BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21046_g1_i1 len=549 path=[1:0-548]

Length=549
                                                                      Score     E

ref|XP_006341968.1|  PREDICTED: probable mitochondrial chaperone ...    117   1e-27   
ref|XP_007223383.1|  hypothetical protein PRUPE_ppa005618mg             115   5e-27   
ref|XP_008220843.1|  PREDICTED: probable mitochondrial chaperone ...    113   2e-26   
ref|XP_009790803.1|  PREDICTED: probable mitochondrial chaperone ...    112   3e-26   
ref|XP_009790802.1|  PREDICTED: probable mitochondrial chaperone ...    113   3e-26   
ref|XP_004238276.2|  PREDICTED: probable mitochondrial chaperone ...    113   3e-26   
ref|XP_010320399.1|  PREDICTED: probable mitochondrial chaperone ...    112   3e-26   
ref|XP_011029668.1|  PREDICTED: 26S protease regulatory subunit 6...    111   3e-25   
ref|XP_007045040.1|  ATP binding protein, putative                      110   4e-25   
ref|XP_002312632.2|  hypothetical protein POPTR_0008s17720g             110   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006293261.1|  hypothetical protein CARUB_v10019597mg             110   5e-25   
ref|XP_006378284.1|  hypothetical protein POPTR_0010s06800g             108   9e-25   
ref|XP_010503768.1|  PREDICTED: probable mitochondrial chaperone ...    108   1e-24   
ref|XP_007045039.1|  ATP binding protein, putative                      108   2e-24   
gb|EYU31186.1|  hypothetical protein MIMGU_mgv1a025149mg                108   2e-24   
ref|XP_002514946.1|  conserved hypothetical protein                     105   2e-24   Ricinus communis
ref|XP_010426631.1|  PREDICTED: probable mitochondrial chaperone ...    108   2e-24   
ref|XP_010105784.1|  putative mitochondrial chaperone bcs1              108   3e-24   
ref|XP_010086943.1|  putative mitochondrial chaperone bcs1              106   4e-24   
ref|XP_010412714.1|  PREDICTED: probable mitochondrial chaperone ...    107   4e-24   
ref|XP_008782422.1|  PREDICTED: mitochondrial chaperone BCS1            107   4e-24   
ref|XP_002521530.1|  ATP binding protein, putative                      107   5e-24   Ricinus communis
ref|NP_190663.2|  cytochrome BC1 synthesis-like protein                 107   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028886.1|  PREDICTED: mitochondrial chaperone BCS1-like       107   5e-24   
emb|CAB42923.1|  putative mitochondrial protein                         107   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004310209.1|  PREDICTED: mitochondrial chaperone BCS1-like       107   6e-24   
ref|XP_008466531.1|  PREDICTED: mitochondrial chaperone BCS1-like       107   7e-24   
ref|XP_004239200.1|  PREDICTED: ATP-dependent zinc metalloproteas...    107   8e-24   
ref|XP_010649112.1|  PREDICTED: uncharacterized protein LOC100262690    106   8e-24   
emb|CAN63362.1|  hypothetical protein VITISV_002406                     106   9e-24   Vitis vinifera
dbj|BAC41960.2|  putative BCS1 protein                                  106   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263593.1|  PREDICTED: mitochondrial chaperone BCS1-like       106   1e-23   
ref|XP_011083653.1|  PREDICTED: probable mitochondrial chaperone ...    105   2e-23   
gb|KCW67878.1|  hypothetical protein EUGRSUZ_F01593                     105   2e-23   
ref|XP_002302018.2|  hypothetical protein POPTR_0002s03410g             105   2e-23   Populus trichocarpa [western balsam poplar]
gb|KFK34344.1|  hypothetical protein AALP_AA5G132900                    105   2e-23   
ref|XP_006361553.1|  PREDICTED: probable mitochondrial chaperone ...    105   2e-23   
ref|XP_010060977.1|  PREDICTED: probable mitochondrial chaperone ...    105   2e-23   
ref|XP_009761879.1|  PREDICTED: 26S protease regulatory subunit 4...    105   2e-23   
ref|XP_008338166.1|  PREDICTED: mitochondrial chaperone BCS1-like       105   3e-23   
ref|XP_010655475.1|  PREDICTED: ATP-dependent zinc metalloproteas...    105   3e-23   
emb|CBI27588.3|  unnamed protein product                                105   3e-23   
ref|XP_009115774.1|  PREDICTED: probable mitochondrial chaperone ...    104   3e-23   
ref|XP_008367101.1|  PREDICTED: LOW QUALITY PROTEIN: probable mit...    104   4e-23   
ref|XP_002514947.1|  Mitochondrial chaperone BCS1, putative             103   4e-23   Ricinus communis
ref|XP_008377205.1|  PREDICTED: mitochondrial chaperone BCS1-like       104   4e-23   
gb|KDP25711.1|  hypothetical protein JCGZ_24012                       99.8    4e-23   
gb|KFK34343.1|  hypothetical protein AALP_AA5G132800                    105   5e-23   
ref|XP_007046849.1|  Cytochrome BC1 synthesis, putative                 105   5e-23   
ref|XP_002514945.1|  ATP binding protein, putative                      105   5e-23   Ricinus communis
ref|XP_004293198.1|  PREDICTED: probable mitochondrial chaperone ...    104   5e-23   
emb|CBI17461.3|  unnamed protein product                                106   5e-23   
ref|XP_009115773.1|  PREDICTED: probable mitochondrial chaperone ...    104   5e-23   
ref|XP_003631351.2|  PREDICTED: ATP-dependent zinc metalloproteas...    104   5e-23   
ref|XP_006291089.1|  hypothetical protein CARUB_v10017204mg             104   6e-23   
emb|CBI27589.3|  unnamed protein product                                104   6e-23   
ref|XP_006391672.1|  hypothetical protein EUTSA_v10023809mg             102   6e-23   
ref|XP_009586810.1|  PREDICTED: probable mitochondrial chaperone ...    103   6e-23   
ref|XP_010655485.1|  PREDICTED: ATP-dependent zinc metalloproteas...    104   6e-23   
emb|CAN79835.1|  hypothetical protein VITISV_036161                     104   6e-23   Vitis vinifera
emb|CDP01981.1|  unnamed protein product                                104   7e-23   
ref|XP_006654862.1|  PREDICTED: uncharacterized protein LOC102720799    104   7e-23   
ref|XP_011087108.1|  PREDICTED: mitochondrial chaperone BCS1-like       104   7e-23   
emb|CAN70582.1|  hypothetical protein VITISV_031444                     104   7e-23   Vitis vinifera
ref|XP_004289097.1|  PREDICTED: uncharacterized protein LOC101300961    106   8e-23   
ref|NP_001174549.1|  Os05g0588850                                       103   8e-23   
ref|XP_010113404.1|  putative mitochondrial chaperone bcs1              104   1e-22   
ref|XP_008338173.1|  PREDICTED: uncharacterized protein LOC103401240    103   1e-22   
ref|XP_006438092.1|  hypothetical protein CICLE_v10031330mg             103   1e-22   
ref|XP_006484060.1|  PREDICTED: 26S protease regulatory subunit 8...    103   1e-22   
ref|XP_010113405.1|  putative mitochondrial chaperone bcs1              103   1e-22   
ref|XP_008354651.1|  PREDICTED: uncharacterized protein LOC103418296    103   2e-22   
ref|XP_010245231.1|  PREDICTED: ATPase family AAA domain-containi...    103   2e-22   
ref|XP_010655467.1|  PREDICTED: peroxisomal biogenesis factor 6-l...    103   2e-22   
ref|XP_009615811.1|  PREDICTED: 26S protease regulatory subunit 8...    102   3e-22   
ref|XP_010515474.1|  PREDICTED: uncharacterized protein LOC104791324    102   3e-22   
ref|XP_010655473.1|  PREDICTED: peroxisomal biogenesis factor 6-l...    103   4e-22   
ref|XP_010925267.1|  PREDICTED: mitochondrial chaperone BCS1-like       102   4e-22   
ref|XP_010503767.1|  PREDICTED: putative cell division cycle ATPase     102   4e-22   
ref|XP_004249747.1|  PREDICTED: ATP-dependent zinc metalloproteas...    102   4e-22   
ref|XP_010312103.1|  PREDICTED: ATP-dependent zinc metalloproteas...    101   4e-22   
ref|XP_006466842.1|  PREDICTED: mitochondrial chaperone BCS1-like       102   4e-22   
gb|KDO71005.1|  hypothetical protein CISIN_1g012016mg                   102   4e-22   
ref|XP_006425625.1|  hypothetical protein CICLE_v10025530mg             102   4e-22   
ref|XP_010086941.1|  putative mitochondrial chaperone bcs1              102   4e-22   
emb|CAN69873.1|  hypothetical protein VITISV_030608                     102   5e-22   Vitis vinifera
ref|XP_010655379.1|  PREDICTED: 26S protease regulatory subunit 6...    102   5e-22   
gb|EYU31187.1|  hypothetical protein MIMGU_mgv1a005299mg                102   5e-22   
gb|KDP25709.1|  hypothetical protein JCGZ_24010                         101   5e-22   
ref|XP_004147876.1|  PREDICTED: probable mitochondrial chaperone ...    101   6e-22   
ref|XP_006351393.1|  PREDICTED: putative cell division cycle ATPa...    101   6e-22   
ref|XP_010041836.1|  PREDICTED: probable mitochondrial chaperone ...  97.8    6e-22   
ref|XP_007224211.1|  hypothetical protein PRUPE_ppa017216mg             100   6e-22   
ref|XP_006403972.1|  hypothetical protein EUTSA_v10010287mg             102   6e-22   
dbj|BAJ95992.1|  predicted protein                                      102   6e-22   
gb|KDO71008.1|  hypothetical protein CISIN_1g011935mg                   100   7e-22   
ref|XP_006466846.1|  PREDICTED: ATP-dependent zinc metalloproteas...    100   7e-22   
ref|NP_001043516.1|  Os01g0605100                                       101   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002283754.2|  PREDICTED: probable mitochondrial chaperone ...    101   7e-22   Vitis vinifera
emb|CDX73766.1|  BnaC08g22370D                                          103   8e-22   
ref|XP_009592953.1|  PREDICTED: probable mitochondrial chaperone ...    101   8e-22   
gb|EAY99234.1|  hypothetical protein OsI_21193                          101   8e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_010426630.1|  PREDICTED: probable mitochondrial chaperone ...    101   8e-22   
ref|XP_008241895.1|  PREDICTED: probable mitochondrial chaperone ...    101   9e-22   
ref|XP_010925278.1|  PREDICTED: probable mitochondrial chaperone ...    101   9e-22   
emb|CDY26528.1|  BnaC01g23710D                                          101   9e-22   
emb|CDX77967.1|  BnaA09g31620D                                          103   9e-22   
gb|EAY74873.1|  hypothetical protein OsI_02762                          101   1e-21   Oryza sativa Indica Group [Indian rice]
gb|EAZ12619.1|  hypothetical protein OsJ_02530                          101   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006466845.1|  PREDICTED: ATP-dependent zinc metalloproteas...    100   1e-21   
ref|XP_009624476.1|  PREDICTED: transitional endoplasmic reticulu...    101   1e-21   
gb|KDO71007.1|  hypothetical protein CISIN_1g011935mg                   100   1e-21   
ref|XP_009598953.1|  PREDICTED: LOW QUALITY PROTEIN: putative cel...    100   1e-21   
ref|XP_006425622.1|  hypothetical protein CICLE_v10025528mg             100   1e-21   
emb|CBI27574.3|  unnamed protein product                                102   1e-21   
ref|XP_010515473.1|  PREDICTED: probable mitochondrial chaperone ...    101   1e-21   
ref|XP_009783764.1|  PREDICTED: probable mitochondrial chaperone ...    100   1e-21   
ref|XP_004287870.1|  PREDICTED: probable mitochondrial chaperone ...  97.8    1e-21   
ref|XP_002510426.1|  ATP binding protein, putative                      100   2e-21   Ricinus communis
ref|XP_006644345.1|  PREDICTED: mitochondrial chaperone BCS1-like       100   2e-21   
gb|KDP25712.1|  hypothetical protein JCGZ_24013                         100   2e-21   
gb|KDP25708.1|  hypothetical protein JCGZ_24009                         100   2e-21   
ref|XP_007017603.1|  P-loop containing nucleoside triphosphate hy...  98.6    3e-21   
ref|XP_007204413.1|  hypothetical protein PRUPE_ppb019907mg           99.0    3e-21   
ref|XP_008241725.1|  PREDICTED: uncharacterized protein LOC103340128    100   3e-21   
gb|EMT30637.1|  Putative mitochondrial chaperone bcs1                   100   3e-21   
ref|XP_002441611.1|  hypothetical protein SORBIDRAFT_09g030310        99.8    3e-21   Sorghum bicolor [broomcorn]
ref|XP_009400490.1|  PREDICTED: probable mitochondrial chaperone ...  99.4    3e-21   
ref|XP_008236924.1|  PREDICTED: mitochondrial chaperone BCS1-like     99.8    3e-21   
gb|EMS57301.1|  Mitochondrial chaperone BCS1                            100   3e-21   
ref|XP_010033425.1|  PREDICTED: mitochondrial chaperone BCS1-like     99.8    3e-21   
ref|XP_010113402.1|  putative mitochondrial chaperone bcs1            99.8    4e-21   
gb|KDP25705.1|  hypothetical protein JCGZ_24006                       95.5    4e-21   
gb|EYU37815.1|  hypothetical protein MIMGU_mgv1a018911mg              99.4    4e-21   
ref|NP_001167860.1|  hypothetical protein                             99.0    4e-21   Zea mays [maize]
emb|CDP18341.1|  unnamed protein product                              99.8    4e-21   
ref|XP_006654863.1|  PREDICTED: probable mitochondrial chaperone ...  99.4    5e-21   
ref|XP_008777540.1|  PREDICTED: probable mitochondrial chaperone ...  99.0    5e-21   
ref|XP_006290890.1|  hypothetical protein CARUB_v10017002mg           99.8    5e-21   
ref|XP_007199173.1|  hypothetical protein PRUPE_ppa021397mg           99.0    5e-21   
ref|XP_008441126.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   5e-21   
gb|KHN00516.1|  Putative mitochondrial chaperone bcs1                 99.0    5e-21   
ref|XP_003569314.1|  PREDICTED: probable mitochondrial chaperone ...  99.0    6e-21   
dbj|BAK02275.1|  predicted protein                                    99.0    6e-21   
emb|CDX73767.1|  BnaC08g22360D                                        99.8    6e-21   
ref|XP_010230962.1|  PREDICTED: probable mitochondrial chaperone ...  99.0    6e-21   
ref|XP_009611008.1|  PREDICTED: probable mitochondrial chaperone ...  99.0    6e-21   
ref|XP_003520292.1|  PREDICTED: transitional endoplasmic reticulu...  99.0    6e-21   
ref|XP_004969095.1|  PREDICTED: mitochondrial chaperone BCS1-like     99.0    6e-21   
emb|CDX78758.1|  BnaA03g06700D                                        96.3    6e-21   
ref|XP_010668035.1|  PREDICTED: probable mitochondrial chaperone ...  99.4    6e-21   
gb|KDP44563.1|  hypothetical protein JCGZ_22145                       97.8    6e-21   
ref|XP_010227813.1|  PREDICTED: uncharacterized protein LOC100829577  99.4    7e-21   
gb|KCW53076.1|  hypothetical protein EUGRSUZ_J02376                   98.6    7e-21   
emb|CDX77966.1|  BnaA09g31610D                                        99.4    7e-21   
ref|XP_009115772.1|  PREDICTED: putative cell division cycle ATPase   99.4    8e-21   
gb|EYU32906.1|  hypothetical protein MIMGU_mgv1a006796mg              98.2    8e-21   
ref|XP_010492742.1|  PREDICTED: mitochondrial chaperone BCS1-like     96.3    8e-21   
ref|XP_009798897.1|  PREDICTED: transitional endoplasmic reticulu...  99.0    8e-21   
ref|XP_002455914.1|  hypothetical protein SORBIDRAFT_03g027200        98.6    8e-21   Sorghum bicolor [broomcorn]
gb|KDO47912.1|  hypothetical protein CISIN_1g011286mg                 98.6    8e-21   
gb|KDO47911.1|  hypothetical protein CISIN_1g011286mg                 98.6    9e-21   
ref|XP_010033437.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    9e-21   
ref|XP_002441612.1|  hypothetical protein SORBIDRAFT_09g030320        98.6    9e-21   Sorghum bicolor [broomcorn]
ref|XP_006487222.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    9e-21   
ref|XP_010033436.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    9e-21   
gb|AFW71485.1|  hypothetical protein ZEAMMB73_526250                  96.7    9e-21   
ref|XP_006423337.1|  hypothetical protein CICLE_v10028347mg           98.2    1e-20   
ref|XP_010033434.1|  PREDICTED: probable mitochondrial chaperone ...  98.6    1e-20   
ref|XP_011025849.1|  PREDICTED: putative cell division cycle ATPase   98.2    1e-20   
gb|KDP44568.1|  hypothetical protein JCGZ_22150                       98.2    1e-20   
ref|NP_850841.1|  P-loop containing nucleoside triphosphate hydro...  98.6    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033435.1|  PREDICTED: probable mitochondrial chaperone ...  97.8    1e-20   
ref|XP_010549720.1|  PREDICTED: mitochondrial chaperone BCS1          98.2    1e-20   
ref|XP_002441613.1|  hypothetical protein SORBIDRAFT_09g030330        97.8    1e-20   Sorghum bicolor [broomcorn]
ref|XP_004289100.1|  PREDICTED: probable mitochondrial chaperone ...  95.9    1e-20   
gb|AFW79394.1|  chaperone BCS1                                        96.7    1e-20   
gb|AGV54871.1|  mitochondrial chaperone BCS1-like isoform 5           98.2    2e-20   
ref|XP_007046840.1|  P-loop containing nucleoside triphosphate hy...  98.2    2e-20   
ref|XP_007046839.1|  P-loop containing nucleoside triphosphate hy...  98.2    2e-20   
gb|KCW53073.1|  hypothetical protein EUGRSUZ_J02373                   97.4    2e-20   
ref|XP_004961039.1|  PREDICTED: probable mitochondrial chaperone ...  97.4    2e-20   
ref|XP_002310265.1|  AAA-type ATPase family protein                   97.4    2e-20   Populus trichocarpa [western balsam poplar]
gb|EMT02204.1|  Putative mitochondrial chaperone BCS1-B               97.1    2e-20   
ref|XP_010033429.1|  PREDICTED: probable mitochondrial chaperone ...  97.8    2e-20   
ref|XP_006383165.1|  hypothetical protein POPTR_0005s12200g           97.8    2e-20   
gb|EMT29435.1|  Putative mitochondrial chaperone bcs1                 97.4    2e-20   
gb|KDO38746.1|  hypothetical protein CISIN_1g024550mg                 95.5    2e-20   
ref|XP_006346970.1|  PREDICTED: probable mitochondrial chaperone ...  97.8    2e-20   
ref|XP_010245232.1|  PREDICTED: uncharacterized protein LOC104588825  97.8    2e-20   
ref|XP_009604677.1|  PREDICTED: mitochondrial chaperone BCS1-like     97.4    2e-20   
ref|XP_007046848.1|  ATP binding protein, putative                    97.8    2e-20   
emb|CBI27584.3|  unnamed protein product                              97.1    2e-20   
ref|XP_006487229.1|  PREDICTED: probable mitochondrial chaperone ...  97.4    2e-20   
emb|CDP10348.1|  unnamed protein product                              95.9    3e-20   
ref|XP_010655455.1|  PREDICTED: mitochondrial chaperone BCS1-like     97.1    3e-20   
ref|XP_008338052.1|  PREDICTED: ATPase family gene 2 protein-like     97.4    3e-20   
gb|EMS64027.1|  putative mitochondrial chaperone bcs1                 97.1    3e-20   
ref|XP_003537605.1|  PREDICTED: mitochondrial chaperone BCS1-like...  97.4    3e-20   
ref|XP_003537604.1|  PREDICTED: mitochondrial chaperone BCS1-like...  97.4    3e-20   
gb|AAK43926.1|AF370607_1  putative mitochondrial protein              97.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64718.1|  BCS1 protein-like protein                             97.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008650092.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  96.7    3e-20   
ref|XP_010113403.1|  putative mitochondrial chaperone BCS1-B          97.4    3e-20   
gb|KDP46725.1|  hypothetical protein JCGZ_06513                       95.1    3e-20   
ref|NP_190662.2|  cytochrome BC1 synthesis                            97.4    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028420.1|  PREDICTED: putative cell division cycle ATPase   97.1    4e-20   
dbj|BAJ97155.1|  predicted protein                                    97.1    4e-20   
ref|NP_001147824.1|  mitochondrial chaperone BCS1                     96.7    4e-20   Zea mays [maize]
ref|XP_004293765.1|  PREDICTED: mitochondrial chaperone BCS1-like     96.3    4e-20   
ref|XP_006343389.1|  PREDICTED: probable mitochondrial chaperone ...  97.1    4e-20   
emb|CDP13323.1|  unnamed protein product                              96.3    4e-20   
ref|XP_004289118.1|  PREDICTED: uncharacterized protein LOC101307633  97.1    4e-20   
ref|XP_004233533.1|  PREDICTED: probable mitochondrial chaperone ...  96.7    4e-20   
ref|XP_006340660.1|  PREDICTED: cell division cycle protein 48 ho...  96.7    5e-20   
emb|CDP01979.1|  unnamed protein product                              96.7    5e-20   
ref|XP_008225835.1|  PREDICTED: 26S protease regulatory subunit 6...  96.3    5e-20   
ref|XP_006343388.1|  PREDICTED: probable mitochondrial chaperone ...  96.7    5e-20   
ref|XP_003517208.1|  PREDICTED: mitochondrial chaperone BCS1-like...  96.7    5e-20   
ref|XP_009632017.1|  PREDICTED: probable mitochondrial chaperone ...  96.7    5e-20   
ref|XP_009149357.1|  PREDICTED: mitochondrial chaperone BCS1-like     96.3    6e-20   
ref|XP_004232432.1|  PREDICTED: cell division cycle protein 48 ho...  96.7    6e-20   
ref|XP_004308901.1|  PREDICTED: mitochondrial chaperone BCS1-like     95.9    6e-20   
ref|XP_006423339.1|  hypothetical protein CICLE_v10028331mg           96.3    6e-20   
emb|CDY57636.1|  BnaAnng14800D                                        95.9    6e-20   
ref|XP_006423342.1|  hypothetical protein CICLE_v10028341mg           96.3    6e-20   
ref|XP_002521535.1|  Mitochondrial chaperone BCS1, putative           96.3    6e-20   Ricinus communis
ref|XP_010680068.1|  PREDICTED: probable mitochondrial chaperone ...  96.3    6e-20   
ref|XP_007158594.1|  hypothetical protein PHAVU_002G165700g           96.3    6e-20   
ref|XP_011025866.1|  PREDICTED: probable mitochondrial chaperone ...  96.3    6e-20   
tpg|DAA58874.1|  TPA: hypothetical protein ZEAMMB73_958179            95.9    7e-20   
ref|XP_008241721.1|  PREDICTED: probable mitochondrial chaperone ...  96.3    7e-20   
ref|XP_003560147.1|  PREDICTED: mitochondrial chaperone BCS1-like     95.9    7e-20   
ref|XP_006487228.1|  PREDICTED: probable mitochondrial chaperone ...  95.9    7e-20   
emb|CDY38456.1|  BnaA10g17020D                                        96.3    7e-20   
gb|EMS53320.1|  putative mitochondrial chaperone BCS1-B               96.3    8e-20   
ref|XP_004287871.1|  PREDICTED: uncharacterized protein LOC101292249  96.3    8e-20   
emb|CDP10341.1|  unnamed protein product                              96.3    8e-20   
ref|XP_010420505.1|  PREDICTED: ATP-dependent zinc metalloproteas...  95.9    8e-20   
gb|AGT16562.1|  hypothetical protein SHCRBa_008_G08_R_120             95.5    8e-20   
ref|XP_009121058.1|  PREDICTED: mitochondrial chaperone BCS1-like     96.3    8e-20   
gb|KDP46731.1|  hypothetical protein JCGZ_06519                       96.7    9e-20   
ref|XP_004234548.1|  PREDICTED: probable mitochondrial chaperone ...  95.9    9e-20   
ref|XP_010936769.1|  PREDICTED: mitochondrial chaperone BCS1-like     95.5    9e-20   
ref|XP_011025845.1|  PREDICTED: probable mitochondrial chaperone ...  95.9    9e-20   
ref|XP_010453978.1|  PREDICTED: peroxisomal ATPase PEX6-like          95.9    9e-20   
ref|XP_004167494.1|  PREDICTED: uncharacterized protein LOC101229...  95.5    9e-20   
gb|AES95029.2|  P-loop nucleoside triphosphate hydrolase superfam...  95.9    1e-19   
ref|XP_008346043.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    1e-19   
ref|XP_008371896.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    1e-19   
emb|CDY30324.1|  BnaA09g09530D                                        95.9    1e-19   
ref|XP_006423341.1|  hypothetical protein CICLE_v10030371mg           95.5    1e-19   
gb|KDP44561.1|  hypothetical protein JCGZ_22143                       95.1    1e-19   
ref|XP_004167493.1|  PREDICTED: uncharacterized protein LOC101229...  95.5    1e-19   
ref|XP_008452101.1|  PREDICTED: mitochondrial chaperone BCS1-like     95.9    1e-19   
ref|XP_010655270.1|  PREDICTED: probable mitochondrial chaperone ...  95.1    1e-19   
gb|EMS53321.1|  putative mitochondrial chaperone BCS1-B               95.5    1e-19   
gb|KCW53069.1|  hypothetical protein EUGRSUZ_J02366                   95.1    1e-19   
ref|XP_002310261.2|  AAA-type ATPase family protein                   95.5    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004957870.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    1e-19   
ref|XP_007201958.1|  hypothetical protein PRUPE_ppa004657mg           95.5    1e-19   
ref|XP_009131606.1|  PREDICTED: 26S protease regulatory subunit 8...  95.5    1e-19   
ref|XP_004512074.1|  PREDICTED: 26S protease regulatory subunit 8...  95.5    1e-19   
emb|CDY16892.1|  BnaC09g40190D                                        95.5    1e-19   
ref|XP_008373069.1|  PREDICTED: ATP-dependent zinc metalloproteas...  95.1    1e-19   
ref|XP_004512073.1|  PREDICTED: 26S protease regulatory subunit 8...  95.5    1e-19   
ref|XP_011025863.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    1e-19   
ref|XP_011083190.1|  PREDICTED: probable mitochondrial chaperone ...  95.5    1e-19   
ref|XP_010276828.1|  PREDICTED: uncharacterized protein LOC104611465  95.9    1e-19   
emb|CDP10337.1|  unnamed protein product                              95.5    1e-19   
ref|XP_003596388.1|  Mitochondrial chaperone BCS1                     94.7    1e-19   
emb|CDX90674.1|  BnaA03g41070D                                        95.1    2e-19   
ref|XP_010034678.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  95.1    2e-19   
ref|XP_003612071.1|  Cell division protease ftsH-like protein         95.9    2e-19   
ref|XP_009136576.1|  PREDICTED: probable mitochondrial chaperone ...  95.1    2e-19   
ref|XP_007156079.1|  hypothetical protein PHAVU_003G256600g           95.1    2e-19   
gb|AES66639.2|  P-loop nucleoside triphosphate hydrolase superfam...  94.7    2e-19   
gb|AGT16564.1|  mitochondrial chaperone                               94.7    2e-19   
ref|XP_011025851.1|  PREDICTED: probable mitochondrial chaperone ...  95.1    2e-19   
ref|XP_011025850.1|  PREDICTED: mitochondrial sorting homolog iso...  95.1    2e-19   
ref|XP_003596404.1|  Mitochondrial chaperone BCS1                     94.7    2e-19   
ref|XP_009771650.1|  PREDICTED: probable mitochondrial chaperone ...  95.1    2e-19   
ref|XP_006465143.1|  PREDICTED: probable mitochondrial chaperone ...  93.2    2e-19   
ref|XP_010690844.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    2e-19   
ref|XP_002310264.2|  hypothetical protein POPTR_0007s13320g           95.1    2e-19   
ref|XP_003547962.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    2e-19   
ref|XP_006287563.1|  hypothetical protein CARUB_v10000774mg           94.7    2e-19   
ref|XP_004170090.1|  PREDICTED: mitochondrial chaperone BCS1-like     94.7    2e-19   
ref|XP_002521536.1|  ATP binding protein, putative                    95.1    2e-19   
ref|XP_010691090.1|  PREDICTED: uncharacterized protein LOC104904519  94.7    2e-19   
ref|XP_004146550.1|  PREDICTED: uncharacterized protein LOC101217052  94.7    2e-19   
ref|XP_009805071.1|  PREDICTED: 26S protease regulatory subunit 8...  94.7    2e-19   
ref|XP_007046843.1|  P-loop containing nucleoside triphosphate hy...  94.0    3e-19   
ref|XP_006343432.1|  PREDICTED: putative cell division cycle ATPa...  94.4    3e-19   
ref|XP_009615009.1|  PREDICTED: probable mitochondrial chaperone ...  94.4    3e-19   
ref|XP_006599360.1|  PREDICTED: probable mitochondrial chaperone ...  94.7    3e-19   
ref|XP_010683381.1|  PREDICTED: probable mitochondrial chaperone ...  93.2    3e-19   
ref|XP_006436358.1|  hypothetical protein CICLE_v10031528mg           94.0    3e-19   
gb|KCW53068.1|  hypothetical protein EUGRSUZ_J02365                   94.0    3e-19   
ref|XP_010034680.1|  PREDICTED: probable mitochondrial chaperone ...  93.2    3e-19   
ref|XP_006423336.1|  hypothetical protein CICLE_v10028857mg           92.8    3e-19   
gb|KDO46837.1|  hypothetical protein CISIN_1g013128mg                 93.6    4e-19   
gb|EMS53322.1|  putative mitochondrial chaperone BCS1-B               94.0    4e-19   
gb|EMT20888.1|  Putative mitochondrial chaperone BCS1-B               94.0    4e-19   
ref|XP_010033428.1|  PREDICTED: probable mitochondrial chaperone ...  94.0    4e-19   
gb|ACU22786.1|  unknown                                               94.0    4e-19   
ref|XP_009112475.1|  PREDICTED: peroxisomal biogenesis factor 6-l...  94.4    4e-19   
ref|XP_007046842.1|  P-loop containing nucleoside triphosphate hy...  94.0    4e-19   
ref|XP_010034677.1|  PREDICTED: uncharacterized protein LOC104423952  94.0    4e-19   
ref|XP_010557749.1|  PREDICTED: probable mitochondrial chaperone ...  93.6    4e-19   
ref|XP_003537611.1|  PREDICTED: probable mitochondrial chaperone ...  94.0    4e-19   
ref|XP_008379647.1|  PREDICTED: mitochondrial chaperone BCS1-like     93.6    4e-19   
gb|EMT29797.1|  Putative mitochondrial chaperone bcs1                 93.2    4e-19   
ref|XP_009112474.1|  PREDICTED: peroxisomal biogenesis factor 6-l...  94.4    4e-19   
ref|XP_006400318.1|  hypothetical protein EUTSA_v10013330mg           94.0    5e-19   
emb|CDY28993.1|  BnaC07g31990D                                        94.0    5e-19   
ref|XP_002460784.1|  hypothetical protein SORBIDRAFT_02g034830        94.0    5e-19   
ref|XP_007046714.1|  P-loop containing nucleoside triphosphate hy...  94.4    5e-19   
emb|CAN83106.1|  hypothetical protein VITISV_041822                   93.6    5e-19   
ref|XP_006466190.1|  PREDICTED: uncharacterized protein LOC102628180  94.4    5e-19   
gb|KDO58720.1|  hypothetical protein CISIN_1g041382mg                 94.4    5e-19   
gb|KCW53072.1|  hypothetical protein EUGRSUZ_J02371                   93.2    6e-19   
ref|XP_004289117.1|  PREDICTED: uncharacterized protein LOC101307344  94.7    6e-19   
ref|XP_004234549.1|  PREDICTED: probable mitochondrial chaperone ...  93.6    6e-19   
ref|XP_011088431.1|  PREDICTED: probable mitochondrial chaperone ...  93.6    6e-19   
gb|AFW81307.1|  hypothetical protein ZEAMMB73_582954                  92.8    6e-19   
ref|XP_006426427.1|  hypothetical protein CICLE_v10025208mg           94.0    6e-19   
ref|XP_004150005.1|  PREDICTED: ATP-dependent zinc metalloproteas...  93.6    6e-19   
ref|XP_010033433.1|  PREDICTED: probable mitochondrial chaperone ...  93.6    6e-19   
ref|XP_002460781.1|  hypothetical protein SORBIDRAFT_02g034790        93.6    6e-19   
gb|KCW53062.1|  hypothetical protein EUGRSUZ_J02356                   93.2    6e-19   
ref|XP_010033426.1|  PREDICTED: uncharacterized protein LOC104422716  93.6    7e-19   
gb|KDP46726.1|  hypothetical protein JCGZ_06514                       94.0    7e-19   
ref|XP_007203925.1|  hypothetical protein PRUPE_ppa018662mg           92.4    7e-19   
ref|XP_009126205.1|  PREDICTED: AFG3-like protein 2                   93.2    7e-19   
gb|KDP30889.1|  hypothetical protein JCGZ_15498                       92.8    7e-19   
emb|CDY59315.1|  BnaAnng15990D                                        93.2    7e-19   
ref|XP_003622403.1|  AAA-ATPase 1-like protein                        93.6    7e-19   
gb|EEC82151.1|  hypothetical protein OsI_26209                        92.8    7e-19   
ref|XP_007212701.1|  hypothetical protein PRUPE_ppa018602mg           92.8    7e-19   
gb|AGT16563.1|  mitochondrial chaperone                               93.2    7e-19   
gb|KFK26001.1|  hypothetical protein AALP_AA8G190000                  93.2    7e-19   
gb|EMT00774.1|  Mitochondrial chaperone BCS1                          91.7    8e-19   
ref|XP_004961038.1|  PREDICTED: probable mitochondrial chaperone ...  92.8    8e-19   
gb|EMT29800.1|  Putative mitochondrial chaperone BCS1-B               93.2    8e-19   
emb|CDX70773.1|  BnaC03g08570D                                        92.8    8e-19   
gb|KGN51687.1|  hypothetical protein Csa_5G590040                     88.6    8e-19   
ref|XP_003612073.1|  hypothetical protein MTR_5g021000                89.4    8e-19   
ref|XP_004961037.1|  PREDICTED: probable mitochondrial chaperone ...  92.8    8e-19   
gb|KDO47913.1|  hypothetical protein CISIN_1g012846mg                 92.8    9e-19   
gb|KGN48864.1|  hypothetical protein Csa_6G504450                     93.2    9e-19   
gb|EMS67182.1|  hypothetical protein TRIUR3_10203                     89.0    9e-19   
ref|XP_006343390.1|  PREDICTED: mitochondrial chaperone BCS1-like     93.2    9e-19   
ref|XP_002460785.1|  hypothetical protein SORBIDRAFT_02g034840        93.2    9e-19   
ref|XP_002517635.1|  conserved hypothetical protein                   91.3    9e-19   
gb|KHN22761.1|  Putative mitochondrial chaperone bcs1                 93.2    9e-19   
gb|KDP44560.1|  hypothetical protein JCGZ_22142                       92.8    1e-18   
ref|XP_009798066.1|  PREDICTED: probable mitochondrial chaperone ...  92.8    1e-18   
ref|XP_004149990.1|  PREDICTED: uncharacterized protein LOC101205...  92.8    1e-18   
ref|NP_192447.1|  AAA-type ATPase family protein                      90.5    1e-18   
ref|XP_004149989.1|  PREDICTED: uncharacterized protein LOC101205...  92.8    1e-18   
ref|XP_010420502.1|  PREDICTED: mitochondrial chaperone BCS1-like     92.4    1e-18   
ref|XP_003596399.1|  Mitochondrial chaperone BCS1                     93.6    1e-18   
gb|KHG10402.1|  putative mitochondrial chaperone bcs1                 92.8    1e-18   
ref|XP_006592932.1|  PREDICTED: mitochondrial chaperone BCS1-like     92.0    1e-18   
gb|EMS53318.1|  putative mitochondrial chaperone BCS1-B               93.2    1e-18   
ref|XP_004961040.1|  PREDICTED: mitochondrial chaperone BCS1-like     92.4    1e-18   
gb|KDP30892.1|  hypothetical protein JCGZ_15501                       92.0    1e-18   
gb|KHG23539.1|  putative mitochondrial chaperone bcs1                 92.4    2e-18   
ref|NP_197275.1|  AAA domain-containing protein                       92.0    2e-18   
ref|XP_003560144.1|  PREDICTED: uncharacterized protein LOC100832286  92.4    2e-18   
emb|CDY29221.1|  BnaA06g25360D                                        91.7    2e-18   
ref|XP_001763152.1|  predicted protein                                90.1    2e-18   
ref|XP_006487227.1|  PREDICTED: mitochondrial chaperone BCS1-like     92.0    2e-18   
ref|XP_007023688.1|  Cytochrome BC1 synthesis, putative               91.3    2e-18   
gb|KDO71006.1|  hypothetical protein CISIN_1g009791mg                 92.4    2e-18   
ref|XP_006425624.1|  hypothetical protein CICLE_v10025354mg           92.4    2e-18   
ref|XP_002512936.1|  ATP binding protein, putative                    92.4    2e-18   
ref|XP_009624708.1|  PREDICTED: mitochondrial chaperone BCS1-like     92.4    2e-18   
ref|XP_006425623.1|  hypothetical protein CICLE_v10025354mg           92.4    2e-18   
ref|XP_007201954.1|  hypothetical protein PRUPE_ppa004603mg           92.4    2e-18   
gb|EMT29802.1|  Putative mitochondrial chaperone BCS1-B               92.0    2e-18   
gb|EMT29803.1|  Putative mitochondrial chaperone BCS1-B               92.4    2e-18   
ref|XP_006400317.1|  hypothetical protein EUTSA_v10015279mg           92.0    2e-18   
ref|XP_008359335.1|  PREDICTED: probable mitochondrial chaperone ...  89.7    2e-18   
gb|EMS53319.1|  putative mitochondrial chaperone BCS1-B               92.0    2e-18   
ref|XP_004287872.1|  PREDICTED: probable mitochondrial chaperone ...  92.0    2e-18   
gb|EMT02261.1|  Putative mitochondrial chaperone BCS1-B               91.3    2e-18   
ref|XP_006423345.1|  hypothetical protein CICLE_v10028304mg           92.0    2e-18   
ref|NP_179411.2|  P-loop containing nucleoside triphosphate hydro...  92.0    2e-18   
ref|XP_010492739.1|  PREDICTED: mitochondrial chaperone BCS1-like     91.7    2e-18   
gb|ABK27085.1|  unknown                                               90.1    2e-18   
gb|KFK33165.1|  hypothetical protein AALP_AA6G338900                  91.7    2e-18   
ref|XP_010679779.1|  PREDICTED: probable mitochondrial chaperone ...  92.0    2e-18   
ref|XP_006388102.1|  hypothetical protein POPTR_0337s00220g           91.7    3e-18   
ref|XP_010679776.1|  PREDICTED: mitochondrial chaperone BCS1-like     91.7    3e-18   
ref|XP_003596387.1|  Mitochondrial chaperone BCS1                     91.3    3e-18   
gb|AFW81310.1|  hypothetical protein ZEAMMB73_440107                  91.3    3e-18   
ref|XP_003565822.1|  PREDICTED: probable mitochondrial chaperone ...  91.3    3e-18   
ref|XP_009603823.1|  PREDICTED: probable mitochondrial chaperone ...  91.7    3e-18   
ref|XP_007046847.1|  P-loop containing nucleoside triphosphate hy...  91.7    3e-18   
ref|XP_002269184.1|  PREDICTED: probable mitochondrial chaperone ...  91.7    3e-18   
ref|XP_006847606.1|  hypothetical protein AMTR_s00014p00241930        91.3    3e-18   
ref|XP_006487238.1|  PREDICTED: probable mitochondrial chaperone ...  91.3    4e-18   
emb|CDY63221.1|  BnaAnng18740D                                        91.3    4e-18   
ref|XP_010467631.1|  PREDICTED: cell division control protein 48 ...  91.3    4e-18   
emb|CBI18437.3|  unnamed protein product                              92.8    4e-18   
ref|XP_010414050.1|  PREDICTED: cell division control protein 48 ...  91.3    4e-18   
ref|XP_009150747.1|  PREDICTED: calmodulin-interacting protein 11...  91.3    4e-18   
ref|XP_010317704.1|  PREDICTED: probable mitochondrial chaperone ...  91.3    4e-18   
ref|XP_010029751.1|  PREDICTED: mitochondrial chaperone BCS1-like     91.3    4e-18   
gb|KDP30887.1|  hypothetical protein JCGZ_15496                       90.1    4e-18   
gb|EEE67277.1|  hypothetical protein OsJ_24463                        90.9    4e-18   
ref|XP_007203418.1|  hypothetical protein PRUPE_ppa021509mg           90.9    4e-18   
ref|XP_007204504.1|  hypothetical protein PRUPE_ppa019191mg           90.5    4e-18   
ref|NP_189502.2|  P-loop containing nucleoside triphosphate hydro...  90.9    4e-18   
ref|XP_009111601.1|  PREDICTED: probable mitochondrial chaperone ...  90.9    4e-18   
ref|XP_004959709.1|  PREDICTED: uncharacterized protein LOC101754826  91.3    4e-18   
gb|KHG10403.1|  putative mitochondrial chaperone bcs1                 90.9    4e-18   
ref|XP_006409187.1|  hypothetical protein EUTSA_v10022958mg           90.9    4e-18   
ref|XP_006847534.1|  hypothetical protein AMTR_s00014p00111720        86.7    4e-18   
ref|XP_002883632.1|  hypothetical protein ARALYDRAFT_480076           86.7    5e-18   
ref|XP_003560146.1|  PREDICTED: probable mitochondrial chaperone ...  90.9    5e-18   
ref|XP_010412439.1|  PREDICTED: probable mitochondrial chaperone ...  88.2    5e-18   
ref|XP_007046846.1|  P-loop containing nucleoside triphosphate hy...  91.3    5e-18   
gb|KDP35052.1|  hypothetical protein JCGZ_11213                       90.5    5e-18   
ref|XP_010420504.1|  PREDICTED: mitochondrial chaperone BCS1-like...  90.9    5e-18   
ref|XP_010424148.1|  PREDICTED: probable mitochondrial chaperone ...  89.0    5e-18   
ref|XP_007212545.1|  hypothetical protein PRUPE_ppa015262mg           90.1    5e-18   
ref|XP_007158597.1|  hypothetical protein PHAVU_002G166000g           90.9    5e-18   
ref|XP_003560148.1|  PREDICTED: probable mitochondrial chaperone ...  90.9    5e-18   
ref|XP_010420503.1|  PREDICTED: mitochondrial chaperone BCS1-like...  90.5    6e-18   
gb|KDP41766.1|  hypothetical protein JCGZ_26784                       90.9    6e-18   
ref|XP_007131808.1|  hypothetical protein PHAVU_011G043100g           90.5    6e-18   
ref|XP_002872752.1|  AAA-type ATPase family protein                   88.2    6e-18   
ref|XP_004289098.1|  PREDICTED: probable mitochondrial chaperone ...  88.6    6e-18   
gb|EMT00775.1|  Putative mitochondrial chaperone bcs1                 90.5    7e-18   
gb|EEC79781.1|  hypothetical protein OsI_21194                        88.6    7e-18   
ref|XP_006375857.1|  hypothetical protein POPTR_0013s04510g           90.9    7e-18   
ref|XP_010105357.1|  putative mitochondrial chaperone bcs1            90.1    7e-18   
ref|XP_010495258.1|  PREDICTED: probable mitochondrial chaperone ...  90.5    7e-18   
emb|CDY00125.1|  BnaC09g01760D                                        90.1    8e-18   
ref|XP_006343431.1|  PREDICTED: uncharacterized protein LOC102583264  90.9    8e-18   
ref|XP_006297415.1|  hypothetical protein CARUB_v10013439mg           90.5    8e-18   
ref|XP_008669733.1|  PREDICTED: probable mitochondrial chaperone ...  90.1    8e-18   
gb|EMT29801.1|  Putative mitochondrial chaperone BCS1-B               90.9    8e-18   
gb|KDP41767.1|  hypothetical protein JCGZ_26785                       90.5    9e-18   
gb|KFK40192.1|  hypothetical protein AALP_AA3G342000                  90.1    9e-18   
ref|XP_004959707.1|  PREDICTED: probable mitochondrial chaperone ...  90.1    1e-17   
gb|AES66657.2|  P-loop nucleoside triphosphate hydrolase superfam...  89.7    1e-17   
ref|XP_006290173.1|  hypothetical protein CARUB_v10003851mg           89.4    1e-17   
emb|CDO97027.1|  unnamed protein product                              90.1    1e-17   
ref|XP_003596406.1|  Mitochondrial chaperone BCS1                     89.7    1e-17   
emb|CDY20912.1|  BnaC06g01320D                                        89.7    1e-17   
ref|XP_011088430.1|  PREDICTED: uncharacterized protein LOC105169662  90.1    1e-17   
ref|XP_004959708.1|  PREDICTED: mitochondrial chaperone BCS1-like     89.7    1e-17   
ref|XP_010041124.1|  PREDICTED: probable mitochondrial chaperone ...  89.7    1e-17   
dbj|BAD42879.1|  AAA-type ATPase like protein                         89.7    1e-17   
ref|XP_004489033.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    1e-17   
ref|NP_849972.1|  P-loop containing nucleoside triphosphate hydro...  89.7    1e-17   
ref|XP_001768974.1|  predicted protein                                89.4    1e-17   
ref|XP_002310262.2|  AAA-type ATPase family protein                   89.7    1e-17   
gb|KCW44626.1|  hypothetical protein EUGRSUZ_L01858                   89.7    1e-17   
ref|XP_003560145.1|  PREDICTED: mitochondrial chaperone BCS1-like     89.7    1e-17   
ref|XP_010456564.1|  PREDICTED: ATP-dependent zinc metalloproteas...  89.7    1e-17   
ref|NP_001050566.1|  Os03g0584400                                     87.8    2e-17   
gb|KHG30044.1|  Mitochondrial chaperone BCS1                          89.7    2e-17   
emb|CDX74412.1|  BnaA04g09770D                                        88.2    2e-17   
dbj|BAJ87784.1|  predicted protein                                    89.4    2e-17   
ref|XP_010514564.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    2e-17   
ref|XP_010425638.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    2e-17   
ref|XP_006845725.1|  hypothetical protein AMTR_s00019p00244450        89.0    2e-17   
ref|XP_010502856.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    2e-17   
emb|CBI37679.3|  unnamed protein product                              88.6    2e-17   
ref|XP_009340060.1|  PREDICTED: probable mitochondrial chaperone ...  89.0    2e-17   
ref|XP_002319660.2|  hypothetical protein POPTR_0013s04520g           89.0    2e-17   
gb|AES66665.2|  P-loop nucleoside triphosphate hydrolase superfam...  88.6    2e-17   
ref|XP_003612075.1|  Mitochondrial chaperone BCS1                     88.2    2e-17   
gb|EMS58097.1|  putative mitochondrial chaperone BCS1-B               87.8    2e-17   
ref|XP_004508798.1|  PREDICTED: probable mitochondrial chaperone ...  89.4    2e-17   
ref|XP_010431485.1|  PREDICTED: mitochondrial chaperone BCS1-like     89.0    2e-17   
ref|XP_002462933.1|  hypothetical protein SORBIDRAFT_02g034850        89.0    3e-17   
ref|XP_004167496.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  88.6    3e-17   
gb|KGN48867.1|  hypothetical protein Csa_6G504480                     88.6    3e-17   
ref|XP_011025956.1|  PREDICTED: probable mitochondrial chaperone ...  88.6    3e-17   
ref|XP_011025846.1|  PREDICTED: uncharacterized AAA domain-contai...  89.0    3e-17   
ref|NP_189501.2|  AAA-type ATPase family protein                      88.6    3e-17   
dbj|BAB02175.1|  mitochondrial protein-like                           88.6    3e-17   
ref|XP_006282526.1|  hypothetical protein CARUB_v10007815mg           89.0    3e-17   
emb|CDP01978.1|  unnamed protein product                              89.0    3e-17   
gb|AAT37998.1|  putative AAA-type ATPase                              88.6    3e-17   
ref|XP_006465145.1|  PREDICTED: probable mitochondrial chaperone ...  88.2    3e-17   
ref|XP_009139945.1|  PREDICTED: probable mitochondrial chaperone ...  88.6    3e-17   
gb|KDP45450.1|  hypothetical protein JCGZ_09699                       85.1    3e-17   
ref|XP_006436359.1|  hypothetical protein CICLE_v10031520mg           88.2    3e-17   
ref|XP_003612072.1|  Cell division protease ftsH-like protein         88.6    3e-17   
ref|XP_003629399.1|  Mitochondrial chaperone BCS1                     88.6    4e-17   
ref|XP_002267368.1|  PREDICTED: probable mitochondrial chaperone ...  88.6    4e-17   
ref|XP_008237253.1|  PREDICTED: probable mitochondrial chaperone ...  85.1    4e-17   
ref|XP_002460780.1|  hypothetical protein SORBIDRAFT_02g034780        88.6    4e-17   



>ref|XP_006341968.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=446

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 75/87 (86%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI+MS+CTF+ F+VLASNYL+ E+H L+ KIE+  L  +VKVTPA
Sbjct  355  DRLDPALLRPGRMDVHIEMSHCTFSGFRVLASNYLKTEEHRLFKKIED--LFQRVKVTPA  412

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+A ELMK++++D+ L NL+ +LQNKE
Sbjct  413  EVAGELMKSNNSDVALENLVKFLQNKE  439



>ref|XP_007223383.1| hypothetical protein PRUPE_ppa005618mg [Prunus persica]
 gb|EMJ24582.1| hypothetical protein PRUPE_ppa005618mg [Prunus persica]
Length=451

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD HI MSYCTF+ FK LA NYLRI++H L+  IE+LL   K + TPA
Sbjct  352  DRLDPALLRPGRMDQHIHMSYCTFSGFKTLAYNYLRIQEHPLFGDIEKLLDYYKAQATPA  411

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+A EL+K+DDA ++L  LI +LQ+K    T
Sbjct  412  EVAGELLKSDDAQVSLQGLITFLQSKNKMET  442



>ref|XP_008220843.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Prunus mume]
Length=451

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCTF+ FK +A NYLRI++H L+  IE+LL   K + TPA
Sbjct  352  DRLDPALLRPGRMDLHIHMSYCTFSGFKTMAYNYLRIQEHPLFGDIEKLLDYYKAQATPA  411

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+A EL+K+DDA ++L  LI  LQ+K    T
Sbjct  412  EVAGELLKSDDAQVSLQGLITLLQSKNKMET  442



>ref|XP_009790803.1| PREDICTED: probable mitochondrial chaperone bcs1 isoform X2 [Nicotiana 
sylvestris]
Length=316

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI+MSYCTF  F++LASNYL+IE+H+ +  IE+  L+LKVK TPA
Sbjct  223  DRLDPALLRPGRMDVHIEMSYCTFGGFRILASNYLKIEEHSKFRVIED--LLLKVKATPA  280

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT*T  270
            E+A ELMK++ A+I L NLI YL NK    T T
Sbjct  281  EVAGELMKSNKAEIALENLIKYLHNKNELLTET  313



>ref|XP_009790802.1| PREDICTED: probable mitochondrial chaperone BCS1-A isoform X1 
[Nicotiana sylvestris]
Length=444

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI+MSYCTF  F++LASNYL+IE+H+ +  IE+  L+LKVK TPA
Sbjct  351  DRLDPALLRPGRMDVHIEMSYCTFGGFRILASNYLKIEEHSKFRVIED--LLLKVKATPA  408

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT*T  270
            E+A ELMK++ A+I L NLI YL NK    T T
Sbjct  409  EVAGELMKSNKAEIALENLIKYLHNKNELLTET  441



>ref|XP_004238276.2| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Solanum lycopersicum]
Length=442

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI+MS+CTF+ F+VLASNYL+ E+H L+ KIE+  L  +VKVTPA
Sbjct  351  DRLDPALLRPGRMDVHIEMSHCTFSGFRVLASNYLKTEEHRLFKKIED--LFQRVKVTPA  408

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+A ELMK++++D+ L NL+ +LQ K+
Sbjct  409  EVAGELMKSNNSDVALENLVKFLQKKK  435



>ref|XP_010320399.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Solanum lycopersicum]
Length=362

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI+MS+CTF+ F+VLASNYL+ E+H L+ KIE+  L  +VKVTPA
Sbjct  271  DRLDPALLRPGRMDVHIEMSHCTFSGFRVLASNYLKTEEHRLFKKIED--LFQRVKVTPA  328

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+A ELMK++++D+ L NL+ +LQ K+
Sbjct  329  EVAGELMKSNNSDVALENLVKFLQKKK  355



>ref|XP_011029668.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Populus 
euphratica]
Length=500

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT   F++LASNYL ++DH+L+ +IEE  L+++V+VTPA
Sbjct  360  DKLDPALLRPGRMDMHIHMSYCTPCGFRILASNYLNVKDHSLFSQIEE--LIMEVEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AEELMKN+D D  L  +I +L+ K+ 
Sbjct  418  EVAEELMKNEDVDTALTGIIGFLERKKG  445



>ref|XP_007045040.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY00872.1| ATP binding protein, putative [Theobroma cacao]
Length=494

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT + F++LASNYL I  H L+ +I+E  L+++V+VTPA
Sbjct  359  DKLDPALLRPGRMDMHIHMSYCTPSGFRILASNYLGITSHKLFTQIDE--LMMEVEVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LMK++DADI L  LI +LQNK++
Sbjct  417  EVAEGLMKSEDADIALEGLIKFLQNKKS  444



>ref|XP_002312632.2| hypothetical protein POPTR_0008s17720g [Populus trichocarpa]
 gb|EEE89999.2| hypothetical protein POPTR_0008s17720g [Populus trichocarpa]
Length=500

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT   FK+LASNYL +++H+L+ +IEE  L+++V+VTPA
Sbjct  360  DKLDPALLRPGRMDMHIHMSYCTPCGFKILASNYLNVKNHSLFSQIEE--LIMEVEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AEELMKN+D D  L  +I +L+ K+ 
Sbjct  418  EVAEELMKNEDVDTALTGIIGFLERKKG  445



>ref|XP_006293261.1| hypothetical protein CARUB_v10019597mg, partial [Capsella rubella]
 gb|EOA26159.1| hypothetical protein CARUB_v10019597mg, partial [Capsella rubella]
Length=457

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT +AFKVLASNYL IE+H L+ K+EE   +   +VTPA
Sbjct  334  EKLDPALLRPGRMDMHIHMSYCTLSAFKVLASNYLEIEEHHLFSKVEE--GIEATEVTPA  391

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  392  EVAEQLMRNDSVDKILEGLIEFLKAKK  418



>ref|XP_006378284.1| hypothetical protein POPTR_0010s06800g [Populus trichocarpa]
 gb|ERP56081.1| hypothetical protein POPTR_0010s06800g [Populus trichocarpa]
Length=424

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 73/87 (84%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT    K+LASNYL +++H+L+ +I+E  L+++V+VTPA
Sbjct  285  DKLDPALLRPGRMDMHIHMSYCTPCGLKILASNYLNVKEHSLFSEIDE--LIMEVEVTPA  342

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AEELMKN+D D TL  LI +L++K+
Sbjct  343  EVAEELMKNEDVDTTLTGLIGFLESKK  369



>ref|XP_010503768.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Camelina 
sativa]
Length=451

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT AAFKVLASNYL IEDH  + +IEE  L+ + +VTPA
Sbjct  364  ERLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIEDHITFEQIEE--LIRETQVTPA  421

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE+LM++D  D  L  L+ +L+ K++
Sbjct  422  EVAEQLMRSDSVDKVLQGLVEFLKAKKS  449



>ref|XP_007045039.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY00871.1| ATP binding protein, putative [Theobroma cacao]
Length=451

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT + F++LASNYL I  H L+ +I+E  L+++V+VTPA
Sbjct  363  DKLDPALLRPGRMDMHIHMSYCTPSGFRILASNYLGITSHNLFTRIDE--LMMEVEVTPA  420

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AEELMK++ ADI L  LI +LQNK+
Sbjct  421  EVAEELMKSEYADIALEGLIKFLQNKK  447



>gb|EYU31186.1| hypothetical protein MIMGU_mgv1a025149mg [Erythranthe guttata]
Length=440

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCTF  FK+LASNYL I +H L+ KIE    V   KVTPA
Sbjct  328  EKLDPALLRPGRMDVHINMSYCTFCGFKLLASNYLGINNHILFEKIE--GSVGIAKVTPA  385

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+L+KNDD +++L  LI ++ NK
Sbjct  386  EVAEQLLKNDDPNVSLRGLINFIHNK  411



>ref|XP_002514946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47500.1| conserved hypothetical protein [Ricinus communis]
Length=233

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYC+ + FK+LASNYL I++H L+ +IE+  L+ +V+VTPA
Sbjct  92   DKLDPALLRPGRMDMHIHMSYCSPSGFKILASNYLNIKNHCLFTEIEK--LIEEVEVTPA  149

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEELMK DD D  L  L  +LQ K+
Sbjct  150  EIAEELMKGDDVDAVLNGLQGFLQRKK  176



>ref|XP_010426631.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Camelina 
sativa]
Length=459

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT AAFKVLASNYL IEDH  + +IEE  L+ + +VTPA
Sbjct  364  ERLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIEDHITFEQIEE--LIRETQVTPA  421

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM++D  D  L  L+ +L+ K+
Sbjct  422  EVAEQLMRSDSVDKVLQGLVEFLKAKK  448



>ref|XP_010105784.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC06137.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=495

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT   FK LA NYL+I+ H L+ +IEE  +++ V+VTPA
Sbjct  362  DKLDPALLRPGRMDMHIHMSYCTPCGFKTLAFNYLQIKSHPLFGEIEE--MIMAVEVTPA  419

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AEELMK+D+ DI L  L+ +LQ K+ 
Sbjct  420  EVAEELMKSDEPDIALAGLVQFLQRKKG  447



>ref|XP_010086943.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB24925.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=331

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI MSY T + FK LA NYLR+++H L+ +IEE   + +VKVTPA
Sbjct  166  DRLDPALLRPGRMDMHIHMSYLTPSGFKTLAFNYLRVKNHPLFGEIEE--RLKEVKVTPA  223

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE LM++D+A++ LG L+ +LQ K+
Sbjct  224  EVAESLMRSDNAEVALGGLVEFLQRKK  250



>ref|XP_010412714.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Camelina 
sativa]
Length=434

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT AAFKVLASNYL I+DH  + +IEE  L+ + +VTPA
Sbjct  347  ERLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIDDHITFEQIEE--LIRETQVTPA  404

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE+LM++D  D  L  L+ +L+ K++
Sbjct  405  EVAEQLMRSDSVDKVLQGLVEFLKAKKS  432



>ref|XP_008782422.1| PREDICTED: mitochondrial chaperone BCS1 [Phoenix dactylifera]
Length=468

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRL+PALLRPGRMD+HI MSYC+ A F+VLASNY R+ DH L+ +IE    + +V+VTPA
Sbjct  359  DRLEPALLRPGRMDVHIHMSYCSPAGFRVLASNYHRLRDHPLFEEIE--ASIKEVEVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT*TLDM--MMEQGSKL  237
            E+AEELMK+DDA++ L  LI  +Q K+   +   D     E G KL
Sbjct  417  EVAEELMKSDDAEVALRGLIKLIQTKKKQASAAPDQNENQEGGRKL  462



>ref|XP_002521530.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40801.1| ATP binding protein, putative [Ricinus communis]
Length=440

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI MSYC+   FK LASNYL + DH L+ +IE   L+   +++PA
Sbjct  339  DRLDPALLRPGRMDMHIHMSYCSPYGFKTLASNYLGVSDHPLFGEIE--ALIESSEISPA  396

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AEELMKNDDAD+ L  LI +++ K+
Sbjct  397  QVAEELMKNDDADVALEGLIQFIKRKK  423



>ref|NP_190663.2| cytochrome BC1 synthesis-like protein [Arabidopsis thaliana]
 gb|ABG48490.1| At3g50940 [Arabidopsis thaliana]
 gb|AEE78729.1| cytochrome BC1 synthesis-like protein [Arabidopsis thaliana]
Length=451

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT AAFKVLASNYL I+DH L+ +IEE   + +++VTPA
Sbjct  360  EKLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIQDHILFEQIEE--FIREIEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM++D  D  L  L+ +L+ K+
Sbjct  418  EVAEQLMRSDSVDKVLQGLVEFLKAKK  444



>ref|XP_011028886.1| PREDICTED: mitochondrial chaperone BCS1-like [Populus euphratica]
Length=446

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+H+ MSYCTF  FK LA NYLR+++H L+ KI+E  L+ KV+ TPA
Sbjct  354  DQLDPALLRPGRMDVHLHMSYCTFNGFKTLAFNYLRLQEHPLFGKIKE--LIEKVEATPA  411

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+A ELMK++D ++ L  LI +L +KE + T
Sbjct  412  EVAGELMKSEDPEVALHGLIKFLHDKETSET  442



>emb|CAB42923.1| putative mitochondrial protein [Arabidopsis thaliana]
Length=480

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT AAFKVLASNYL I+DH L+ +IEE   + +++VTPA
Sbjct  389  EKLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIQDHILFEQIEE--FIREIEVTPA  446

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM++D  D  L  L+ +L+ K+
Sbjct  447  EVAEQLMRSDSVDKVLQGLVEFLKAKK  473



>ref|XP_004310209.1| PREDICTED: mitochondrial chaperone BCS1-like [Fragaria vesca 
subsp. vesca]
Length=474

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMH+ MS+CT   FK LA NYL++  H L+ +IEE  L+  V  TPA
Sbjct  369  DKLDPALLRPGRMDMHVHMSFCTPCGFKTLAHNYLKVTTHHLFSEIEE--LIKDVDTTPA  426

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEELMKN+DADI L  L+ +L+ K+
Sbjct  427  EIAEELMKNEDADIVLEGLVKFLKKKK  453



>ref|XP_008466531.1| PREDICTED: mitochondrial chaperone BCS1-like [Cucumis melo]
Length=462

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMH+ MSYC F+ FK+LA NYL I++H L+ KIEE  L+ KV+ TPA
Sbjct  363  DRLDPALLRPGRMDMHLPMSYCDFSGFKILAYNYLLIQEHPLFEKIEE--LLNKVEATPA  420

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+A ELMK+DDA  +L  +I +L +K+  T
Sbjct  421  ELAGELMKSDDAASSLQGIIQFLHDKQEKT  450



>ref|XP_004239200.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial-like 
[Solanum lycopersicum]
Length=486

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPAL+RPGRMDMHI MSYCT + FK+LASNYL +E H  + +IEE  L+ +V VTPA
Sbjct  361  ERLDPALIRPGRMDMHIHMSYCTPSGFKILASNYLGLEKHYKFREIEE--LITEVNVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEELMK+D+ADI L  LI ++  K+
Sbjct  419  EIAEELMKSDEADIALDGLIKFINKKK  445



>ref|XP_010649112.1| PREDICTED: uncharacterized protein LOC100262690 [Vitis vinifera]
Length=469

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRL PALLRPGRMDMHI MSYCT+  FK LASNYL + DH L+ +IE   L+   +V+PA
Sbjct  360  DRLAPALLRPGRMDMHIYMSYCTYDGFKTLASNYLGVTDHPLFGEIE--TLLKNTEVSPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EI EELM++DDAD+ LG L+ ++  K+
Sbjct  418  EIGEELMRSDDADVALGGLVEFINRKK  444



>emb|CAN63362.1| hypothetical protein VITISV_002406 [Vitis vinifera]
Length=459

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRL PALLRPGRMDMHI MSYCT+  FK LASNYL + DH L+ +IE   L+   +V+PA
Sbjct  350  DRLAPALLRPGRMDMHIYMSYCTYDGFKTLASNYLGVTDHPLFGEIE--TLLKNTEVSPA  407

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EI EELM++DDAD+ LG L+ ++  K+
Sbjct  408  EIGEELMRSDDADVALGGLVEFINRKK  434



>dbj|BAC41960.2| putative BCS1 protein [Arabidopsis thaliana]
Length=451

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT AAFKVLASNYL I+DH L+ +IEE   + +++VTP+
Sbjct  360  EKLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIQDHILFEQIEE--FIREIEVTPS  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM++D  D  L  L+ +L+ K+
Sbjct  418  EVAEQLMRSDSVDKVLQGLVEFLKAKK  444



>ref|XP_010263593.1| PREDICTED: mitochondrial chaperone BCS1-like [Nelumbo nucifera]
Length=490

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI MSYCT + F++LASNYL I +H+L+ +I+E  L+ + +VTPA
Sbjct  374  DRLDPALLRPGRMDMHIHMSYCTPSGFRLLASNYLGISEHSLFPEIDE--LIKETEVTPA  431

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AEE MKND  +I L  L+ ++Q K+
Sbjct  432  EVAEEFMKNDSPEIVLTGLLQFIQTKK  458



>ref|XP_011083653.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Sesamum indicum]
Length=443

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+ I+MS C F+ FK+LASNYLRIE+H+L+  I+E  L+ KV+ TPA
Sbjct  356  NRLDPALLRPGRMDVQIEMSCCRFSGFKILASNYLRIEEHSLFTVIQE--LLTKVEATPA  413

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+A ELMK++DADI L NLI  L++K
Sbjct  414  EVAGELMKSEDADIALINLIRLLESK  439



>gb|KCW67878.1| hypothetical protein EUGRSUZ_F01593, partial [Eucalyptus grandis]
Length=405

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+HI MSYC+F+ FK LASNYL I+DH L+ K+EE  L+  V+ TPA
Sbjct  317  ERLDPALLRPGRMDLHIHMSYCSFSGFKTLASNYLGIQDHPLFEKVEE--LLKVVQATPA  374

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            EIA ELMK    D  L  LI +L  + + T
Sbjct  375  EIAGELMKTKHPDFALQGLIKFLHCRRDET  404



>ref|XP_002302018.2| hypothetical protein POPTR_0002s03410g [Populus trichocarpa]
 gb|EEE81291.2| hypothetical protein POPTR_0002s03410g [Populus trichocarpa]
Length=446

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+H+ MSYCTF  FK LA NYLR+++H L+ +I+E  L+ KV+ TPA
Sbjct  354  DQLDPALLRPGRMDVHLHMSYCTFNGFKTLALNYLRLQEHPLFGEIKE--LLEKVQATPA  411

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+A ELMK++D ++ L  LI +L +KE + T
Sbjct  412  EVAGELMKSEDPEVALQGLIKFLHDKETSET  442



>gb|KFK34344.1| hypothetical protein AALP_AA5G132900 [Arabis alpina]
Length=467

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT A F+VLASNYL+IEDH L+ ++E    + + +VTPA
Sbjct  366  EKLDPALLRPGRMDMHIHMSYCTPAGFEVLASNYLKIEDHILFEQVE--GFIRETEVTPA  423

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAE+LM+N   D  L  LI++L+ K+
Sbjct  424  EIAEQLMRNGYVDKVLQGLIVFLKAKK  450



>ref|XP_006361553.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=493

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPAL+RPGRMDMHI MSYCT + FK+LASNYL +E H  + +IEE  L+ +V VTPA
Sbjct  361  ERLDPALIRPGRMDMHIHMSYCTPSGFKILASNYLGLEKHYKFREIEE--LITEVNVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEELMK+D+ADI L  LI  L  K+
Sbjct  419  EIAEELMKSDEADIALDGLIKLLNKKK  445



>ref|XP_010060977.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Eucalyptus 
grandis]
Length=439

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+HI MSYC+F+ FK LASNYL I+DH L+ K+EE  L+  V+ TPA
Sbjct  351  ERLDPALLRPGRMDLHIHMSYCSFSGFKTLASNYLGIQDHPLFEKVEE--LLKVVQATPA  408

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            EIA ELMK    D  L  LI +L  + + T
Sbjct  409  EIAGELMKTKHPDFALQGLIKFLHCRRDET  438



>ref|XP_009761879.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Nicotiana 
sylvestris]
Length=485

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT + FK+LASNYL +++H  + +IE+  L+ ++ VTPA
Sbjct  357  ERLDPALLRPGRMDMHIHMSYCTPSGFKILASNYLGLKNHCKFREIEQ--LITELNVTPA  414

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT*TLD  264
            EIAEELM +D+ADI L  LI +L  K+      +D
Sbjct  415  EIAEELMISDEADIALDGLIKFLNKKKQVVQNAVD  449



>ref|XP_008338166.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=480

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 5/89 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            DRLDPALLRPGRMD+HI MSYCT + FKVLASNYL I +   H+L  ++E   L+   +V
Sbjct  361  DRLDPALLRPGRMDVHIHMSYCTPSGFKVLASNYLDIHEDNLHSLCGEVE--GLIKSTEV  418

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQNK  291
            TPAE+AEELMK+DDAD+ LG L+ +L+ K
Sbjct  419  TPAEVAEELMKSDDADVALGGLVNFLKRK  447



>ref|XP_010655475.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X3 [Vitis vinifera]
 ref|XP_010655479.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X3 [Vitis vinifera]
Length=491

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 11/113 (10%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  361  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYL------QNKENTTT*TLDMMMEQGSKLKPI  228
            EIAEELMK+++AD+ L  LI +L      +NK N     +D   EQG++ + +
Sbjct  419  EIAEELMKSEEADVALEGLIEFLKRAKIAENKSNGEGKEVD---EQGTERRDV  468



>emb|CBI27588.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 11/113 (10%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  341  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  398

Query  368  EIAEELMKNDDADITLGNLIIYL------QNKENTTT*TLDMMMEQGSKLKPI  228
            EIAEELMK+++AD+ L  LI +L      +NK N     +D   EQG++ + +
Sbjct  399  EIAEELMKSEEADVALEGLIEFLKRAKIAENKSNGEGKEVD---EQGTERRDV  448



>ref|XP_009115774.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X2 
[Brassica rapa]
Length=374

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+HI MSYCT A FKVLASNYL +EDH L+   E   L+ ++KVTPA
Sbjct  284  ERLDPALLRPGRMDVHIHMSYCTPAGFKVLASNYLEVEDHVLFE--EIEELIREIKVTPA  341

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAE+LM+ND  D  L  LI++L+ K+
Sbjct  342  EIAEQLMRNDSVDQILHGLIVFLRAKK  368



>ref|XP_008367101.1| PREDICTED: LOW QUALITY PROTEIN: probable mitochondrial chaperone 
BCS1-A [Malus domestica]
Length=461

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT + FK+LASNYL I+ H L+ +IEE   + +++VTPA
Sbjct  357  EKLDPALLRPGRMDMHIHMSYCTPSGFKILASNYLGIKTHHLFDEIEE--FLKQLEVTPA  414

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAE+LMK+++AD  L  L  +L+NK+
Sbjct  415  EIAEQLMKSEEADKALAGLAAFLKNKK  441



>ref|XP_002514947.1| Mitochondrial chaperone BCS1, putative [Ricinus communis]
 gb|EEF47501.1| Mitochondrial chaperone BCS1, putative [Ricinus communis]
Length=270

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LD ALLRPGRMDMHI MSYC+ + FK+LASNYL I++H L+ +IE+  L+ +V+VTPA
Sbjct  130  DKLDSALLRPGRMDMHIHMSYCSPSGFKILASNYLNIKNHCLFTEIEK--LIEEVEVTPA  187

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEELMK DD D  L  L  +LQ K+
Sbjct  188  EIAEELMKGDDVDTVLNGLQGFLQRKK  214



>ref|XP_008377205.1| PREDICTED: mitochondrial chaperone BCS1-like [Malus domestica]
Length=433

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCTF  FK LA NYL I +H L+ +IE  +L+ + + TPA
Sbjct  346  DRLDPALLRPGRMDLHIHMSYCTFGGFKTLAYNYLLIHEHTLFGEIE--MLLDRAQATPA  403

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+A ELM +DDA ++L  LI +L+ K + T
Sbjct  404  EVAGELMTSDDAHVSLQGLIEFLRGKTDRT  433



>gb|KDP25711.1| hypothetical protein JCGZ_24012 [Jatropha curcas]
Length=126

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAEI  363
            LDPALLRPGRMDMHI MSYCT   F+VLA NYL I +H LY +I+   L+ +  VTPA +
Sbjct  42   LDPALLRPGRMDMHIHMSYCTSKGFRVLAFNYLGIHEHKLYQEID--ALMERTNVTPASL  99

Query  362  AEELMKNDDADITLGNLIIYLQNKE  288
            AEELMK+DD D+ LG ++ +L+ K+
Sbjct  100  AEELMKSDDPDVALGEVLNFLKQKK  124



>gb|KFK34343.1| hypothetical protein AALP_AA5G132800 [Arabis alpina]
Length=523

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT +AFK LASNYL IE+H L+ KIEE   +   +V+PA
Sbjct  376  EKLDPALLRPGRMDMHIHMSYCTPSAFKDLASNYLEIEEHELFSKIEE--GIEATEVSPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNK--ENTTT*TLDMMMEQGSKLKPI  228
            E+AE+LM+ND  D  L  LI +L+ K  EN          E+ +K KPI
Sbjct  434  EVAEQLMRNDTIDKILEGLIGFLKVKKIENEEDKAKKEKQERENKEKPI  482



>ref|XP_007046849.1| Cytochrome BC1 synthesis, putative [Theobroma cacao]
 gb|EOX91006.1| Cytochrome BC1 synthesis, putative [Theobroma cacao]
Length=543

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT +AF++LASNYL I+DHAL+ +IEE   +   +VTPA
Sbjct  412  DKLDPALLRPGRMDVHIHMSYCTPSAFRILASNYLGIKDHALFGEIEE--AIRTTEVTPA  469

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+L+++DD +  L +LI +L+ K+
Sbjct  470  EVAEQLLRSDDLETVLRDLIGFLKVKK  496



>ref|XP_002514945.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47499.1| ATP binding protein, putative [Ricinus communis]
Length=503

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT + FK+LA NYL+I+ H L+ +IE+  L+ +V+VTPA
Sbjct  366  DKLDPALLRPGRMDMHIHMSYCTTSGFKILAFNYLKIKTHCLFTEIEK--LIEEVEVTPA  423

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AEELMK  D D+ L  L  +LQ K+
Sbjct  424  EVAEELMKGGDVDLVLKGLQGFLQGKK  450



>ref|XP_004293198.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Fragaria 
vesca subsp. vesca]
Length=425

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLD ALLRPGRMD+H+ MSYCTF+ FK LA NYL+I++H L+ +IE+  L+   + TPA
Sbjct  342  DRLDQALLRPGRMDLHLHMSYCTFSGFKTLAYNYLQIKEHPLFTEIED--LINHKEATPA  399

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+A ELMK+DDA+++L  L  +LQ+K
Sbjct  400  EVAGELMKSDDAEVSLQGLTKFLQSK  425



>emb|CBI17461.3| unnamed protein product [Vitis vinifera]
Length=853

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRL PALLRPGRMDMHI MSYCT+  FK LASNYL + DH L+ +IE   L+   +V+PA
Sbjct  744  DRLAPALLRPGRMDMHIYMSYCTYDGFKTLASNYLGVTDHPLFGEIE--TLLKNTEVSPA  801

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EI EELM++DDAD+ LG L+ ++  K+
Sbjct  802  EIGEELMRSDDADVALGGLVEFINRKK  828



>ref|XP_009115773.1| PREDICTED: probable mitochondrial chaperone BCS1-B isoform X1 
[Brassica rapa]
Length=448

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+HI MSYCT A FKVLASNYL +EDH L+ +IEE  L+ ++KVTPA
Sbjct  358  ERLDPALLRPGRMDVHIHMSYCTPAGFKVLASNYLEVEDHVLFEEIEE--LIREIKVTPA  415

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAE+LM+ND  D  L  LI++L+ K+
Sbjct  416  EIAEQLMRNDSVDQILHGLIVFLRAKK  442



>ref|XP_003631351.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
[Vitis vinifera]
Length=494

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT   FK LASNYL I DH L+ +IE+  L+++V+VTPA
Sbjct  359  ERLDPALLRPGRMDMHIHMSYCTPCGFKTLASNYLGIRDHRLFPEIEK--LIVEVEVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYL  300
             IAEELMK+++ADI LG L+ +L
Sbjct  417  AIAEELMKSEEADIALGRLVEFL  439



>ref|XP_006291089.1| hypothetical protein CARUB_v10017204mg [Capsella rubella]
 gb|EOA23987.1| hypothetical protein CARUB_v10017204mg [Capsella rubella]
Length=459

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT AAFKVLASNYL IEDH  +  IEE  ++ +V+VTPA
Sbjct  364  EKLDPALLRPGRMDMHIHMSYCTPAAFKVLASNYLDIEDHITFEHIEE--MIREVQVTPA  421

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM++D  D  L  L+ +L  K+
Sbjct  422  EVAEQLMRSDSVDKVLQGLVEFLNAKK  448



>emb|CBI27589.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  341  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  398

Query  368  EIAEELMKNDDADITLGNLIIYL------QNKENTTT*TLDMMMEQG  246
            EIAEELMK+++AD+ L  LI +L      +NK N     +D   EQG
Sbjct  399  EIAEELMKSEEADVALEGLIAFLKRAKSAENKSNCRGKKVD---EQG  442



>ref|XP_006391672.1| hypothetical protein EUTSA_v10023809mg [Eutrema salsugineum]
 gb|ESQ28958.1| hypothetical protein EUTSA_v10023809mg [Eutrema salsugineum]
Length=251

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT +AFK LA NYL I+DH L++KIEE   +   +V+PA
Sbjct  100  EKLDPALLRPGRMDMHIHMSYCTPSAFKALALNYLEIKDHHLFNKIEE--HIETTEVSPA  157

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  158  EVAEQLMRNDTVDKILEGLIEFLKVKK  184



>ref|XP_009586810.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
 ref|XP_009586811.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=445

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+ I+MSYCTF+ F++LA+NYL+IE+H+ +  IE   L+LKVK TPA
Sbjct  352  DRLDPALLRPGRMDVDIEMSYCTFSGFRILAANYLKIEEHSKFRVIE--FLLLKVKATPA  409

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT*T  270
            E+A ELMK+++ +I L NLI YL  +  + T T
Sbjct  410  EVAGELMKSNNTEIALENLIKYLSKQNASLTET  442



>ref|XP_010655485.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
[Vitis vinifera]
Length=499

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  361  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYL------QNKENTTT*TLDMMMEQG  246
            EIAEELMK+++AD+ L  LI +L      +NK N     +D   EQG
Sbjct  419  EIAEELMKSEEADVALEGLIAFLKRAKSAENKSNCRGKKVD---EQG  462



>emb|CAN79835.1| hypothetical protein VITISV_036161 [Vitis vinifera]
Length=476

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  337  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  394

Query  368  EIAEELMKNDDADITLGNLIIYL------QNKENTTT*TLDMMMEQG  246
            EIAEELMK+++AD+ L  LI +L      +NK N     +D   EQG
Sbjct  395  EIAEELMKSEEADVALEGLIAFLKRAKSAENKSNCRGKKVD---EQG  438



>emb|CDP01981.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT + F++LA+NYL I+DH L+ +IEE  L+   +VTPA
Sbjct  351  EKLDPALLRPGRMDVHIHMSYCTPSGFRILAANYLEIKDHCLFKEIEE--LIAATEVTPA  408

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            E+AE+L+KND+AD+ L  LI +L
Sbjct  409  EVAEQLLKNDEADVILEGLIDFL  431



>ref|XP_006654862.1| PREDICTED: uncharacterized protein LOC102720799 [Oryza brachyantha]
Length=481

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF+VLASNY  +E+HA+Y +IE+  L+ +V +TPA
Sbjct  372  ERLDPALLRPGRMDMHIHMGYCTPEAFRVLASNYHSVENHAMYPEIEQ--LIEEVPITPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AE LM+ND+AD+ L  L  +L  K+N T
Sbjct  430  EVAEVLMRNDNADVALQVLAEFLMAKKNQT  459



>ref|XP_011087108.1| PREDICTED: mitochondrial chaperone BCS1-like [Sesamum indicum]
Length=487

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI MSYCTF+ FK+LASNYL I+ H  +++IE   L+ +V+VTPA
Sbjct  371  DRLDPALLRPGRMDMHIHMSYCTFSGFKILASNYLGIKSHWRFNEIER--LMEEVEVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AEE+MK++D D  +  ++ +L  K +
Sbjct  429  EVAEEMMKSEDVDAVMEKVVKFLCKKRS  456



>emb|CAN70582.1| hypothetical protein VITISV_031444 [Vitis vinifera]
Length=513

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT   FK LASNYL I DH L+ +IE+  L+++V+VTPA
Sbjct  359  ERLDPALLRPGRMDMHIHMSYCTPCGFKTLASNYLGIRDHRLFPEIEK--LIVEVEVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYL  300
             IAEELMK+++ADI LG L+ +L
Sbjct  417  AIAEELMKSEEADIALGRLVEFL  439



>ref|XP_004289097.1| PREDICTED: uncharacterized protein LOC101300961 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 9/106 (8%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            DRLDPALLRPGRMDMHI MSYCT + F+VLASNYL I +   H L  +IE   L+   +V
Sbjct  894  DRLDPALLRPGRMDMHIHMSYCTPSGFRVLASNYLGIHESNPHLLCREIE--GLIESTEV  951

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQNKENTTT*TLDMMMEQGSK  240
            TPA++AEELMK+DDAD+TL  L+ +L+ K+       D M EQG++
Sbjct  952  TPADVAEELMKSDDADVTLKGLVNFLKKKKVEN----DKMKEQGAE  993


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 63/94 (67%), Gaps = 10/94 (11%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            +RLDPALLRPGRMDMHI MSYCT   FK LASNYL I+D   H L  +IE   L+    +
Sbjct  390  ERLDPALLRPGRMDMHIHMSYCTPKGFKTLASNYLGIQDTSKHQLCQEIE--GLMESTNI  447

Query  377  TPAEIAEELMK-----NDDADITLGNLIIYLQNK  291
            TPAE+ EELM+     +DDADI L  L+  L+ K
Sbjct  448  TPAEVCEELMRGGGGDDDDADIALEGLVNCLKRK  481



>ref|NP_001174549.1| Os05g0588850 [Oryza sativa Japonica Group]
 gb|AAT37997.1| putative AAA-type ATPase [Oryza sativa Japonica Group]
 gb|EEE64876.1| hypothetical protein OsJ_19733 [Oryza sativa Japonica Group]
 dbj|BAH93277.1| Os05g0588850 [Oryza sativa Japonica Group]
Length=479

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF+VLASNY  +E+HA+Y +IE+  L+ +V  TPA
Sbjct  370  ERLDPALLRPGRMDMHIHMGYCTREAFRVLASNYHNVENHAMYPEIEQ--LIEEVLTTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD D+ L  L  +L+ K N
Sbjct  428  EVAEVLMRNDDVDVALQVLAEFLKAKRN  455



>ref|XP_010113404.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC35431.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=508

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT   F++LASNYL I+DH L+ +IE+   V   +VTPA
Sbjct  374  EKLDPALLRPGRMDVHVHMSYCTPCGFRLLASNYLGIKDHLLFAEIEQ--RVHSTEVTPA  431

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEEL+KNDD DI L  LI +L+ K+
Sbjct  432  EIAEELVKNDDPDIALQGLIEFLKVKK  458



>ref|XP_008338173.1| PREDICTED: uncharacterized protein LOC103401240 [Malus domestica]
Length=496

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 5/90 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            DRLDPALLRPGRMD+HI +SYCT + FKVLASNYL I D   H LY +IE   L+   +V
Sbjct  363  DRLDPALLRPGRMDVHIHLSYCTASGFKVLASNYLGIGDENHHRLYGEIE--GLIESAEV  420

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQNKE  288
            TPAE+AEELMK+DDAD+ L  L+ +L+ K+
Sbjct  421  TPAEVAEELMKSDDADVVLVGLVDFLKCKK  450



>ref|XP_006438092.1| hypothetical protein CICLE_v10031330mg [Citrus clementina]
 gb|ESR51332.1| hypothetical protein CICLE_v10031330mg [Citrus clementina]
Length=496

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSY T   FK+LA NYL+I+ H+++ +IEE  L+ +V+VTPA
Sbjct  360  ERLDPALLRPGRMDMHIHMSYLTPGGFKILAFNYLKIKSHSMFDEIEE--LIKEVEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AEE MK++DAD+ L  L+ +L  K+  T
Sbjct  418  EVAEEFMKSEDADVALNGLVDFLLRKKEQT  447



>ref|XP_006484060.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Citrus 
sinensis]
Length=496

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSY T   FK+LA NYL+I+ H+++ +IEE  L+ +V+VTPA
Sbjct  360  ERLDPALLRPGRMDMHIHMSYLTPGGFKILAFNYLKIKSHSMFDEIEE--LIKEVEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AEE MK++DAD+ L  L+ +L  K+  T
Sbjct  418  EVAEEFMKSEDADVALNGLVDFLLRKKEQT  447



>ref|XP_010113405.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC35432.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=516

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ +SYCT   F+VLASNYL I DH+L+ +IE+   V   +VTPA
Sbjct  380  EKLDPALLRPGRMDVHVHLSYCTPCGFRVLASNYLGINDHSLFAEIEQ--RVQATEVTPA  437

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEEL+K+DD DI L  LI +L+ K+
Sbjct  438  EIAEELLKSDDPDIALQGLIEFLKVKK  464



>ref|XP_008354651.1| PREDICTED: uncharacterized protein LOC103418296 [Malus domestica]
Length=496

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 5/90 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            DRLDPALLRPGRMD+HI +SYCT + FKVLASNYL I D   H LY +IE   L+   +V
Sbjct  363  DRLDPALLRPGRMDVHIHLSYCTASGFKVLASNYLGIGDENHHRLYGEIE--GLIESAEV  420

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQNKE  288
            TPAE+AEELMK+DDAD+ L  L+ +L+ K+
Sbjct  421  TPAEVAEELMKSDDADVVLVGLVDFLKCKK  450



>ref|XP_010245231.1| PREDICTED: ATPase family AAA domain-containing protein 2-like 
[Nelumbo nucifera]
Length=504

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI MSYCT   FK+LASNY  I DH L+ +IEE  L+ K +VTPA
Sbjct  372  DRLDPALLRPGRMDMHIHMSYCTPKGFKLLASNYHGIHDHPLHGEIEE--LIEKTEVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AEELMK+D AD  +  +I +L+ K+
Sbjct  430  ELAEELMKSDQADTAMAGVINFLKRKK  456



>ref|XP_010655467.1| PREDICTED: peroxisomal biogenesis factor 6-like isoform X1 [Vitis 
vinifera]
Length=561

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 11/113 (10%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  431  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  488

Query  368  EIAEELMKNDDADITLGNLIIYL------QNKENTTT*TLDMMMEQGSKLKPI  228
            EIAEELMK+++AD+ L  LI +L      +NK N     +D   EQG++ + +
Sbjct  489  EIAEELMKSEEADVALEGLIEFLKRAKIAENKSNGEGKEVD---EQGTERRDV  538



>ref|XP_009615811.1| PREDICTED: 26S protease regulatory subunit 8 homolog [Nicotiana 
tomentosiformis]
Length=488

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI+MSYCT + FK+LASNYL +++H  + +IEE  L+ ++ VT A
Sbjct  357  ERLDPALLRPGRMDMHIEMSYCTPSGFKILASNYLGLKNHCKFREIEE--LITELNVTAA  414

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIA+ELM +D+ADI L  LI +L  K+
Sbjct  415  EIAQELMISDEADIALDGLIKFLNKKK  441



>ref|XP_010515474.1| PREDICTED: uncharacterized protein LOC104791324 [Camelina sativa]
Length=529

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT + FK LASNYL I++H L+ K+EE   +   +VTPA
Sbjct  372  EKLDPALLRPGRMDMHIHMSYCTPSTFKALASNYLEIKEHHLFSKVEE--GIEATEVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  430  EVAEQLMRNDTVDKVLEGLIEFLKVKK  456



>ref|XP_010655473.1| PREDICTED: peroxisomal biogenesis factor 6-like isoform X2 [Vitis 
vinifera]
Length=543

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLRPGRMDMHI MSYCT   FK LASNYL + +H L+ +IE   L+ +V+VTPA
Sbjct  431  DRIDPALLRPGRMDMHIHMSYCTPYGFKTLASNYLGVSNHRLFTEIER--LITEVEVTPA  488

Query  368  EIAEELMKNDDADITLGNLIIYLQ  297
            EIAEELMK+++AD+ L  LI +L+
Sbjct  489  EIAEELMKSEEADVALEGLIEFLK  512



>ref|XP_010925267.1| PREDICTED: mitochondrial chaperone BCS1-like [Elaeis guineensis]
Length=478

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   AF+VLASNY  I+DH L+ +IE   LV +V+VTPA
Sbjct  364  ERLDPALLRPGRMDMHIHMGYCGPHAFRVLASNYHAIDDHHLFPEIE--GLVREVEVTPA  421

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+AEELM++DD D+ L  L+ +LQ K+   +
Sbjct  422  EVAEELMRSDDTDVALQGLVEFLQEKKKKAS  452



>ref|XP_010503767.1| PREDICTED: putative cell division cycle ATPase [Camelina sativa]
Length=527

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT + FK LASNYL I++H L+ K+EE   +   +VTPA
Sbjct  372  EKLDPALLRPGRMDMHIHMSYCTPSTFKALASNYLEIKEHHLFSKVEE--GIEATEVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  430  EVAEQLMRNDTVDKVLEGLIEFLKVKK  456



>ref|XP_004249747.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=465

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ +IE   L+    VTPA
Sbjct  367  EKLDPALLRPGRMDVHIHMSYCTPCGFKLLASNYLGITEHQLFEEIEN--LIGATAVTPA  424

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LMK+DD DI L +LI +L  KE
Sbjct  425  EVAEKLMKDDDVDIALKSLIDFLHLKE  451



>ref|XP_010312103.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=441

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ +IE   L+    VTPA
Sbjct  343  EKLDPALLRPGRMDVHIHMSYCTPCGFKLLASNYLGITEHQLFEEIEN--LIGATAVTPA  400

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LMK+DD DI L +LI +L  KE
Sbjct  401  EVAEKLMKDDDVDIALKSLIDFLHLKE  427



>ref|XP_006466842.1| PREDICTED: mitochondrial chaperone BCS1-like [Citrus sinensis]
Length=473

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT + FK+LA+NYL I++H L+ +IEE  L+   +VTPA
Sbjct  370  EKLDPALLRPGRMDVHVHMSYCTPSGFKLLAANYLGIKEHILFEEIEE--LISTTQVTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+LM+NDD ++ L  LI +L+ K
Sbjct  428  EVAEQLMRNDDPELVLNGLIEFLKVK  453



>gb|KDO71005.1| hypothetical protein CISIN_1g012016mg [Citrus sinensis]
Length=473

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT + FK+LA+NYL I++H L+ +IEE  L+   +VTPA
Sbjct  370  EKLDPALLRPGRMDVHVHMSYCTPSGFKLLAANYLGIKEHILFEEIEE--LISTTQVTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+LM+NDD ++ L  LI +L+ K
Sbjct  428  EVAEQLMRNDDPELVLNGLIEFLKVK  453



>ref|XP_006425625.1| hypothetical protein CICLE_v10025530mg [Citrus clementina]
 gb|ESR38865.1| hypothetical protein CICLE_v10025530mg [Citrus clementina]
Length=473

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT + FK+LA+NYL I++H L+ +IEE  L+   +VTPA
Sbjct  370  EKLDPALLRPGRMDVHVHMSYCTPSGFKLLAANYLGIKEHILFEEIEE--LISTTQVTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+LM+NDD ++ L  LI +L+ K
Sbjct  428  EVAEQLMRNDDPELVLNGLIEFLKVK  453



>ref|XP_010086941.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXB24923.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=543

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI +SY T + FK LA NYLR+++H L+ +I+E   + +V+VTPA
Sbjct  382  DRLDPALLRPGRMDMHIHLSYLTPSGFKTLAFNYLRVKEHPLFGEIKE--RLKEVEVTPA  439

Query  368  EIAEELMKNDDADITLGNLIIYLQ  297
            E+AE+LM++D+ D+ LG L+ +LQ
Sbjct  440  EVAEKLMRSDNPDVALGGLVEFLQ  463



>emb|CAN69873.1| hypothetical protein VITISV_030608 [Vitis vinifera]
Length=492

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT + FK+LA+NYL I  H L+ KIE   L+ +V+VTPA
Sbjct  361  ERLDPALLRPGRMDMHIHMSYCTPSGFKILAANYLNINTHPLFTKIER--LMTEVEVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEEL+K ++ D+ L  +I +L+ K+
Sbjct  419  EIAEELLKCEEVDVALEGIIKFLERKK  445



>ref|XP_010655379.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Vitis 
vinifera]
Length=498

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT + FK+LA+NYL I  H L+ KIE   L+ +V+VTPA
Sbjct  367  ERLDPALLRPGRMDMHIHMSYCTPSGFKILAANYLNINTHPLFTKIER--LMTEVEVTPA  424

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEEL+K ++ D+ L  +I +L+ K+
Sbjct  425  EIAEELLKCEEVDVALEGIIKFLERKK  451



>gb|EYU31187.1| hypothetical protein MIMGU_mgv1a005299mg [Erythranthe guttata]
Length=490

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCTF  FK+LASNYL I +H  + +IE    +   KVTPA
Sbjct  371  EKLDPALLRPGRMDVHINMSYCTFCGFKLLASNYLGINNHYSFDEIE--GSIGIAKVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+L+KNDD DI+L  LI ++  K
Sbjct  429  EVAEQLLKNDDIDISLHGLIDFIHKK  454



>gb|KDP25709.1| hypothetical protein JCGZ_24010 [Jatropha curcas]
Length=472

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAEI  363
            LDPALLRPGRMDMHI MSYCT  AF+VLA NYL I +H LY +I+   L+    VTPA +
Sbjct  361  LDPALLRPGRMDMHIHMSYCTIKAFRVLAFNYLGIHEHKLYQEID--GLIENTNVTPASL  418

Query  362  AEELMKNDDADITLGNLIIYLQNKE  288
            AEEL K+DDAD+ LG ++ +L+ K+
Sbjct  419  AEELTKSDDADVALGEVVNFLKRKK  443



>ref|XP_004147876.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Cucumis 
sativus]
 ref|XP_004164010.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Cucumis 
sativus]
 gb|KGN59989.1| hypothetical protein Csa_3G860250 [Cucumis sativus]
Length=461

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMH+ MSYC F  FK+LA NYL I++H L+ KI+E   + KV+ TPA
Sbjct  362  DRLDPALLRPGRMDMHLHMSYCDFGGFKILAYNYLLIQEHPLFEKIKE--FLNKVEATPA  419

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+A ELMK+DD   +L  +I  L +K+  T
Sbjct  420  ELAGELMKSDDTISSLQGIIQLLHDKQEKT  449



>ref|XP_006351393.1| PREDICTED: putative cell division cycle ATPase-like [Solanum 
tuberosum]
Length=465

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT + FK+LASNYL I +H L+ +IE   L+    VTPA
Sbjct  367  EKLDPALLRPGRMDVHIHMSYCTPSGFKLLASNYLGITEHQLFQEIEN--LIGATAVTPA  424

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LMK+D+ DI L  LI +L  KE
Sbjct  425  EVAEKLMKDDEVDIALKGLIDFLHMKE  451



>ref|XP_010041836.1| PREDICTED: probable mitochondrial chaperone bcs1 [Eucalyptus 
grandis]
Length=164

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   FK+LASNYL I  H L+ +IE   ++   +VTPA
Sbjct  44   EKLDPALLRPGRMDLHIPMSYCTPCGFKLLASNYLGINHHELFDQIES--VITTARVTPA  101

Query  368  EIAEELMKNDDADITLGNLIIYL---QNKEN  285
            E+AE+LMK D+ ++ LG+++ +L   + KEN
Sbjct  102  EVAEQLMKCDEPEVALGDMVSFLISHKRKEN  132



>ref|XP_007224211.1| hypothetical protein PRUPE_ppa017216mg [Prunus persica]
 gb|EMJ25410.1| hypothetical protein PRUPE_ppa017216mg [Prunus persica]
Length=394

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MS CT   FK+LAS YL I+ H  + +IE    + +V+VTPA
Sbjct  290  DKLDPALLRPGRMDMHIHMS-CTPGGFKILASYYLGIKTHGFFDEIE--ASIREVEVTPA  346

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEELMK++D D  LG L+ +L+NK+
Sbjct  347  EIAEELMKSEDTDTVLGGLVAFLKNKK  373



>ref|XP_006403972.1| hypothetical protein EUTSA_v10010287mg [Eutrema salsugineum]
 gb|ESQ45425.1| hypothetical protein EUTSA_v10010287mg [Eutrema salsugineum]
Length=527

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT +AFK LA NYL I+DH L++KIEE   +   +V+PA
Sbjct  376  EKLDPALLRPGRMDMHIHMSYCTPSAFKALALNYLEIKDHHLFNKIEE--HIETTEVSPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  434  EVAEQLMRNDTVDRILEGLIEFLKVKK  460



>dbj|BAJ95992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF++LA+NY  I+ HA Y +IEE  L+ +V VTPA
Sbjct  356  ERLDPALLRPGRMDMHIHMGYCTTEAFRILANNYHSIDYHATYPEIEE--LIEEVTVTPA  413

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+AE LM+NDD D+ L +L+  L+ K+N  T
Sbjct  414  EVAEVLMRNDDTDVALHDLVELLKLKKNDAT  444



>gb|KDO71008.1| hypothetical protein CISIN_1g011935mg [Citrus sinensis]
Length=436

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI--EDHALYHKIEElllvlkvkVT  375
            +R+DPALLRPGRMD+HI MSYCT   FKVLASNYL I  + H+L+ +IE   L+    VT
Sbjct  320  ERIDPALLRPGRMDVHINMSYCTVHGFKVLASNYLGIKGKSHSLFGEIE--GLIQSTDVT  377

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELMK DDAD+ L  L+ +L+ K
Sbjct  378  PAEVAEELMKADDADVALEGLVNFLKRK  405



>ref|XP_006466846.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=436

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI--EDHALYHKIEElllvlkvkVT  375
            +R+DPALLRPGRMD+HI MSYCT   FKVLASNYL I  + H+L+ +IE   L+    VT
Sbjct  320  ERIDPALLRPGRMDVHINMSYCTVHGFKVLASNYLGIKGKSHSLFGEIE--GLIQSTDVT  377

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELMK DDAD+ L  L+ +L+ K
Sbjct  378  PAEVAEELMKADDADVALEGLVNFLKRK  405



>ref|NP_001043516.1| Os01g0605100 [Oryza sativa Japonica Group]
 dbj|BAD52668.1| BCS1 protein precursor-like [Oryza sativa Japonica Group]
 dbj|BAF05430.1| Os01g0605100 [Oryza sativa Japonica Group]
Length=453

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMH+ M YC   +F++LASNY  I++HA Y +IEE  L+ +V VTPA
Sbjct  328  ERLDPALLRPGRMDMHVHMGYCCPESFRILASNYHSIDNHATYPEIEE--LIKEVMVTPA  385

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD D+ L  LI +L+ K++
Sbjct  386  EVAEVLMRNDDTDVALEGLIQFLKRKKD  413



>ref|XP_002283754.2| PREDICTED: probable mitochondrial chaperone BCS1-B [Vitis vinifera]
Length=495

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMDMHI MSYCT   FK+LASNYL I +H L+ ++E+  L+L+ KVTPA
Sbjct  368  DKLDPALLRPGRMDMHINMSYCTPCGFKMLASNYLEITNHPLFPEVED--LILEAKVTPA  425

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENT  282
            E+ E+LMK+++ DITL  LI +L  K+ +
Sbjct  426  EVGEQLMKSEEPDITLEGLIRFLVEKKES  454



>emb|CDX73766.1| BnaC08g22370D [Brassica napus]
Length=1291

 Score =   103 bits (257),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+HI MSYCT A FKVLASNYL +EDH L+ +     L+ ++KVTPA
Sbjct  318  ERLDPALLRPGRMDVHIHMSYCTPAGFKVLASNYLEVEDHKLFEE--IEELIREIKVTPA  375

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAE+LM+ND  D  L  LI++L+ K+
Sbjct  376  EIAEQLMRNDSVDQILHGLIVFLRAKK  402



>ref|XP_009592953.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Nicotiana 
tomentosiformis]
Length=467

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ M+YCT   F++LASNYL I +H L+ +IEE  L+    VTPA
Sbjct  366  EKLDPALLRPGRMDVHVHMAYCTSCGFRLLASNYLGIREHQLFEEIEE--LIGNTAVTPA  423

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+LMK D+ DI L NLI +L  +
Sbjct  424  EVAEQLMKEDEVDIALKNLIEFLHKR  449



>gb|EAY99234.1| hypothetical protein OsI_21193 [Oryza sativa Indica Group]
Length=479

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF+VLASNY  +E+HA+Y +IE+  L+ +V  TPA
Sbjct  370  ERLDPALLRPGRMDMHIHMGYCTREAFRVLASNYHNVENHAMYPEIEQ--LIEEVLTTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD D  L  L  +L+ K N
Sbjct  428  EVAEVLMRNDDVDDALQVLAEFLKAKRN  455



>ref|XP_010426630.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Camelina 
sativa]
Length=510

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT +AFKVLASNYL I++H L+ K+EE   +  ++VTPA
Sbjct  378  EKLDPALLRPGRMDMHIHMSYCTPSAFKVLASNYLEIQEHPLFTKVEE--YIEAIEVTPA  435

Query  368  EIAEELMKNDDA-DITLGNLIIYLQNKE  288
            ++AE+LM+N+D+ D  L  L+ +L+ K+
Sbjct  436  DVAEQLMRNNDSVDKILEGLVEFLEAKK  463



>ref|XP_008241895.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Prunus mume]
Length=492

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 70/88 (80%), Gaps = 5/88 (6%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI---EDHALYHKIEElllvlkvkVTP  372
            LDPALLRPGRMD+HI MSYCT + F+VLASNYL I   EDH L+ +IE   L+   +VTP
Sbjct  370  LDPALLRPGRMDVHIHMSYCTPSGFRVLASNYLGIRDGEDHRLFGEIER--LIESTEVTP  427

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMK+DDA+++LG L+ +L++ +
Sbjct  428  AQVAEELMKSDDAEVSLGGLVNFLKHNQ  455



>ref|XP_010925278.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Elaeis guineensis]
Length=506

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F+VLASNY  I+DH L+ +IE   LV +V+VTPA
Sbjct  397  ERLDPALLRPGRMDMHIHMGYCGPHSFRVLASNYHAIDDHPLFPQIE--GLVREVEVTPA  454

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT  276
            E+AE+LM++DD D  L  L+ +LQ KE   +
Sbjct  455  EVAEQLMRSDDTDAALQGLLEFLQGKEKNAS  485



>emb|CDY26528.1| BnaC01g23710D [Brassica napus]
Length=468

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT + FK LA NYL I+DH L+ KI E   +   +VTPA
Sbjct  352  DKLDPALLRPGRMDVHIHMSYCTSSTFKALAWNYLEIKDHPLFSKIVE--GIEATEVTPA  409

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+N+  DI L  L+ +L+ K+
Sbjct  410  DVAEQLMRNESVDIILEGLVEFLEAKK  436



>emb|CDX77967.1| BnaA09g31620D [Brassica napus]
Length=1273

 Score =   103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMD+HI MSYCT A FKVLASNYL +EDH L+ +IEE  L+ ++KVTPA
Sbjct  318  ERLDPALLRPGRMDVHIHMSYCTPAGFKVLASNYLEVEDHMLFEEIEE--LIREIKVTPA  375

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAE+LM+ND  D  L  LI++L+ K+
Sbjct  376  EIAEQLMRNDSVDQILHGLIVFLRAKK  402



>gb|EAY74873.1| hypothetical protein OsI_02762 [Oryza sativa Indica Group]
Length=486

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMH+ M YC   +F++LASNY  I++HA Y +IEE  L+ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHVHMGYCCPESFRILASNYHSIDNHATYPEIEE--LIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD D+ L  LI +L+ K++
Sbjct  419  EVAEVLMRNDDTDVALEGLIQFLKRKKD  446



>gb|EAZ12619.1| hypothetical protein OsJ_02530 [Oryza sativa Japonica Group]
Length=486

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMH+ M YC   +F++LASNY  I++HA Y +IEE  L+ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHVHMGYCCPESFRILASNYHSIDNHATYPEIEE--LIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD D+ L  LI +L+ K++
Sbjct  419  EVAEVLMRNDDTDVALEGLIQFLKRKKD  446



>ref|XP_006466845.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=474

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI--EDHALYHKIEElllvlkvkVT  375
            +R+DPALLRPGRMD+HI MSYCT   FKVLASNYL I  + H+L+ +IE   L+    VT
Sbjct  358  ERIDPALLRPGRMDVHINMSYCTVHGFKVLASNYLGIKGKSHSLFGEIE--GLIQSTDVT  415

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELMK DDAD+ L  L+ +L+ K
Sbjct  416  PAEVAEELMKADDADVALEGLVNFLKRK  443



>ref|XP_009624476.1| PREDICTED: transitional endoplasmic reticulum ATPase {ECO:0000250|UniProtKB:P23787}-like 
[Nicotiana tomentosiformis]
Length=513

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT  +FK+LA NYL + DH L+ +IE   L+  V+VTPA
Sbjct  360  EKLDPALLRPGRMDMHIHMSYCTNQSFKILAFNYLGVRDHRLFEEIE--GLIKNVEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            EIAEELM+++DAD+ L  ++  L+ K N
Sbjct  418  EIAEELMRSEDADVALEGVVNLLKRKAN  445



>gb|KDO71007.1| hypothetical protein CISIN_1g011935mg [Citrus sinensis]
Length=474

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI--EDHALYHKIEElllvlkvkVT  375
            +R+DPALLRPGRMD+HI MSYCT   FKVLASNYL I  + H+L+ +IE   L+    VT
Sbjct  358  ERIDPALLRPGRMDVHINMSYCTVHGFKVLASNYLGIKGKSHSLFGEIE--GLIQSTDVT  415

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELMK DDAD+ L  L+ +L+ K
Sbjct  416  PAEVAEELMKADDADVALEGLVNFLKRK  443



>ref|XP_009598953.1| PREDICTED: LOW QUALITY PROTEIN: putative cell division cycle 
ATPase [Nicotiana tomentosiformis]
Length=477

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -2

Query  545  RLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAE  366
            +LDPALLRPGRMDMHI M+YCT   FK+LA+NYL I++H L+ + EE  L+ K  VTPAE
Sbjct  376  KLDPALLRPGRMDMHIHMAYCTPCGFKLLAANYLGIKEHKLFEETEE--LIGKTAVTPAE  433

Query  365  IAEELMKNDDADITLGNLIIYLQNK  291
            +AE+LMK D+ DI+L  LI +L +K
Sbjct  434  VAEQLMKEDEVDISLNGLIEFLNSK  458



>ref|XP_006425622.1| hypothetical protein CICLE_v10025528mg [Citrus clementina]
 gb|ESR38862.1| hypothetical protein CICLE_v10025528mg [Citrus clementina]
Length=474

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI--EDHALYHKIEElllvlkvkVT  375
            +R+DPALLRPGRMD+HI MSYCT   FKVLASNYL I  + H+L+ +IE   L+    VT
Sbjct  358  ERIDPALLRPGRMDVHINMSYCTVHGFKVLASNYLGIKGKSHSLFGEIE--GLIQSTDVT  415

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELMK DDAD+ L  L+ +L+ K
Sbjct  416  PAEVAEELMKADDADVALEGLVNFLKRK  443



>emb|CBI27574.3| unnamed protein product [Vitis vinifera]
Length=623

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSYCT + FK+LA+NYL I  H L+ KIE   L+ +V+VTPA
Sbjct  336  ERLDPALLRPGRMDMHIHMSYCTPSGFKILAANYLNINTHPLFTKIER--LMTEVEVTPA  393

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            EIAEEL+K ++ D+ L  +I +L+ K+
Sbjct  394  EIAEELLKCEEVDVALEGIIKFLERKK  420



>ref|XP_010515473.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Camelina 
sativa]
Length=526

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT +AFKVLA NYL I +H L+ K+EE   +  ++VTPA
Sbjct  401  EKLDPALLRPGRMDMHIHMSYCTPSAFKVLALNYLEINEHPLFTKVEE--CIEAIEVTPA  458

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+ND  D  L  L+ +L+ K+
Sbjct  459  DVAEQLMRNDSVDKILEGLVEFLEAKK  485



>ref|XP_009783764.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Nicotiana 
sylvestris]
Length=488

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LD ALLRPGRMDMHI MSYC  +AFK L  NYLRI++H L+ +I +  L+  V+VTPA
Sbjct  357  DKLDAALLRPGRMDMHIHMSYCKLSAFKQLVFNYLRIQEHELFDQIGQ--LLEAVEVTPA  414

Query  368  EIAEELMKNDDADITLGNLIIYLQNK--ENTTT*TLDMMME  252
            E+A EL+K+ + +I+L NLI +LQNK  EN     +D+ M+
Sbjct  415  EVAGELLKSKNPNISLQNLIEFLQNKIAENKMKIEMDLTMQ  455



>ref|XP_004287870.1| PREDICTED: probable mitochondrial chaperone bcs1-like [Fragaria 
vesca subsp. vesca]
Length=212

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElll-vlkvkVTP  372
            DRLDPALLRPGRMD+HI MSYCT + F++LASNYL I ++  +H   E+   +   +VTP
Sbjct  99   DRLDPALLRPGRMDVHIHMSYCTPSGFRILASNYLGIHENNPHHLCGEVEGLIQSTEVTP  158

Query  371  AEIAEELMKNDDADITLGNLIIYLQNK  291
            A++AEELMK+DDAD+ L  ++ +L+ K
Sbjct  159  AQVAEELMKSDDADVALEGIVNFLKCK  185



>ref|XP_002510426.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52613.1| ATP binding protein, putative [Ricinus communis]
Length=435

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+L P LLRPGRMDMH+ +SYCTF  FK LASNYL I+DH L+ +IE+  L+ K + TPA
Sbjct  346  DQLVPVLLRPGRMDMHLHLSYCTFNGFKTLASNYLHIKDHHLFDEIEQ--LLEKAQSTPA  403

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+A ELMK  DA++ L  LI +LQ K
Sbjct  404  EVAGELMKCTDAELALEGLIKFLQGK  429



>ref|XP_006644345.1| PREDICTED: mitochondrial chaperone BCS1-like [Oryza brachyantha]
Length=487

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMH+ M YC   +F++LASNY  I+ HA Y +IEE  L+ +V+VTPA
Sbjct  361  ERLDPALLRPGRMDMHVHMGYCCPESFRILASNYHSIDSHATYPEIEE--LIKEVQVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD D  L  LI +L++K++
Sbjct  419  EVAEVLMRNDDTDFALEGLIQFLKSKKD  446



>gb|KDP25712.1| hypothetical protein JCGZ_24013 [Jatropha curcas]
Length=461

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAEI  363
            LDPALLRPGRMDMHI MSYCT   F+VLA NYL I +H LY +I+   L+ +  VTPA +
Sbjct  377  LDPALLRPGRMDMHIHMSYCTSKGFRVLAFNYLGIHEHKLYQEID--ALMERTNVTPASL  434

Query  362  AEELMKNDDADITLGNLIIYLQNKE  288
            AEELMK+DD D+ LG ++ +L+ K+
Sbjct  435  AEELMKSDDPDVALGEVLNFLKQKK  459



>gb|KDP25708.1| hypothetical protein JCGZ_24009 [Jatropha curcas]
Length=456

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAEI  363
            LDPALLRPGRMDMHI MSYCT   F+VLA NYL I +H LY +I+   L+ +  VTPA +
Sbjct  372  LDPALLRPGRMDMHIHMSYCTSKGFRVLAFNYLGIHEHKLYQEID--ALMERTNVTPASL  429

Query  362  AEELMKNDDADITLGNLIIYLQNKEN  285
            AEELMK+DD D+ LG ++ +L+ K+ 
Sbjct  430  AEELMKSDDPDVALGEVLNFLKQKKG  455



>ref|XP_007017603.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY14828.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein, putative [Theobroma cacao]
Length=345

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D LDP LLRPGRMDMH+ M+YCTF+ F+ LASNYL+I+ H L+ +I+   L+ KV+ TPA
Sbjct  253  DSLDPVLLRPGRMDMHLHMTYCTFSGFRALASNYLQIQHHPLFEEIK--GLLEKVQATPA  310

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
             +A ELMK++D D++L  LI +L +K
Sbjct  311  AVAGELMKSEDQDVSLQGLIKFLHDK  336



>ref|XP_007204413.1| hypothetical protein PRUPE_ppb019907mg [Prunus persica]
 gb|EMJ05612.1| hypothetical protein PRUPE_ppb019907mg [Prunus persica]
Length=373

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI---EDHALYHKIEElllvlkvkVTP  372
            LDPALLRPGRMD+HI MSYCT + F+VLA NYL I   EDH L+ +IE   L+   +VTP
Sbjct  276  LDPALLRPGRMDVHIHMSYCTPSGFRVLACNYLGIRDGEDHRLFGEIER--LIESTEVTP  333

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMK+DDA+++LG L+ +L++ +
Sbjct  334  AQVAEELMKSDDAEVSLGALVNFLKHNQ  361



>ref|XP_008241725.1| PREDICTED: uncharacterized protein LOC103340128 [Prunus mume]
Length=489

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElll-vlkvkVTP  372
            DRLDPALLRPGRMD+HI +SYCT + F++LASNYL I D+  +H+  E+   +   +VTP
Sbjct  366  DRLDPALLRPGRMDVHIHLSYCTTSGFRILASNYLGIGDNNRHHRCGEIEGLIESTEVTP  425

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            AE+AEELMK++DAD+ L  L+  L+ K+
Sbjct  426  AEVAEELMKSEDADVALQGLVNLLKRKK  453



>gb|EMT30637.1| Putative mitochondrial chaperone bcs1 [Aegilops tauschii]
Length=514

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI M +C + AFK LA NY  ++DHAL+ +I+ELL  ++VKVTPA
Sbjct  409  DRLDPALLRPGRMDMHIYMGHCCWEAFKTLAVNYHLVDDHALFPEIQELLAAVEVKVTPA  468

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E++E L++++DAD+ L  L  +LQ+K +
Sbjct  469  EVSEMLLRSEDADVALRVLTEFLQDKRS  496



>ref|XP_002441611.1| hypothetical protein SORBIDRAFT_09g030310 [Sorghum bicolor]
 gb|EES20041.1| hypothetical protein SORBIDRAFT_09g030310 [Sorghum bicolor]
Length=465

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA NY  +E+HA+Y +IE+  L+ +V V+PA
Sbjct  367  ERLDPALLRPGRMDMHIHMGYCTPESFRILARNYHSVENHAMYAEIEQ--LIQEVMVSPA  424

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AE LM+ND++D+ L +L+ +L+ K   +
Sbjct  425  EVAEVLMRNDNSDVALQDLLEFLKKKRKQS  454



>ref|XP_009400490.1| PREDICTED: probable mitochondrial chaperone bcs1 [Musa acuminata 
subsp. malaccensis]
Length=449

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI M YC   AF+VLASNY  I++H+L+  IE   L+ +V+VTPA
Sbjct  360  DRLDPALLRPGRMDMHIHMGYCGPHAFRVLASNYHAIDEHSLFADIE--GLIREVEVTPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+LM++DDAD  L  L+ YL+ K
Sbjct  418  EVAEQLMRSDDADTALEGLLEYLRAK  443



>ref|XP_008236924.1| PREDICTED: mitochondrial chaperone BCS1-like [Prunus mume]
Length=479

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MS+C+   FK LASNYL I +H L+  IE+  L+  +KVTPA
Sbjct  376  DRLDPALLRPGRMDVHIHMSFCSPCVFKTLASNYLGITEHTLFFDIEQ--LIATMKVTPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+ E+L+KN+D +  L +LI +L+ K++ T
Sbjct  434  EVGEQLLKNEDPECALRDLIGFLERKKSAT  463



>gb|EMS57301.1| Mitochondrial chaperone BCS1 [Triticum urartu]
Length=500

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI M +C + AFK LA NY  ++DHAL+  I+ELL  ++VKVTPA
Sbjct  395  DRLDPALLRPGRMDMHIYMGHCCWEAFKTLARNYHLVDDHALFPGIQELLAAVEVKVTPA  454

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E++E L++++DAD+ L  L  +LQ+K +
Sbjct  455  EVSEMLLRSEDADVALRVLTEFLQDKRS  482



>ref|XP_010033425.1| PREDICTED: mitochondrial chaperone BCS1-like [Eucalyptus grandis]
 gb|KCW53060.1| hypothetical protein EUGRSUZ_J02354 [Eucalyptus grandis]
Length=476

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYLRI+ H L+ +IE    +   +VTPA
Sbjct  379  EKLDPALLRPGRMDVHIHMSYCTPCGFRLLASNYLRIDSHELFDQIES--SITTARVTPA  436

Query  368  EIAEELMKNDDADITLGNLIIYLQN  294
            E+AE+LMK+D+ ++ L +++ +L N
Sbjct  437  EVAEQLMKSDEPEVALRDMVSFLVN  461



>ref|XP_010113402.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
 gb|EXC35429.1| putative mitochondrial chaperone bcs1 [Morus notabilis]
Length=512

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYL--RIEDHALYHKIEElllvlkvkVT  375
            DRLDPALLRPGRMDMHI MSYCT   FK LASNYL  R  DH L  +IE   L+   +VT
Sbjct  360  DRLDPALLRPGRMDMHINMSYCTTNGFKTLASNYLGIRGNDHDLCGEIE--GLIDSTEVT  417

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNKE  288
            PAE+AEELMK+D AD+ L  L+ +L+ K+
Sbjct  418  PAEVAEELMKSDKADVALEGLVNFLKRKK  446



>gb|KDP25705.1| hypothetical protein JCGZ_24006 [Jatropha curcas]
Length=163

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED--HALYHKIEElllvlkvkVT  375
            +RLDPALLRPGRMD+HI MSYC+   F +LASNYL I    H LY +IE   L+    VT
Sbjct  55   ERLDPALLRPGRMDVHINMSYCSSKGFSLLASNYLGIHSKHHLLYGEIE--GLIDNTNVT  112

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELMK++D D+ L  L+ +L+ K
Sbjct  113  PAEVAEELMKSEDVDVALNGLVNFLKRK  140



>gb|EYU37815.1| hypothetical protein MIMGU_mgv1a018911mg [Erythranthe guttata]
Length=473

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI M+YCT  AFK+LA NY  I +H+L+ +IE   L+  V VTPA
Sbjct  369  DRLDPALLRPGRMDMHILMNYCTPCAFKILAKNYHGINNHSLFGEIE--GLIDDVMVTPA  426

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+ E+L++N+DADI L  LI +L+ K+
Sbjct  427  EVGEQLLRNEDADIALRELIEFLREKK  453



>ref|NP_001167860.1| hypothetical protein [Zea mays]
 gb|ACN26328.1| unknown [Zea mays]
 gb|AFW79395.1| hypothetical protein ZEAMMB73_027247 [Zea mays]
Length=464

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA NY  +E+HA+Y +IE+  L+ +V V+PA
Sbjct  366  ERLDPALLRPGRMDMHINMGYCTPESFRILARNYHSVENHAMYPEIEQ--LIQEVMVSPA  423

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AE LM+ND++DI L +L+ +L+ K   +
Sbjct  424  EVAELLMRNDNSDIVLKDLLEFLKEKRKRS  453



>emb|CDP18341.1| unnamed protein product [Coffea canephora]
Length=536

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT   FK+LASNYL I DH L+  +E+  L+   KVTPA
Sbjct  371  DKLDPALLRPGRMDVHIHMSYCTLCGFKLLASNYLGITDHPLFLAVEQ--LLKVTKVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+ E+L+KN + +I L  LI +L+ K+
Sbjct  429  EVGEQLLKNGEPEIVLACLIEFLEEKK  455



>ref|XP_006654863.1| PREDICTED: probable mitochondrial chaperone BCS1-A-like [Oryza 
brachyantha]
Length=484

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF++LASNY  I+ HA Y +IEE  L+ +V VTPA
Sbjct  362  ERLDPALLRPGRMDMHIHMGYCTPEAFRILASNYHSIDYHATYPEIEE--LIKEVMVTPA  419

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE LM+NDD DI L  L+  L++K
Sbjct  420  EVAEVLMRNDDTDIALLGLMELLKSK  445



>ref|XP_008777540.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
 ref|XP_008777541.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Phoenix dactylifera]
Length=460

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   AF+VLASNY  I+DH L+ +IE   LV +V+VTPA
Sbjct  356  ERLDPALLRPGRMDMHIHMGYCGAHAFRVLASNYHAIDDHPLFPEIE--GLVREVEVTPA  413

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
             +AEELM++DD D  L  L+ +LQ K+
Sbjct  414  AVAEELMRSDDTDAALHGLVQFLQRKK  440



>ref|XP_006290890.1| hypothetical protein CARUB_v10017002mg [Capsella rubella]
 gb|EOA23788.1| hypothetical protein CARUB_v10017002mg [Capsella rubella]
Length=530

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FK LASNYL I++H L+ KIEE   +   +VTPA
Sbjct  376  EKLDAALLRPGRMDMHIHMSYCTPSTFKALASNYLEIKEHHLFSKIEE--GIEATEVTPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  434  EVAEQLMRNDTVDKVLEGLIEFLKVKK  460



>ref|XP_007199173.1| hypothetical protein PRUPE_ppa021397mg [Prunus persica]
 gb|EMJ00372.1| hypothetical protein PRUPE_ppa021397mg [Prunus persica]
Length=474

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPAL+RPGRMD+HI MS+C+   FK LASNYL I +H L+  IE+  L+  +KVTPA
Sbjct  371  DRLDPALVRPGRMDVHIHMSFCSPCGFKTLASNYLGITEHTLFFDIEQ--LLATMKVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+ E+L+KN+D +  L +LI +L+ K++ T
Sbjct  429  EVGEQLLKNEDPECALRDLIGFLERKKSAT  458



>ref|XP_008441126.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103485356 
[Cucumis melo]
Length=938

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT   F+VLASNYL IE+H L+ +IEE  L+   KVTPA
Sbjct  399  EKLDPALLRPGRMDVHVHMSYCTPCGFRVLASNYLGIENHTLFGEIEE--LIPGAKVTPA  456

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AEEL+K D++D +L +LI +L  K
Sbjct  457  EVAEELLKGDESDKSLRDLIEFLNVK  482


 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMD+H+ MSYC+   F++LASNYL IE+H L+ +IEE  L+LK KVTPA
Sbjct  823  EKLDEALLRPGRMDVHVHMSYCSPCGFRLLASNYLGIENHELFGEIEE--LILKAKVTPA  880

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE+L+K DD D  L  L+ +L++K+ 
Sbjct  881  EVAEQLLKGDDGDKALSELMEFLEDKKG  908



>gb|KHN00516.1| Putative mitochondrial chaperone bcs1 [Glycine soja]
Length=472

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT   F+ LASNYL I++H+L+ KIEE   + K +VTPA
Sbjct  342  DKLDPALLRPGRMDVHIHMSYCTPCGFRQLASNYLGIKEHSLFEKIEE--EMQKTQVTPA  399

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENT  282
            E+AE+L+K+   + +L  LI +++ K+ T
Sbjct  400  EVAEQLLKSSHIETSLEQLIDFMRKKKET  428



>ref|XP_003569314.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brachypodium 
distachyon]
Length=487

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I+ HA Y +IEE  L+ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSIDHHATYPEIEE--LIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AE LM+N++ DI L  LI +L+ K + T
Sbjct  419  EVAEVLMRNEETDIALEGLIQFLKRKRDGT  448



>dbj|BAK02275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I+ HA Y +IEE  ++ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSIDHHATYQEIEE--MIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+N++ DI L  LI +L+ K++
Sbjct  419  EVAEVLMRNEETDIALEGLIQFLKRKKD  446



>emb|CDX73767.1| BnaC08g22360D [Brassica napus]
Length=538

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FKVLASNYL I++H L+ KI E   +   +V+PA
Sbjct  376  EKLDAALLRPGRMDMHIHMSYCTPSTFKVLASNYLEIKEHKLFSKIGE--GIEATEVSPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LMKND  D  L  LI +L+ K+
Sbjct  434  EVAEQLMKNDTVDKVLEGLIEFLKVKK  460



>ref|XP_010230962.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Brachypodium 
distachyon]
Length=486

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF++LA+NY  I+ H  Y +IE   L+ +V VTPA
Sbjct  354  ERLDPALLRPGRMDMHIHMGYCTREAFRILANNYHSIDYHVTYPEIE--GLIEEVTVTPA  411

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE LM+NDD D+ L +L++ L +K+
Sbjct  412  EVAEVLMRNDDTDVALSDLVVLLNSKK  438



>ref|XP_009611008.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Nicotiana 
tomentosiformis]
Length=489

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D++DPALLRPGRMDMHI MSY T   F VLA NY ++ DH  +H  E   L+  V+VTPA
Sbjct  373  DKIDPALLRPGRMDMHIHMSYLTIEGFTVLAKNYFKVHDHQNWHFTEIQQLIESVQVTPA  432

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AEELMK+D+A I L  L+ +L+ K
Sbjct  433  EVAEELMKSDNAKICLERLVKFLKRK  458



>ref|XP_003520292.1| PREDICTED: transitional endoplasmic reticulum ATPase homolog 
2-like [Glycine max]
Length=498

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT   F+ LASNYL I++H+L+ KIEE   + K +VTPA
Sbjct  368  DKLDPALLRPGRMDVHIHMSYCTPCGFRQLASNYLGIKEHSLFEKIEE--EMQKTQVTPA  425

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENT  282
            E+AE+L+K+   + +L  LI +++ K+ T
Sbjct  426  EVAEQLLKSSHIETSLEQLIDFMRKKKET  454



>ref|XP_004969095.1| PREDICTED: mitochondrial chaperone BCS1-like [Setaria italica]
Length=487

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I DH  Y +IEE  L+ +V VTPA
Sbjct  363  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHAISDHDRYPEIEE--LIKEVMVTPA  420

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD DI L  LI +L+ K +
Sbjct  421  EVAEVLMRNDDTDIALEGLIQFLKAKRS  448



>emb|CDX78758.1| BnaA03g06700D [Brassica napus]
Length=217

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED----HALYHKIEElllvlkvk  381
            DRLDPALLRPGRMDMHI M +CTF  FK LASNYL + D    H LY +IE   L+    
Sbjct  82   DRLDPALLRPGRMDMHIYMGHCTFQGFKTLASNYLGLNDTTMPHRLYPEIER--LMDGEV  139

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQ  297
            +TPA++AEELMK++DAD+ L  L+  L+
Sbjct  140  ITPAQVAEELMKSEDADVALEGLVNVLE  167



>ref|XP_010668035.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MSY     FKVLASNYL +E+H+L+ KIE+  L+   +V+PA
Sbjct  386  ERLDPALLRPGRMDMHIHMSYLGMPGFKVLASNYLDLEEHSLFKKIEK--LIETTEVSPA  443

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AEEL+++DD DI L  ++  L+ K+
Sbjct  444  EVAEELIRSDDPDIALAGVVKMLEGKK  470



>gb|KDP44563.1| hypothetical protein JCGZ_22145 [Jatropha curcas]
Length=352

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT   F++LASNY+ I DH L+ +IEE   +   +VTPA
Sbjct  234  EKLDPALLRPGRMDVHVHMSYCTPCGFRLLASNYVGINDHFLFQEIEE--FISTTQVTPA  291

Query  368  EIAEELMKNDDADITLGNLIIYL--QNKEN  285
            E+AE+LM++D+ +  L  LI +L  + KEN
Sbjct  292  EVAEQLMRSDEPETVLVELIQFLKVKKKEN  321



>ref|XP_010227813.1| PREDICTED: uncharacterized protein LOC100829577 [Brachypodium 
distachyon]
Length=523

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I+ HA Y +IEE  L+ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSIDHHATYPEIEE--LIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AE LM+N++ DI L  LI +L+ K + T
Sbjct  419  EVAEVLMRNEETDIALEGLIQFLKRKRDGT  448



>gb|KCW53076.1| hypothetical protein EUGRSUZ_J02376 [Eucalyptus grandis]
Length=462

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+ +IE    +   +VTPA
Sbjct  342  EKLDPALLRPGRMDLHIHMSYCTPCGFRLLASNYLGIDHHELFDQIES--AITTARVTPA  399

Query  368  EIAEELMKNDDADITLGNLIIYLQN---KEN  285
            E+AE+LMK D+ ++ LG+++ +L N   KEN
Sbjct  400  EVAEQLMKCDEPEVALGDMVSFLINHKRKEN  430



>emb|CDX77966.1| BnaA09g31610D [Brassica napus]
Length=528

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FKVLASNYL I++H L+ KI E   +   +V+PA
Sbjct  366  EKLDAALLRPGRMDMHIHMSYCTPSTFKVLASNYLEIKEHKLFSKIGE--GIEATEVSPA  423

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LMKND  D  L  L+ +L+ K+
Sbjct  424  EVAEQLMKNDTVDKVLEGLVEFLKVKK  450



>ref|XP_009115772.1| PREDICTED: putative cell division cycle ATPase [Brassica rapa]
Length=538

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FKVLASNYL I++H L+ KI E   +   +V+PA
Sbjct  376  EKLDAALLRPGRMDMHIHMSYCTPSTFKVLASNYLEIKEHKLFSKIGE--GIEATEVSPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LMKND  D  L  L+ +L+ K+
Sbjct  434  EVAEQLMKNDTVDKVLEGLVEFLKVKK  460



>gb|EYU32906.1| hypothetical protein MIMGU_mgv1a006796mg [Erythranthe guttata]
Length=431

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 7/92 (8%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-----EDHALYHKIEElllvlkv  384
            +RLDPALLRPGRMD+ ++M YC F+ FK+LAS YLRI     E H L+  I+E  L+ KV
Sbjct  339  NRLDPALLRPGRMDVQLEMGYCKFSGFKILASTYLRIDGEEEEGHPLFAAIDE--LLAKV  396

Query  383  kVTPAEIAEELMKNDDADITLGNLIIYLQNKE  288
            + TPAE+A ELMK+++AD+ L NL+ +L+ KE
Sbjct  397  QATPAEVAGELMKSENADVALLNLVKFLEAKE  428



>ref|XP_010492742.1| PREDICTED: mitochondrial chaperone BCS1-like [Camelina sativa]
Length=233

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED----HALYHKIEElllvlkvk  381
            DRLDPALLRPGRMDMHI M +C+F  FK LASNYL + D    H LY +IE   L+    
Sbjct  97   DRLDPALLRPGRMDMHIYMGHCSFQGFKTLASNYLGLNDATMPHRLYPEIER--LIDGEV  154

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQ  297
            +TPA++AEELMK++DAD+ L  L+  L+
Sbjct  155  ITPAQVAEELMKSEDADVALEGLVNVLE  182



>ref|XP_009798897.1| PREDICTED: transitional endoplasmic reticulum ATPase-like [Nicotiana 
sylvestris]
Length=513

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT  +FK+LA NYL I DH L+ +IE   L+  V+ TPA
Sbjct  360  EKLDPALLRPGRMDMHIHMSYCTNQSFKILAFNYLGIRDHRLFLEIE--GLIKNVEATPA  417

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            EIAEELM+++DAD+ L  ++  L+ K
Sbjct  418  EIAEELMRSEDADVVLEGVVNLLKRK  443



>ref|XP_002455914.1| hypothetical protein SORBIDRAFT_03g027200 [Sorghum bicolor]
 gb|EES01034.1| hypothetical protein SORBIDRAFT_03g027200 [Sorghum bicolor]
Length=497

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I DH  Y +IE   L+ +  VTPA
Sbjct  372  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSITDHDTYPEIE--ALIKEAMVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDD DI L  LI +L+ K+ 
Sbjct  430  EVAEVLMRNDDTDIALQGLIRFLKGKKG  457



>gb|KDO47912.1| hypothetical protein CISIN_1g011286mg [Citrus sinensis]
Length=489

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ ++EE  L+ KV+VTPA
Sbjct  371  DRLDPALLRPGRMDVHIHMSYCTPCGFKMLASNYLGITEHPLFLEVEE--LIEKVEVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            ++AE+LM+++   I L  LI +LQ K+  T
Sbjct  429  DVAEQLMRDEVPKIALSGLIQFLQIKKRET  458



>gb|KDO47911.1| hypothetical protein CISIN_1g011286mg [Citrus sinensis]
Length=487

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ ++EE  L+ KV+VTPA
Sbjct  369  DRLDPALLRPGRMDVHIHMSYCTPCGFKMLASNYLGITEHPLFLEVEE--LIEKVEVTPA  426

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            ++AE+LM+++   I L  LI +LQ K+  T
Sbjct  427  DVAEQLMRDEVPKIALSGLIQFLQIKKRET  456



>ref|XP_010033437.1| PREDICTED: probable mitochondrial chaperone BCS1-A isoform X2 
[Eucalyptus grandis]
Length=488

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+ +IE    +   +VTPA
Sbjct  368  EKLDPALLRPGRMDLHIHMSYCTPCGFRLLASNYLGIDHHELFDQIES--AITTARVTPA  425

Query  368  EIAEELMKNDDADITLGNLIIYLQN---KEN  285
            E+AE+LMK D+ ++ LG+++ +L N   KEN
Sbjct  426  EVAEQLMKCDEPEVALGDMVSFLINHKRKEN  456



>ref|XP_002441612.1| hypothetical protein SORBIDRAFT_09g030320 [Sorghum bicolor]
 gb|EES20042.1| hypothetical protein SORBIDRAFT_09g030320 [Sorghum bicolor]
Length=472

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA+NY  IE H  Y +IE+  L+++V VTPA
Sbjct  359  ERLDPALLRPGRMDMHIHMGYCTPESFRILANNYHSIEYHDTYPEIEK--LIMEVTVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE LM+NDDAD+ L +L+ +L++K
Sbjct  417  EVAEVLMRNDDADVVLHDLVDFLKSK  442



>ref|XP_006487222.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Citrus 
sinensis]
Length=489

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ ++EE  L+ KV+VTPA
Sbjct  371  DRLDPALLRPGRMDVHIHMSYCTPCGFKMLASNYLGITEHPLFLEVEE--LIEKVEVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            ++AE+LM+++   I L  LI +LQ K+  T
Sbjct  429  DVAEQLMRDEVPKIALSGLIQFLQIKKRET  458



>ref|XP_010033436.1| PREDICTED: probable mitochondrial chaperone BCS1-A isoform X1 
[Eucalyptus grandis]
Length=492

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+ +IE    +   +VTPA
Sbjct  372  EKLDPALLRPGRMDLHIHMSYCTPCGFRLLASNYLGIDHHELFDQIES--AITTARVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQN---KEN  285
            E+AE+LMK D+ ++ LG+++ +L N   KEN
Sbjct  430  EVAEQLMKCDEPEVALGDMVSFLINHKRKEN  460



>gb|AFW71485.1| hypothetical protein ZEAMMB73_526250 [Zea mays]
Length=286

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAEI  363
            LDPALLRPGRMDMHI M YCT  +F++LA+NY  IE H  Y KIE+  L+ ++ VTPAE+
Sbjct  175  LDPALLRPGRMDMHIHMGYCTLESFQILANNYHSIEYHDTYPKIEK--LIKEMMVTPAEV  232

Query  362  AEELMKNDDADITLGNLIIYLQNK  291
            AE LM+NDD D+ L +LI +L+++
Sbjct  233  AEVLMRNDDTDVVLHDLIGFLKSR  256



>ref|XP_006423337.1| hypothetical protein CICLE_v10028347mg [Citrus clementina]
 gb|ESR36577.1| hypothetical protein CICLE_v10028347mg [Citrus clementina]
Length=476

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ ++EE  L+ KV+VTPA
Sbjct  358  DRLDPALLRPGRMDVHIHMSYCTPCGFKMLASNYLGITEHPLFLEVEE--LIEKVEVTPA  415

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            ++AE+LM+++   I L  LI +LQ K+  T
Sbjct  416  DVAEQLMRDEVPKIALSGLIQFLQIKKRET  445



>ref|XP_010033434.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Eucalyptus 
grandis]
 gb|KCW53074.1| hypothetical protein EUGRSUZ_J02373 [Eucalyptus grandis]
Length=493

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+ +IE    +   +VTPA
Sbjct  373  EKLDPALLRPGRMDLHIPMSYCTPCGFRLLASNYLGIDHHELFGQIES--AITTARVTPA  430

Query  368  EIAEELMKNDDADITLGNLIIYLQN---KEN  285
            E+AE+LMK D+ ++ LG+++ +L N   KEN
Sbjct  431  EVAEQLMKCDEPEVALGDMVSFLINHKRKEN  461



>ref|XP_011025849.1| PREDICTED: putative cell division cycle ATPase [Populus euphratica]
Length=474

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED--HALYHKIEElllvlkvkVT  375
            DRLDPALLRPGRMD+HI MSYCT  AF +LASNYL I D  H LY +IE   L+    VT
Sbjct  365  DRLDPALLRPGRMDVHINMSYCTPQAFSILASNYLDIRDKNHYLYDEIE--GLMESTNVT  422

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELM +++AD+ L  L+ +L+ K
Sbjct  423  PAEVAEELMASENADVALEGLVNFLKRK  450



>gb|KDP44568.1| hypothetical protein JCGZ_22150 [Jatropha curcas]
Length=486

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT + F++LASNYL I DH L+ +IEE   +   +VTPA
Sbjct  372  EKLDPALLRPGRMDVHVHMSYCTPSGFRLLASNYLGINDHFLFQQIEE--FISTTQVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYL--QNKEN  285
            E+AE+LM++D+ +  L  LI +L  + KEN
Sbjct  430  EVAEQLMRSDEIETVLVELIQFLKVKKKEN  459



>ref|NP_850841.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB09575.1| AAA-type ATPase-like protein [Arabidopsis thaliana]
 gb|AED92464.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=505

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKI--EElllvlkvkVT  375
            DRLDPALLRPGRMDMHI M +C+F  FK LASNYL + D A+ H++  E   L+    +T
Sbjct  369  DRLDPALLRPGRMDMHIYMGHCSFQGFKTLASNYLGLSDAAMPHRLFPEIERLIDGEVMT  428

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNKENTTT*TLDMMMEQ  249
            PA++AEELMK++DAD+ L  L+  L+     +  +  +MM+Q
Sbjct  429  PAQVAEELMKSEDADVALEGLVNVLEKMRLKSKESNPVMMKQ  470



>ref|XP_010033435.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Eucalyptus 
grandis]
Length=463

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+ +IE   ++   +VTPA
Sbjct  375  EKLDPALLRPGRMDLHIPMSYCTPCGFRLLASNYLGIDHHELFGQIES--VITTARVTPA  432

Query  368  EIAEELMKNDDADITLGNLIIYLQN  294
            E+AE+LMK D+ ++ LG+++ +L N
Sbjct  433  EVAEQLMKCDEPEVALGDMVSFLIN  457



>ref|XP_010549720.1| PREDICTED: mitochondrial chaperone BCS1 [Tarenaya hassleriana]
Length=491

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 6/93 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI----EDHALYHKIEElllvlkvk  381
            ++LDPALLRPGRMDMHI M +CTF  FK LASNYL +      H LY +I+    +   K
Sbjct  351  EKLDPALLRPGRMDMHIYMGHCTFQGFKTLASNYLGLPCSDNGHCLYDRIQ--GTIEGAK  408

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQNKENT  282
            VTPA+IAEELMK++DAD  L NLI +L+ K  T
Sbjct  409  VTPAQIAEELMKSEDADFALENLIKFLERKRLT  441



>ref|XP_002441613.1| hypothetical protein SORBIDRAFT_09g030330 [Sorghum bicolor]
 gb|EES20043.1| hypothetical protein SORBIDRAFT_09g030330 [Sorghum bicolor]
Length=472

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA+NY  +E H  Y +IE+  L+ +V VTPA
Sbjct  359  ERLDPALLRPGRMDMHIHMGYCTPESFRILANNYHSVEYHDTYPEIEK--LIKEVMVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE LM+NDDAD+ L +L+ +L++K
Sbjct  417  EVAEVLMRNDDADVVLHDLVDFLKSK  442



>ref|XP_004289100.1| PREDICTED: probable mitochondrial chaperone bcs1-like [Fragaria 
vesca subsp. vesca]
Length=267

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 5/90 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            D+LDPALLRPGRMD+HI +SYCT   FK LASNYL I++   H L  K+E   L+   +V
Sbjct  152  DKLDPALLRPGRMDLHIHLSYCTPNGFKTLASNYLGIQESNPHPLCGKVER--LMETTEV  209

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQNKE  288
            TPAE+AEELMK+DDAD+ L  ++  L+ K+
Sbjct  210  TPAEVAEELMKSDDADVALQGVVSLLKRKK  239



>gb|AFW79394.1| chaperone BCS1 [Zea mays]
Length=382

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA+NY  IE H  Y +IE+  L+ +V VTPA
Sbjct  273  ERLDPALLRPGRMDMHIHMGYCTPESFQILANNYHSIEYHDTYPEIEK--LIKEVTVTPA  330

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE LM+NDD D+ L +L+ +L++K
Sbjct  331  EVAEVLMRNDDTDVVLHDLVDFLKSK  356



>gb|AGV54871.1| mitochondrial chaperone BCS1-like isoform 5 [Phaseolus vulgaris]
Length=500

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYC++  FK+LASNYL I  +H L+ +IE   L+  +++TP
Sbjct  355  ERLDPALLRPGRMDMHIHMSYCSYQGFKLLASNYLEIPSEHPLFGEIE--GLIEDIQITP  412

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMKN+DA+ TL   +  L+ K+
Sbjct  413  AQVAEELMKNEDAEATLEGFVKLLKRKK  440



>ref|XP_007046840.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX90997.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=509

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED--HALYHKIEElllvlkvkVT  375
            DR+DPALLRPGRMDMHI MSYCT   FK+LASNYL I    +  + +I+   L+   + T
Sbjct  361  DRIDPALLRPGRMDMHINMSYCTPDGFKLLASNYLNISSKHNPFFGEID--GLLKSAEAT  418

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNKEN  285
            PAE+AEELMK DDAD+ L  L+ +L+ K +
Sbjct  419  PAEVAEELMKTDDADVALQGLVSFLKRKRD  448



>ref|XP_007046839.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90996.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=508

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED--HALYHKIEElllvlkvkVT  375
            DR+DPALLRPGRMDMHI MSYCT   FK+LASNYL I    +  + +I+   L+   + T
Sbjct  360  DRIDPALLRPGRMDMHINMSYCTPDGFKLLASNYLNISSKHNPFFGEID--GLLKSAEAT  417

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNKEN  285
            PAE+AEELMK DDAD+ L  L+ +L+ K +
Sbjct  418  PAEVAEELMKTDDADVALQGLVSFLKRKRD  447



>gb|KCW53073.1| hypothetical protein EUGRSUZ_J02373 [Eucalyptus grandis]
Length=461

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+ +IE   ++   +VTPA
Sbjct  373  EKLDPALLRPGRMDLHIPMSYCTPCGFRLLASNYLGIDHHELFGQIES--VITTARVTPA  430

Query  368  EIAEELMKNDDADITLGNLIIYLQN  294
            E+AE+LMK D+ ++ LG+++ +L N
Sbjct  431  EVAEQLMKCDEPEVALGDMVSFLIN  455



>ref|XP_004961039.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Setaria 
italica]
Length=467

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA NY  I+ HA Y +IE+  L+ +V VTPA
Sbjct  356  ERLDPALLRPGRMDMHIYMGYCTPQSFRILAHNYHMIDYHATYPEIEK--LMKEVMVTPA  413

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+NDDAD+ L +LI  L++K N
Sbjct  414  EVAEVLMRNDDADVALHDLIDLLKSKVN  441



>ref|XP_002310265.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE90715.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=450

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED--HALYHKIEElllvlkvkVT  375
            DRLDPALLRPGRMD+HI M YCT  AF +LASNYL I D  H LY +IE   L+    VT
Sbjct  343  DRLDPALLRPGRMDVHINMPYCTPQAFSILASNYLDIRDKNHYLYDEIE--GLMESTNVT  400

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNK  291
            PAE+AEELM +++AD+ L  L+ +L+ K
Sbjct  401  PAEVAEELMASENADVALEGLVNFLKRK  428



>gb|EMT02204.1| Putative mitochondrial chaperone BCS1-B [Aegilops tauschii]
Length=428

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI M YC + AF++LA NY  ++DH L+ +I+E  L+ +V+VTPA
Sbjct  335  DRLDPALLRPGRMDMHIYMGYCGWEAFRMLARNYFLVDDHPLFPEIQE--LLAEVEVTPA  392

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E++E L++N+DADI L  L+ +L  K+ 
Sbjct  393  EVSEMLLRNEDADIALLGLVEFLTPKKQ  420



>ref|XP_010033429.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Eucalyptus 
grandis]
 ref|XP_010033430.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Eucalyptus 
grandis]
 ref|XP_010033431.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Eucalyptus 
grandis]
 gb|KCW53066.1| hypothetical protein EUGRSUZ_J02363 [Eucalyptus grandis]
Length=483

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F++LASNYL I+ H L+  IE    +   +VTPA
Sbjct  363  EKLDPALLRPGRMDLHIPMSYCTPCGFRLLASNYLGIDHHELFGHIES--AITTARVTPA  420

Query  368  EIAEELMKNDDADITLGNLIIYLQN---KEN  285
            E+AE+LMK D+ ++ LG+++ +L N   KEN
Sbjct  421  EVAEQLMKCDEPEVALGDMVSFLINHKRKEN  451



>ref|XP_006383165.1| hypothetical protein POPTR_0005s12200g [Populus trichocarpa]
 gb|ERP60962.1| hypothetical protein POPTR_0005s12200g [Populus trichocarpa]
Length=501

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED-HALYHKIEElllvlkvkVTP  372
            DRLDPALLRPGRMDMHI MSYCT   F+VLASNYL I   H L+ +IE+  L+   +VTP
Sbjct  370  DRLDPALLRPGRMDMHIHMSYCTTHGFRVLASNYLGINGYHTLFGEIED--LIKTTEVTP  427

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMK++D++I L  ++  L+ K+
Sbjct  428  AQVAEELMKSEDSNIALEGVVKLLKRKK  455



>gb|EMT29435.1| Putative mitochondrial chaperone bcs1 [Aegilops tauschii]
Length=485

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I+ HA Y +IEE  L+ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSIDHHATYPEIEE--LIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+N++ D+ L  LI +L+ K++
Sbjct  419  EVAEVLMRNEETDVALKGLIQFLKRKKD  446



>gb|KDO38746.1| hypothetical protein CISIN_1g024550mg [Citrus sinensis]
Length=266

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MS+CT + FK+LASNYL I +H L+ +IE+  L+   KVTPA
Sbjct  154  ERLDPALLRPGRMDMHINMSHCTPSGFKMLASNYLGIAEHPLFVEIEK--LIATAKVTPA  211

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+N+  +  L  LI +L++K+
Sbjct  212  DVAEQLMRNEAPEFALSGLIEFLESKK  238



>ref|XP_006346970.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=495

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI +SYCT + F++LA+NYL   +H L+ +IEE  L+    VTPA
Sbjct  371  EKLDPALLRPGRMDMHIHLSYCTPSGFRLLAANYLDTREHKLFKQIEE--LIETAMVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            E+AE+L+K D+ D++L  LI +L
Sbjct  429  EVAEQLLKEDEVDVSLNGLISFL  451



>ref|XP_010245232.1| PREDICTED: uncharacterized protein LOC104588825 [Nelumbo nucifera]
Length=501

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
            D LDPALLRPGRMD HI MSYCT   FK+LASNYL I E+H L+ +IE+  L+  ++VTP
Sbjct  387  DWLDPALLRPGRMDKHIHMSYCTPKGFKLLASNYLGIHENHQLFREIED--LIENIQVTP  444

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            AE+AEELMK+++A++ L  LI +L+ K+
Sbjct  445  AEVAEELMKSEEAEVALSGLINFLEQKK  472



>ref|XP_009604677.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=485

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LD ALLRPGRMDMHI MSYC  ++FK L  NYLRI++H L+ KI +  L+  V+VTPA
Sbjct  357  DKLDAALLRPGRMDMHIYMSYCKLSSFKQLVFNYLRIQEHKLFDKIGQ--LLEAVEVTPA  414

Query  368  EIAEELMKNDDADITLGNLIIYLQNK--ENTTT*TLDMMME  252
            E+A EL+K+ + +I+L +LI +LQNK  EN     +D+ ++
Sbjct  415  EVAGELLKSTNPNISLQSLIEFLQNKIAENKMKAEMDLTLQ  455



>ref|XP_007046848.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOX91005.1| ATP binding protein, putative [Theobroma cacao]
Length=502

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = -2

Query  545  RLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIE-DHALYHKIEElllvlkvkVTPA  369
            RLDPAL RPGRMDMHI MSYCT  AF++LASNYL  + +H L+  I+E  L+   KVTPA
Sbjct  376  RLDPALWRPGRMDMHINMSYCTTQAFRILASNYLGTKGEHRLFRDIDE--LLEATKVTPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AEELMKN+DAD  L     +L+ K+
Sbjct  434  QVAEELMKNEDADTALEAFFTFLKQKK  460



>emb|CBI27584.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MS+C    FK LASNYL + +H L+ +IE+  L+++V+VTPA
Sbjct  327  DKLDPALLRPGRMDVHIHMSFCNPCGFKTLASNYLDVSNHKLFPEIEK--LLMEVEVTPA  384

Query  368  EIAEELMKNDDADITLGNLIIYLQ  297
            EIAEE MK++DAD+ L  L+ +L+
Sbjct  385  EIAEEFMKSEDADVALEGLVEFLR  408



>ref|XP_006487229.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like isoform 
X1 [Citrus sinensis]
 ref|XP_006487230.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like isoform 
X2 [Citrus sinensis]
Length=479

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ +IE+  L+   KVTPA
Sbjct  378  DRLDPALLRPGRMDVHIHMSYCTPCGFKMLASNYLGIAEHPLFVEIEK--LIETAKVTPA  435

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+L++N++ ++ L  LI +L+ K+
Sbjct  436  DVAEQLLRNEEPELALSGLIEFLETKK  462



>emb|CDP10348.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT   FK+LASNYL I DH L+  +E+  L+   KVTPA
Sbjct  183  DKLDPALLRPGRMDVHIYMSYCTPCGFKLLASNYLGITDHPLFLVVEQ--LMKVTKVTPA  240

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+ E+L+KN + +  L  LI +L+ K+
Sbjct  241  EVGEQLLKNGEPETALEGLIQFLEEKK  267



>ref|XP_010655455.1| PREDICTED: mitochondrial chaperone BCS1-like [Vitis vinifera]
Length=450

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MS+C    FK LASNYL + +H L+ +IE+  L+++V+VTPA
Sbjct  349  DKLDPALLRPGRMDVHIHMSFCNPCGFKTLASNYLDVSNHKLFPEIEK--LLMEVEVTPA  406

Query  368  EIAEELMKNDDADITLGNLIIYLQ  297
            EIAEE MK++DAD+ L  L+ +L+
Sbjct  407  EIAEEFMKSEDADVALEGLVEFLR  430



>ref|XP_008338052.1| PREDICTED: ATPase family gene 2 protein-like [Malus domestica]
Length=506

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            DRLDPALLRPGRMD+HI MSYCT A +++LASNYL I++   H L  +IE   L+   +V
Sbjct  371  DRLDPALLRPGRMDLHIHMSYCTTAGYRILASNYLGIQENNRHRLCGEIE--GLIESTEV  428

Query  377  TPAEIAEELMKNDDADITLGNLI  309
            TPAE+AEELMK+DDAD+ L  L+
Sbjct  429  TPAEVAEELMKSDDADVALQGLV  451



>gb|EMS64027.1| putative mitochondrial chaperone bcs1 [Triticum urartu]
Length=485

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I+ HA Y +IEE  L+ +V VTPA
Sbjct  361  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSIDHHATYPEIEE--LIKEVMVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+N++ D+ L  LI +L+ K++
Sbjct  419  EVAEVLMRNEETDVALEGLIQFLKRKKD  446



>ref|XP_003537605.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 2 [Glycine 
max]
 gb|KHN41945.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=511

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 10/113 (9%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYC++  FK+LASNYL    DH L+ ++E   L+  +++TP
Sbjct  372  ERLDPALLRPGRMDMHIHMSYCSYQGFKILASNYLETSSDHPLFGEVE--GLIEDIQITP  429

Query  371  AEIAEELMKNDDADITLGNLIIYLQNK-------ENTTT*TLDMMMEQGSKLK  234
            A++AEELMKN+D + TL   +  L+ K       EN+T    +   +Q  + K
Sbjct  430  AQVAEELMKNEDPEATLEGFVKLLKRKKMEGDVCENSTPDKAEPTRQQSKRRK  482



>ref|XP_003537604.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 1 [Glycine 
max]
Length=501

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 10/113 (9%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYC++  FK+LASNYL    DH L+ ++E   L+  +++TP
Sbjct  362  ERLDPALLRPGRMDMHIHMSYCSYQGFKILASNYLETSSDHPLFGEVE--GLIEDIQITP  419

Query  371  AEIAEELMKNDDADITLGNLIIYLQNK-------ENTTT*TLDMMMEQGSKLK  234
            A++AEELMKN+D + TL   +  L+ K       EN+T    +   +Q  + K
Sbjct  420  AQVAEELMKNEDPEATLEGFVKLLKRKKMEGDVCENSTPDKAEPTRQQSKRRK  472



>gb|AAK43926.1|AF370607_1 putative mitochondrial protein [Arabidopsis thaliana]
 emb|CAB42922.1| putative mitochondrial protein [Arabidopsis thaliana]
 gb|AAM26687.1| AT3g50930/F18B3_210 [Arabidopsis thaliana]
Length=534

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FK LA NYL I++H L+ KIEE   +   +VTPA
Sbjct  376  EKLDAALLRPGRMDMHIHMSYCTPSTFKALALNYLEIKEHRLFSKIEE--GIEATEVTPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  434  EVAEQLMRNDSVDKVLEGLIEFLKVKK  460



>gb|AAM64718.1| BCS1 protein-like protein [Arabidopsis thaliana]
Length=534

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FK LA NYL I++H L+ KIEE   +   +VTPA
Sbjct  376  EKLDAALLRPGRMDMHIHMSYCTPSTFKALALNYLEIKEHRLFSKIEE--GIEATEVTPA  433

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  434  EVAEQLMRNDSVDKVLEGLIEFLKVKK  460



>ref|XP_008650092.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial chaperone BCS1-like 
[Zea mays]
Length=443

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA+NY  IE H  Y +IE+  L+ +V VTPA
Sbjct  334  ERLDPALLRPGRMDMHIHMGYCTPESFQILANNYHSIEYHDTYPEIEK--LIKEVTVTPA  391

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE LM+NDD D+ L +L+ +L++K
Sbjct  392  EVAEVLMRNDDTDVVLHDLVDFLKSK  417



>ref|XP_010113403.1| putative mitochondrial chaperone BCS1-B [Morus notabilis]
 gb|EXC35430.1| putative mitochondrial chaperone BCS1-B [Morus notabilis]
Length=518

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIE-DHALYHKIEElllvlkvkVTP  372
            DRLDPALLRPGRMDMHI MSYCT+  FK+LASNYL I   H L+ +IE   L+ + +VTP
Sbjct  361  DRLDPALLRPGRMDMHIHMSYCTYHGFKLLASNYLGIHGSHMLFGEIE--ALMQEAEVTP  418

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMK+++ D+ L  L+  L+ K+
Sbjct  419  AQVAEELMKSENTDVALEGLVKLLKRKK  446



>gb|KDP46725.1| hypothetical protein JCGZ_06513 [Jatropha curcas]
Length=305

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLR GRMDMHI +SYCTF+ FK LA+NYL I DH L+  IE+  L+ +V+V+PA
Sbjct  53   DRIDPALLRAGRMDMHIYLSYCTFSTFKQLAANYLDIWDHHLFTSIEK--LIKEVQVSPA  110

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            ++A ELMKN D   +L  L+ +L++K++
Sbjct  111  DVAGELMKNRDPKTSLEGLVKFLEDKKS  138



>ref|NP_190662.2| cytochrome BC1 synthesis [Arabidopsis thaliana]
 gb|AAL57634.1| AT3g50930/F18B3_210 [Arabidopsis thaliana]
 gb|AAO11527.1| At3g50930/F18B3_210 [Arabidopsis thaliana]
 gb|AEE78728.1| cytochrome BC1 synthesis [Arabidopsis thaliana]
Length=576

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LD ALLRPGRMDMHI MSYCT + FK LA NYL I++H L+ KIEE   +   +VTPA
Sbjct  418  EKLDAALLRPGRMDMHIHMSYCTPSTFKALALNYLEIKEHRLFSKIEE--GIEATEVTPA  475

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+LM+ND  D  L  LI +L+ K+
Sbjct  476  EVAEQLMRNDSVDKVLEGLIEFLKVKK  502



>ref|XP_011028420.1| PREDICTED: putative cell division cycle ATPase [Populus euphratica]
Length=496

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED-HALYHKIEElllvlkvkVTP  372
            DRLDPALLRPGRMDMHI MSYCT   F+VLASNYL I   H L+ +IE+  L+   +VTP
Sbjct  365  DRLDPALLRPGRMDMHIHMSYCTTHGFRVLASNYLGINGYHTLFGEIED--LIKTTEVTP  422

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMK++D++I L  ++  L+ K+
Sbjct  423  AQLAEELMKSEDSNIALEGVVKLLKRKK  450



>dbj|BAJ97155.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMHI M YC + AFK LA NY  ++DHAL+ +I+E  L+  V+VTPA
Sbjct  405  DRLDPALLRPGRMDMHIYMGYCCWEAFKTLARNYHLVDDHALFPEIKE--LLAAVEVTPA  462

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E++E L++++DAD+ L  L  +LQ+K
Sbjct  463  EVSEMLLRSEDADVALRVLTEFLQDK  488



>ref|NP_001147824.1| mitochondrial chaperone BCS1 [Zea mays]
 gb|ACG28815.1| mitochondrial chaperone BCS1 [Zea mays]
Length=468

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA+NY  IE H  Y +IE+  L+ +V VTPA
Sbjct  359  ERLDPALLRPGRMDMHIHMGYCTPESFQILANNYHSIEYHDTYPEIEK--LIKEVTVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE LM+NDD D+ L +L+ +L++K
Sbjct  417  EVAEVLMRNDDTDVVLHDLVDFLKSK  442



>ref|XP_004293765.1| PREDICTED: mitochondrial chaperone BCS1-like [Fragaria vesca 
subsp. vesca]
Length=446

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = -2

Query  545  RLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAE  366
            +LDPALLR GRMDMHI MSYC++  FK LASNYL + DH L+  IE   L+   K+TPA+
Sbjct  344  KLDPALLRSGRMDMHIHMSYCSYEGFKTLASNYLGVCDHPLFENIES--LLKNTKITPAQ  401

Query  365  IAEELMKNDDADITLGNLIIYLQNK  291
            IAE LMK++DA++ L  LI  L+ K
Sbjct  402  IAEALMKSEDAEVALQGLITVLKEK  426



>ref|XP_006343389.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=502

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI M+YCT   FK+LA+NYL I+DH L+ +IEE  L+    VTPA
Sbjct  373  EKLDPALLRPGRMDMHIHMAYCTPCGFKLLATNYLGIKDHKLFKEIEE--LIDIANVTPA  430

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+L+K D+ + +L  LI +L  K
Sbjct  431  EVAEQLLKEDEVENSLKGLINFLYKK  456



>emb|CDP13323.1| unnamed protein product [Coffea canephora]
Length=454

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI +SYCT   F++LASNYL ++DH  + +IEE  L+ +V+VT A
Sbjct  331  ERLDPALLRPGRMDMHIHLSYCTPGGFRILASNYLGLKDHDRFSEIEE--LIAEVEVTAA  388

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            EIAEELMK+++ D  L  L+ +L
Sbjct  389  EIAEELMKSEEIDFVLAGLVAFL  411



>ref|XP_004289118.1| PREDICTED: uncharacterized protein LOC101307633 [Fragaria vesca 
subsp. vesca]
Length=514

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 5/90 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYL---RIEDHALYHKIEElllvlkvkV  378
            DRLDPALLRPGRMDMHI +SYCT  AF +LASNYL   R   H LY +IE   L+   +V
Sbjct  406  DRLDPALLRPGRMDMHINLSYCTAGAFSILASNYLGIHRSNRHRLYGEIE--GLIEGSEV  463

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQNKE  288
            TPAE+AEEL+K DDA++ L  L+  L+ K+
Sbjct  464  TPAEVAEELLKIDDAEVALEGLLSLLKRKK  493



>ref|XP_004233533.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Solanum lycopersicum]
Length=496

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI +SYCT + F++LA+NYL   +H L+ +IEE  LV    VTPA
Sbjct  370  EKLDPALLRPGRMDMHIHLSYCTPSGFRLLAANYLETREHKLFKQIEE--LVETAMVTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            ++AE+L+K D+ D++L  LI +L
Sbjct  428  QVAEQLLKEDEVDVSLDGLISFL  450



>ref|XP_006340660.1| PREDICTED: cell division cycle protein 48 homolog [Solanum tuberosum]
Length=514

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT  +FK+LA NYL + DH L+ +IE   L+  V+VTPA
Sbjct  361  EKLDPALLRPGRMDMHIHMSYCTNQSFKILAFNYLGVSDHRLFGEIE--GLIKNVEVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AEELM+++DA++ L  ++  L+ K
Sbjct  419  EVAEELMRSEDAEVVLEGVLNLLKRK  444



>emb|CDP01979.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElll-vlkvkVTP  372
            DRLDPALLR GRMDMHI MSY T   FK LA+NYL I+DH  + + EE+   +  + VTP
Sbjct  366  DRLDPALLRAGRMDMHISMSYLTAEGFKTLATNYLDIKDH--HWQFEEIGELIESMNVTP  423

Query  371  AEIAEELMKNDDADITLGNLIIYLQNK  291
            AE+AEELMK+DDAD++LG L+ +L  K
Sbjct  424  AEVAEELMKSDDADVSLGGLLNFLNVK  450



>ref|XP_008225835.1| PREDICTED: 26S protease regulatory subunit 6A-like [Prunus mume]
Length=468

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI--EDHALYHKIEElllvlkvkVT  375
             +LDPALLR GRMDMHI MSYCT+  FK+LA NYLR   + H L+ +IE   L+ K KVT
Sbjct  358  SKLDPALLRSGRMDMHIHMSYCTYEGFKILACNYLRTCEQKHPLFEEIES--LLKKTKVT  415

Query  374  PAEIAEELMKNDDADITLGNLIIYLQNKEN  285
            PA++AE+LMK+++A++ L  LI  L+ K+N
Sbjct  416  PAQVAEQLMKSEEAEVALQGLITLLKQKKN  445



>ref|XP_006343388.1| PREDICTED: probable mitochondrial chaperone BCS1-B-like [Solanum 
tuberosum]
Length=501

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI M+YCT   FK+LA+NYL I+DH L+ +IEE  L+    VTPA
Sbjct  372  EKLDPALLRPGRMDMHIHMAYCTPCGFKLLAANYLGIKDHKLFKEIEE--LIDIANVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+L+K D+ + +L  LI +L  K
Sbjct  430  EVAEQLLKEDEVENSLQGLINFLYKK  455



>ref|XP_003517208.1| PREDICTED: mitochondrial chaperone BCS1-like isoform 1 [Glycine 
max]
 gb|KHN36079.1| Putative mitochondrial chaperone BCS1-B [Glycine soja]
Length=504

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYC++  FK+LASNYL    DH L+ ++E   L+  +++TP
Sbjct  363  ERLDPALLRPGRMDMHIHMSYCSYQGFKILASNYLETPSDHPLFGEVE--GLIEDIQITP  420

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMKN+D + TL   +  L+ K+
Sbjct  421  AQVAEELMKNEDPEATLEGFVKLLKRKK  448



>ref|XP_009632017.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Nicotiana 
tomentosiformis]
Length=494

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT   F++LA+NYL  ++H L+ +IEE  L+    VTPA
Sbjct  367  EKLDPALLRPGRMDMHIHMSYCTPCGFRLLAANYLGTKEHILFKQIEE--LIETAMVTPA  424

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+L+K D+ +I+L  LI +L  K
Sbjct  425  EVAEQLLKEDEIEISLNGLINFLHVK  450



>ref|XP_009149357.1| PREDICTED: mitochondrial chaperone BCS1-like [Brassica rapa]
Length=468

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT + FK LA NYL I++H L+ KI E   +   +VTPA
Sbjct  352  DKLDPALLRPGRMDVHIHMSYCTPSTFKALAWNYLEIKEHPLFSKIVE--GIEATEVTPA  409

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+N+  D  L  L+ +L+ K+
Sbjct  410  DVAEQLMRNESVDSILEGLVEFLEAKK  436



>ref|XP_004232432.1| PREDICTED: cell division cycle protein 48 homolog [Solanum lycopersicum]
Length=514

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI MSYCT  +FK+LA NYL + DH L+ +IE   L+  V+VTPA
Sbjct  361  EKLDPALLRPGRMDMHIHMSYCTNQSFKILAFNYLGVSDHRLFGEIE--GLIKNVEVTPA  418

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AEELM+++DA++ L  ++  L+ K
Sbjct  419  EVAEELMRSEDAEVVLEGVLNLLKRK  444



>ref|XP_004308901.1| PREDICTED: mitochondrial chaperone BCS1-like [Fragaria vesca 
subsp. vesca]
Length=453

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 5/87 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED---HALYHKIEElllvlkvkV  378
            +RLDPALLRPG MD+HI +SYCT + F+VLASNYL I +   H L+ +IE   L+   +V
Sbjct  305  ERLDPALLRPGHMDLHIHLSYCTPSGFRVLASNYLGIHESSPHHLFGEIE--SLIKSTEV  362

Query  377  TPAEIAEELMKNDDADITLGNLIIYLQ  297
            TPA IAEELMKNDDAD+ L  L+ +L+
Sbjct  363  TPAAIAEELMKNDDADVVLEGLVKFLK  389



>ref|XP_006423339.1| hypothetical protein CICLE_v10028331mg [Citrus clementina]
 gb|ESR36579.1| hypothetical protein CICLE_v10028331mg [Citrus clementina]
Length=481

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MS+CT + FK+LASNYL I +H L+ +IE+  L+   KVTPA
Sbjct  369  ERLDPALLRPGRMDMHINMSHCTPSGFKMLASNYLGIAEHPLFVEIEK--LIATAKVTPA  426

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+N+  +  L  LI +L++K+
Sbjct  427  DVAEQLMRNEAPEFALSGLIEFLESKK  453



>emb|CDY57636.1| BnaAnng14800D [Brassica napus]
Length=468

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT + FK LA NYL I++H L+ KI E   +   +VTPA
Sbjct  352  DKLDPALLRPGRMDVHIHMSYCTPSTFKALAWNYLEIKEHPLFSKIVE--GIEATEVTPA  409

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+N+  D  L  L+ +L+ K+
Sbjct  410  DVAEQLMRNESVDSILEGLVEFLEAKK  436



>ref|XP_006423342.1| hypothetical protein CICLE_v10028341mg [Citrus clementina]
 gb|ESR36582.1| hypothetical protein CICLE_v10028341mg [Citrus clementina]
Length=479

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+HI MSYCT   FK+LASNYL I +H L+ +IE+  L+   K TPA
Sbjct  378  DRLDPALLRPGRMDVHIHMSYCTPCGFKMLASNYLGITEHPLFVEIEK--LIETAKATPA  435

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+L++N+  ++ L  LI +L+ K+
Sbjct  436  DVAEQLLRNEVPELALSGLIEFLETKK  462



>ref|XP_002521535.1| Mitochondrial chaperone BCS1, putative [Ricinus communis]
 gb|EEF40806.1| Mitochondrial chaperone BCS1, putative [Ricinus communis]
Length=482

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -2

Query  542  LDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPAEI  363
            LDPALLRPGRMDMHI MSYCT   F++LASNYL I+DH L+ +I+   L+   +VTPA +
Sbjct  368  LDPALLRPGRMDMHIHMSYCTPQGFRILASNYLEIKDHFLFEEID--GLIRSTEVTPASL  425

Query  362  AEELMKNDDADITLGNLIIYLQ  297
            AEEL+K+DDAD+ L  ++ +L+
Sbjct  426  AEELLKSDDADLALEEVLNFLK  447



>ref|XP_010680068.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI MSYCT   FKVLA NYL I++H L+  +E   L+ + +VTPA
Sbjct  354  DKLDPALLRPGRMDLHIHMSYCTSCGFKVLAKNYLGIQNHELFLDVES--LIEEAEVTPA  411

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+LM++DD +  L  L+ +L+ K
Sbjct  412  EVAEQLMRHDDVNYALKGLVEFLKLK  437



>ref|XP_007158594.1| hypothetical protein PHAVU_002G165700g [Phaseolus vulgaris]
 gb|ESW30588.1| hypothetical protein PHAVU_002G165700g [Phaseolus vulgaris]
Length=506

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYC++  FK+LASNYL I  +H L+ +IE   L+  +++TP
Sbjct  361  ERLDPALLRPGRMDMHIHMSYCSYQGFKLLASNYLEIPSEHPLFGEIE--GLIEDIQITP  418

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMKN+DA+ TL      L+ K+
Sbjct  419  AQVAEELMKNEDAEATLEGFAKLLKRKK  446



>ref|XP_011025866.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=501

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 71/103 (69%), Gaps = 8/103 (8%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI M +CT AAFK LAS YL I++H L+  IE+  L+    +TPA
Sbjct  370  EKLDPALLRPGRMDVHIYMGHCTPAAFKKLASTYLGIKEHVLFKCIED--LIQSKVITPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTTT*TLDMMMEQGSK  240
            E+A++LMK D+  + L +LI ++  KE T       MM+ G+K
Sbjct  428  EVAQQLMKCDNPQVALQSLIEFINQKETTE------MMDNGAK  464



>tpg|DAA58874.1| TPA: hypothetical protein ZEAMMB73_958179 [Zea mays]
Length=463

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YC   +F++LASNY  I DH  Y +IE   L+ +V VTPA
Sbjct  369  ERLDPALLRPGRMDMHIHMGYCCPESFRILASNYHSITDHDTYPEIE--ALITEVMVTPA  426

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E+AE LM+N+D D+ L  LI +L  K++
Sbjct  427  EVAEVLMRNEDTDVALEGLIQFLNGKKD  454



>ref|XP_008241721.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Prunus mume]
Length=497

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYC+ + F++LA+NYL I+DH L+ +IEE   +   KVTPA
Sbjct  370  EKLDPALLRPGRMDVHVHMSYCSPSGFRLLAANYLGIKDHLLFGEIEE--QIDTTKVTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+AE+L+K+D+  I L  LI +L+ K+
Sbjct  428  EVAEQLIKSDEPGIALQGLIEFLKVKK  454



>ref|XP_003560147.1| PREDICTED: mitochondrial chaperone BCS1-like [Brachypodium distachyon]
Length=473

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMDMH+ M YC + AFK LA NY  I+DH L+ +IEE  L+ KV+VTPA
Sbjct  380  DRLDPALLRPGRMDMHVYMGYCCWEAFKTLARNYFLIDDHLLFPEIEE--LLAKVEVTPA  437

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            E++E L++++DA + L  L+ +L  KE 
Sbjct  438  EVSEMLLRDEDAGVALHGLMEFLTEKEQ  465



>ref|XP_006487228.1| PREDICTED: probable mitochondrial chaperone bcs1-like, partial 
[Citrus sinensis]
Length=454

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI MS+CT   FK+LASNYL I +H L+ +IE+  L+   KVTPA
Sbjct  342  ERLDPALLRPGRMDMHINMSHCTPCGFKMLASNYLGITEHPLFAEIEK--LIETAKVTPA  399

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            ++AE+LM+N+  +  L  LI +L++K+
Sbjct  400  DVAEQLMRNEAPEFALSGLIEFLESKK  426



>emb|CDY38456.1| BnaA10g17020D [Brassica napus]
Length=499

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 72/109 (66%), Gaps = 6/109 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED----HALYHKIEElllvlkvk  381
            DRLDPALLRPGRMDMHI M +CTF  FK LASNYL + D    H LY +IE   L+    
Sbjct  364  DRLDPALLRPGRMDMHIYMGHCTFQGFKTLASNYLCLNDTTMPHRLYPEIER--LMEGDV  421

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQNKENTTT*TLDMMMEQGSKLK  234
            +TPA++AEELMK++DAD+ L  L+  L+        +  ++M++  +L+
Sbjct  422  ITPAQVAEELMKSEDADMALEGLVSVLEKMRFKADESSQVIMKKEGRLE  470



>gb|EMS53320.1| putative mitochondrial chaperone BCS1-B [Triticum urartu]
Length=508

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  AF++LA+NY  I+ HA Y +IE+  L+ +V VTPA
Sbjct  357  ERLDPALLRPGRMDMHIHMGYCTTEAFRILANNYHSIDYHATYPEIEK--LIEEVTVTPA  414

Query  368  EIAEELMKNDDADITLGNLI  309
            E+AE LM+NDD D+ L +L+
Sbjct  415  EVAEVLMRNDDTDVALHDLV  434



>ref|XP_004287871.1| PREDICTED: uncharacterized protein LOC101292249 [Fragaria vesca 
subsp. vesca]
Length=504

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED-HALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYCT+  F++LASNYL I++ H LY +IE   L+ + +VTP
Sbjct  364  ERLDPALLRPGRMDMHIHMSYCTYHGFQLLASNYLDIQNHHHLYDEIE--GLLKETEVTP  421

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMK+++ D+ L  L+  L+ K+
Sbjct  422  AQVAEELMKSEEVDVALEGLVKLLKRKK  449



>emb|CDP10341.1| unnamed protein product [Coffea canephora]
Length=553

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            D+LDPALLRPGRMD+HI +SYCT   FK+LASNYL I DH L+  +E+  L+   KVTPA
Sbjct  370  DKLDPALLRPGRMDVHIHLSYCTLCGFKLLASNYLGITDHPLFLVVEQ--LMKVTKVTPA  427

Query  368  EIAEELMKNDDADITLGNLIIYLQNKE  288
            E+ E+L+KN + +  L  LI +L+ K+
Sbjct  428  EVGEQLLKNGEPETALEGLIEFLEGKK  454



>ref|XP_010420505.1| PREDICTED: ATP-dependent zinc metalloprotease YME1 homolog, partial 
[Camelina sativa]
Length=490

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 6/89 (7%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED----HALYHKIEElllvlkvk  381
            DRLDPALLRPGRMDMHI M +C+F  FK LASNYL + D    H LY +IE   L+    
Sbjct  366  DRLDPALLRPGRMDMHIYMGHCSFQGFKTLASNYLGLNDATMPHRLYPEIER--LIDGEV  423

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQN  294
            +TPA++AEELMK++DAD+ L  L+  L+ 
Sbjct  424  ITPAQVAEELMKSEDADVALEGLVNVLEK  452



>gb|AGT16562.1| hypothetical protein SHCRBa_008_G08_R_120 [Saccharum hybrid cultivar 
R570]
Length=466

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            +RLDPALLRPGRMDMHI M YCT  +F++LA NY  +E+H +Y +IE+  L+ +V V+PA
Sbjct  368  ERLDPALLRPGRMDMHIHMGYCTPESFRILARNYHSVENHVMYPEIEQ--LIQEVMVSPA  425

Query  368  EIAEELMKNDDADITLGNLIIYLQNKENTT  279
            E+AE LM+ND++D+ L +L+  L+ K   +
Sbjct  426  EVAEVLMRNDNSDVVLQDLLEILKEKRKQS  455



>ref|XP_009121058.1| PREDICTED: mitochondrial chaperone BCS1-like [Brassica rapa]
Length=511

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 72/109 (66%), Gaps = 6/109 (6%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED----HALYHKIEElllvlkvk  381
            DRLDPALLRPGRMDMHI M +CTF  FK LASNYL + D    H LY +IE   L+    
Sbjct  376  DRLDPALLRPGRMDMHIYMGHCTFQGFKTLASNYLCLNDTTMPHRLYPEIER--LMEGDV  433

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQNKENTTT*TLDMMMEQGSKLK  234
            +TPA++AEELMK++DAD+ L  L+  L+        +  ++M++  +L+
Sbjct  434  ITPAQVAEELMKSEDADMALEGLVSVLEKMRFKADESSQVIMKKEGRLE  482



>gb|KDP46731.1| hypothetical protein JCGZ_06519 [Jatropha curcas]
Length=601

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DR+DPALLR GRMDMHI +SYCTF+ FK LA NYL I DH L++ IE+  L+ +V+V+PA
Sbjct  346  DRIDPALLRAGRMDMHIYLSYCTFSTFKQLAVNYLDIWDHDLFNSIEK--LIKEVQVSPA  403

Query  368  EIAEELMKNDDADITLGNLIIYLQNKEN  285
            ++A ELMKN D + +L  L+ +L++K++
Sbjct  404  DVAGELMKNKDPETSLQGLVKFLEDKKS  431



>ref|XP_004234548.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Solanum lycopersicum]
Length=490

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMDMHI M+YCT   FK+LA+NYL I+DH L+ +IEE  L+    VTPA
Sbjct  373  EKLDPALLRPGRMDMHIHMTYCTPCGFKLLANNYLGIKDHKLFKEIEE--LIDIANVTPA  430

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            E+AE+L+K D+ + +L  LI +L
Sbjct  431  EVAEQLLKEDEVENSLKGLINFL  453



>ref|XP_010936769.1| PREDICTED: mitochondrial chaperone BCS1-like [Elaeis guineensis]
Length=468

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            DRLDPALLRPGRMD+H+ M YC    F+VLASNY  + DH L+ +IE   L+ +V+VTPA
Sbjct  359  DRLDPALLRPGRMDVHVPMGYCGPTGFRVLASNYHCLGDHPLFKEIE--ALIKEVEVTPA  416

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            E+AEELMK+DDA+I L  LI+ L
Sbjct  417  EVAEELMKSDDAEIALRGLIMKL  439



>ref|XP_011025845.1| PREDICTED: probable mitochondrial chaperone BCS1-B [Populus euphratica]
Length=490

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+H+ MSYCT   FK LA+NYL I+DH L+ +IEE  L+   +VTPA
Sbjct  372  EKLDPALLRPGRMDVHVHMSYCTPCGFKFLAANYLGIKDHVLFEEIEE--LIKTAEVTPA  429

Query  368  EIAEELMKNDDADITLGNLIIYL  300
            E+AE+LM++D+ +  L  LI +L
Sbjct  430  EVAEQLMRSDELETVLKELIEFL  452



>ref|XP_010453978.1| PREDICTED: peroxisomal ATPase PEX6-like [Camelina sativa]
Length=504

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 6/89 (7%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIED----HALYHKIEElllvlkvk  381
            DRLDPALLRPGRMDMHI M +C+F  FK LASNYL + D    H LY +IE   L+    
Sbjct  368  DRLDPALLRPGRMDMHIYMGHCSFQGFKTLASNYLGLNDATMPHRLYPEIER--LIDGEV  425

Query  380  VTPAEIAEELMKNDDADITLGNLIIYLQN  294
            +TPA++AEELMK++DAD+ L  L+  L+ 
Sbjct  426  ITPAQVAEELMKSEDADVALEGLVNVLEK  454



>ref|XP_004167494.1| PREDICTED: uncharacterized protein LOC101229933 isoform 2 [Cucumis 
sativus]
Length=480

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 2/86 (2%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIEDHALYHKIEElllvlkvkVTPA  369
            ++LDPALLRPGRMD+HI MSYCT   F+VLASNYL IE+H L+ +IE   L+   KVTPA
Sbjct  371  EKLDPALLRPGRMDVHIHMSYCTPCGFRVLASNYLGIENHRLFGEIE--GLIPGAKVTPA  428

Query  368  EIAEELMKNDDADITLGNLIIYLQNK  291
            E+AE+L+K +++D +L +LI +L+ K
Sbjct  429  EVAEQLLKGEESDNSLMDLIEFLKVK  454



>gb|AES95029.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=503

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRIE-DHALYHKIEElllvlkvkVTP  372
            +RLDPALLRPGRMDMHI MSYC++  FK+LASNYL I  D+  + +IE   L+  +++TP
Sbjct  364  ERLDPALLRPGRMDMHIHMSYCSYEGFKILASNYLDISHDNPFFGEIE--GLIEDIQITP  421

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKE  288
            A++AEELMKN+DA+ TL   +  L+ K+
Sbjct  422  AQVAEELMKNEDAEATLEGFVKLLKRKK  449



>ref|XP_008346043.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Malus domestica]
Length=470

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
             +LD ALLR GRMDMHI MS+CT+  FK LA NYL+I   H LY KIE   L+ K K TP
Sbjct  362  SKLDSALLRSGRMDMHIHMSFCTYEGFKTLACNYLKICGTHPLYEKIE--TLLQKTKATP  419

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKEN  285
            A++AEELMK+++A++ L  LI +L+ K+N
Sbjct  420  AQVAEELMKSEEAEVALQGLITFLEEKKN  448



>ref|XP_008371896.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Malus domestica]
Length=470

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 3/89 (3%)
 Frame = -2

Query  548  DRLDPALLRPGRMDMHIQMSYCTFAAFKVLASNYLRI-EDHALYHKIEElllvlkvkVTP  372
             +LD ALLR GRMDMHI MS+CT+  FK LA NYL+I   H LY KIE   L+ K K TP
Sbjct  362  SKLDSALLRSGRMDMHIHMSFCTYEGFKTLACNYLKICGTHPLYEKIE--TLLQKTKATP  419

Query  371  AEIAEELMKNDDADITLGNLIIYLQNKEN  285
            A++AEELMK+++A++ L  LI +L+ K+N
Sbjct  420  AQVAEELMKSEEAEVALQGLITFLEEKKN  448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558743307496