDYDGTLSPIVEDP  135

Query  580   DSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSK  759
             D A+MSD MR  VR++A YFPTAIV+GRC DKV SFV+LA +YYAGSHGMDIKGP++ + 
Sbjct  136   DKAYMSDEMREAVREVAAYFPTAIVTGRCVDKVRSFVKLAGIYYAGSHGMDIKGPTKANC  195

Query  760   YKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWG  939
             Y K +++ +L QPASEFLPMIDEV+K L E+T S  G  VENNKFC+SVHFR VDE +W 
Sbjct  196   YNK-SDQGMLLQPASEFLPMIDEVFKILKEKTKSIKGAMVENNKFCLSVHFRRVDEKRWI  254

Query  940   ELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIG  1119
              LA++V+ VL +YPKLRLTQGRKVLEIRP I+WDKGKALEFLLE+LG+ NS DVFP+YIG
Sbjct  255   ALAEKVKLVLNDYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLETLGFVNSNDVFPIYIG  314

Query  1120  DDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DDRTDEDAFKVL+E  QGFG+LVSK PK+T+ASYSLQEP++V  FL+RLVEWK
Sbjct  315   DDRTDEDAFKVLQERGQGFGVLVSKFPKETNASYSLQEPNQVRAFLQRLVEWK  367



>ref|XP_008445345.1| PREDICTED: probable trehalose-phosphate phosphatase D isoform 
X1 [Cucumis melo]
Length=370

 Score =   441 bits (1134),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 250/302 (83%), Gaps = 3/302 (1%)
 Frame = +1

Query  379   VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             ++S VD MRASSPT+ ++P+S     W+ Q PSAL+MF+QI  ASKGK IVMFLDYDGTL
Sbjct  56    IASSVDLMRASSPTRLNSPISVSQSPWIFQLPSALNMFDQITTASKGKQIVMFLDYDGTL  115

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIV+DPD AFM++ MRA V+ +AT FPTAIV+GR  DKVY FVRL EL+YAGSHGMDI+
Sbjct  116   SPIVEDPDRAFMTNEMRAAVKNIATCFPTAIVTGRRRDKVYEFVRLGELFYAGSHGMDIQ  175

Query  739   GPSRG--SKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHF  912
             GP++G  +KYKKG  E VLFQPASE LPMI+EV+KTL E T S  G KVENNKFC+SVHF
Sbjct  176   GPTKGYNNKYKKG-NEAVLFQPASELLPMIEEVHKTLSEITKSINGAKVENNKFCISVHF  234

Query  913   RCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANS  1092
             RCVDE +WG LA+QV+SV+ +YPKL ++ GRKVLEIRP I+WDKGKALEFLLESLG+ NS
Sbjct  235   RCVDEKRWGALAEQVKSVVNQYPKLIMSLGRKVLEIRPAIKWDKGKALEFLLESLGFTNS  294

Query  1093  TDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVE  1272
             +DV PVYIGDDRTDEDAFKVL+    GFGILVSK PK+T ASYSLQEPSEV  FL RLV 
Sbjct  295   SDVLPVYIGDDRTDEDAFKVLQSKGLGFGILVSKFPKETCASYSLQEPSEVEEFLCRLVN  354

Query  1273  WK  1278
             WK
Sbjct  355   WK  356



>gb|KHN19743.1| Trehalose-phosphate phosphatase [Glycine soja]
Length=381

 Score =   440 bits (1132),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/355 (62%), Positives = 270/355 (76%), Gaps = 22/355 (6%)
 Frame = +1

Query  223   MTRHNVV-------------AVSDPNRFPTAG-HKPPVVPGGYINFDVTSGKELLQNLDV  360
             MT  NVV             ++S+    P+A   +   V GG+  + +   K L++ L+ 
Sbjct  2     MTNQNVVTHEVINTLIAVAASISNSTALPSATVPESMAVLGGF--WGLPHNKNLVKRLE-  58

Query  361   NGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
                 AKVS+W+DSMRASSPT+  +  S + R+W++ HPSAL+ FEQI+ ++KGK +V+FL
Sbjct  59    ---GAKVSAWIDSMRASSPTRAKSE-SQEKRSWILYHPSALNTFEQIVCSAKGKQVVVFL  114

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV DPD AFM+  MRAT++ +A +FPTAIV+GRC DKVY+FV+LAELYYAGS
Sbjct  115   DYDGTLSPIVADPDKAFMTRKMRATLKGIARHFPTAIVTGRCRDKVYNFVKLAELYYAGS  174

Query  721   HGMDIKGPSRGSKYKKGAEED-VLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFC  897
             HGMDIKGP++    K+G     VLFQPAS+FLPMIDEVYK LLE+T + PG  VENNKFC
Sbjct  175   HGMDIKGPTKSQSPKQGNNNKAVLFQPASQFLPMIDEVYKILLEKTKTVPGANVENNKFC  234

Query  898   VSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESL  1077
             +SVHFRCVDE  W  LA++VR VL +YP+LRLTQGRKVLEIRP I+WDKGKALEFLLESL
Sbjct  235   LSVHFRCVDEKSWAALAEKVRLVLNDYPQLRLTQGRKVLEIRPTIKWDKGKALEFLLESL  294

Query  1078  GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSE  1242
             GY NS DVFP+YIGDDRTDEDAFKVLR   QG GILVS++ K+T ASY+LQ+PSE
Sbjct  295   GYENSNDVFPIYIGDDRTDEDAFKVLRSRGQGIGILVSRVAKETDASYTLQDPSE  349



>ref|XP_004500616.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cicer 
arietinum]
Length=363

 Score =   439 bits (1129),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 263/340 (77%), Gaps = 13/340 (4%)
 Frame = +1

Query  274   AGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHR  453
             +G +   V G ++ F   S    ++ LD+ GA   V++W+D MRA+SPT+     + +  
Sbjct  22    SGPESMAVLGEFLGF---SHSNFIKRLDLEGA--NVNAWIDLMRAASPTRSE---NQEKS  73

Query  454   TWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLAT  633
             +W++ HPSA+ +F++II ++KGK IV FLDYDGTLSPIV DPD AFM+  MRAT++ +A 
Sbjct  74    SWILYHPSAIKLFDEIIYSAKGKEIVFFLDYDGTLSPIVADPDKAFMTRKMRATLKDIAR  133

Query  634   YFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSR-GSKYKKGAE----EDVLFQP  798
             +FPTAIV+GRC DKV++FV+LAELYYA SHGMDI GP++ GS  K        + VLFQP
Sbjct  134   HFPTAIVTGRCRDKVFNFVKLAELYYAASHGMDIMGPTKNGSAVKSNNNNNTNKAVLFQP  193

Query  799   ASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEY  978
             A +FLPMIDEVYK LLE+T   PG KVENNKFC+SVHFRCVDE  W  LA++VR VL EY
Sbjct  194   AGQFLPMIDEVYKILLEKTKCVPGAKVENNKFCLSVHFRCVDEKSWAPLAEKVRLVLNEY  253

Query  979   PKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLR  1158
             PKLRLTQGRKVLEIRP I+WDKGKALEFLLESLGY NS DVFP+YIGDDRTDEDAFKVLR
Sbjct  254   PKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLGYENSNDVFPIYIGDDRTDEDAFKVLR  313

Query  1159  ETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
                QG GILVS +PK+T ASY+LQ+PSEV  FLRRLVEWK
Sbjct  314   RRGQGVGILVSSVPKETDASYTLQDPSEVEHFLRRLVEWK  353



>ref|NP_001167890.1| hypothetical protein [Zea mays]
 gb|ACN26421.1| unknown [Zea mays]
 gb|AFW64448.1| hypothetical protein ZEAMMB73_364503 [Zea mays]
Length=356

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 213/299 (71%), Positives = 245/299 (82%), Gaps = 8/299 (3%)
 Frame = +1

Query  385   SWVDSMRASSPTQKSTPLSDDHRT-WMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLS  561
             +WV++MRASSPT+       D  T WM +HPSAL  FEQI  AS+GK +VMFLDYDGTL+
Sbjct  55    TWVEAMRASSPTRSRAAADVDELTAWMRKHPSALGKFEQIASASQGKKVVMFLDYDGTLA  114

Query  562   PIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKG  741
             PIV DPD+A+MSD MRA VR +A +FPTAIVSGRC DKV SFV L+ELYYAGSHGMDI+G
Sbjct  115   PIVADPDAAYMSDVMRAAVRDVAKHFPTAIVSGRCRDKVRSFVDLSELYYAGSHGMDIEG  174

Query  742   PSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCV  921
             PS          E VL QPASEFLP+IDEVYK L+E+T STPG KVENNKFC+SVHFRCV
Sbjct  175   PSSNP-------ESVLCQPASEFLPVIDEVYKALVEKTKSTPGAKVENNKFCLSVHFRCV  227

Query  922   DELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDV  1101
             DE +W  LA+QV++V+K+YPKL+LTQGRKVLEIRP I WDKGKALEFLLESLG+A+ +D 
Sbjct  228   DEKRWNALAEQVKAVIKDYPKLKLTQGRKVLEIRPSIMWDKGKALEFLLESLGFASCSDA  287

Query  1102  FPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              PVYIGDDRTDEDAFKVLR+  QG GILVSK PK+T+ASYSLQ+P EVM FL RLVEWK
Sbjct  288   LPVYIGDDRTDEDAFKVLRKRGQGVGILVSKCPKETNASYSLQDPGEVMDFLLRLVEWK  346



>ref|XP_004956679.1| PREDICTED: probable trehalose-phosphate phosphatase 7-like [Setaria 
italica]
Length=380

 Score =   439 bits (1129),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 212/303 (70%), Positives = 246/303 (81%), Gaps = 7/303 (2%)
 Frame = +1

Query  391   VDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDG  552
             V+SMRASSPT           + D+   WM++HPSAL  FEQI+ AS+GK IVMFLDYDG
Sbjct  65    VESMRASSPTHAKAAAALAAGVDDERAAWMVRHPSALGKFEQIVAASEGKRIVMFLDYDG  124

Query  553   TLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMD  732
             TLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGMD
Sbjct  125   TLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMD  184

Query  733   IKGPSRGS-KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVH  909
             IKGP++ S ++ K   + VLFQPASEFLPMI+EV++ L E T   PG KVENNKFCVSVH
Sbjct  185   IKGPAKASSRHAKAKAKGVLFQPASEFLPMIEEVHERLAETTRCIPGAKVENNKFCVSVH  244

Query  910   FRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYAN  1089
             FRCVDE  WGE+++ V+ VL+EYPKLRLT GR VLE+RP I+WDKGKALEFLLESLG+A+
Sbjct  245   FRCVDEKMWGEVSEAVKGVLREYPKLRLTLGRMVLEVRPTIKWDKGKALEFLLESLGFAD  304

Query  1090  STDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLV  1269
              T+V PVYIGDDRTDEDAFKVLR   QG GILVSK PK+T A+YSLQEP+EVM FL RLV
Sbjct  305   CTNVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKETSANYSLQEPAEVMEFLLRLV  364

Query  1270  EWK  1278
             EWK
Sbjct  365   EWK  367



>gb|KEH34903.1| trehalose-6-phosphate phosphatase [Medicago truncatula]
Length=368

 Score =   438 bits (1127),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 263/341 (77%), Gaps = 10/341 (3%)
 Frame = +1

Query  265   FPTAGHKPP--VVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPL  438
              P+A   P    +  G++ F   S K   + L+     +KV++W+DSMRA+SPT+  +  
Sbjct  25    LPSAATVPESMALINGFLGF---SRKNFTKRLE----ESKVNAWIDSMRAASPTRVKSSE  77

Query  439   SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATV  618
             + +  +W++ HPSAL +F+QI+ ++K K IV FLDYDGTLSPIV DP+ AFM+  MRAT+
Sbjct  78    NQEKCSWILYHPSALKLFDQILYSAKRKQIVFFLDYDGTLSPIVADPEKAFMTRKMRATL  137

Query  619   RKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRG-SKYKKGAEEDVLFQ  795
             + +A  FPTAIV+GRC +KV++FV+LAELYYA SHGMDI GP++  S  K    + VLFQ
Sbjct  138   KDIARNFPTAIVTGRCREKVFNFVKLAELYYAASHGMDIMGPTKNRSAEKSNVNKAVLFQ  197

Query  796   PASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKE  975
             PAS++LPMIDEVYK LLE+T S  G KVENNKFC+SVHFRCVDE  W  LA++VR VL E
Sbjct  198   PASQYLPMIDEVYKILLEKTKSVSGAKVENNKFCLSVHFRCVDEKSWAPLAEKVRLVLNE  257

Query  976   YPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVL  1155
             YPKL+LTQGRKVLEIRP I+WDKGKALEFLLESLGY NS DVFP+YIGDDRTDEDAFKVL
Sbjct  258   YPKLKLTQGRKVLEIRPTIKWDKGKALEFLLESLGYKNSNDVFPIYIGDDRTDEDAFKVL  317

Query  1156  RETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             R   QG GILVS +PK+T ASY+LQ+PSEV  FLRRLVEWK
Sbjct  318   RRRGQGVGILVSSVPKETDASYTLQDPSEVEHFLRRLVEWK  358



>ref|XP_004150660.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 ref|XP_004170683.1| PREDICTED: probable trehalose-phosphate phosphatase J-like [Cucumis 
sativus]
 gb|KGN62169.1| hypothetical protein Csa_2G307340 [Cucumis sativus]
Length=370

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 249/302 (82%), Gaps = 3/302 (1%)
 Frame = +1

Query  379   VSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             ++S VD MRASSPT+ ++ +S     W+ Q PSAL+MF+QI  ASKGK IVMFLDYDGTL
Sbjct  56    IASSVDLMRASSPTRLNSHISVSQSPWIFQLPSALNMFDQITTASKGKQIVMFLDYDGTL  115

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIV+DPD AFM++ MRA V+ +AT FPTAIV+GR  DKVY FV L EL+YAGSHGMDI+
Sbjct  116   SPIVEDPDRAFMTNEMRAAVKNIATCFPTAIVTGRRRDKVYEFVGLGELFYAGSHGMDIQ  175

Query  739   GPSRG--SKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHF  912
             GP++G  +KYKKG  E VLFQPASE LPMIDEV+KTL E T S  G KVENNKFC+SVHF
Sbjct  176   GPTKGYNNKYKKG-NEAVLFQPASELLPMIDEVHKTLSEITKSINGAKVENNKFCISVHF  234

Query  913   RCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANS  1092
             RCVDE +WG LA+QV+SV+ +YPKL ++ GRKVLEIRP I+WDKGKALEFLLESLG+ANS
Sbjct  235   RCVDEKRWGALAEQVKSVVNQYPKLIMSLGRKVLEIRPAIKWDKGKALEFLLESLGFANS  294

Query  1093  TDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVE  1272
             +DV PVYIGDDRTDEDAFKVL+    GFGILVSK PK+T ASYSLQEPSEV  FL RLV 
Sbjct  295   SDVLPVYIGDDRTDEDAFKVLQSKGLGFGILVSKFPKETCASYSLQEPSEVEEFLCRLVN  354

Query  1273  WK  1278
             WK
Sbjct  355   WK  356



>ref|XP_010064765.1| PREDICTED: probable trehalose-phosphate phosphatase H [Eucalyptus 
grandis]
Length=365

 Score =   437 bits (1125),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 246/301 (82%), Gaps = 0/301 (0%)
 Frame = +1

Query  376   KVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGT  555
             K  +WVDSMR SSPT+ S P + +H +W++ HPSAL  FE +  A+KGK IV+FLDYDGT
Sbjct  39    KNHAWVDSMRDSSPTRVSLPGTGEHNSWIVHHPSALKTFELVTNAAKGKEIVIFLDYDGT  98

Query  556   LSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDI  735
             LSPIV+DPD AFMS  MR  V++ A +FPTAI+SGR  DKVY FV+L ELYYAGSHGMDI
Sbjct  99    LSPIVEDPDRAFMSSQMREAVKEAARHFPTAIISGRSRDKVYDFVKLPELYYAGSHGMDI  158

Query  736   KGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFR  915
             +GPS+  +  K  +E V FQPASEFLPMI+EVY+ LL +T S PG KVENNKFC+SVH+R
Sbjct  159   RGPSKSQRKCKKGDEGVPFQPASEFLPMINEVYRALLNRTKSIPGAKVENNKFCLSVHYR  218

Query  916   CVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANST  1095
              VDE +W  LA+QVRSVL EYPKL+LTQGRKVLEIRPII WDKGKALE+LLESLGYAN +
Sbjct  219   NVDEKRWAALAEQVRSVLSEYPKLKLTQGRKVLEIRPIINWDKGKALEYLLESLGYANDS  278

Query  1096  DVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEW  1275
             +V P+YIGDDRTDEDAFKVLR+  +G GILVSK+ K+T ASYSLQ+P EVM FL R+VEW
Sbjct  279   NVLPIYIGDDRTDEDAFKVLRDRGRGIGILVSKVAKETCASYSLQDPPEVMSFLMRMVEW  338

Query  1276  K  1278
             K
Sbjct  339   K  339



>ref|XP_009419974.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   437 bits (1125),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/366 (61%), Positives = 269/366 (73%), Gaps = 20/366 (5%)
 Frame = +1

Query  223   MTRHNVVA-----VSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT  NVV       +  N  P   + PP   G      +   K+ L  +D+ G     + 
Sbjct  1     MTNQNVVVQAITVAAVANSPPLFTYPPPRTSGSSAAAAIP--KKYLSPVDLGGGW--TNG  56

Query  388   WVDSMRASSPTQKSTPL---------SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
             W+++++ASSPT   + L          D+  TW+M+HPSAL  FEQI  A+KGK IVMFL
Sbjct  57    WLEAIKASSPTHAKSALLSAPAVESEQDEQSTWIMRHPSALSKFEQITSATKGKQIVMFL  116

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIVDDPDSAFMSD MRA V+K+A  FPTAIVSGRC  +VY FVRL ELYYAGS
Sbjct  117   DYDGTLSPIVDDPDSAFMSDTMRAAVKKVARLFPTAIVSGRCRSRVYEFVRLTELYYAGS  176

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDIK P +G++Y K  ++ VLFQPASEFLP+++E++K LLE T S PG KVENNKFCV
Sbjct  177   HGMDIKVP-KGTRYTK-KKKAVLFQPASEFLPLMNEIHKALLETTRSIPGAKVENNKFCV  234

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVHFRCVDE  WG L +QV S+LK +P+LRLTQGRKVLEIRP I+WDKGKALEFLL+SLG
Sbjct  235   SVHFRCVDETCWGVLVEQVVSLLKSHPELRLTQGRKVLEIRPTIKWDKGKALEFLLKSLG  294

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             +A++ +V P+YIGDD TDEDAFKVLR+  QG GILVS+ PKDT+ASYSL+EP EVM FL 
Sbjct  295   FADNKNVVPIYIGDDHTDEDAFKVLRDRGQGIGILVSEYPKDTNASYSLKEPYEVMEFLL  354

Query  1261  RLVEWK  1278
              LVEWK
Sbjct  355   HLVEWK  360



>ref|XP_010500057.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=368

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 277/372 (74%), Gaps = 31/372 (8%)
 Frame = +1

Query  223   MTRHNV----------VAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT HN           VAV  PN+  F   G       G YI+      K+L+Q L+ + 
Sbjct  1     MTNHNALIPDAKASIGVAVRVPNQSLFSPGG-------GRYISI---PRKKLVQKLEADP  50

Query  367   AAAKVSSWVDSMRASSPTQ------KSTPLS--DDHRTWMMQHPSALDMFEQIIKASKGK  522
             +  ++++W+++MRASSPT+       S P S  D+H +WM QHPSAL MFE+I +ASKGK
Sbjct  51    SQTRINTWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGK  110

Query  523   NIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAE  702
              I+MFLDYDGTLSPIV+DP+ A+MSD MR  V+ +A YFPTAIV+GRC DKV  FV+L  
Sbjct  111   QIIMFLDYDGTLSPIVEDPERAYMSDEMRNAVKGVAKYFPTAIVTGRCRDKVRRFVKLPG  170

Query  703   LYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVE  882
             LYYAGSHGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  VE
Sbjct  171   LYYAGSHGMDIKGPSKKTKHNK-NNKGVLFQAANEFLPMIDQVSKCLVEKMRDVEGASVE  229

Query  883   NNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEF  1062
             NNKFCVSVH+RCVD+  WG +A+ V S+L EYPKLRLTQGRKVLEIRP I+WDKGKALEF
Sbjct  230   NNKFCVSVHYRCVDQKDWGLVAEHVTSILSEYPKLRLTQGRKVLEIRPTIKWDKGKALEF  289

Query  1063  LLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSE  1242
             LLESLG+ANS +V P+YIGDDRTDEDAF+VLR+  +GFGILVSK+PK+T A+YSLQEPSE
Sbjct  290   LLESLGFANSKNVLPIYIGDDRTDEDAFQVLRKRGEGFGILVSKVPKETTATYSLQEPSE  349

Query  1243  VMLFLRRLVEWK  1278
             V  FLRRLVEWK
Sbjct  350   VGEFLRRLVEWK  361



>ref|XP_010676890.1| PREDICTED: probable trehalose-phosphate phosphatase D [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/367 (62%), Positives = 274/367 (75%), Gaps = 27/367 (7%)
 Frame = +1

Query  223   MTRHNVV--------------AVSDPNRFPTAGHKPPVVPGG-YINFDVTSGKELLQNLD  357
             MT  NVV              A+S+ + F  A  KPP    G +I       +++++ L+
Sbjct  1     MTNQNVVVSDGKQSLKVAVAMAMSNSSLFSPAVPKPPTSTAGRFIR------RKVVKKLE  54

Query  358   VNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMF  537
               GA  K++ WVDSMRASSP +     S +H TWM+ HPSAL MF+QII+ASKGK IVMF
Sbjct  55    TQGAPQKINVWVDSMRASSPAKSPP-SSPEHDTWMVTHPSALGMFDQIIRASKGKKIVMF  113

Query  538   LDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAG  717
             LDYDGTLSPIV DPD AFMSD MRA V+ +A YFPTAIVSGR  DKVY FV+L ELYYAG
Sbjct  114   LDYDGTLSPIVQDPDRAFMSDEMRAAVKTVARYFPTAIVSGRGKDKVYDFVKLKELYYAG  173

Query  718   SHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFC  897
             SHGMDI+GP  GS      ++ V+ QPASEFLP+I+ VY  L+E+T    G KVE+NKFC
Sbjct  174   SHGMDIEGPVNGSN-----DKSVVCQPASEFLPIINHVYNKLVEKTKFIEGAKVESNKFC  228

Query  898   VSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESL  1077
             +SVHFRCVDE KW ELA+ V+ VL +YPKL++T GRKVLEI+P I+WDKGKALEFLL++L
Sbjct  229   LSVHFRCVDEKKWPELAEIVKEVLNDYPKLKMTYGRKVLEIKPTIKWDKGKALEFLLQAL  288

Query  1078  GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFL  1257
             GYANS DV P+YIGDDRTDEDAFKVL++ +QGFGILVSK PK+T A+Y+LQ+PSEV  FL
Sbjct  289   GYANSKDVLPIYIGDDRTDEDAFKVLQKRKQGFGILVSKSPKETSAAYTLQDPSEVKCFL  348

Query  1258  RRLVEWK  1278
             +RLVEWK
Sbjct  349   QRLVEWK  355



>ref|XP_003576467.1| PREDICTED: probable trehalose-phosphate phosphatase 7 [Brachypodium 
distachyon]
Length=385

 Score =   437 bits (1124),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 212/321 (66%), Positives = 250/321 (78%), Gaps = 7/321 (2%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFE  495
             +  L+       A  ++  V+SMRASSPT           + D+H  WM +HPSAL  FE
Sbjct  43    RTCLRAAQAELGAGLLNGLVESMRASSPTHAKAAAALAAGVDDEHAAWMARHPSALGKFE  102

Query  496   QIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDK  675
             +I+ ASKGK IVMFLDYDGTLSPIVDDP++AFMS+ MR  VR +A +FPTAIVSGRC DK
Sbjct  103   EIVAASKGKQIVMFLDYDGTLSPIVDDPEAAFMSETMRMAVRSVAKHFPTAIVSGRCRDK  162

Query  676   VYSFVRLAELYYAGSHGMDIKGPSRGS-KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQ  852
             V+ FV+LAELYYAGSHGMDIKGP++ S  + K   + V+FQPASEFLPMI+EV++ L+E+
Sbjct  163   VFEFVKLAELYYAGSHGMDIKGPAKSSCGHAKSKAKRVVFQPASEFLPMIEEVHQRLIEE  222

Query  853   TSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPII  1032
             TS  PG KVENNKFCVSVHFRCVDE  WG LA+ V+ VL+ YP+LRL+QGR VLE+RP I
Sbjct  223   TSCVPGAKVENNKFCVSVHFRCVDEKSWGALAETVKGVLRGYPRLRLSQGRMVLEVRPTI  282

Query  1033  EWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTH  1212
             +WDKGKALEFLL+SLG+A+  DV PVYIGDDRTDEDAFKVLR   QG GILVSK  KDT 
Sbjct  283   KWDKGKALEFLLDSLGFADCADVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHAKDTS  342

Query  1213  ASYSLQEPSEVMLFLRRLVEW  1275
             ASYSLQEP+EVM FL RLVEW
Sbjct  343   ASYSLQEPAEVMEFLLRLVEW  363



>ref|XP_006305131.1| hypothetical protein CARUB_v10009500mg [Capsella rubella]
 gb|EOA38029.1| hypothetical protein CARUB_v10009500mg [Capsella rubella]
Length=369

 Score =   436 bits (1122),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 275/373 (74%), Gaps = 32/373 (9%)
 Frame = +1

Query  223   MTRHNV------------VAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT HN             V VS+ + F   G       G YI+      K+L+Q L+ + 
Sbjct  1     MTNHNALISDAKASIGVAVRVSNQSLFSPGG-------GRYISI---PRKKLVQKLEADP  50

Query  367   AAAKVSSWVDSMRASSPTQ------KSTPLSDD---HRTWMMQHPSALDMFEQIIKASKG  519
             +  ++++W+++MRASSPT+       S P SD+   H +WM QHPSAL MFE+I +ASKG
Sbjct  51    SQTRINTWIEAMRASSPTKTRPGNISSLPESDEEDEHSSWMAQHPSALRMFEEIAEASKG  110

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV+DP+ A+M+D MR  V+  A YFPTAIV+GRC DKV  FV+L 
Sbjct  111   KQIVMFLDYDGTLSPIVEDPERAYMTDEMRDAVKGAARYFPTAIVTGRCRDKVRRFVKLP  170

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
              LYYAGSHGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  V
Sbjct  171   GLYYAGSHGMDIKGPSKKTKHNK-NNKGVLFQAANEFLPMIDQVSKCLVEKMRDVQGASV  229

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFCVSVH+RCVD+  WG +A+ V ++L EYPKLRLTQGRKVLEIRP ++WDKGKALE
Sbjct  230   ENNKFCVSVHYRCVDQKNWGLVAEHVTTILSEYPKLRLTQGRKVLEIRPTVKWDKGKALE  289

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+ANS DV P+YIGDDRTDEDAF+VLR+  QGFGILVSK+PK+T A+YSLQEPS
Sbjct  290   FLLESLGFANSKDVLPIYIGDDRTDEDAFQVLRKRGQGFGILVSKVPKETSATYSLQEPS  349

Query  1240  EVMLFLRRLVEWK  1278
             EV  FLRRLVEWK
Sbjct  350   EVGEFLRRLVEWK  362



>ref|XP_010496062.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=372

 Score =   436 bits (1122),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 228/372 (61%), Positives = 276/372 (74%), Gaps = 31/372 (8%)
 Frame = +1

Query  223   MTRHNV----------VAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT HN           VAV  PN+  F   G       G YI+      K+L+Q L+ + 
Sbjct  1     MTNHNALISDAKASIGVAVRVPNQSLFSPGG-------GRYISI---PRKKLVQKLEADP  50

Query  367   AAAKVSSWVDSMRASSPTQ------KSTPLS--DDHRTWMMQHPSALDMFEQIIKASKGK  522
             +  ++++W+++MRASSPT+       S P S  D+H +WM QHPSAL MFE+I +ASKGK
Sbjct  51    SQTRINTWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGK  110

Query  523   NIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAE  702
              IVMFLDYDGTLSPIV+DP+ A+MSD MR  V+ +A YFPTAIV+GRC DKV  FV+L  
Sbjct  111   QIVMFLDYDGTLSPIVEDPERAYMSDEMRDAVKGVAKYFPTAIVTGRCRDKVRRFVKLPG  170

Query  703   LYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVE  882
             LYYAGSHGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  VE
Sbjct  171   LYYAGSHGMDIKGPSKKTKHNK-NNKGVLFQAANEFLPMIDQVSKCLVEKMRDVEGASVE  229

Query  883   NNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEF  1062
             NNKFCVSVH+RCVD+  WG +A+ V S+L EYPKLRLTQGRKVLEIRP I+WDKGKALEF
Sbjct  230   NNKFCVSVHYRCVDQKDWGLVAEHVTSILSEYPKLRLTQGRKVLEIRPTIKWDKGKALEF  289

Query  1063  LLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSE  1242
             LLESLG+ANS +V P+YIGDDRTDEDAF+VLR+   GFGILVSK+PK+T A+YSLQEPSE
Sbjct  290   LLESLGFANSRNVLPIYIGDDRTDEDAFQVLRKRGDGFGILVSKVPKETSATYSLQEPSE  349

Query  1243  VMLFLRRLVEWK  1278
             V  FLRRLVEWK
Sbjct  350   VGEFLRRLVEWK  361



>ref|XP_008646283.1| PREDICTED: probable trehalose-phosphate phosphatase 4 [Zea mays]
 gb|AFW73481.1| hypothetical protein ZEAMMB73_506380 [Zea mays]
Length=357

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 244/298 (82%), Gaps = 9/298 (3%)
 Frame = +1

Query  385   SWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             +W D+MRASSPT+     +D+   W+ +HPSAL  FEQI  ASKGK +VMFLDYDGTLSP
Sbjct  56    TWADAMRASSPTRSRA--ADEFTAWVRKHPSALGKFEQIASASKGKKVVMFLDYDGTLSP  113

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IV DPD+A+MSD MRA VR +A +FPT+IVSGRC DKV +FV L+ELYYAGSHGMDIKGP
Sbjct  114   IVADPDAAYMSDAMRAAVRDVAKHFPTSIVSGRCRDKVRNFVALSELYYAGSHGMDIKGP  173

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             S          E VL QPASEFLP++DEVYK L+E+T STPG KVE+NKFC+SVHFRCVD
Sbjct  174   SSNP-------ESVLCQPASEFLPVMDEVYKALVEKTKSTPGAKVEHNKFCLSVHFRCVD  226

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +W  LA+QV++V K+YPKL+LT GRKVLEIRP I WDKGKALEFLLESLG+AN +DV 
Sbjct  227   EKRWNGLAEQVKAVTKDYPKLKLTHGRKVLEIRPSIMWDKGKALEFLLESLGFANRSDVL  286

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDDRTDEDAFKVLR+  QG GILVSK PK+T+ASYSLQ+P EVM FL RLV+WK
Sbjct  287   PVYIGDDRTDEDAFKVLRKRGQGIGILVSKCPKETNASYSLQDPGEVMDFLLRLVDWK  344



>ref|XP_009380195.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   435 bits (1118),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/364 (61%), Positives = 269/364 (74%), Gaps = 23/364 (6%)
 Frame = +1

Query  220   KMTRHNVVAVSDPNRFP-TAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVD  396
             +M + NV+    P  F  T     P  PG  +     S K++   LD    + ++ +WVD
Sbjct  6     EMRKQNVIV---PEEFAITRVMAAPSRPGLAV-----SCKKMFSQLD----SGRIGAWVD  53

Query  397   SMRASSPTQ-KSTPL---------SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDY  546
             SMRASSPT+ K+ P            ++  W+ QHPSAL  F+ ++ ASKGK +V+FLDY
Sbjct  54    SMRASSPTRVKAAPALAPSITASSDQEYDGWLGQHPSALSNFDDVVAASKGKRVVLFLDY  113

Query  547   DGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHG  726
             DGTLSPIVDDPD AFMSD MR  VR  A +FPTAIVSGRC DKV+SFV+L ELYYAGSHG
Sbjct  114   DGTLSPIVDDPDRAFMSDSMREAVRDAARHFPTAIVSGRCRDKVFSFVQLRELYYAGSHG  173

Query  727   MDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSV  906
             MDI+GP + +K+ K   + V FQPA+EFLPMIDEVYK L+E+T S  G KVENN F +SV
Sbjct  174   MDIRGPVKATKHTKAKAKAVSFQPATEFLPMIDEVYKALVERTKSIQGSKVENNTFSLSV  233

Query  907   HFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYA  1086
             HFRCV+E KW  LA+QVRSVLK+YPKLRLT GRKVLEIRP I+WDKGKALEFLLESLG+A
Sbjct  234   HFRCVEEKKWSSLAEQVRSVLKDYPKLRLTLGRKVLEIRPSIKWDKGKALEFLLESLGFA  293

Query  1087  NSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRL  1266
             + ++VFP+YIGDD TDEDAF+VLR+  QG GILVS+  K+T+ASYSL+EP+EV  FLRRL
Sbjct  294   HCSNVFPIYIGDDCTDEDAFEVLRDREQGLGILVSRRAKETNASYSLREPAEVKEFLRRL  353

Query  1267  VEWK  1278
             V WK
Sbjct  354   VGWK  357



>ref|NP_564464.1| probable trehalose-phosphate phosphatase D [Arabidopsis thaliana]
 sp|Q67XC9.1|TPPD_ARATH RecName: Full=Probable trehalose-phosphate phosphatase D; Short=AtTPPD; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 dbj|BAD44653.1| putative trehalose-phosphatase [Arabidopsis thaliana]
 gb|AEE31836.1| probable trehalose-phosphate phosphatase D [Arabidopsis thaliana]
Length=369

 Score =   435 bits (1118),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 227/373 (61%), Positives = 275/373 (74%), Gaps = 32/373 (9%)
 Frame = +1

Query  223   MTRHNV----------VAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT HN           VAV  PN+  F   G       G YI+      K+L+Q L+ + 
Sbjct  1     MTNHNALISDAKGSIGVAVRVPNQSLFSPGG-------GRYISI---PRKKLVQKLEADP  50

Query  367   AAAKVSSWVDSMRASSPTQKS----TPL-----SDDHRTWMMQHPSALDMFEQIIKASKG  519
             +  ++ +W+++MRASSPT+      +PL      D++ +WM QHPSAL MFE+I +ASKG
Sbjct  51    SQTRIHTWIEAMRASSPTRTRPGNISPLPESDEEDEYSSWMAQHPSALTMFEEIAEASKG  110

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV++PD A+MS+ MR  V+ +A YFPTAIV+GRC DKV  FV+L 
Sbjct  111   KQIVMFLDYDGTLSPIVENPDRAYMSEEMREAVKGVARYFPTAIVTGRCRDKVRRFVKLP  170

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
              LYYAGSHGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  V
Sbjct  171   GLYYAGSHGMDIKGPSKRNKHNK-NNKGVLFQAANEFLPMIDKVSKCLVEKMRDIEGANV  229

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFCVSVH+RCVD+  WG +A+ V S+L EYPKLRLTQGRKVLEIRP I+WDKGKALE
Sbjct  230   ENNKFCVSVHYRCVDQKDWGLVAEHVTSILSEYPKLRLTQGRKVLEIRPTIKWDKGKALE  289

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+ANS DV P+YIGDDRTDEDAFKVLR   QGFGILVSK+PK+T A+YSLQEPS
Sbjct  290   FLLESLGFANSNDVLPIYIGDDRTDEDAFKVLRNKGQGFGILVSKIPKETSATYSLQEPS  349

Query  1240  EVMLFLRRLVEWK  1278
             EV  FL+RLVEWK
Sbjct  350   EVGEFLQRLVEWK  362



>ref|XP_002460140.1| hypothetical protein SORBIDRAFT_02g023260 [Sorghum bicolor]
 gb|EER96661.1| hypothetical protein SORBIDRAFT_02g023260 [Sorghum bicolor]
Length=381

 Score =   435 bits (1118),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 267/370 (72%), Gaps = 18/370 (5%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVVP-----GGYINFDVTSGKELLQNLDVNGAAAKV--  381
             M + +V AV +    P A     + P     G  I   V   K L   L    A   +  
Sbjct  1     MAKPSVAAVPEVVGVPAAAQATTLFPYPPPRGAGITAAVVRRKCLQVELGAGAAGPLLGG  60

Query  382   SSW-VDSMRASSPTQKSTPLS-----DDHR--TWMMQHPSALDMFEQIIKASKGKNIVMF  537
             + W V+SMRASSPT      +     D+ R   W ++HPSAL  FEQI+ AS+GK IVMF
Sbjct  61    ACWGVESMRASSPTHAKAAAALAAGVDEERRAAWTVRHPSALGKFEQIVAASEGKRIVMF  120

Query  538   LDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAG  717
             LDYDGTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAG
Sbjct  121   LDYDGTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAG  180

Query  718   SHGMDIKGPSRGS-KYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKF  894
             SHGMDI+GP++ S ++ K   + VLFQPASEFLPMI+EV+  L+E T   PG KVENNKF
Sbjct  181   SHGMDIRGPAKASSRHAKAKAKGVLFQPASEFLPMIEEVHDRLVETTRCIPGAKVENNKF  240

Query  895   CVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLES  1074
             CVSVHFRCVDE  WGEL++ V+ VL+EYPKLRLTQGR V E+RP I+WDKGKALEFLLES
Sbjct  241   CVSVHFRCVDEKMWGELSESVKGVLREYPKLRLTQGRMVFEVRPTIKWDKGKALEFLLES  300

Query  1075  LGYANSTDVFPVYIGDDRTDEDAFKVLRETRQ--GFGILVSKLPKDTHASYSLQEPSEVM  1248
             LG+A+ ++V PVYIGDDRTDEDAFKVLR   Q  G GILVSK PK+T ASYSLQEP+EVM
Sbjct  301   LGFADCSNVLPVYIGDDRTDEDAFKVLRRRGQGHGVGILVSKHPKETSASYSLQEPAEVM  360

Query  1249  LFLRRLVEWK  1278
              FL RLVEWK
Sbjct  361   EFLLRLVEWK  370



>ref|XP_006660121.1| PREDICTED: probable trehalose-phosphate phosphatase 6-like [Oryza 
brachyantha]
Length=319

 Score =   432 bits (1112),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 205/276 (74%), Positives = 234/276 (85%), Gaps = 0/276 (0%)
 Frame = +1

Query  451   RTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLA  630
             R W ++HPSAL  FEQI+ ASKGK IVMFLDYDGTLSPIVDDPDSAFMSD MR  VR +A
Sbjct  35    RGWSVRHPSALSKFEQIVAASKGKKIVMFLDYDGTLSPIVDDPDSAFMSDTMRRAVRSVA  94

Query  631   TYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEF  810
               FPTAIVSGRC DKV+ FV+LAELYYAGSHGMDIKGP++ S++ K   + VLFQPASEF
Sbjct  95    KPFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDIKGPAKASRHNKAKAKGVLFQPASEF  154

Query  811   LPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLR  990
             LPMI++V+ +L+E+T   PG KVENNKFCVSVHFRCVDE  W  LA+ V++ LKEYPKL+
Sbjct  155   LPMIEQVHDSLIEKTKCIPGAKVENNKFCVSVHFRCVDEKSWNTLAEIVKAELKEYPKLK  214

Query  991   LTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQ  1170
             LTQGR V EIRP I+WDKGKALEFLLESLG+A+ T+V PVYIGDDRTDEDAFKVLR+  Q
Sbjct  215   LTQGRMVFEIRPTIKWDKGKALEFLLESLGFADCTNVLPVYIGDDRTDEDAFKVLRKRGQ  274

Query  1171  GFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             G GILVSK PKDT+ASYSLQEP+EVM FL RLVEW+
Sbjct  275   GIGILVSKYPKDTNASYSLQEPAEVMDFLLRLVEWE  310



>emb|CDY15842.1| BnaA04g12690D [Brassica napus]
Length=338

 Score =   433 bits (1113),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 217/326 (67%), Positives = 249/326 (76%), Gaps = 8/326 (2%)
 Frame = +1

Query  283   KPPVVPGGYINFDVTSGKELLQNL-----DVNGAAAKVSSWVDSMRASSPTQKSTPLSDD  447
             K  V+  G  + D +   ++ Q+      DV      + SWVDSMRA SPT    P  D+
Sbjct  9     KSEVLYAGGDDGDTSPATKIFQDFQINEEDVGRGGGLIRSWVDSMRACSPTHLK-PF-DN  66

Query  448   HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKL  627
               +W+ +HPSAL+MFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS+ MR TVRKL
Sbjct  67    QSSWIKEHPSALNMFEEILHESEGKQIVMFLDYDGTLSPIVDDPDRAFMSNKMRNTVRKL  126

Query  628   ATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASE  807
             A  FPT IVSGR  +KVYSFV+L ELYYAGSHGMDIKGP + SKYKK  +  +L QPA+E
Sbjct  127   AMCFPTVIVSGRSREKVYSFVKLTELYYAGSHGMDIKGPEQNSKYKKKTQS-LLCQPATE  185

Query  808   FLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKL  987
             FLP+I EVY  L+E+T S  G KVENNKFC SVHFRCVDE KW +LA  VRSVLK YPKL
Sbjct  186   FLPVISEVYMKLVEKTKSIQGAKVENNKFCASVHFRCVDENKWSDLAHLVRSVLKNYPKL  245

Query  988   RLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETR  1167
              LTQGRKVLEIRPII+WDKGKALEFLLESLGY N T VFP+YIGDDRTDEDAFK+LR+ R
Sbjct  246   MLTQGRKVLEIRPIIKWDKGKALEFLLESLGYENCTHVFPIYIGDDRTDEDAFKILRDKR  305

Query  1168  QGFGILVSKLPKDTHASYSLQEPSEV  1245
             QG GILVSK  K+T+ASYSLQEP E 
Sbjct  306   QGLGILVSKYAKETNASYSLQEPDEA  331



>emb|CDY63411.1| BnaCnng42030D [Brassica napus]
Length=339

 Score =   432 bits (1112),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 215/327 (66%), Positives = 250/327 (76%), Gaps = 9/327 (3%)
 Frame = +1

Query  283   KPPVVPGGYINFDVTSGKELLQNLDVN------GAAAKVSSWVDSMRASSPTQKSTPLSD  444
             K  V+  G  + D +   ++ Q+  +N      G    + SWVDSMRA SP+    P  +
Sbjct  9     KSEVLCAGGDDGDTSPATKVFQDFQINEEDVGRGGGGLIRSWVDSMRACSPSHLK-PF-N  66

Query  445   DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRK  624
             +  +W+ +HPSAL+MFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS+ MR TVRK
Sbjct  67    NQSSWIKEHPSALNMFEEILHESEGKQIVMFLDYDGTLSPIVDDPDRAFMSNKMRNTVRK  126

Query  625   LATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPAS  804
             LA  FPT IVSGR  +KVYSFV+L ELYYAGSHGMDIKGP + SKYKK  +  +L QPA+
Sbjct  127   LAMCFPTVIVSGRSREKVYSFVKLTELYYAGSHGMDIKGPEQNSKYKKKTQS-LLCQPAT  185

Query  805   EFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPK  984
             EFLP+I EVY  L+E+T S  G KVENNKFC SVHFRCVDE KW +LA  VRSVLK YPK
Sbjct  186   EFLPVISEVYMKLVEKTKSIQGAKVENNKFCASVHFRCVDENKWSDLAHLVRSVLKNYPK  245

Query  985   LRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRET  1164
             L LTQGRKVLEIRPII+WDKGKALEFLLESLGY N T VFP+YIGDDRTDEDAFK+LR+ 
Sbjct  246   LMLTQGRKVLEIRPIIKWDKGKALEFLLESLGYENCTHVFPIYIGDDRTDEDAFKILRDK  305

Query  1165  RQGFGILVSKLPKDTHASYSLQEPSEV  1245
             RQG GILVSK  K+T+ASYSLQEP E 
Sbjct  306   RQGLGILVSKYAKETNASYSLQEPDEA  332



>gb|AAM63513.1| trehalose-phosphatase, putative [Arabidopsis thaliana]
Length=369

 Score =   433 bits (1113),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 226/373 (61%), Positives = 275/373 (74%), Gaps = 32/373 (9%)
 Frame = +1

Query  223   MTRHNV----------VAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT HN           VAV  PN+  F   G       G YI+      K+L+Q L+ + 
Sbjct  1     MTNHNALISDAKGSIGVAVRVPNQSLFSPGG-------GRYISI---PRKKLVQKLEADP  50

Query  367   AAAKVSSWVDSMRASSPTQKS----TPLS-----DDHRTWMMQHPSALDMFEQIIKASKG  519
             +  ++ +W+++MRASSPT+      +PL+     D++ +WM QHPSAL MFE+I +ASKG
Sbjct  51    SQTRIHTWIEAMRASSPTRTRPGNISPLTESDEEDEYSSWMAQHPSALTMFEEIAEASKG  110

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV++PD A+MS+ MR  V+ +A YFPTAIV+GRC DKV  FV+L 
Sbjct  111   KQIVMFLDYDGTLSPIVENPDRAYMSEEMREAVKGVARYFPTAIVTGRCRDKVRRFVKLP  170

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
              LYYAGSHGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  V
Sbjct  171   GLYYAGSHGMDIKGPSKRNKHNK-NNKGVLFQAANEFLPMIDKVSKCLVEKMRDIEGANV  229

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFCVSVH+RCVD+  WG +A+ V S+L EYPKL LTQGRKVLEIRP I+WDKGKALE
Sbjct  230   ENNKFCVSVHYRCVDQKDWGLVAEHVTSILSEYPKLSLTQGRKVLEIRPTIKWDKGKALE  289

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+ANS DV P+YIGDDRTDEDAFKVLR   QGFGILVSK+PK+T A+YSLQEPS
Sbjct  290   FLLESLGFANSNDVLPIYIGDDRTDEDAFKVLRNKGQGFGILVSKIPKETSATYSLQEPS  349

Query  1240  EVMLFLRRLVEWK  1278
             EV  FL+RLVEWK
Sbjct  350   EVGEFLQRLVEWK  362



>ref|XP_006647910.1| PREDICTED: LOW QUALITY PROTEIN: probable trehalose-phosphate 
phosphatase 4-like [Oryza brachyantha]
Length=356

 Score =   432 bits (1112),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/300 (69%), Positives = 246/300 (82%), Gaps = 9/300 (3%)
 Frame = +1

Query  385   SWVDSMRASSPTQKSTPLSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTL  558
             +W ++MRASSPT+ S   +D  +   W+ +HPSAL  FE+I   S+GK IVMF+DYDGTL
Sbjct  51    TWAETMRASSPTRSSRSAADVDEFTAWVSKHPSALTKFEEIAGKSRGKKIVMFMDYDGTL  110

Query  559   SPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIK  738
             SPIV DPD+A+MSD MRA VR++A  FPTAIVSGRC DKV +FV L++LYYAGSHGMDIK
Sbjct  111   SPIVADPDAAYMSDAMRAAVREVAKNFPTAIVSGRCRDKVRNFVGLSDLYYAGSHGMDIK  170

Query  739   GPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRC  918
             GPS          E VL QPASEFLPMI+EVYK L+E+T STPG KVENNKFC+SVHFRC
Sbjct  171   GPSSNP-------ESVLCQPASEFLPMINEVYKILVEKTKSTPGAKVENNKFCLSVHFRC  223

Query  919   VDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTD  1098
             VDE +W  L +QV++V+KEYPKL+LT GRKVLEIRP I+WDKG+ALEFLLESLG+AN +D
Sbjct  224   VDEKRWNALGEQVKAVMKEYPKLKLTYGRKVLEIRPSIKWDKGQALEFLLESLGFANCSD  283

Query  1099  VFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             V PVYIGDDRTDEDAFKVL++  QG GILVSK PK+T+ASYSLQ+P+EVM FL RLVEWK
Sbjct  284   VLPVYIGDDRTDEDAFKVLKKRGQGIGILVSKCPKETNASYSLQDPTEVMEFLLRLVEWK  343



>ref|XP_009388774.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/308 (68%), Positives = 245/308 (80%), Gaps = 11/308 (4%)
 Frame = +1

Query  388   WVDSMRASSPTQKSTPLS-----------DDHRTWMMQHPSALDMFEQIIKASKGKNIVM  534
             W++SM+ASSPT   +  +            D+  WM  HPSALD FE +  ASKGK IVM
Sbjct  56    WIESMKASSPTHVKSAAARAVSSFASHDEQDYDGWMKLHPSALDDFEVLAAASKGKQIVM  115

Query  535   FLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYA  714
             FLDYDGTLSPIVDDPD AFMSD MR  VR++A  FPTAIVSGRCT+KV SFV L+ELYYA
Sbjct  116   FLDYDGTLSPIVDDPDRAFMSDEMREAVREVARQFPTAIVSGRCTEKVTSFVELSELYYA  175

Query  715   GSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKF  894
             GSHGMDIKGP+ G ++ K   E+VLFQPA +FLPMIDEVYK L+E T   PG +VENNKF
Sbjct  176   GSHGMDIKGPNDGPQHLKAKAENVLFQPARDFLPMIDEVYKHLVETTKCIPGCRVENNKF  235

Query  895   CVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLES  1074
             C+SVHFRCVDE KW  LA++VRS + +YPKLRLT GRKVLEIRP I+WDKGKALEFLLES
Sbjct  236   CLSVHFRCVDEKKWCLLAEKVRSTITDYPKLRLTHGRKVLEIRPSIKWDKGKALEFLLES  295

Query  1075  LGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLF  1254
             LGY    DVFP+YIGDDRTDEDAFKVL++  QGFGILVS + K+T+AS+SL+EP+EV+ F
Sbjct  296   LGYDGFNDVFPLYIGDDRTDEDAFKVLQDRGQGFGILVSTIAKETNASFSLREPAEVLKF  355

Query  1255  LRRLVEWK  1278
             LRR+VEWK
Sbjct  356   LRRIVEWK  363



>gb|AFK47239.1| unknown [Medicago truncatula]
Length=379

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 250/313 (80%), Gaps = 1/313 (0%)
 Frame = +1

Query  343   LQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKG  519
             L++ + +  A KV++W+DSMRASSPT+ +    + D   W + HPSAL+MF +I+  + G
Sbjct  58    LEDDNDHKGATKVNAWIDSMRASSPTRTRHDSENRDQTHWTLFHPSALNMFSKIMYNTNG  117

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IV+FLDYDGTLSPIV DPD A+MS  MR T++ +A +FPTAIVSGRC DK++SFVRLA
Sbjct  118   KQIVVFLDYDGTLSPIVADPDKAYMSKKMRVTLKDIARHFPTAIVSGRCLDKLFSFVRLA  177

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGP+     KKG  + VL QPASEFLPMI+EVYK L+E+T   PG  V
Sbjct  178   ELYYAGSHGMDIKGPTNRRSTKKGNNDGVLLQPASEFLPMINEVYKILVEKTKCVPGAMV  237

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC+SVHFR VDE  W  L +QV  V+ +YPKL+LTQGRKVLEIRPII+WDKG+ALE
Sbjct  238   ENNKFCLSVHFRNVDEKSWEALGEQVSLVMNDYPKLKLTQGRKVLEIRPIIKWDKGRALE  297

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+ANS  VFP+YIGDDRTDEDAFKVLR   QG GILVSK+ K+T+ASY+LQ+PS
Sbjct  298   FLLESLGFANSKGVFPIYIGDDRTDEDAFKVLRNRGQGCGILVSKISKETNASYTLQDPS  357

Query  1240  EVMLFLRRLVEWK  1278
             EV  FLR LV+WK
Sbjct  358   EVGEFLRHLVDWK  370



>ref|XP_003615055.1| Trehalose-6-phosphate phosphatase [Medicago truncatula]
 gb|AES98013.1| trehalose-6-phosphate phosphatase [Medicago truncatula]
Length=379

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 250/313 (80%), Gaps = 1/313 (0%)
 Frame = +1

Query  343   LQNLDVNGAAAKVSSWVDSMRASSPTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKG  519
             L++ + +  A KV++W+DSMRASSPT+ +    + D   W + HPSAL+MF +I+  + G
Sbjct  58    LEDDNDHKGATKVNAWIDSMRASSPTRTRHDSENRDQTHWTLFHPSALNMFSKIMYNTNG  117

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IV+FLDYDGTLSPIV DPD A+MS  MR T++ +A +FPTAIVSGRC DK++SFVRLA
Sbjct  118   KQIVVFLDYDGTLSPIVADPDKAYMSKKMRVTLKDIARHFPTAIVSGRCLDKLFSFVRLA  177

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGP+     KKG  + VL QPASEFLPMI+EVYK L+E+T   PG  V
Sbjct  178   ELYYAGSHGMDIKGPTNRRSTKKGNNDGVLLQPASEFLPMINEVYKILVEKTKCVPGAMV  237

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC+SVHFR VDE  W  L +QV  V+ +YPKL+LTQGRKVLEIRPII+WDKG+ALE
Sbjct  238   ENNKFCLSVHFRNVDEKSWEALGEQVSLVMNDYPKLKLTQGRKVLEIRPIIKWDKGRALE  297

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+ANS  VFP+YIGDDRTDEDAFKVLR   QG GILVSK+ K+T+ASY+LQ+PS
Sbjct  298   FLLESLGFANSKGVFPIYIGDDRTDEDAFKVLRNRGQGCGILVSKISKETNASYTLQDPS  357

Query  1240  EVMLFLRRLVEWK  1278
             EV  FLR LV+WK
Sbjct  358   EVGEFLRHLVDWK  370



>ref|XP_010461341.1| PREDICTED: probable trehalose-phosphate phosphatase D [Camelina 
sativa]
Length=369

 Score =   431 bits (1109),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 222/366 (61%), Positives = 275/366 (75%), Gaps = 19/366 (5%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPP----VVPGG--YINFDVTSGKELLQNLDVNGAAAKVS  384
             MT HN + +SD         + P      PGG  YI+      K+L+Q L+ + +  +++
Sbjct  1     MTNHNAL-ISDAKASIGVAVRVPNQSLFSPGGGRYISI---PRKKLVQKLEADPSQTRIN  56

Query  385   SWVDSMRASSPTQ------KSTPLS--DDHRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
             +W+++MRASSPT+       S P S  D+H +WM QHPSAL MFE+I +ASKGK I+MFL
Sbjct  57    TWIEAMRASSPTRTRPGNISSLPESKEDEHSSWMAQHPSALSMFEEIAEASKGKQIIMFL  116

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV+DP+ A+MSD MR  V+ +A YFPTAIV+GRC DKV  FV+L  LYYAGS
Sbjct  117   DYDGTLSPIVEDPERAYMSDEMRDAVKGVAKYFPTAIVTGRCRDKVRRFVKLPGLYYAGS  176

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  VENNKFCV
Sbjct  177   HGMDIKGPSKKTKHNK-NNKGVLFQAANEFLPMIDQVSKCLVEKIRDVEGASVENNKFCV  235

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVH+RCVD+  WG +A+ V S+L EYPKLRLTQGRKVLEIRP I+WDKGKAL+ LLESLG
Sbjct  236   SVHYRCVDQNDWGLVAEHVTSILSEYPKLRLTQGRKVLEIRPTIKWDKGKALDLLLESLG  295

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             +ANS +V P+YIGDD TDEDAF+VLR+  +GFGILVSK+PK+T A+YSLQEPSEV  FLR
Sbjct  296   FANSKNVLPIYIGDDHTDEDAFQVLRKRGEGFGILVSKVPKETSATYSLQEPSEVGEFLR  355

Query  1261  RLVEWK  1278
             RLVEWK
Sbjct  356   RLVEWK  361



>gb|AAD23621.1| putative trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 gb|AAQ89670.1| At2g22190 [Arabidopsis thaliana]
Length=269

 Score =   427 bits (1098),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 205/264 (78%), Positives = 227/264 (86%), Gaps = 1/264 (0%)
 Frame = +1

Query  487   MFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRC  666
             MFE+I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC
Sbjct  1     MFEEILHKSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRC  60

Query  667   TDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLL  846
              +KV SFV+L ELYYAGSHGMDIKGP +GSKYKK   + +L QPA+EFLP+I+EVYK L+
Sbjct  61    REKVSSFVKLTELYYAGSHGMDIKGPEQGSKYKK-ENQSLLCQPATEFLPVINEVYKKLV  119

Query  847   EQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRP  1026
             E T S PG KVENNKFC SVHFRCV+E KW +LA QVRSVLK YPKL LTQGRKVLEIRP
Sbjct  120   ENTQSIPGAKVENNKFCASVHFRCVEENKWSDLAHQVRSVLKNYPKLMLTQGRKVLEIRP  179

Query  1027  IIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKD  1206
             II+WDKGKALEFLLESLGY N TDVFP+YIGDDRTDEDAFK+LR+ +QG GILVSK  K+
Sbjct  180   IIKWDKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKKQGLGILVSKYAKE  239

Query  1207  THASYSLQEPSEVMLFLRRLVEWK  1278
             T+ASYSLQEP EVM+FL RLVEWK
Sbjct  240   TNASYSLQEPDEVMVFLERLVEWK  263



>sp|Q6H5L4.2|TPP7_ORYSJ RecName: Full=Probable trehalose-phosphate phosphatase 7; Short=OsTPP7; 
AltName: Full=Trehalose 6-phosphate phosphatase [Oryza 
sativa Japonica Group]
Length=375

 Score =   431 bits (1108),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 243/304 (80%), Gaps = 8/304 (3%)
 Frame = +1

Query  388   WVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYD  549
             WV+SMRASSPT           + ++H  WM +HPSAL  FE+++ ASKGK IVMFLDYD
Sbjct  62    WVESMRASSPTHAKAAAALAAGVDEEHAAWMARHPSALGEFEKVVAASKGKQIVMFLDYD  121

Query  550   GTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGM  729
             GTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGM
Sbjct  122   GTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGM  181

Query  730   DIKGPSRGSKYKKGAEED--VLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVS  903
             DIKGP+      K    +  VLFQPASEFLPMI++V++ L + TSS PG KVENNKFCVS
Sbjct  182   DIKGPASRHAAAKSPPHNKGVLFQPASEFLPMIEQVHQRLEQATSSIPGAKVENNKFCVS  241

Query  904   VHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGY  1083
             VHFRCVDE  WG LA+ VR V++E+P+LRL+QGR V E+RP I+WDKGKALEFLL+SLG+
Sbjct  242   VHFRCVDEKSWGALAETVRRVVREFPRLRLSQGRMVFEVRPTIKWDKGKALEFLLDSLGF  301

Query  1084  ANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRR  1263
             A+ +DV PVYIGDDRTDEDAFKVLR   QG GILVSK PK+T AS+SLQEP+EVM FL R
Sbjct  302   ADCSDVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKETSASFSLQEPAEVMEFLLR  361

Query  1264  LVEW  1275
             LVEW
Sbjct  362   LVEW  365



>ref|XP_002893908.1| hypothetical protein ARALYDRAFT_891246 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70167.1| hypothetical protein ARALYDRAFT_891246 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   431 bits (1107),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 223/366 (61%), Positives = 270/366 (74%), Gaps = 18/366 (5%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPP---VVPGG--YINFDVTSGKELLQNLDVNGAAAKVSS  387
             MT HN +          A   P      PGG  YI+      K+L+Q L+ + +  +  S
Sbjct  1     MTNHNALISDAKGSIGVAVRVPNQSLFSPGGGRYISI---PRKKLVQKLETDQSQTRTHS  57

Query  388   WVDSMRASSPTQ------KSTPLSDD---HRTWMMQHPSALDMFEQIIKASKGKNIVMFL  540
             W+++MRASSPT+       S P SD+   + +W+ QHPSAL MFE+I +ASKGK IVMFL
Sbjct  58    WIEAMRASSPTRIRPGNISSLPESDEEDEYSSWLAQHPSALTMFEEIAEASKGKQIVMFL  117

Query  541   DYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGS  720
             DYDGTLSPIV++PD A+MSD MR  V+ +A YFPTAIV+GRC DKV  FV+L  LYYAGS
Sbjct  118   DYDGTLSPIVENPDRAYMSDEMREAVKGVARYFPTAIVTGRCRDKVRRFVKLPGLYYAGS  177

Query  721   HGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCV  900
             HGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  VENNKFCV
Sbjct  178   HGMDIKGPSKKTKHNK-NNKGVLFQAANEFLPMIDQVSKCLVEKMRDIEGANVENNKFCV  236

Query  901   SVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLG  1080
             SVH+RCVD+  W  +A+ V S+L EYPKLRLTQGRKVLEIRP I+WDKGKALEFLLESLG
Sbjct  237   SVHYRCVDQKDWALVAEHVTSILSEYPKLRLTQGRKVLEIRPTIKWDKGKALEFLLESLG  296

Query  1081  YANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLR  1260
             +ANS DV P+YIGDDRTDEDAFKVL+   QGFGILVSK+PK+T A+YSLQ+PSEV  FL+
Sbjct  297   FANSNDVLPIYIGDDRTDEDAFKVLKRKGQGFGILVSKVPKETSATYSLQQPSEVGEFLQ  356

Query  1261  RLVEWK  1278
             RLVEWK
Sbjct  357   RLVEWK  362



>gb|EAZ08844.1| hypothetical protein OsI_31105 [Oryza sativa Indica Group]
Length=375

 Score =   430 bits (1105),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 242/304 (80%), Gaps = 8/304 (3%)
 Frame = +1

Query  388   WVDSMRASSPTQKSTP------LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYD  549
             WV+SMRASSPT           + ++H  WM +HPSAL  FE+++ ASKGK IVMFLDYD
Sbjct  62    WVESMRASSPTHAKAAAALAAGVDEEHAAWMARHPSALGEFEKVVAASKGKQIVMFLDYD  121

Query  550   GTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGM  729
             GTLSPIVDDPD+AFMS+ MR  VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGM
Sbjct  122   GTLSPIVDDPDAAFMSETMRMAVRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGM  181

Query  730   DIKGPSRGSKYKKGAEED--VLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVS  903
             DIKGP+      K    +  VLFQPASEFLPMI++V++ L + TSS PG KVENNKFCVS
Sbjct  182   DIKGPASRHAAAKSPPHNKGVLFQPASEFLPMIEQVHQRLEQATSSIPGAKVENNKFCVS  241

Query  904   VHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGY  1083
             VHFRCVDE  WG LA+ VR V++E+P+LRL+QGR V E+RP I+WDKGKALEFLL+SLG+
Sbjct  242   VHFRCVDEKSWGALAETVRRVVREFPRLRLSQGRMVFEVRPTIKWDKGKALEFLLDSLGF  301

Query  1084  ANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRR  1263
             A+  DV PVYIGDDRTDEDAFKVLR   QG GILVSK PK+T AS+SLQEP+EVM FL R
Sbjct  302   ADCRDVLPVYIGDDRTDEDAFKVLRRRGQGVGILVSKHPKETSASFSLQEPAEVMEFLLR  361

Query  1264  LVEW  1275
             LVEW
Sbjct  362   LVEW  365



>gb|ADK11431.1| trehalose-6-phosphate phosphatase [Medicago sativa]
Length=379

 Score =   430 bits (1105),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/349 (61%), Positives = 265/349 (76%), Gaps = 2/349 (1%)
 Frame = +1

Query  238   VVAVSDPNRFP-TAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASS  414
              +++S+ N  P T+  +   + GG +     +  + L++ + +  A KV++W+DSM ASS
Sbjct  22    AMSISNSNVLPRTSVSELMALFGGLLGRHKNNLIKPLEDDNDHKGATKVNAWIDSMGASS  81

Query  415   PTQ-KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAF  591
             PT+ +    + D   W + HPSAL+MF QI+  + GK I++FLDYDGTLSPIV DPD A+
Sbjct  82    PTRTRHESENRDQTHWTLFHPSALNMFNQIMYNTNGKQIIVFLDYDGTLSPIVADPDKAY  141

Query  592   MSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKG  771
             MS  MR T++ +A  FPTAIVSGRC DK++SFVRLAELYYAGSHGMDIKGP+     KKG
Sbjct  142   MSKKMRVTLKDIARRFPTAIVSGRCLDKLFSFVRLAELYYAGSHGMDIKGPTNRRSTKKG  201

Query  772   AEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQ  951
               ++VL QPASEFLPMI+EVYK L+E+T   PG  VENNKFC+SV FR VDE  W  LA+
Sbjct  202   NNDEVLLQPASEFLPMINEVYKILVEKTKCVPGAMVENNKFCLSVPFRNVDEKSWAPLAE  261

Query  952   QVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRT  1131
             QV  VL +YPKL+LTQGRKVLEIRP I+WDKG+ALEFLLESLG+ANS +VFP+YIGDDRT
Sbjct  262   QVSLVLNDYPKLKLTQGRKVLEIRPTIKWDKGRALEFLLESLGFANSKNVFPIYIGDDRT  321

Query  1132  DEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             DEDAFKVLR   QG GILVSK+ K+T+ASY+LQ+PSEV  FLR LV+WK
Sbjct  322   DEDAFKVLRNRSQGCGILVSKISKETNASYTLQDPSEVGQFLRHLVDWK  370



>ref|XP_009409163.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   430 bits (1105),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/311 (66%), Positives = 252/311 (81%), Gaps = 10/311 (3%)
 Frame = +1

Query  376   KVSSWVDSMRASSPTQKSTPL----------SDDHRTWMMQHPSALDMFEQIIKASKGKN  525
             + SSW++SM+A  P+Q S+            S+D+  W+ +HPSAL  F++++ ASKGK 
Sbjct  67    RASSWIESMKALPPSQLSSAAACTAPVLASHSEDYDGWVKRHPSALRNFDELMAASKGKQ  126

Query  526   IVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAEL  705
             IVMFLDYDGTLSPIV+DPD A+MSD MR  VR  A+ FPTAIVSGRC +KV SFV+L+EL
Sbjct  127   IVMFLDYDGTLSPIVEDPDRAYMSDEMREAVRDAASLFPTAIVSGRCREKVSSFVKLSEL  186

Query  706   YYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVEN  885
             YYAGSHGMDIKGP+ G K+ K   + +LFQPASEFLPMIDEVYK+L++ T S PG +VEN
Sbjct  187   YYAGSHGMDIKGPNDGPKHTKAKAKAILFQPASEFLPMIDEVYKSLVDSTKSIPGSRVEN  246

Query  886   NKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFL  1065
             NKFC+SVHFRCVD  KW  L ++V++V+K+YPKLRLT+GRKVLEIRP I+WDKGKALEFL
Sbjct  247   NKFCLSVHFRCVDAKKWSLLDERVKTVIKDYPKLRLTKGRKVLEIRPTIKWDKGKALEFL  306

Query  1066  LESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             LESLG+ +  DV P+YIGDDRTDEDAFKVLR+  QG+GILVSK+ K+T AS+SL+EP+EV
Sbjct  307   LESLGFDDCNDVLPLYIGDDRTDEDAFKVLRDRGQGYGILVSKIAKETSASFSLREPAEV  366

Query  1246  MLFLRRLVEWK  1278
             + FL RLVEWK
Sbjct  367   LEFLCRLVEWK  377



>ref|XP_010446536.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X2 [Camelina sativa]
Length=269

 Score =   424 bits (1091),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 231/264 (88%), Gaps = 1/264 (0%)
 Frame = +1

Query  487   MFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRC  666
             MFE I+  S+GK IVMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA  FPTAIVSGRC
Sbjct  1     MFEDILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRC  60

Query  667   TDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLL  846
              +KVY+FV+L ELYYAGSHGMDIKGP +GSKY++ ++  +L QPA+EFLPMIDEVY+ L+
Sbjct  61    REKVYNFVKLTELYYAGSHGMDIKGPEQGSKYEEDSKS-LLCQPATEFLPMIDEVYQKLV  119

Query  847   EQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRP  1026
             ++T  TPG +VENNKFCVSVHFR V+E  W +LA QVRSV+K+YPKLRLTQGRKVLE+RP
Sbjct  120   QKTKLTPGAQVENNKFCVSVHFRRVNENNWSDLANQVRSVMKDYPKLRLTQGRKVLEVRP  179

Query  1027  IIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKD  1206
             II+WDKGKALEFLLESLGYAN TDVFP+YIGDDRTDEDAFK+LRE +QG GILVSK PK+
Sbjct  180   IIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERKQGLGILVSKFPKE  239

Query  1207  THASYSLQEPSEVMLFLRRLVEWK  1278
             T ASYSLQEP EVM FL+RLVEWK
Sbjct  240   TSASYSLQEPDEVMDFLQRLVEWK  263



>ref|XP_009390913.1| PREDICTED: probable trehalose-phosphate phosphatase 6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=389

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/328 (65%), Positives = 254/328 (77%), Gaps = 13/328 (4%)
 Frame = +1

Query  334   KELLQNLDVNGAA---AKVSSWVDSMRASSPTQ-KSTPL---------SDDHRTWMMQHP  474
             K  L  LD+       A++S+WVDSMRASSPT  K+  +          +D+   + QHP
Sbjct  48    KRFLSQLDMGSGGGGGARISAWVDSMRASSPTHVKAAAMLSASFAASHDEDYNNRVKQHP  107

Query  475   SALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIV  654
             SAL +FE I+ ASKGK IV+FLDYDGTLSPIVDDPD AF+S+ M+ TVR +A +FPTAIV
Sbjct  108   SALSVFEDIVAASKGKQIVVFLDYDGTLSPIVDDPDRAFISNAMKETVRDVARHFPTAIV  167

Query  655   SGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVY  834
             SGR  DKV+SFVRL ELYYAGSHGMDIKGP++ +K+ K   + VLFQPA+EFLPMIDEVY
Sbjct  168   SGRRRDKVFSFVRLRELYYAGSHGMDIKGPTKRTKHTKAKTKAVLFQPATEFLPMIDEVY  227

Query  835   KTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVL  1014
             K L+E+T    G +VENN F +SVHFRCVDE  W  LA+ VRSVLK+YPKLRLT GRKVL
Sbjct  228   KALMEKTKLIQGSRVENNIFTLSVHFRCVDEKIWSSLAELVRSVLKDYPKLRLTMGRKVL  287

Query  1015  EIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSK  1194
             EIRP I+WDKGKALEF+LESLG A+S +VFPVYIGDDRTDEDAFKVL   RQG GILVS+
Sbjct  288   EIRPSIKWDKGKALEFMLESLGLADSGNVFPVYIGDDRTDEDAFKVLHGRRQGLGILVSE  347

Query  1195  LPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             + ++T A  SL++P+EV  FLRRLVEWK
Sbjct  348   VIRETSARCSLRQPAEVQKFLRRLVEWK  375



>gb|AAG51089.1|AC027032_9 trehalose-phosphatase, putative [Arabidopsis thaliana]
Length=366

 Score =   425 bits (1093),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 273/373 (73%), Gaps = 35/373 (9%)
 Frame = +1

Query  223   MTRHNV----------VAVSDPNR--FPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNG  366
             MT HN           VAV  PN+  F   G       G YI+      K+L+Q L+ + 
Sbjct  1     MTNHNALISDAKGSIGVAVRVPNQSLFSPGG-------GRYISI---PRKKLVQKLEADP  50

Query  367   AAAKVSSWVDSMRASSPTQKS----TPL-----SDDHRTWMMQHPSALDMFEQIIKASKG  519
             +  ++ +W+++MRASSPT+      +PL      D++ +WM QHPSAL MFE+I +ASKG
Sbjct  51    SQTRIHTWIEAMRASSPTRTRPGNISPLPESDEEDEYSSWMAQHPSALTMFEEIAEASKG  110

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV++PD A+MS+     V+ +A YFPTAIV+GRC DKV  FV+L 
Sbjct  111   KQIVMFLDYDGTLSPIVENPDRAYMSE---EAVKGVARYFPTAIVTGRCRDKVRRFVKLP  167

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
              LYYAGSHGMDIKGPS+ +K+ K   + VLFQ A+EFLPMID+V K L+E+     G  V
Sbjct  168   GLYYAGSHGMDIKGPSKRNKHNK-NNKGVLFQAANEFLPMIDKVSKCLVEKMRDIEGANV  226

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFCVSVH+RCVD+  WG +A+ V S+L EYPKLRLTQGRKVLEIRP I+WDKGKALE
Sbjct  227   ENNKFCVSVHYRCVDQKDWGLVAEHVTSILSEYPKLRLTQGRKVLEIRPTIKWDKGKALE  286

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+ANS DV P+YIGDDRTDEDAFKVLR   QGFGILVSK+PK+T A+YSLQEPS
Sbjct  287   FLLESLGFANSNDVLPIYIGDDRTDEDAFKVLRNKGQGFGILVSKIPKETSATYSLQEPS  346

Query  1240  EVMLFLRRLVEWK  1278
             EV  FL+RLVEWK
Sbjct  347   EVGEFLQRLVEWK  359



>ref|XP_006660576.1| PREDICTED: probable trehalose-phosphate phosphatase 7-like, partial 
[Oryza brachyantha]
Length=301

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 235/281 (84%), Gaps = 1/281 (0%)
 Frame = +1

Query  436   LSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRAT  615
             + D+H  WM +HPSAL  FE+++ ASKGK IVMFLDYDGTLSPIVDDPD+AFMS+ MR  
Sbjct  13    VDDEHAAWMARHPSALGEFEKVVAASKGKQIVMFLDYDGTLSPIVDDPDAAFMSETMRMA  72

Query  616   VRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQ  795
             VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGMDIKGP++ S     A+  VLFQ
Sbjct  73    VRSVAKHFPTAIVSGRCRDKVFEFVKLAELYYAGSHGMDIKGPAKPSSRHAKAK-GVLFQ  131

Query  796   PASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKE  975
             PASEFLPMI++V++ L ++TSS PG KVENNKFCVSVHFRCVDE  W  LA+ VR V++E
Sbjct  132   PASEFLPMIEQVHRRLEKETSSIPGAKVENNKFCVSVHFRCVDEKSWAALAETVRRVVRE  191

Query  976   YPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVL  1155
             +P+LRL+QGR V E+RP I+WDKGKALEFLL+SLG+A+ +DV PVYIGDDRTDEDAFKVL
Sbjct  192   FPRLRLSQGRMVFEVRPTIKWDKGKALEFLLDSLGFADCSDVLPVYIGDDRTDEDAFKVL  251

Query  1156  RETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             R   QG GILVSK PK+T AS+SLQEP+EVM FL RLVEWK
Sbjct  252   RRRGQGVGILVSKHPKETTASFSLQEPAEVMEFLLRLVEWK  292



>ref|XP_006390024.1| hypothetical protein EUTSA_v10018720mg [Eutrema salsugineum]
 gb|ESQ27310.1| hypothetical protein EUTSA_v10018720mg [Eutrema salsugineum]
Length=376

 Score =   424 bits (1091),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 270/373 (72%), Gaps = 25/373 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV----------PGGYINFDVTSGKELLQNLDVNGA-  369
             MT  NV+ VSD  R P  G K   V          P  Y  F      +LL+  D N + 
Sbjct  1     MTNQNVI-VSD--RKPILGLKTITVSVSNSALFSSPPTYFTFPRRKFLKLLEAADKNNSK  57

Query  370   ----AAKVSSWVDSMRASSPTQ------KSTPLSDDHRTWMMQHPSALDMFEQIIKASKG  519
                 A K++SWVDSMR SSPT+       S   +DD  +W+++ PSAL MF++I+ A+KG
Sbjct  58    NNLGAGKIASWVDSMRDSSPTRLRSSSHDSFSDNDDQTSWIVRFPSALSMFDEIVNAAKG  117

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K IVMFLDYDGTLSPIV+DPD A+++  MR  V+ +A  FPTAIV+GR   KV SFV+L 
Sbjct  118   KQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDVALNFPTAIVTGRSITKVRSFVKLN  177

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             E+YYAGSHGMDI+GP+  + Y  G+ + VLFQPASEF+PMI++V K L E+T   PG  V
Sbjct  178   EIYYAGSHGMDIEGPTNETNYG-GSNQGVLFQPASEFVPMIEKVVKILQEKTKWIPGAMV  236

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC+SVHFR VDE +W  LA+QV+SVL +YPKL+LTQGRKVLEIRP I+WDKG+AL 
Sbjct  237   ENNKFCLSVHFRRVDEKRWAALAEQVKSVLIDYPKLKLTQGRKVLEIRPTIKWDKGQALS  296

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLL SLG+ NS DV PVYIGDDRTDEDAFKVLRE  QGFGILVSK+PK+T+ASYSLQ+PS
Sbjct  297   FLLNSLGFENSEDVVPVYIGDDRTDEDAFKVLRERGQGFGILVSKVPKETNASYSLQDPS  356

Query  1240  EVMLFLRRLVEWK  1278
             +V  FL+RL EWK
Sbjct  357   QVNEFLKRLAEWK  369



>tpg|DAA39973.1| TPA: hypothetical protein ZEAMMB73_891232 [Zea mays]
Length=384

 Score =   424 bits (1091),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 255/347 (73%), Gaps = 22/347 (6%)
 Frame = +1

Query  286   PPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSW-VDSMRASSPTQKSTPL--------  438
             PP  P G       + +      +V G A     W V+SMRASSPT              
Sbjct  35    PP--PRGASGIAAAAVRRKCLQAEVGGGAC----WGVESMRASSPTHARAAAALAGAGAD  88

Query  439   -SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRAT  615
               ++   WM +HPSAL  FE+I+ AS+G+ IVMFLDYDGTLSPIVDDPD+AFMS+ MR  
Sbjct  89    EEEERAAWMARHPSALGKFERIVAASEGRRIVMFLDYDGTLSPIVDDPDAAFMSETMRMA  148

Query  616   VRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGS--KYKKGAEEDVL  789
             VR +A +FPTAIVSGRC DKV+ FV+LAELYYAGSHGMDIKGP++ S  +++K   + VL
Sbjct  149   VRSVAKHFPTAIVSGRCRDKVFGFVKLAELYYAGSHGMDIKGPAKASSSRHEKAKAKGVL  208

Query  790   FQPA--SEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRS  963
             FQPA  SEFLPMI+ V++ L+E T S PG KVENN+FCVSVHFRCVDE  WGEL + V+ 
Sbjct  209   FQPATASEFLPMIEAVHERLVETTRSIPGAKVENNRFCVSVHFRCVDEKMWGELWESVKG  268

Query  964   VLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDA  1143
             VL+EYP+LRLTQGR VLE+RP I+WDKGKALEFLLESLG+A  T+V PVYIGDDRTDEDA
Sbjct  269   VLREYPRLRLTQGRMVLEVRPTIKWDKGKALEFLLESLGFAGCTNVLPVYIGDDRTDEDA  328

Query  1144  FKVLRE--TRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             F+ LR     QG GILVSK PK+T ASYSLQEP+EVM FL RLVEWK
Sbjct  329   FRALRRRGQGQGVGILVSKHPKETSASYSLQEPAEVMEFLLRLVEWK  375



>gb|EYU36516.1| hypothetical protein MIMGU_mgv1a008595mg [Erythranthe guttata]
Length=368

 Score =   423 bits (1087),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 264/340 (78%), Gaps = 18/340 (5%)
 Frame = +1

Query  235   NVVAVSDPNRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASS  414
             + V   DP  F +A  KP V P GY      S K+L++ L+  G  A++   +DSMRASS
Sbjct  20    STVTRPDPALFSSA--KPLVSPNGYF-----SRKKLVKKLESCGNGARL---LDSMRASS  69

Query  415   PTQKSTPLSD---DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDS  585
             PT+  T L+D   D  +W   HPSAL MFE+I+  SKGK IV+FLDYDGTLSPIV+DPD 
Sbjct  70    PTR--TRLNDTDPDPNSWTAHHPSALSMFEEIMGESKGKEIVVFLDYDGTLSPIVEDPDR  127

Query  586   AFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYK  765
             AFM+  MR  VR +A +FPTAIVSGRC  KVY+FVRL+ELYYAGSHGMDIKGP++G +  
Sbjct  128   AFMTTEMREAVRDVAKFFPTAIVSGRCRAKVYNFVRLSELYYAGSHGMDIKGPAKGPR--  185

Query  766   KGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGEL  945
             KG  + VL QPA EFLPMIDEV+K+L+E+    PG KVENNKFC+SVH+RCV+E +WGEL
Sbjct  186   KG-NKTVLCQPAREFLPMIDEVFKSLIEKMKHIPGAKVENNKFCLSVHYRCVEEKRWGEL  244

Query  946   AQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDD  1125
             A++V+SV+++Y +LR++QGRKVLEIRP I+WDKG A+EFLLESLGYA+S DV PVYIGDD
Sbjct  245   AEKVKSVMRDYQELRMSQGRKVLEIRPTIKWDKGNAIEFLLESLGYADSDDVLPVYIGDD  304

Query  1126  RTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             RTDEDAF+VLR   QG GILVSK PK+T+ASY+LQEPSE 
Sbjct  305   RTDEDAFQVLRNRGQGIGILVSKTPKETNASYTLQEPSEA  344



>gb|EMT12736.1| hypothetical protein F775_52288 [Aegilops tauschii]
Length=376

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 245/298 (82%), Gaps = 10/298 (3%)
 Frame = +1

Query  391   VDSMRASSPTQKSTPLSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             +++MRA+SPT +S P +D  +   WM +HPSAL  FEQI  ASKGK IVMFLDYDGTLSP
Sbjct  45    LEAMRAASPT-RSRPGADVDELTAWMRKHPSALSKFEQIASASKGKKIVMFLDYDGTLSP  103

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IV +PD+A+MSD MR  VR +A +FPTAIVSGRC DKV++FV L+ELYYAGSHGMDIKGP
Sbjct  104   IVANPDAAYMSDAMREAVRDVAKHFPTAIVSGRCRDKVHNFVGLSELYYAGSHGMDIKGP  163

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
               GS       E VL QPASEFLPMIDEVYK L+E+T STPG KVENNKFC+SVHFRCVD
Sbjct  164   --GSN-----PESVLCQPASEFLPMIDEVYKVLVEKTKSTPGAKVENNKFCLSVHFRCVD  216

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +W  LA+QV++V+K++P L+LTQGRKV E+RP I WDKGKALEFLLESLG+A+ +DV 
Sbjct  217   EKRWNFLAEQVKAVIKDFPMLKLTQGRKVFELRPSIMWDKGKALEFLLESLGFASCSDVL  276

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDDRTDEDAFKVLR+  QG GILVSK  K+T ASYSLQ+P+EVM FL RLVEWK
Sbjct  277   PVYIGDDRTDEDAFKVLRKRGQGVGILVSKCAKETSASYSLQDPAEVMEFLLRLVEWK  334



>ref|XP_003573088.1| PREDICTED: probable trehalose-phosphate phosphatase 4 [Brachypodium 
distachyon]
Length=366

 Score =   421 bits (1082),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 245/312 (79%), Gaps = 10/312 (3%)
 Frame = +1

Query  349   NLDVNGAAAKVSSWVDSMRASSPTQKSTPLS---DDHRTWMMQHPSALDMFEQIIKASKG  519
             +L    +A    +W+++MRA SP +         D+  +WM +HPSAL  FEQI  A KG
Sbjct  46    HLAAARSAPASCTWLEAMRACSPPRSRGGAGADVDELSSWMRKHPSALGKFEQIAGACKG  105

Query  520   KNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLA  699
             K +VMFLDYDGTLSPIV +PD+A+++D MRA VR +A +FPTAIVSGRC DKV++FV L+
Sbjct  106   KKVVMFLDYDGTLSPIVANPDAAYITDAMRAAVRDVAKHFPTAIVSGRCRDKVHNFVGLS  165

Query  700   ELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKV  879
             ELYYAGSHGMDIKGP+          E VL QPASEFLPMI+EVYK L+E+T STPG  V
Sbjct  166   ELYYAGSHGMDIKGPTSNP-------ESVLCQPASEFLPMIEEVYKVLVEKTKSTPGAMV  218

Query  880   ENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALE  1059
             ENNKFC+SVHFRCVDE +W  LA+QV++V+K+YP L+LTQGRKV E+RP I WDKGKALE
Sbjct  219   ENNKFCLSVHFRCVDEKRWNFLAEQVKAVIKDYPMLKLTQGRKVFELRPSIMWDKGKALE  278

Query  1060  FLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPS  1239
             FLLESLG+A+ +DV PVYIGDDRTDEDAFKVLR+  QG GILVSK PK+T ASYSLQ+P+
Sbjct  279   FLLESLGFADCSDVLPVYIGDDRTDEDAFKVLRKRGQGVGILVSKCPKETSASYSLQDPT  338

Query  1240  EVMLFLRRLVEW  1275
             EVM FL RLVEW
Sbjct  339   EVMEFLLRLVEW  350



>gb|KCW68839.1| hypothetical protein EUGRSUZ_F02439, partial [Eucalyptus grandis]
Length=373

 Score =   420 bits (1080),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/316 (65%), Positives = 243/316 (77%), Gaps = 17/316 (5%)
 Frame = +1

Query  343   LQNLDVNGA----AAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKA  510
             +Q ++  G       K  +WVDSMR SSPT+             + HPSAL  FE +  A
Sbjct  45    MQRIEPGGGEGDFVVKNHAWVDSMRDSSPTR-------------VHHPSALKTFELVTNA  91

Query  511   SKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFV  690
             +KGK IV+FLDYDGTLSPIV+DPD AFMS  MR  V++ A +FPTAI+SGR  DKVY FV
Sbjct  92    AKGKEIVIFLDYDGTLSPIVEDPDRAFMSSQMREAVKEAARHFPTAIISGRSRDKVYDFV  151

Query  691   RLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPG  870
             +L ELYYAGSHGMDI+GPS+  +  K  +E V FQPASEFLPMI+EVY+ LL +T S PG
Sbjct  152   KLPELYYAGSHGMDIRGPSKSQRKCKKGDEGVPFQPASEFLPMINEVYRALLNRTKSIPG  211

Query  871   VKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGK  1050
              KVENNKFC+SVH+R VDE +W  LA+QVRSVL EYPKL+LTQGRKVLEIRPII WDKGK
Sbjct  212   AKVENNKFCLSVHYRNVDEKRWAALAEQVRSVLSEYPKLKLTQGRKVLEIRPIINWDKGK  271

Query  1051  ALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQ  1230
             ALE+LLESLGYAN ++V P+YIGDDRTDEDAFKVLR+  +G GILVSK+ K+T ASYSLQ
Sbjct  272   ALEYLLESLGYANDSNVLPIYIGDDRTDEDAFKVLRDRGRGIGILVSKVAKETCASYSLQ  331

Query  1231  EPSEVMLFLRRLVEWK  1278
             +P EVM FL R+VEWK
Sbjct  332   DPPEVMSFLMRMVEWK  347



>gb|KHG18855.1| Trehalose-phosphate phosphatase [Gossypium arboreum]
Length=346

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 220/346 (64%), Positives = 247/346 (71%), Gaps = 38/346 (11%)
 Frame = +1

Query  274   AGHKPPVVPGGYINFDVTSGKELLQNLDVNGAAAKVSSWVDSMRASSPT--QKSTPLSDD  447
             +   P   PG  I+      K+LLQN +++ A A+V++WVDSMRASSPT  + ++ ++DD
Sbjct  18    STQNPLASPGHNISIKT---KKLLQNHEIS-AGARVNAWVDSMRASSPTHTKSTSSVTDD  73

Query  448   HRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKL  627
               TW + HPSAL+MFEQII ASKGK IVMFLDYDGTLSPIV+DPD AFMS  MR TVRKL
Sbjct  74    QVTWNLHHPSALEMFEQIIDASKGKQIVMFLDYDGTLSPIVEDPDRAFMSKKMRNTVRKL  133

Query  628   ATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGA---------EE  780
             A  FPTAIVSGRC DKVY FV+LAELYYAGSHG+D KGP + SK K             E
Sbjct  134   AKCFPTAIVSGRCRDKVYKFVKLAELYYAGSHGLDTKGPEKRSKSKNERVCSLVKVMDGE  193

Query  781   DVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVR  960
              VLFQPASEFLPMIDEVYK L++ T STPG KVENNKFC+SVHFRCVDE KW ELAQ VR
Sbjct  194   SVLFQPASEFLPMIDEVYKQLVDTTKSTPGAKVENNKFCLSVHFRCVDEKKWSELAQLVR  253

Query  961   SVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDED  1140
             S L EYPKLRLTQGRK     P+                        FPVYI  DRTDED
Sbjct  254   SALTEYPKLRLTQGRKDSLTVPMF-----------------------FPVYIRYDRTDED  290

Query  1141  AFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             AFK+LR+  QGFGILVSK PK+T ASYSLQEP EVM FLRRLVEWK
Sbjct  291   AFKILRDRGQGFGILVSKFPKETSASYSLQEPDEVMDFLRRLVEWK  336



>dbj|BAJ99358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   418 bits (1074),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 206/298 (69%), Positives = 242/298 (81%), Gaps = 10/298 (3%)
 Frame = +1

Query  391   VDSMRASSPTQKSTPLSD--DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSP  564
             ++ MRA+SPT +S P +D  D   WM +HPSAL  FEQI  ASKGK IVMFLDYDGTLSP
Sbjct  65    LEVMRAASPT-RSRPGADVDDLTAWMRKHPSALAKFEQIASASKGKKIVMFLDYDGTLSP  123

Query  565   IVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGP  744
             IV +PD+A+MSD MR  VR +A +FPTAIVSGRC +KV++FV L+ELYYAGSHGMDIKGP
Sbjct  124   IVANPDAAYMSDAMREAVRDVAKHFPTAIVSGRCREKVHNFVGLSELYYAGSHGMDIKGP  183

Query  745   SRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVD  924
             S          E V+ QPA EFLP+I+EVYK L+E+T STPG KVENNKFC+SVHFRCVD
Sbjct  184   SSNP-------ESVVCQPAREFLPVIEEVYKVLVEKTKSTPGAKVENNKFCLSVHFRCVD  236

Query  925   ELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVF  1104
             E +W  LA+QV++V+K+YP L+LTQGRKV E+RP I WDKGKALEFLLESLG+A+ +DV 
Sbjct  237   EKRWNFLAEQVKAVMKDYPMLKLTQGRKVFELRPSIMWDKGKALEFLLESLGFASCSDVL  296

Query  1105  PVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             PVYIGDDRTDEDAFKVLR+  QG GILVSK  K+T ASYSLQ+P+EVM FL RLVEWK
Sbjct  297   PVYIGDDRTDEDAFKVLRKRGQGVGILVSKSAKETSASYSLQDPAEVMEFLLRLVEWK  354



>ref|XP_009390290.1| PREDICTED: probable trehalose-phosphate phosphatase 6 [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   416 bits (1070),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/307 (67%), Positives = 236/307 (77%), Gaps = 10/307 (3%)
 Frame = +1

Query  388   WVDSMRASSPTQ----------KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMF  537
             WVDSMRASSPT           +     D++  W+ Q+PSAL  F+ I  ASKG  IVMF
Sbjct  12    WVDSMRASSPTHAKAAAVLSGSQEASHDDEYHKWVKQYPSALSNFDDIFAASKGIQIVMF  71

Query  538   LDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAG  717
             LDYDGTLSPIVDDPD AFMSD MR  VR  A +FPTAIVSGRC DKV+SFVRL ELYYAG
Sbjct  72    LDYDGTLSPIVDDPDRAFMSDAMREVVRDAARHFPTAIVSGRCRDKVFSFVRLRELYYAG  131

Query  718   SHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFC  897
             SHGMDIKGPS+ +K+ K   + VLFQPAS FLPMIDEVYKTLL +T   PG  VENN F 
Sbjct  132   SHGMDIKGPSKTTKHTKAKRKGVLFQPASVFLPMIDEVYKTLLRKTELFPGSSVENNTFS  191

Query  898   VSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESL  1077
             +SVH+RCVD+     L + V+SVL++YP+LR T G+KVLEIRP I WDKGKALEFLLESL
Sbjct  192   LSVHYRCVDDKILSSLFEMVKSVLEDYPELRRTSGKKVLEIRPSINWDKGKALEFLLESL  251

Query  1078  GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFL  1257
             G+ + TDVFPVYIGDD TDEDAFKVLR+  QG GILVS +PK+THASYSL+EP+EV  FL
Sbjct  252   GFGDRTDVFPVYIGDDCTDEDAFKVLRDRGQGAGILVSDIPKETHASYSLREPAEVKEFL  311

Query  1258  RRLVEWK  1278
              RLVEWK
Sbjct  312   SRLVEWK  318



>ref|XP_010428924.1| PREDICTED: trehalose-phosphate phosphatase B [Camelina sativa]
Length=377

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 264/351 (75%), Gaps = 23/351 (7%)
 Frame = +1

Query  259   NRFPTAGHKPPVVPGGYINFDVTSGKELLQNLDVNGA----AAKVS-SWVDSMRASSPTQ  423
             N FPT           Y  F      +LL+  D N +    A K++ SWVDSMR SSPT+
Sbjct  32    NSFPT-----------YFTFPRRKFLKLLEAADNNNSNLVVAPKITTSWVDSMRDSSPTR  80

Query  424   -KSTPL-----SDDHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDS  585
              +S+ L     +DD  +W+++ PSAL MF++I+ A+KGK IVMFLDYDGTLSPIV+DPD 
Sbjct  81    LRSSSLDSVSDNDDKTSWIVRFPSALSMFDEIVNAAKGKQIVMFLDYDGTLSPIVEDPDK  140

Query  586   AFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYK  765
             AF++  MR  V+ +A +FPTAIV+GR  DKV  FV+L E+YYAGSHGMDI+GP++ + Y 
Sbjct  141   AFITHEMRGVVKDVALHFPTAIVTGRSIDKVRRFVKLNEIYYAGSHGMDIEGPTKENNYG  200

Query  766   KGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGEL  945
             + + E VLFQPA EFLPMI++V K L E+T   PG  VENNKFC+SVHFR VDE +W  L
Sbjct  201   Q-SNERVLFQPAREFLPMIEKVVKILEEKTKWIPGAMVENNKFCLSVHFRRVDEKRWDTL  259

Query  946   AQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDD  1125
             A+ V+SVL +YP+L+L QGRKVLEIRP I+WDKG+AL FLL+SLGY NS DV PVYIGDD
Sbjct  260   AEVVKSVLTDYPELKLNQGRKVLEIRPTIKWDKGQALNFLLKSLGYENSKDVVPVYIGDD  319

Query  1126  RTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             RTDEDAFKVLRE  QGFGILVSK+PKDT+ASYSL++PS+V  FL+RLVEWK
Sbjct  320   RTDEDAFKVLREREQGFGILVSKIPKDTNASYSLKDPSQVKEFLKRLVEWK  370



>ref|XP_002461047.1| hypothetical protein SORBIDRAFT_02g039790 [Sorghum bicolor]
 gb|EER97568.1| hypothetical protein SORBIDRAFT_02g039790 [Sorghum bicolor]
Length=355

 Score =   416 bits (1069),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 228/278 (82%), Gaps = 0/278 (0%)
 Frame = +1

Query  445   DHRTWMMQHPSALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRK  624
             D   WM +HPSAL  FE ++ A+KGK IVMFLDYDGTLSPIV DPDSA MS+ MR  VR 
Sbjct  75    DFENWMEKHPSALAEFESVLAAAKGKQIVMFLDYDGTLSPIVKDPDSAVMSEEMRDAVRG  134

Query  625   LATYFPTAIVSGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPAS  804
             +A +FPTAIVSGRC DKV++FV+LAELYYAGSHGMDIKGP+  SK+ K   E VL QPAS
Sbjct  135   VAEHFPTAIVSGRCRDKVFNFVKLAELYYAGSHGMDIKGPTAQSKHTKAKAEAVLCQPAS  194

Query  805   EFLPMIDEVYKTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPK  984
              FLP+IDEVY+TL  +T+  PG  VENNKFC+SVHFRCV E KW  L +QVRSVLKEYP 
Sbjct  195   AFLPVIDEVYRTLTARTAPIPGATVENNKFCLSVHFRCVHEEKWRALEEQVRSVLKEYPD  254

Query  985   LRLTQGRKVLEIRPIIEWDKGKALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRET  1164
             LRLT+GRKVLEIRP IEWDKG AL+FLLESLG+A+S +VFP+YIGDDRTDEDAFKVLR  
Sbjct  255   LRLTKGRKVLEIRPSIEWDKGNALQFLLESLGFADSNNVFPIYIGDDRTDEDAFKVLRSM  314

Query  1165  RQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
              QG GILVSK+PK+T ASYSL+EPSEV  FLR+LV  K
Sbjct  315   GQGIGILVSKIPKETSASYSLREPSEVKEFLRKLVRSK  352



>gb|KFK42193.1| hypothetical protein AALP_AA2G223500 [Arabis alpina]
Length=371

 Score =   416 bits (1070),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 218/371 (59%), Positives = 269/371 (73%), Gaps = 26/371 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV-----------PGGYINFDVTSGKELLQNLDVNGA  369
             MT  NV+ VSD  R P  G K   V           P  Y  F     ++LLQ L+ N  
Sbjct  1     MTNQNVI-VSD--RKPILGSKTITVSVSNSPLFSTSPPTYFTF---PRRKLLQLLESNNM  54

Query  370   AA--KVSSWVDSMRASSPTQ------KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKN  525
                 K+SSWVDSMR SSPT+       S   +DD  +W+++ PSAL+MF++I+  +KGK 
Sbjct  55    VGTPKISSWVDSMRDSSPTRLRSSSHDSVLENDDKNSWIVRFPSALNMFDEIVNVAKGKQ  114

Query  526   IVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAEL  705
             IVMFLDYDGTLSPIV+DPD A+++  MR  ++ +A  FPTAIV+GR  DKV SFV+L E+
Sbjct  115   IVMFLDYDGTLSPIVEDPDKAYITHEMREVIKDVALNFPTAIVTGRSIDKVRSFVKLNEI  174

Query  706   YYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVEN  885
             YYAGSHGMDI+ P + +   +   + VLFQPA EF+PMI++V K L E+T   PG  VEN
Sbjct  175   YYAGSHGMDIEAPVKENTCGEN-NQGVLFQPAREFVPMIEKVVKILEEKTKWIPGAMVEN  233

Query  886   NKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFL  1065
             NKFC+SVHFR VDE +W  LA+QV+SVL +YPKL+LTQGRKVLEIRP I+WDKG+AL FL
Sbjct  234   NKFCLSVHFRRVDEKRWAALAEQVKSVLLDYPKLKLTQGRKVLEIRPTIKWDKGQALTFL  293

Query  1066  LESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             L+SLGY NS DV PVYIGDDRTDEDAFKVLRE  QGFGILVSK+PK+T+ASYSLQ+PS+V
Sbjct  294   LKSLGYENSEDVLPVYIGDDRTDEDAFKVLRERGQGFGILVSKVPKETNASYSLQDPSQV  353

Query  1246  MLFLRRLVEWK  1278
               FL+RLV+WK
Sbjct  354   NEFLKRLVDWK  364



>ref|XP_007136236.1| hypothetical protein PHAVU_009G0298000g, partial [Phaseolus vulgaris]
 gb|ESW08230.1| hypothetical protein PHAVU_009G0298000g, partial [Phaseolus vulgaris]
Length=291

 Score =   412 bits (1060),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 230/284 (81%), Gaps = 5/284 (2%)
 Frame = +1

Query  334   KELLQNLDVNGAAAKVSSWVDSMRASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKAS  513
             K L++ L+     AKV +W+DSMRASSPT+  +  S + R+W++ HPSAL+ FEQI   S
Sbjct  13    KNLVKRLE----GAKVGAWIDSMRASSPTRGKSE-SQEKRSWILYHPSALNTFEQITYNS  67

Query  514   KGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVR  693
             KGK IV+FLDYDGTLSPIV DPD AFMS  MRAT++ +A +FPTAIV+GRC DKVY+FV+
Sbjct  68    KGKQIVVFLDYDGTLSPIVTDPDKAFMSRKMRATLKGIARHFPTAIVTGRCRDKVYNFVK  127

Query  694   LAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGV  873
             L ELYYAGSHGMDIKGP++    K+G  + VLFQPAS+FLPMIDEVYK LLE+T S PG 
Sbjct  128   LGELYYAGSHGMDIKGPTKSRSGKQGNNKGVLFQPASQFLPMIDEVYKILLERTKSVPGA  187

Query  874   KVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKA  1053
             KVENNKFC+SVHFRCVDE  W  LA +VR VL +YP L+LTQGRKVLEIRP I+WDKGKA
Sbjct  188   KVENNKFCLSVHFRCVDEKSWASLADKVRLVLNDYPHLKLTQGRKVLEIRPTIKWDKGKA  247

Query  1054  LEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGIL  1185
             LEFLLESLGY NS DVFP+YIGDDRTDEDAFKVLR   QG GIL
Sbjct  248   LEFLLESLGYENSNDVFPIYIGDDRTDEDAFKVLRSRGQGIGIL  291



>emb|CDY14635.1| BnaC02g24780D [Brassica napus]
Length=377

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 270/374 (72%), Gaps = 26/374 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV----------PGGYINFDVTSGKELLQNLDVNG--  366
             MT  NV+ VSD N  P  G K   V          P  Y  F      ELL+  D N   
Sbjct  1     MTNQNVI-VSDRN--PILGSKTITVSVSNSPLFSSPPTYFTFPRRKFLELLEAADKNNNN  57

Query  367   ----AAAKVSSWVDSMRASSPTQKSTPL------SDDHRTWMMQHPSALDMFEQIIKASK  516
                  A K+SSWVDSMR SSPT+  +        +D+  +W+++ PSAL+MF++I+ A+K
Sbjct  58    KNNLGAGKISSWVDSMRDSSPTRLRSSSRDSDSDNDEKTSWIVRFPSALNMFDKIMNAAK  117

Query  517   GKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRL  696
             GK IVMFLDYDGTLSPIV+DPD A+++  MR  V+  A  FPTAIV+GR  DKV +FV+L
Sbjct  118   GKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDAALNFPTAIVTGRSIDKVRAFVKL  177

Query  697   AELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVK  876
              E+YYAGSHGMDI+GP+  + Y + + + VLFQPA EF+PMI++V K L E+T   PG  
Sbjct  178   NEIYYAGSHGMDIEGPTNENSYGE-SNQGVLFQPAREFVPMIEKVVKILEEKTKCIPGAM  236

Query  877   VENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKAL  1056
             VENNKFC+SVHFR VDE +W  LA+QV+SVL +YP+L+LTQGRKVLEIRP I+WDKG+AL
Sbjct  237   VENNKFCLSVHFRRVDEKRWAGLAEQVKSVLIDYPQLKLTQGRKVLEIRPTIKWDKGQAL  296

Query  1057  EFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEP  1236
              FLL SLG+ NS +V PVYIGDDRTDEDAFKVLRE  QGFGILVSK+PK+T+ASYSLQ+P
Sbjct  297   NFLLRSLGFENSENVVPVYIGDDRTDEDAFKVLREKGQGFGILVSKVPKETNASYSLQDP  356

Query  1237  SEVMLFLRRLVEWK  1278
             S+V  FL+RLVEWK
Sbjct  357   SQVNEFLKRLVEWK  370



>ref|XP_010321467.1| PREDICTED: probable trehalose-phosphate phosphatase H isoform 
X3 [Solanum lycopersicum]
Length=314

 Score =   413 bits (1061),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/302 (68%), Positives = 230/302 (76%), Gaps = 35/302 (12%)
 Frame = +1

Query  352   LDVNGAAAKVSSWVDSMRASSPTQK-STPLSDDHRTWMMQHPSALDMFEQIIKASKGKNI  528
             +++NG    + SW+DSMRASSPT   ST L +D  +WM+ HPSA+DMFE II  SKGK I
Sbjct  45    VEINGDPKIMKSWIDSMRASSPTHHMSTTLYEDKTSWMVHHPSAVDMFEDIISVSKGKKI  104

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIVDDPD AFMS  MR TVRKLA YFPTAIVSGRC DKVY+FV+L+ELY
Sbjct  105   VMFLDYDGTLSPIVDDPDQAFMSHDMRGTVRKLARYFPTAIVSGRCRDKVYNFVQLSELY  164

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDIKGPS+GSKY K   + +LFQPAS+FLPMI E                    
Sbjct  165   YAGSHGMDIKGPSKGSKYSKKGTQAILFQPASKFLPMIIE--------------------  204

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
                           KWGEL+Q+VR VLKEYPKL+L QGRKVLEIRPII+WDKGKAL+FLL
Sbjct  205   --------------KWGELSQEVRLVLKEYPKLKLCQGRKVLEIRPIIKWDKGKALQFLL  250

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             +SLGYA   DVFP+YIGDDRTDEDAFKVLRE RQG GILVSK PK+THASYSLQEPSEV 
Sbjct  251   QSLGYAKCNDVFPIYIGDDRTDEDAFKVLRERRQGLGILVSKTPKETHASYSLQEPSEVR  310

Query  1249  LF  1254
             +F
Sbjct  311   IF  312



>ref|XP_004958375.1| PREDICTED: probable trehalose-phosphate phosphatase 3-like isoform 
X2 [Setaria italica]
Length=345

 Score =   414 bits (1064),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 240/307 (78%), Gaps = 12/307 (4%)
 Frame = +1

Query  364   GAAAKVSSWVDSM--RASSPTQKSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKNIVMF  537
             G  A+  SW+ ++  RA +          +H  WM +HPSAL  FE ++ A+KGK +VMF
Sbjct  46    GVVARAGSWLGAVPRRAEA----------EHDDWMEKHPSALAAFESVLAAAKGKQVVMF  95

Query  538   LDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYYAG  717
             LDYDGTLSPIV DPDSA M+D MR  VR +A +FPTAIVSGRC DKV++FV+LAELYYAG
Sbjct  96    LDYDGTLSPIVKDPDSAVMTDEMRDAVRGVAEHFPTAIVSGRCRDKVFNFVKLAELYYAG  155

Query  718   SHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNKFC  897
             SHGMDIKGP+  SK+ K   E VL QPASEFLP+IDEV + L   T++ PG +VENNKFC
Sbjct  156   SHGMDIKGPTAQSKHAKAKAEAVLCQPASEFLPVIDEVCRALTATTAAIPGARVENNKFC  215

Query  898   VSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLESL  1077
             +SVHFRCV E KW  L +QVRSVLKEYP LRLT+GRKVLEIRP I+WDKG AL+FLLE+L
Sbjct  216   LSVHFRCVQEEKWRALEEQVRSVLKEYPDLRLTKGRKVLEIRPSIKWDKGNALQFLLEAL  275

Query  1078  GYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFL  1257
             G+A+S +VFP+YIGDDRTDEDAFKVLR   QG GILVSK+PK+T ASYSL+EPSEV  FL
Sbjct  276   GFADSKNVFPIYIGDDRTDEDAFKVLRNMGQGVGILVSKIPKETSASYSLREPSEVKEFL  335

Query  1258  RRLVEWK  1278
              +LV+ K
Sbjct  336   HKLVKSK  342



>ref|NP_177932.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
 sp|Q9C9S4.1|TPPB_ARATH RecName: Full=Trehalose-phosphate phosphatase B; Short=AtTPPB; 
AltName: Full=Trehalose 6-phosphate phosphatase [Arabidopsis 
thaliana]
 gb|AAG52092.1|AC012680_3 trehalose-6-phosphate phosphatase (AtTPPB); 8719-11059 [Arabidopsis 
thaliana]
 gb|AAO22625.1| putative trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis 
thaliana]
 gb|AAO42342.1| putative trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis 
thaliana]
 gb|AEE36066.1| trehalose-6-phosphate phosphatase [Arabidopsis thaliana]
Length=374

 Score =   414 bits (1064),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 219/371 (59%), Positives = 268/371 (72%), Gaps = 23/371 (6%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVVPGG-----------YINFDVTSGKELLQNLDVNG-  366
             MT  NV+ VSD  R P  G K   V              Y NF      +LL+  D N  
Sbjct  1     MTNQNVI-VSD--RKPILGLKTITVSVSNSPLFSNSFPTYFNFPRRKLLKLLEAADKNNL  57

Query  367   -AAAKVSSWVDSMRASSPTQ------KSTPLSDDHRTWMMQHPSALDMFEQIIKASKGKN  525
               A K++S +DSMR SSPT+       S   +DD  +W+++ PSAL+MF++I+ A+KGK 
Sbjct  58    VVAPKITSMIDSMRDSSPTRLRSSSYDSVSDNDDKTSWIVRFPSALNMFDEIVNAAKGKQ  117

Query  526   IVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAEL  705
             IVMFLDYDGTLSPIV+DPD AF++  MR  V+ +A+ FPTAIV+GR  +KV SFV++ E+
Sbjct  118   IVMFLDYDGTLSPIVEDPDKAFITHEMREVVKDVASNFPTAIVTGRSIEKVRSFVQVNEI  177

Query  706   YYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVEN  885
             YYAGSHGMDI+GP+  +   + + E VLFQPA EFLPMI++V   L E+T   PG  VEN
Sbjct  178   YYAGSHGMDIEGPTNENSNGQ-SNERVLFQPAREFLPMIEKVVNILEEKTKWIPGAMVEN  236

Query  886   NKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFL  1065
             NKFC+SVHFR VDE +W  LA+ V+SVL +YPKL+LTQGRKVLEIRP I+WDKG+AL FL
Sbjct  237   NKFCLSVHFRRVDEKRWPALAEVVKSVLIDYPKLKLTQGRKVLEIRPTIKWDKGQALNFL  296

Query  1066  LESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEV  1245
             L+SLGY NS DV PVYIGDDRTDEDAFKVLRE  QGFGILVSK+PKDT+ASYSLQ+PS+V
Sbjct  297   LKSLGYENSDDVVPVYIGDDRTDEDAFKVLRERGQGFGILVSKVPKDTNASYSLQDPSQV  356

Query  1246  MLFLRRLVEWK  1278
               FL RLVEWK
Sbjct  357   NKFLERLVEWK  367



>ref|XP_006302406.1| hypothetical protein CARUB_v10020479mg [Capsella rubella]
 gb|EOA35304.1| hypothetical protein CARUB_v10020479mg [Capsella rubella]
Length=376

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 249/309 (81%), Gaps = 7/309 (2%)
 Frame = +1

Query  370   AAKVSSWVDSMRASSPTQKSTPLSD------DHRTWMMQHPSALDMFEQIIKASKGKNIV  531
             A K++SWV+SMR SSPT+  +   D      D  +W+++ PSAL+MF++++ A+KGK IV
Sbjct  62    APKITSWVESMRDSSPTRLRSSSHDSVSDNADKTSWIVRFPSALNMFDEVVNAAKGKQIV  121

Query  532   MFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELYY  711
             MFLDYDGTLSPIV+DPD AF++  MR  V+ +A  FPTAIV+GR  DKV SFV++ E+YY
Sbjct  122   MFLDYDGTLSPIVEDPDKAFITHEMRDVVKDVALNFPTAIVTGRSIDKVRSFVKVNEIYY  181

Query  712   AGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENNK  891
             AGSHGMDI+GP+  + Y + ++E VLFQPA EFLPMI++V K L E+T   PG  VENNK
Sbjct  182   AGSHGMDIEGPTNENSYCQ-SKERVLFQPAREFLPMIEKVVKILEEKTKWIPGAMVENNK  240

Query  892   FCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLLE  1071
             FC+SVHFR VDE +W  LA+ V+SVL +YPKL+LTQGRKVLEIRP I+WDKG+AL FLL+
Sbjct  241   FCLSVHFRRVDEKRWAALAEIVKSVLIDYPKLKLTQGRKVLEIRPTIKWDKGQALNFLLK  300

Query  1072  SLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVML  1251
             SLGY NS +V PVYIGDDRTDEDAFKVLRE  QGFG+LVSK+PKDT+ASYSL++PS+V  
Sbjct  301   SLGYENSKNVVPVYIGDDRTDEDAFKVLREREQGFGVLVSKIPKDTNASYSLKDPSQVKE  360

Query  1252  FLRRLVEWK  1278
             FL+RLVEWK
Sbjct  361   FLKRLVEWK  369



>ref|XP_009128274.1| PREDICTED: trehalose-phosphate phosphatase B isoform X1 [Brassica 
rapa]
Length=377

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 217/374 (58%), Positives = 270/374 (72%), Gaps = 26/374 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV----------PGGYINFDVTSGKELLQNLDVNG--  366
             MT  NV+ VSD N  P  G K   V          P  Y  F      ELL+  D N   
Sbjct  1     MTNQNVI-VSDRN--PILGSKTITVSVSNSPLFSSPPTYFTFPRRKFLELLEAADKNNNN  57

Query  367   ----AAAKVSSWVDSMRASSPTQKSTPL------SDDHRTWMMQHPSALDMFEQIIKASK  516
                  A K+SSWVDSMR SSPT+  +        +D+  +W+++ PSAL+MF++I+ A+K
Sbjct  58    KNNLGAGKISSWVDSMRDSSPTRLRSSSRDSDSDNDEKTSWIVRFPSALNMFDKIMNAAK  117

Query  517   GKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRL  696
             GK IVMFLDYDGTLSPIV+DPD A+++  MR  V+ +A  FPTAIV+GR  DKV +FV+L
Sbjct  118   GKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDVALNFPTAIVTGRSIDKVRAFVKL  177

Query  697   AELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVK  876
              E+YYAGSHGMDI+GP+  + Y + + + VLFQPA EF+PMI++V K L E+T   PG  
Sbjct  178   NEIYYAGSHGMDIEGPTNENSYGE-SNQGVLFQPAREFVPMIEKVVKILEEKTKCIPGAM  236

Query  877   VENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKAL  1056
             VENNKFC+SVHFR VDE  W  LA+QV+SVL +YPKL+LTQGRKVLEIRP I+WDKG+AL
Sbjct  237   VENNKFCLSVHFRRVDEKIWAALAEQVKSVLVDYPKLKLTQGRKVLEIRPTIKWDKGQAL  296

Query  1057  EFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEP  1236
              FLL SLG+ +S +V PVYIGDDRTDEDAFKVLRE  QGFGILVSK+PK+T+ASYSLQ+P
Sbjct  297   NFLLRSLGFEHSENVVPVYIGDDRTDEDAFKVLREKGQGFGILVSKVPKETNASYSLQDP  356

Query  1237  SEVMLFLRRLVEWK  1278
             S+V  FL+RLV+WK
Sbjct  357   SQVNEFLKRLVDWK  370



>ref|XP_009390912.1| PREDICTED: probable trehalose-phosphate phosphatase 6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=416

 Score =   414 bits (1064),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/355 (60%), Positives = 254/355 (72%), Gaps = 40/355 (11%)
 Frame = +1

Query  334   KELLQNLDVNGAA---AKVSSWVDSMRASSPTQ-KSTPL---------SDDHRTWMMQHP  474
             K  L  LD+       A++S+WVDSMRASSPT  K+  +          +D+   + QHP
Sbjct  48    KRFLSQLDMGSGGGGGARISAWVDSMRASSPTHVKAAAMLSASFAASHDEDYNNRVKQHP  107

Query  475   SALDMFEQIIKASKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIV  654
             SAL +FE I+ ASKGK IV+FLDYDGTLSPIVDDPD AF+S+ M+ TVR +A +FPTAIV
Sbjct  108   SALSVFEDIVAASKGKQIVVFLDYDGTLSPIVDDPDRAFISNAMKETVRDVARHFPTAIV  167

Query  655   SGRCTDKVYSFVRLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVY  834
             SGR  DKV+SFVRL ELYYAGSHGMDIKGP++ +K+ K   + VLFQPA+EFLPMIDEVY
Sbjct  168   SGRRRDKVFSFVRLRELYYAGSHGMDIKGPTKRTKHTKAKTKAVLFQPATEFLPMIDEVY  227

Query  835   KTLLEQTSSTPGVKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVL  1014
             K L+E+T    G +VENN F +SVHFRCVDE  W  LA+ VRSVLK+YPKLRLT GRKVL
Sbjct  228   KALMEKTKLIQGSRVENNIFTLSVHFRCVDEKIWSSLAELVRSVLKDYPKLRLTMGRKVL  287

Query  1015  EIRPIIEWDKGKALEFLLESLG---------------------------YANSTDVFPVY  1113
             EIRP I+WDKGKALEF+LESLG                            A+S +VFPVY
Sbjct  288   EIRPSIKWDKGKALEFMLESLGELEQDLIHTLSSPTFNTRSVILLSRTGLADSGNVFPVY  347

Query  1114  IGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVMLFLRRLVEWK  1278
             IGDDRTDEDAFKVL   RQG GILVS++ ++T A  SL++P+EV  FLRRLVEWK
Sbjct  348   IGDDRTDEDAFKVLHGRRQGLGILVSEVIRETSARCSLRQPAEVQKFLRRLVEWK  402



>emb|CDY26848.1| BnaA02g18730D [Brassica napus]
Length=379

 Score =   411 bits (1056),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 216/376 (57%), Positives = 270/376 (72%), Gaps = 28/376 (7%)
 Frame = +1

Query  223   MTRHNVVAVSDPNRFPTAGHKPPVV----------PGGYINFDVTSGKELLQNLDVNG--  366
             MT  NV+ VSD N  P  G K   V          P  Y  F      ELL+  D N   
Sbjct  1     MTNQNVI-VSDRN--PILGSKTITVSVSNSPLFSSPPTYFTFPRRKFLELLEAADKNNNN  57

Query  367   ------AAAKVSSWVDSMRASSPTQKSTPL------SDDHRTWMMQHPSALDMFEQIIKA  510
                    A K++SWVDSMR SSPT+  +        +D+  +W+++ PSAL+MF++I+ A
Sbjct  58    NNKNNLGAGKIASWVDSMRDSSPTRLRSSSRDSDSDNDEKTSWIVRFPSALNMFDKIMNA  117

Query  511   SKGKNIVMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFV  690
             +KGK IVMFLDYDGTLSPIV+DPD A+++  MR  V+ +A  FPTAIV+GR  DKV +FV
Sbjct  118   AKGKQIVMFLDYDGTLSPIVEDPDKAYITHEMREVVKDVALNFPTAIVTGRSIDKVRAFV  177

Query  691   RLAELYYAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPG  870
             +L E+YYAGSHGMDI+GP+  + Y + + + VLFQPA EF+PMI++V K L E+T   PG
Sbjct  178   KLNEIYYAGSHGMDIEGPTNENSYGE-SNQGVLFQPAREFVPMIEKVVKILEEKTKCIPG  236

Query  871   VKVENNKFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGK  1050
               VENNKFC+SVHFR VDE  W  LA+QV+SVL +YPKL+LTQGRKVLEIRP I+WDKG+
Sbjct  237   AMVENNKFCLSVHFRRVDEKIWAALAEQVKSVLVDYPKLKLTQGRKVLEIRPTIKWDKGQ  296

Query  1051  ALEFLLESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQ  1230
             AL FLL SLG+ +S +V PVYIGDDRTDEDAFKVLRE  QGFGILVSK+PK+T+ASYSLQ
Sbjct  297   ALNFLLRSLGFEHSENVVPVYIGDDRTDEDAFKVLREKGQGFGILVSKVPKETNASYSLQ  356

Query  1231  EPSEVMLFLRRLVEWK  1278
             +PS+V  FL+RLV+WK
Sbjct  357   DPSQVNEFLKRLVDWK  372



>emb|CDX88416.1| BnaC06g38600D [Brassica napus]
Length=378

 Score =   410 bits (1055),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 246/310 (79%), Gaps = 6/310 (2%)
 Frame = +1

Query  367   AAAKVSSWVDSMRASSPTQ-----KSTPLSDDHRT-WMMQHPSALDMFEQIIKASKGKNI  528
              A K++SWVDSMR SSPT+     + +   +DH+T W+++ PSAL+MF++I+ A+KGK I
Sbjct  62    GAGKIASWVDSMRDSSPTRLRPSSRDSVSDNDHKTSWIVRFPSALNMFDEIVNAAKGKQI  121

Query  529   VMFLDYDGTLSPIVDDPDSAFMSDPMRATVRKLATYFPTAIVSGRCTDKVYSFVRLAELY  708
             VMFLDYDGTLSPIV+DPD A+++  MR  V+ +A  FPTAIV+GR  DKV  FV+L E+Y
Sbjct  122   VMFLDYDGTLSPIVEDPDKAYITHEMREVVKNVALNFPTAIVTGRSIDKVRGFVKLDEIY  181

Query  709   YAGSHGMDIKGPSRGSKYKKGAEEDVLFQPASEFLPMIDEVYKTLLEQTSSTPGVKVENN  888
             YAGSHGMDI+GP+    Y   + + VLFQPA EF+P I++VYK L E+T   PG  VENN
Sbjct  182   YAGSHGMDIEGPTSEYAYGGVSNQGVLFQPAREFVPTIEKVYKILEEKTKWIPGAMVENN  241

Query  889   KFCVSVHFRCVDELKWGELAQQVRSVLKEYPKLRLTQGRKVLEIRPIIEWDKGKALEFLL  1068
             KFC+SVHFR VDE +W  LA+QV+SVL +YP+L+LTQGRKVLEIRP I+WDKG+AL FLL
Sbjct  242   KFCLSVHFRRVDEKRWAGLAEQVKSVLIDYPQLKLTQGRKVLEIRPTIKWDKGQALNFLL  301

Query  1069  ESLGYANSTDVFPVYIGDDRTDEDAFKVLRETRQGFGILVSKLPKDTHASYSLQEPSEVM  1248
             +SLG+  S DV PVYIGDD TDEDAFKVLRE  QGFGILVSK+PK+T ASYSLQ+PS+V 
Sbjct  302   KSLGFEKSEDVVPVYIGDDLTDEDAFKVLRERGQGFGILVSKVPKETDASYSLQDPSQVN  361

Query  1249  LFLRRLVEWK  1278
              FLRRLVEWK
Sbjct  362   EFLRRLVEWK  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5309665725034