BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21043_g2_i1 len=1809 path=[1:0-621 623:622-663 665:664-1808]

Length=1809
                                                                      Score     E

ref|XP_006347595.1|  PREDICTED: putative ribokinase-like                633   0.0      
gb|KDP39538.1|  hypothetical protein JCGZ_02558                         622   0.0      
ref|XP_011075771.1|  PREDICTED: adenosine kinase                        619   0.0      
ref|XP_002520073.1|  Ribokinase, putative                               618   0.0      Ricinus communis
ref|XP_010318288.1|  PREDICTED: adenosine kinase                        617   0.0      
emb|CAN82032.1|  hypothetical protein VITISV_012090                     612   0.0      Vitis vinifera
ref|XP_011044453.1|  PREDICTED: probable fructokinase-5                 614   0.0      
ref|XP_009768568.1|  PREDICTED: adenosine kinase-like                   615   0.0      
ref|XP_008234539.1|  PREDICTED: adenosine kinase                        615   0.0      
ref|XP_009621736.1|  PREDICTED: adenosine kinase isoform X1             614   0.0      
ref|XP_007219014.1|  hypothetical protein PRUPE_ppa004295mg             615   0.0      
ref|XP_002319785.1|  hypothetical protein POPTR_0013s07620g             612   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI26479.3|  unnamed protein product                                607   0.0      
gb|EYU44872.1|  hypothetical protein MIMGU_mgv1a005512mg                610   0.0      
ref|XP_002271653.1|  PREDICTED: adenosine kinase                        609   0.0      Vitis vinifera
ref|XP_004307845.1|  PREDICTED: uncharacterized sugar kinase slr0...    607   0.0      
ref|XP_007029674.1|  PfkB-like carbohydrate kinase family protein...    608   0.0      
ref|XP_009361139.1|  PREDICTED: adenosine kinase                        607   0.0      
ref|XP_010087455.1|  putative sugar kinase                              604   0.0      
ref|XP_009381953.1|  PREDICTED: uncharacterized protein LOC103970046    603   0.0      
gb|KDO49204.1|  hypothetical protein CISIN_1g011689mg                   602   0.0      
ref|XP_006437439.1|  hypothetical protein CICLE_v10031395mg             602   0.0      
ref|XP_006484603.1|  PREDICTED: putative ribokinase-like                600   0.0      
ref|XP_008357070.1|  PREDICTED: adenosine kinase-like                   601   0.0      
ref|XP_010063481.1|  PREDICTED: adenosine kinase                        597   0.0      
ref|XP_010273147.1|  PREDICTED: adenosine kinase-like                   589   0.0      
ref|XP_008796285.1|  PREDICTED: adenosine kinase isoform X1             590   0.0      
ref|XP_010671085.1|  PREDICTED: adenosine kinase                        589   0.0      
ref|XP_010553829.1|  PREDICTED: adenosine kinase-like                   588   0.0      
gb|KHG24465.1|  Sugar kinase                                            586   0.0      
ref|XP_006284998.1|  hypothetical protein CARUB_v10006305mg             585   0.0      
ref|XP_004148345.1|  PREDICTED: uncharacterized sugar kinase slr0...    583   0.0      
ref|XP_010240880.1|  PREDICTED: adenosine kinase-like                   583   0.0      
ref|XP_002867493.1|  pfkB-type carbohydrate kinase family protein       581   0.0      
ref|XP_008465855.1|  PREDICTED: adenosine kinase 2                      581   0.0      
ref|XP_010550983.1|  PREDICTED: uncharacterized protein LOC104821716    579   0.0      
emb|CAB38272.1|  carbohydrate kinase-like protein                       575   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438586.1|  PREDICTED: adenosine kinase-like                   577   0.0      
ref|XP_010448105.1|  PREDICTED: adenosine kinase-like                   576   0.0      
ref|NP_567780.1|  pfkB-like carbohydrate kinase family protein          576   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433342.1|  PREDICTED: adenosine kinase-like                   575   0.0      
gb|AAM66103.1|  carbohydrate kinase-like protein                        574   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413058.1|  hypothetical protein EUTSA_v10025109mg             574   0.0      
emb|CDX89233.1|  BnaA01g16600D                                          573   0.0      
ref|XP_009143609.1|  PREDICTED: uncharacterized protein LOC103867304    570   0.0      
gb|KFK29284.1|  hypothetical protein AALP_AA7G113600                    568   0.0      
emb|CDY56323.1|  BnaC07g50370D                                          565   0.0      
ref|XP_003540095.1|  PREDICTED: putative ribokinase-like                564   0.0      
gb|KHN46468.1|  Putative sugar kinase                                   563   0.0      
ref|XP_009137672.1|  PREDICTED: uncharacterized protein LOC103861704    563   0.0      
emb|CDY29847.1|  BnaA03g48680D                                          563   0.0      
emb|CDP04921.1|  unnamed protein product                                560   0.0      
ref|XP_010919935.1|  PREDICTED: adenosine kinase                        562   0.0      
ref|XP_006662622.1|  PREDICTED: adenosine kinase-like                   560   0.0      
ref|XP_003537819.1|  PREDICTED: putative ribokinase-like                556   0.0      
gb|KHN39864.1|  Putative sugar kinase                                   555   0.0      
ref|XP_007131505.1|  hypothetical protein PHAVU_011G018700g             554   0.0      
ref|XP_004983571.1|  PREDICTED: adenosine kinase 2-like                 553   0.0      
ref|XP_004505583.1|  PREDICTED: uncharacterized sugar kinase slr0...    552   0.0      
ref|XP_003607450.1|  Carbohydrate kinase-like protein                   552   0.0      
ref|NP_001065468.1|  Os10g0573000                                       550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467453.1|  hypothetical protein SORBIDRAFT_01g028370          547   0.0      Sorghum bicolor [broomcorn]
ref|NP_001141360.1|  uncharacterized protein LOC100273451               536   0.0      Zea mays [maize]
ref|XP_006837407.1|  hypothetical protein AMTR_s00111p00144320          530   0.0      
ref|XP_007029675.1|  Ribokinase, putative isoform 2                     530   0.0      
ref|XP_003574373.1|  PREDICTED: adenosine kinase                        532   0.0      
ref|XP_003607451.1|  Carbohydrate kinase-like protein                   526   3e-180   
dbj|BAJ86279.1|  predicted protein                                      520   1e-177   
dbj|BAJ95584.1|  predicted protein                                      518   2e-175   
gb|EMT09267.1|  hypothetical protein F775_18306                         514   4e-172   
gb|EPS67248.1|  hypothetical protein M569_07525                         499   4e-170   
gb|ADE76449.1|  unknown                                                 488   1e-163   
ref|XP_001777742.1|  predicted protein                                  464   2e-155   
gb|AFK48701.1|  unknown                                                 461   2e-155   
ref|XP_001764515.1|  predicted protein                                  458   1e-151   
ref|XP_001764628.1|  predicted protein                                  440   4e-146   
ref|XP_002975657.1|  hypothetical protein SELMODRAFT_174960             439   7e-146   
ref|XP_002978840.1|  hypothetical protein SELMODRAFT_109255             437   4e-145   
emb|CDY19050.1|  BnaC01g20180D                                          426   4e-129   
ref|XP_009621737.1|  PREDICTED: uncharacterized protein LOC104113...    382   4e-124   
gb|KDO49205.1|  hypothetical protein CISIN_1g011689mg                   374   8e-121   
ref|XP_008796286.1|  PREDICTED: uncharacterized protein LOC103711...    353   8e-113   
gb|ABG66284.1|  carbohydrate kinase, putative, expressed                335   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005846464.1|  hypothetical protein CHLNCDRAFT_16922              273   1e-81    
gb|KDO49206.1|  hypothetical protein CISIN_1g011689mg                   261   1e-78    
ref|XP_005646173.1|  Ribokinase-like protein                            255   1e-75    
ref|XP_004173245.1|  PREDICTED: uncharacterized protein LOC101230396    252   4e-75    
gb|EAY79604.1|  hypothetical protein OsI_34744                          246   4e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_009768566.1|  PREDICTED: adenosine kinase-like                   229   6e-68    
ref|XP_002946747.1|  hypothetical protein VOLCADRAFT_103178             223   1e-61    
ref|WP_020770930.1|  carbohydrate kinase, PfkB family                   217   3e-61    
ref|WP_008590648.1|  ribokinase                                         214   8e-60    
ref|WP_017719427.1|  ribokinase                                         214   1e-59    
ref|XP_001691836.1|  PfkB-type carbohydrate kinase                      212   5e-59    Chlamydomonas reinhardtii
ref|WP_037220024.1|  ribokinase                                         211   5e-59    
ref|WP_010411497.1|  ribokinase                                         209   3e-58    
ref|WP_016549272.1|  carbohydrate kinase, PfkB family                   209   6e-58    
ref|WP_004500259.1|  MULTISPECIES: carbohydrate kinase, PfkB family     208   1e-57    
gb|AFW87768.1|  hypothetical protein ZEAMMB73_369666                    202   2e-57    
ref|WP_002628400.1|  carbohydrate kinase, PfkB family                   207   2e-57    
ref|WP_004503959.1|  carbohydrate kinase, PfkB family                   206   3e-57    
ref|WP_015179322.1|  Adenosine kinase                                   207   3e-57    
ref|WP_000683570.1|  ribokinase                                         206   5e-57    
ref|WP_020774432.1|  carbohydrate kinase, PfkB family                   206   6e-57    
ref|WP_004495408.1|  ribokinase                                         205   1e-56    
ref|WP_002751661.1|  carbohydrate kinase, PfkB family                   205   1e-56    
ref|WP_004504818.1|  carbohydrate kinase, PfkB family                   205   1e-56    
ref|WP_002764112.1|  carbohydrate kinase, PfkB family                   205   1e-56    
ref|WP_003000981.1|  carbohydrate kinase, PfkB family                   204   2e-56    
ref|WP_010578622.1|  ribokinase                                         204   2e-56    
ref|WP_010570354.1|  ribokinase                                         204   2e-56    
ref|WP_008396489.1|  MULTISPECIES: carbohydrate kinase, PfkB family     204   2e-56    
ref|WP_016753536.1|  ribokinase                                         204   2e-56    
ref|WP_004753706.1|  ribokinase                                         204   3e-56    
ref|WP_000683571.1|  ribokinase                                         204   3e-56    
ref|WP_000683574.1|  ribokinase                                         204   3e-56    
ref|WP_002725176.1|  MULTISPECIES: ribokinase                           204   3e-56    
ref|WP_004778749.1|  carbohydrate kinase, PfkB family                   204   4e-56    
ref|WP_015118416.1|  sugar kinase                                       204   4e-56    
ref|WP_002745525.1|  carbohydrate kinase, PfkB family                   204   4e-56    
ref|WP_004457203.1|  carbohydrate kinase, PfkB family                   203   4e-56    
ref|WP_000683572.1|  ribokinase                                         203   5e-56    
ref|WP_004767076.1|  carbohydrate kinase, PfkB family                   203   5e-56    
ref|WP_004452232.1|  carbohydrate kinase, PfkB family                   203   5e-56    
ref|WP_000683575.1|  ribokinase                                         203   6e-56    
ref|WP_004450102.1|  carbohydrate kinase, PfkB family                   203   6e-56    
ref|WP_004438610.1|  carbohydrate kinase, PfkB family                   203   6e-56    
ref|WP_016544786.1|  carbohydrate kinase, PfkB family                   203   6e-56    
gb|KFM23276.1|  putative sugar kinase                                   205   7e-56    
ref|WP_017850955.1|  ribokinase                                         203   7e-56    
ref|WP_002152849.1|  carbohydrate kinase, PfkB family                   202   9e-56    
ref|WP_020766792.1|  MULTISPECIES: carbohydrate kinase, PfkB family     202   1e-55    
ref|WP_004445863.1|  carbohydrate kinase, PfkB family                   202   1e-55    
ref|WP_020762479.1|  carbohydrate kinase, PfkB family                   202   1e-55    
ref|WP_004474738.1|  carbohydrate kinase, PfkB family                   202   2e-55    
ref|WP_010575277.1|  ribokinase                                         202   2e-55    
ref|WP_004782893.1|  carbohydrate kinase, PfkB family                   202   2e-55    
ref|WP_004466088.1|  ribokinase                                         202   2e-55    
ref|WP_007353415.1|  MULTISPECIES: ribokinase                           202   2e-55    
ref|WP_004428525.1|  carbohydrate kinase, PfkB family                   202   2e-55    
ref|WP_004470257.1|  carbohydrate kinase, PfkB family                   202   2e-55    
ref|WP_006635787.1|  ribokinase                                         201   3e-55    
ref|WP_004491703.1|  carbohydrate kinase, PfkB family                   201   3e-55    
ref|WP_004479070.1|  carbohydrate kinase, PfkB family                   201   3e-55    
ref|WP_004422117.1|  carbohydrate kinase, PfkB family                   201   3e-55    
ref|WP_002177371.1|  MULTISPECIES: carbohydrate kinase, PfkB family     201   4e-55    
ref|WP_004462069.1|  ribokinase                                         201   4e-55    
ref|WP_004489649.1|  carbohydrate kinase, PfkB family                   201   4e-55    
ref|WP_002646856.1|  adenosine kinase                                   199   2e-54    
ref|WP_015677599.1|  carbohydrate kinase, PfkB family                   199   2e-54    
ref|WP_002971867.1|  carbohydrate kinase, PfkB family                   198   5e-54    
ref|WP_000683573.1|  ribokinase                                         196   6e-54    
ref|WP_023065161.1|  pfkB carbohydrate kinase family protein            197   2e-53    
ref|WP_008190583.1|  ribokinase                                         196   2e-53    
ref|WP_013631072.1|  adenosine kinase                                   195   6e-53    
ref|WP_012387526.1|  ribokinase                                         195   9e-53    
ref|WP_012476126.1|  ribokinase                                         194   1e-52    
ref|WP_009783090.1|  ribokinase                                         194   1e-52    
ref|WP_013108841.1|  adenosine kinase                                   194   1e-52    
ref|XP_006347648.1|  PREDICTED: uncharacterized protein LOC102579206    190   2e-52    
ref|WP_006622099.1|  ribokinase                                         191   2e-51    
ref|WP_006618006.1|  ribokinase                                         191   3e-51    
gb|AID56158.1|  fructokinase                                            190   5e-51    
ref|WP_027249848.1|  ribokinase                                         190   6e-51    
ref|WP_008051861.1|  ribokinase                                         189   7e-51    
ref|WP_035982988.1|  ribokinase                                         189   7e-51    
ref|WP_002771420.1|  ribokinase                                         189   9e-51    
gb|AFW87769.1|  hypothetical protein ZEAMMB73_779135                    182   1e-50    
ref|WP_006668650.1|  ribokinase                                         189   1e-50    
ref|WP_010587274.1|  adenosine kinase                                   188   1e-50    
gb|KEI67830.1|  PfkB                                                    189   1e-50    
ref|WP_026795087.1|  MULTISPECIES: ribokinase                           188   2e-50    
ref|WP_026788306.1|  ribokinase                                         187   5e-50    
ref|WP_026796818.1|  ribokinase                                         186   8e-50    
ref|WP_015682315.1|  carbohydrate kinase, PfkB family                   186   1e-49    
ref|WP_002990587.1|  carbohydrate kinase, PfkB family                   186   1e-49    
ref|WP_011612741.1|  ribokinase                                         186   2e-49    
ref|WP_018282632.1|  hypothetical protein                               182   4e-48    
ref|WP_038247299.1|  adenosine kinase                                   180   2e-47    
ref|WP_004787611.1|  ribokinase                                         179   2e-47    
ref|WP_013300155.1|  PfkB family protein carbohydrate kinase            179   2e-47    
ref|WP_007325340.1|  adenosine kinase                                   179   5e-47    
ref|WP_007339822.1|  ribokinase-like domain-containing protein          179   6e-47    
ref|WP_008886664.1|  adenosine kinase                                   179   7e-47    
ref|WP_011123698.1|  adenosine kinase                                   179   8e-47    
ref|WP_008655254.1|  ribokinase-like domain-containing protein          178   1e-46    
ref|WP_025973199.1|  carbohydrate kinase                                177   2e-46    
ref|WP_025894155.1|  MULTISPECIES: carbohydrate kinase                  176   4e-46    
ref|WP_025924266.1|  carbohydrate kinase                                176   6e-46    
ref|WP_013950141.1|  MULTISPECIES: carbohydrate kinase                  176   6e-46    
ref|WP_025929230.1|  carbohydrate kinase                                174   2e-45    
ref|WP_025971846.1|  carbohydrate kinase                                174   2e-45    
ref|WP_007796080.1|  adenosine kinase                                   174   4e-45    
ref|WP_015599643.1|  carbohydrate kinase                                173   5e-45    
ref|WP_008702140.1|  ribokinase-like domain-containing protein          173   7e-45    
ref|WP_034279184.1|  sugar kinase                                       172   8e-45    
ref|WP_005637436.1|  carbohydrate kinase                                172   1e-44    
ref|WP_013217240.1|  carbohydrate kinase                                171   2e-44    
ref|WP_012007329.1|  carbohydrate kinase                                171   2e-44    
ref|WP_008154315.1|  carbohydrate kinase                                171   3e-44    
ref|WP_022322601.1|  kinase PfkB family                                 171   3e-44    
ref|WP_025942218.1|  carbohydrate kinase                                171   3e-44    
ref|WP_000641867.1|  ribokinase                                         169   3e-44    
ref|WP_011818014.1|  carbohydrate kinase                                171   4e-44    
ref|WP_025926146.1|  carbohydrate kinase                                171   4e-44    
ref|WP_008152707.1|  MULTISPECIES: carbohydrate kinase                  170   4e-44    
ref|WP_018049324.1|  hypothetical protein                               171   5e-44    
ref|WP_032524689.1|  carbohydrate kinase                                171   5e-44    
ref|WP_025957138.1|  MULTISPECIES: carbohydrate kinase                  170   5e-44    
ref|WP_025952498.1|  carbohydrate kinase                                170   5e-44    
ref|WP_025970652.1|  carbohydrate kinase                                170   6e-44    
ref|WP_025964660.1|  carbohydrate kinase                                170   6e-44    
ref|WP_025955345.1|  carbohydrate kinase                                170   6e-44    
ref|WP_025887753.1|  carbohydrate kinase                                170   6e-44    
ref|WP_025941427.1|  carbohydrate kinase                                170   7e-44    
ref|WP_034727758.1|  sugar kinase                                       170   7e-44    
ref|WP_025913503.1|  carbohydrate kinase                                170   8e-44    
ref|WP_025890512.1|  MULTISPECIES: carbohydrate kinase                  170   8e-44    
ref|WP_009850740.1|  adenosine kinase                                   169   9e-44    
ref|WP_005647033.1|  carbohydrate kinase                                169   9e-44    
gb|EQC49348.1|  carbohydrate kinase, PfkB family                        171   9e-44    
ref|WP_025964125.1|  carbohydrate kinase                                169   1e-43    
ref|WP_032514878.1|  carbohydrate kinase                                169   1e-43    
ref|WP_025939793.1|  carbohydrate kinase                                169   1e-43    
ref|WP_018293509.1|  adenosine kinase                                   169   1e-43    
ref|WP_032519413.1|  carbohydrate kinase                                169   1e-43    
ref|WP_036510529.1|  carbohydrate kinase                                169   2e-43    
ref|WP_019307461.1|  hypothetical protein                               169   2e-43    
ref|WP_002805982.1|  carbohydrate kinase                                169   2e-43    
ref|WP_013738664.1|  carbohydrate kinase                                169   2e-43    
ref|WP_026873337.1|  carbohydrate kinase                                169   2e-43    
ref|WP_025956537.1|  carbohydrate kinase                                169   2e-43    
ref|WP_035380620.1|  carbohydrate kinase                                169   2e-43    
ref|WP_025944513.1|  carbohydrate kinase                                169   2e-43    
ref|WP_025980884.1|  carbohydrate kinase                                168   2e-43    
ref|WP_026398234.1|  carbohydrate kinase                                168   3e-43    
ref|WP_011819885.1|  carbohydrate kinase                                168   3e-43    
ref|WP_014019423.1|  sugar kinase                                       168   4e-43    
gb|KGB22584.1|  Fructokinase                                            169   4e-43    
ref|WP_025953545.1|  carbohydrate kinase                                168   4e-43    
ref|WP_025963603.1|  carbohydrate kinase                                168   4e-43    
ref|WP_020890709.1|  Ribokinase                                         167   4e-43    
ref|WP_025954006.1|  MULTISPECIES: carbohydrate kinase                  167   5e-43    
ref|WP_025931522.1|  MULTISPECIES: carbohydrate kinase                  167   7e-43    
ref|WP_011132140.1|  carbohydrate kinase                                167   7e-43    
ref|WP_018308277.1|  carbohydrate kinase                                167   8e-43    
ref|WP_009505872.1|  adenosine kinase                                   167   8e-43    
ref|WP_032517792.1|  carbohydrate kinase                                167   8e-43    
ref|WP_006557422.1|  carbohydrate kinase                                167   9e-43    
ref|WP_017952531.1|  hypothetical protein                               167   9e-43    
ref|WP_032522492.1|  carbohydrate kinase                                167   9e-43    
ref|WP_029734807.1|  sugar kinase                                       167   9e-43    
ref|WP_011862525.1|  carbohydrate kinase                                166   1e-42    
ref|WP_025945762.1|  MULTISPECIES: carbohydrate kinase                  166   2e-42    
ref|WP_020056014.1|  hypothetical protein                               166   2e-42    
ref|WP_009095693.1|  ribokinase-like domain-containing protein          166   2e-42    
ref|WP_019474055.1|  hypothetical protein                               165   3e-42    
ref|WP_032523445.1|  carbohydrate kinase                                166   3e-42    
ref|WP_022005973.1|  sugar kinase                                       165   3e-42    
ref|WP_039707187.1|  hypothetical protein                               165   3e-42    
ref|WP_022187329.1|  sugar kinase                                       165   3e-42    
ref|WP_022727958.1|  carbohydrate kinase                                165   4e-42    
ref|WP_006956885.1|  sugar kinase                                       165   4e-42    
dbj|GAK52860.1|  sugar kinase                                           165   4e-42    
emb|CEG60805.1|  putative enzyme                                        165   5e-42    
ref|WP_020402737.1|  hypothetical protein                               164   6e-42    
ref|WP_012567920.1|  carbohydrate kinase                                164   6e-42    
ref|WP_039746978.1|  sugar kinase                                       164   7e-42    
ref|WP_025914324.1|  carbohydrate kinase                                164   7e-42    
ref|WP_021130758.1|  sugar kinase                                       164   8e-42    
ref|WP_011376065.1|  carbohydrate kinase                                164   9e-42    
ref|WP_032526806.1|  carbohydrate kinase                                164   1e-41    
ref|WP_035828889.1|  carbohydrate kinase                                164   1e-41    
ref|WP_026986864.1|  carbohydrate kinase                                163   1e-41    
ref|WP_034425228.1|  hypothetical protein                               163   1e-41    
ref|WP_008684256.1|  ribokinase-like domain-containing protein          163   1e-41    
ref|WP_015440672.1|  putative carbohydrate kinase                       163   1e-41    
ref|WP_022079027.1|  sugar kinase                                       163   2e-41    
ref|WP_032513921.1|  carbohydrate kinase                                163   2e-41    
ref|WP_036897499.1|  carbohydrate kinase                                163   2e-41    
emb|CBL88133.1|  carbohydrate kinase family protein, PfkB               163   2e-41    
ref|WP_011823302.1|  carbohydrate kinase                                162   3e-41    
emb|CAM77264.1|  Sugar kinases, ribokinase family                       162   3e-41    
gb|AIQ94573.1|  Fructokinase                                            162   3e-41    
ref|WP_024081348.1|  putative Adenosine kinase                          162   4e-41    
ref|WP_014625876.1|  carbohydrate kinase                                162   4e-41    
ref|WP_012039759.1|  MULTISPECIES: carbohydrate kinase                  162   4e-41    
ref|WP_013640494.1|  carbohydrate kinase                                162   5e-41    
ref|WP_011387910.1|  carbohydrate kinase                                164   5e-41    
ref|WP_028821104.1|  hypothetical protein                               161   6e-41    
ref|WP_010130728.1|  sugar kinase                                       161   6e-41    
ref|WP_018471872.1|  sugar kinase                                       162   6e-41    
gb|EKE15565.1|  hypothetical protein ACD_11C00134G0003                  168   7e-41    
ref|WP_011294470.1|  carbohydrate kinase                                161   7e-41    
ref|WP_011386533.1|  carbohydrate kinase                                161   7e-41    
ref|WP_003629784.1|  carbohydrate kinase                                161   7e-41    
ref|WP_020040551.1|  adenosine kinase                                   161   9e-41    
ref|WP_006104256.1|  sugar kinase                                       161   9e-41    
ref|WP_002050662.1|  MULTISPECIES: carbohydrate kinase, PfkB family     161   9e-41    
ref|WP_012800886.1|  sugar kinase                                       161   1e-40    
ref|WP_038344389.1|  sugar kinase                                       161   1e-40    
ref|WP_015145523.1|  sugar kinase                                       160   1e-40    
ref|WP_034773506.1|  sugar kinase                                       161   1e-40    
ref|WP_020085879.1|  hypothetical protein                               160   1e-40    
ref|WP_009582092.1|  Ribokinase                                         160   1e-40    
ref|WP_019087800.1|  carbohydrate kinase                                160   1e-40    
ref|WP_006116707.1|  carbohydrate kinase                                160   1e-40    
ref|WP_019475991.1|  hypothetical protein                               160   1e-40    
ref|WP_011935297.1|  carbohydrate kinase                                160   1e-40    
ref|WP_036906914.1|  carbohydrate kinase                                160   1e-40    
ref|WP_007424584.1|  carbohydrate kinase                                160   2e-40    
ref|WP_009540461.1|  Fructokinase                                       160   2e-40    
ref|WP_004449185.1|  carbohydrate kinase                                160   2e-40    
ref|WP_036917040.1|  MULTISPECIES: carbohydrate kinase                  160   3e-40    
ref|WP_010468309.1|  sugar kinase                                       160   3e-40    
ref|WP_029455810.1|  adenosine kinase                                   159   3e-40    
ref|WP_019478431.1|  hypothetical protein                               159   5e-40    
dbj|BAQ15766.1|  fructokinase                                           159   5e-40    
ref|WP_010307344.1|  carbohydrate kinase                                159   5e-40    
ref|WP_017398333.1|  sugar kinase                                       159   5e-40    
ref|WP_010544384.1|  carbohydrate kinase                                159   6e-40    
ref|WP_008561943.1|  adenosine kinase                                   159   6e-40    
ref|WP_034845783.1|  carbohydrate kinase                                159   6e-40    
ref|WP_034731463.1|  sugar kinase                                       159   6e-40    
ref|WP_020053925.1|  hypothetical protein                               159   6e-40    
ref|WP_006507412.1|  sugar kinase, ribokinase                           159   7e-40    
ref|WP_009343636.1|  sugar kinase                                       160   7e-40    
ref|WP_006530272.1|  sugar kinase, ribokinase                           158   7e-40    
ref|WP_020614536.1|  carbohydrate kinase                                158   7e-40    
ref|WP_039702167.1|  carbohydrate kinase                                158   8e-40    
ref|WP_020468184.1|  hypothetical protein                               158   8e-40    
ref|WP_004708489.1|  MULTISPECIES: sugar kinase                         158   8e-40    
gb|ETW13410.1|  PfkB protein                                            158   9e-40    
ref|WP_019458768.1|  sugar kinase                                       158   9e-40    
ref|WP_032011552.1|  sugar kinase                                       158   9e-40    
ref|WP_025587663.1|  MULTISPECIES: carbohydrate kinase                  158   1e-39    
ref|WP_013505715.1|  sugar kinase                                       158   1e-39    
gb|KHN67273.1|  sugar kinase                                            158   1e-39    
ref|WP_022575629.1|  sugar kinase                                       158   1e-39    
ref|WP_004701296.1|  hypothetical protein                               158   1e-39    
dbj|GAK60336.1|  sugar kinase                                           157   1e-39    
ref|WP_026626684.1|  sugar kinase                                       157   1e-39    
ref|WP_039249840.1|  sugar kinase                                       157   2e-39    
ref|WP_028577565.1|  sugar kinase                                       157   2e-39    
ref|WP_011631108.1|  carbohydrate kinase                                157   2e-39    
ref|WP_026951763.1|  sugar kinase                                       157   2e-39    
ref|WP_015107753.1|  sugar kinase                                       157   2e-39    
gb|KHF77981.1|  Ribokinase                                              157   2e-39    
ref|WP_014500968.1|  carbohydrate kinase                                157   2e-39    
ref|WP_036901193.1|  carbohydrate kinase                                157   2e-39    
ref|WP_019902539.1|  hypothetical protein                               157   2e-39    
ref|WP_007101913.1|  carbohydrate kinase                                157   3e-39    
ref|WP_026009356.1|  carbohydrate kinase                                157   3e-39    
ref|WP_009829618.1|  adenosine kinase                                   157   3e-39    
ref|WP_023460082.1|  hypothetical protein                               157   3e-39    
ref|WP_033846540.1|  sugar kinase                                       157   3e-39    
ref|WP_036487992.1|  sugar kinase                                       156   3e-39    
ref|WP_005160027.1|  hypothetical protein                               157   3e-39    
ref|WP_008618442.1|  sugar kinase                                       157   3e-39    
ref|WP_031982726.1|  sugar kinase                                       157   3e-39    
ref|WP_002728929.1|  carbohydrate kinase                                157   3e-39    
ref|WP_007230969.1|  sugar kinase                                       156   4e-39    
ref|WP_005294558.1|  hypothetical protein                               156   4e-39    
ref|WP_018997349.1|  carbohydrate kinase                                156   4e-39    
ref|WP_009025371.1|  sugar kinase                                       156   4e-39    
ref|WP_016137931.1|  hypothetical protein                               156   5e-39    
ref|WP_009809967.1|  adenosine kinase                                   156   5e-39    
ref|WP_018700064.1|  hypothetical protein                               156   5e-39    
ref|WP_005011165.1|  Predicted ribokinase family sugar kinase           156   5e-39    
ref|WP_011241619.1|  carbohydrate kinase                                156   6e-39    
ref|WP_038132565.1|  adenosine kinase                                   155   6e-39    
ref|WP_020021935.1|  hypothetical protein                               155   6e-39    
ref|WP_014849125.1|  carbohydrate kinase                                156   6e-39    
gb|KFL92360.1|  Fructokinase                                            156   6e-39    
dbj|BAP17017.1|  carbohydrate kinase PfkB family                        155   6e-39    
gb|KDE21374.1|  carbohydrate kinase                                     155   6e-39    
ref|WP_005257837.1|  hypothetical protein                               156   6e-39    
ref|WP_000246661.1|  sugar kinase                                       155   6e-39    
ref|WP_023593577.1|  sugar kinase, ribokinase                           155   7e-39    
ref|WP_023785856.1|  carbohydrate kinase                                155   8e-39    
ref|WP_011932531.1|  carbohydrate kinase                                155   8e-39    
ref|WP_031551244.1|  hypothetical protein                               155   8e-39    
ref|WP_035599360.1|  carbohydrate kinase                                155   9e-39    
ref|WP_009392642.1|  carbohydrate kinase, PfkB family                   155   1e-38    
ref|WP_018624550.1|  sugar kinase                                       155   1e-38    
ref|WP_005230734.1|  hypothetical protein                               155   1e-38    
ref|WP_008203517.1|  adenosine kinase                                   155   1e-38    
ref|WP_020044599.1|  hypothetical protein                               155   1e-38    
ref|WP_034170349.1|  sugar kinase                                       155   1e-38    
ref|WP_029963227.1|  hypothetical protein                               155   1e-38    
ref|WP_008554457.1|  adenosine kinase                                   155   1e-38    
ref|WP_013046471.1|  carbohydrate kinase                                154   1e-38    
ref|WP_006043589.1|  carbohydrate kinase                                155   1e-38    
ref|WP_016163844.1|  hypothetical protein                               155   2e-38    
ref|WP_008943130.1|  carbohydrate kinase                                154   2e-38    
ref|WP_004806757.1|  hypothetical protein                               155   2e-38    
ref|WP_039247614.1|  sugar kinase                                       154   2e-38    
ref|WP_023172039.1|  PfkB domain protein                                154   2e-38    
ref|WP_031999824.1|  sugar kinase                                       154   2e-38    
ref|WP_032060389.1|  sugar kinase                                       154   2e-38    
ref|WP_034340726.1|  carbohydrate kinase                                154   2e-38    
ref|WP_016140781.1|  hypothetical protein                               154   2e-38    
ref|WP_022955548.1|  sugar kinase                                       154   2e-38    
ref|WP_018081377.1|  carbohydrate kinase                                154   2e-38    
ref|WP_038080098.1|  adenosine kinase                                   154   2e-38    
ref|WP_025965428.1|  carbohydrate kinase                                153   2e-38    
ref|WP_017400362.1|  sugar kinase                                       154   2e-38    
gb|EUK17689.1|  sugar kinase                                            154   2e-38    
ref|WP_022609083.1|  sugar kinase, ribokinase family                    154   2e-38    
ref|WP_024436615.1|  sugar kinase                                       154   2e-38    
ref|WP_007655051.1|  carbohydrate kinase                                154   2e-38    
ref|WP_020056917.1|  carbohydrate kinase                                154   2e-38    
ref|WP_026861523.1|  sugar kinase                                       154   2e-38    
ref|WP_008201809.1|  sugar kinase                                       154   2e-38    
ref|WP_015467073.1|  Fructokinase                                       155   2e-38    
ref|WP_031948523.1|  sugar kinase                                       154   2e-38    
ref|WP_004905004.1|  hypothetical protein                               154   2e-38    
ref|WP_037260068.1|  adenosine kinase                                   154   2e-38    
ref|WP_008853012.1|  carbohydrate kinase                                154   2e-38    
ref|WP_020398735.1|  hypothetical protein                               154   3e-38    
ref|WP_010801930.1|  MULTISPECIES: hypothetical protein                 154   3e-38    
ref|WP_024284848.1|  sugar kinase                                       154   3e-38    
ref|WP_005068997.1|  MULTISPECIES: hypothetical protein                 154   3e-38    
ref|WP_004158454.1|  sugar kinase                                       154   3e-38    
ref|WP_000246668.1|  sugar kinase                                       154   3e-38    
ref|WP_005216412.1|  hypothetical protein                               154   3e-38    
ref|WP_036921751.1|  carbohydrate kinase                                154   3e-38    
ref|WP_035489992.1|  sugar kinase                                       154   3e-38    
gb|EKE11075.1|  hypothetical protein ACD_15C00140G0003                  159   3e-38    
ref|WP_005212608.1|  hypothetical protein                               154   3e-38    
ref|WP_004662303.1|  hypothetical protein                               154   3e-38    
ref|WP_002784584.1|  putative enzyme                                    154   3e-38    
ref|WP_021511201.1|  sugar kinase                                       154   3e-38    
ref|WP_026945253.1|  sugar kinase                                       154   3e-38    
ref|WP_032003785.1|  sugar kinase                                       154   3e-38    
ref|WP_004772427.1|  hypothetical protein                               154   3e-38    
ref|WP_002741448.1|  pfkB carbohydrate kinase family protein            154   3e-38    
ref|WP_004812757.1|  hypothetical protein                               154   3e-38    
ref|WP_039718344.1|  carbohydrate kinase                                154   4e-38    
ref|WP_005040087.1|  hypothetical protein                               154   4e-38    
ref|WP_002790005.1|  sugar kinase                                       154   4e-38    
ref|WP_004752254.1|  hypothetical protein                               154   4e-38    
ref|WP_037524421.1|  carbohydrate kinase                                153   4e-38    
ref|WP_012817608.1|  carbohydrate kinase                                154   4e-38    
ref|WP_016255671.1|  Ribokinase                                         153   4e-38    
ref|WP_012160737.1|  sugar kinase                                       154   4e-38    
ref|WP_004791963.1|  hypothetical protein                               153   4e-38    
ref|WP_013256808.1|  carbohydrate kinase                                153   4e-38    
ref|WP_007303753.1|  sugar kinase                                       153   4e-38    
ref|WP_011140793.1|  sugar kinase                                       153   4e-38    
ref|WP_002761882.1|  sugar kinase                                       153   4e-38    
ref|WP_035807113.1|  sugar kinase                                       153   4e-38    
ref|WP_009802426.1|  carbohydrate kinase                                153   4e-38    
ref|WP_004677301.1|  hypothetical protein                               153   5e-38    
ref|WP_019646758.1|  hypothetical protein                               153   5e-38    
gb|EON75110.1|  Ribokinase                                              153   5e-38    
ref|WP_000207185.1|  sugar kinase                                       153   5e-38    
ref|WP_013068195.1|  adenosine kinase                                   153   5e-38    
ref|WP_012594433.1|  sugar kinase                                       153   6e-38    
ref|WP_019475524.1|  hypothetical protein                               153   6e-38    
ref|WP_032029459.1|  sugar kinase                                       153   6e-38    
ref|WP_028729750.1|  carbohydrate kinase                                153   6e-38    
ref|WP_019085932.1|  carbohydrate kinase                                153   6e-38    
ref|WP_002796843.1|  sugar kinase                                       153   6e-38    
ref|WP_023912892.1|  adenosine kinase                                   153   6e-38    
ref|WP_008623478.1|  Ribokinase                                         153   6e-38    
ref|WP_000214227.1|  sugar kinase                                       153   6e-38    
ref|WP_005275160.1|  hypothetical protein                               153   7e-38    
ref|WP_016516185.1|  5-dehydro-2-deoxygluconokinase                     153   7e-38    
ref|WP_028099597.1|  carbohydrate kinase                                153   7e-38    
gb|ABO12349.2|  putative sugar kinase protein                           153   7e-38    
ref|WP_005286128.1|  hypothetical protein                               153   7e-38    
ref|WP_005188144.1|  hypothetical protein                               153   7e-38    
ref|WP_023919835.1|  adenosine kinase                                   152   7e-38    
ref|WP_015201746.1|  PfkB domain-containing protein                     152   7e-38    
ref|WP_004643063.1|  hypothetical protein                               153   7e-38    
ref|WP_008275458.1|  sugar kinase                                       152   7e-38    
gb|AHJ62168.1|  Fructokinase                                            153   7e-38    
ref|WP_002059046.1|  carbohydrate kinase, PfkB family                   153   7e-38    
ref|WP_000246666.1|  sugar kinase                                       153   7e-38    
ref|WP_008494082.1|  carbohydrate kinase                                152   7e-38    
ref|WP_008101143.1|  sugar kinase                                       152   7e-38    
gb|KHQ53475.1|  Kinase, pfkB family protein                             152   7e-38    
gb|EAY79613.1|  hypothetical protein OsI_34754                          148   7e-38    
ref|WP_002055409.1|  carbohydrate kinase, PfkB family                   153   7e-38    
ref|WP_032873212.1|  sugar kinase                                       153   8e-38    
ref|WP_039047353.1|  sugar kinase                                       153   8e-38    
ref|WP_013197642.1|  sugar kinase                                       152   8e-38    
ref|WP_017388242.1|  sugar kinase                                       152   8e-38    
ref|WP_022720484.1|  carbohydrate kinase                                152   8e-38    
ref|WP_025466301.1|  sugar kinase                                       152   8e-38    
ref|WP_014102341.1|  carbohydrate kinase                                153   8e-38    
ref|WP_000246663.1|  sugar kinase                                       152   8e-38    
ref|WP_000246660.1|  MULTISPECIES: sugar kinase                         152   8e-38    
ref|WP_008202922.1|  sugar kinase                                       152   8e-38    
ref|WP_021891702.1|  putative uncharacterized protein                   153   8e-38    
ref|WP_017733801.1|  hypothetical protein                               152   8e-38    
ref|WP_038543646.1|  carbohydrate kinase                                152   9e-38    
ref|WP_023453214.1|  carbohydrate kinase                                152   9e-38    
ref|WP_029077148.1|  carbohydrate kinase                                152   9e-38    



>ref|XP_006347595.1| PREDICTED: putative ribokinase-like [Solanum tuberosum]
Length=495

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/372 (82%), Positives = 336/372 (90%), Gaps = 0/372 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             +EED     S L  RWDVLGLGQAMVDFSGMVD++FLE+LGLEKGTRKVVNHEERGK+L 
Sbjct  124   DEEDVGYSNSDLPQRWDVLGLGQAMVDFSGMVDNEFLERLGLEKGTRKVVNHEERGKVLS  183

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             AMDGCSYKAAAGGSLSNSLVALARLGGQ I GPAL++A+AGS+GSDPLG FYRSKLRRAN
Sbjct  184   AMDGCSYKAAAGGSLSNSLVALARLGGQSIAGPALNVALAGSIGSDPLGGFYRSKLRRAN  243

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             VNFLSAPVKDGTTGTVIVLTT DAQRTMLAYQGTSS I Y+P LA AI++T ILVVEGYL
Sbjct  244   VNFLSAPVKDGTTGTVIVLTTSDAQRTMLAYQGTSSRINYDPCLAEAITKTNILVVEGYL  303

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             FELPDT++TI+K CE+AR+ GALVAITASDVSCIERHYDD+WEI+ANYADIVF NS+EA+
Sbjct  304   FELPDTVRTISKVCEEARKNGALVAITASDVSCIERHYDDYWEIMANYADIVFANSEEAK  363

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             AFCHF SNESP SA RYLSHFVPLVSVTDG +GSYIGVKGEA+Y+PPSPC P+DTCGAGD
Sbjct  364   AFCHFSSNESPLSATRYLSHFVPLVSVTDGPKGSYIGVKGEAIYIPPSPCTPVDTCGAGD  423

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             AYASGILYGILRGVSDLK++G++A+KVASVVVGQQGTRLRVQDA  LAE F     NS+ 
Sbjct  424   AYASGILYGILRGVSDLKNMGSIASKVASVVVGQQGTRLRVQDAIGLAESFSVHCRNSTF  483

Query  1662  WSDIASDQISSL  1697
             WSDI SDQISSL
Sbjct  484   WSDIGSDQISSL  495



>gb|KDP39538.1| hypothetical protein JCGZ_02558 [Jatropha curcas]
Length=500

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/366 (81%), Positives = 332/366 (91%), Gaps = 0/366 (0%)
 Frame = +3

Query  600   SPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS  779
             SPT+VL  RWDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRK+VNHEERGK+LRAMDGCS
Sbjct  135   SPTAVLPERWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKIVNHEERGKVLRAMDGCS  194

Query  780   YKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSA  959
             YKAAAGGSLSNSLVALARLG + I GPAL++A+AGSVGSDPLG+FYR+KLRRANVNFLSA
Sbjct  195   YKAAAGGSLSNSLVALARLGCKSISGPALNVALAGSVGSDPLGDFYRAKLRRANVNFLSA  254

Query  960   PVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDT  1139
             P+KDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+P LA  IS+T ILV+EGYLFELPDT
Sbjct  255   PLKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDPCLASVISKTNILVIEGYLFELPDT  314

Query  1140  IKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFR  1319
             IKTI++AC++ARR G L+AITASDVSCIERHYDDFWEI+ NYAD++F NSDEARA C F 
Sbjct  315   IKTISRACQEARRNGVLIAITASDVSCIERHYDDFWEIVENYADVIFANSDEARALCDFA  374

Query  1320  SNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGI  1499
               ES  SAARYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGI
Sbjct  375   PKESTISAARYLSHFVPLVSVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGI  434

Query  1500  LYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIAS  1679
             LYGILRGVSDLK +GTLAA++A+ VVGQQGTRLRVQDA +LAE F   L  S+I SD+ S
Sbjct  435   LYGILRGVSDLKGMGTLAARIAATVVGQQGTRLRVQDAIKLAESFAFNLETSTIRSDVGS  494

Query  1680  DQISSL  1697
             D ISSL
Sbjct  495   DHISSL  500



>ref|XP_011075771.1| PREDICTED: adenosine kinase [Sesamum indicum]
Length=486

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/358 (82%), Positives = 327/358 (91%), Gaps = 0/358 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RW VLGLGQAMVDFSGMVDD+FLE+LGL+KGTRKVVNHEERG++LRAMDGCSYKAAAGGS
Sbjct  129   RWHVLGLGQAMVDFSGMVDDEFLERLGLDKGTRKVVNHEERGRVLRAMDGCSYKAAAGGS  188

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
             LSN+LVALARLGGQPIGGP+L++AMAGSVGSDPLG FYRSKL+RANVNFLSAPV DGTTG
Sbjct  189   LSNTLVALARLGGQPIGGPSLNVAMAGSVGSDPLGGFYRSKLQRANVNFLSAPVDDGTTG  248

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             TVIVLTTPDAQRTMLAYQG SS + Y+P LA  IS+T IL+VEGYLFE PDTIKTIA AC
Sbjct  249   TVIVLTTPDAQRTMLAYQGMSSRVNYDPCLASLISKTSILIVEGYLFEFPDTIKTIAMAC  308

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E+ARR GALVAITASD++CIERHYDDFW+I+ANYADI+F NSDEAR FCHF S ESP SA
Sbjct  309   EEARRCGALVAITASDITCIERHYDDFWDIMANYADIIFANSDEARTFCHFSSKESPISA  368

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              RYLSHFVP VSVTDG +GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+LRGV
Sbjct  369   TRYLSHFVPFVSVTDGPKGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGLLRGV  428

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
             SDL+D+G LA+KVASVVV QQGTRLRVQDA +LA+ F     +S++WSD+ SDQISSL
Sbjct  429   SDLRDMGALASKVASVVVAQQGTRLRVQDAVKLAKSFAFHQKSSAVWSDVGSDQISSL  486



>ref|XP_002520073.1| Ribokinase, putative [Ricinus communis]
 gb|EEF42397.1| Ribokinase, putative [Ricinus communis]
Length=483

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/366 (82%), Positives = 330/366 (90%), Gaps = 0/366 (0%)
 Frame = +3

Query  600   SPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS  779
             SPT VL  RWDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRKVVNHEERG++LRAMDGCS
Sbjct  118   SPTGVLPDRWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVVNHEERGRVLRAMDGCS  177

Query  780   YKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSA  959
             YKAAAGGSLSNSLVALARLG +PI GPAL++AMAGSVGSDPLGEFYR+KLRRANVNFLS 
Sbjct  178   YKAAAGGSLSNSLVALARLGCKPIAGPALNVAMAGSVGSDPLGEFYRAKLRRANVNFLSV  237

Query  960   PVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDT  1139
             PVKDGTTGTVIVLTTPDAQRTMLAY+GTSST++Y+P LA  I +T ILVVEGYLFEL DT
Sbjct  238   PVKDGTTGTVIVLTTPDAQRTMLAYRGTSSTVSYDPCLASIIPKTNILVVEGYLFELTDT  297

Query  1140  IKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFR  1319
             IKTIA+ACE+ARR GAL+A+TASDVSCIERHYD+FWEII NYAD+VF NSDEARA C F 
Sbjct  298   IKTIARACEEARRNGALIAVTASDVSCIERHYDNFWEIIENYADVVFANSDEARALCDFA  357

Query  1320  SNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGI  1499
               ES  SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGI
Sbjct  358   PKESTVSATRYLSHFVPLVSVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGI  417

Query  1500  LYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIAS  1679
             LYGILRGVSDLK +GTLAA++A+ VVGQQGTRLR+QDA +LAE F   L  S+I SD+ S
Sbjct  418   LYGILRGVSDLKGMGTLAARIAATVVGQQGTRLRIQDAVKLAESFAFNLETSTIRSDVGS  477

Query  1680  DQISSL  1697
             D ISSL
Sbjct  478   DHISSL  483



>ref|XP_010318288.1| PREDICTED: adenosine kinase [Solanum lycopersicum]
Length=485

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/362 (81%), Positives = 328/362 (91%), Gaps = 0/362 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             +EED     S L  RWDVLGLGQAMVDFSGMVD++FLE+LGLEKGTRKVVNHEERGK+L 
Sbjct  124   DEEDAGYSNSDLPQRWDVLGLGQAMVDFSGMVDNEFLERLGLEKGTRKVVNHEERGKVLS  183

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             AMDGCSYKAAAGGSLSNSLVALARLGGQPI GPAL++A+AGS+GSDPLG FYRSKLRRAN
Sbjct  184   AMDGCSYKAAAGGSLSNSLVALARLGGQPIAGPALNVALAGSIGSDPLGGFYRSKLRRAN  243

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             VNFLSAPVKDGTTGTVIVLTT DAQRTMLAYQGTSS I Y+P LA AI++T ILVVEGYL
Sbjct  244   VNFLSAPVKDGTTGTVIVLTTSDAQRTMLAYQGTSSRINYDPCLAEAITKTNILVVEGYL  303

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             FELPDT++TI+KAC++AR+ GALVAITASDVSCIERHYDD+WEI+ANYADIVF NS+EA+
Sbjct  304   FELPDTVRTISKACKEARKNGALVAITASDVSCIERHYDDYWEIMANYADIVFANSEEAK  363

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             AFCHF SNESP SA RYLSHFVPLVSVTDG +GSYIGVKGEA+Y+PPSPC P+DTCGAGD
Sbjct  364   AFCHFSSNESPLSATRYLSHFVPLVSVTDGPKGSYIGVKGEAIYIPPSPCTPVDTCGAGD  423

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             AYASGILYGILRGVSDLK++G++A+KVASVVVGQQGTRLRV DA  L+E F     NS+ 
Sbjct  424   AYASGILYGILRGVSDLKNMGSIASKVASVVVGQQGTRLRVHDAIGLSESFSVHCRNSTF  483

Query  1662  WS  1667
             WS
Sbjct  484   WS  485



>emb|CAN82032.1| hypothetical protein VITISV_012090 [Vitis vinifera]
Length=414

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/374 (80%), Positives = 330/374 (88%), Gaps = 2/374 (1%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             V E+E+  +  SV+  RWDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRKVVNHEERG++
Sbjct  43    VAEKEEMGA--SVVPERWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVVNHEERGRV  100

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             L+AMDGCSYKAAAGGSLSNSLVALARLGG+ IGGP L++AMAGS+GSDPLG FYR+KLRR
Sbjct  101   LQAMDGCSYKAAAGGSLSNSLVALARLGGRSIGGPPLNVAMAGSIGSDPLGSFYRTKLRR  160

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  IS+T ILVVEG
Sbjct  161   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVDYDACLASTISKTNILVVEG  220

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDE  1295
             YLFELPDTI+TI KAC +A R G+LVA+TASDVSCIERHYDDFWEII NYA IVF NS+E
Sbjct  221   YLFELPDTIRTITKACREAHRNGSLVAVTASDVSCIERHYDDFWEIIGNYAGIVFANSEE  280

Query  1296  ARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGA  1475
             ARA CHF S ESP SA RYLSHFVPLVSVTDG RGSYIG+KGEAVY+PPSPC+P+DTCGA
Sbjct  281   ARALCHFSSKESPASATRYLSHFVPLVSVTDGPRGSYIGIKGEAVYIPPSPCVPVDTCGA  340

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNS  1655
             GDAYASGILY  LRGVSD+K +GTLAAKVA+ VV QQGTRL V DA ELAE F   LN+S
Sbjct  341   GDAYASGILYSFLRGVSDVKGMGTLAAKVAATVVRQQGTRLSVHDAVELAESFAFHLNSS  400

Query  1656  SIWSDIASDQISSL  1697
             +I SDI SD ISSL
Sbjct  401   AIRSDIGSDHISSL  414



>ref|XP_011044453.1| PREDICTED: probable fructokinase-5 [Populus euphratica]
Length=465

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/375 (80%), Positives = 332/375 (89%), Gaps = 0/375 (0%)
 Frame = +3

Query  573   DVDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGK  752
             D +EE +  SPTSVL  RWDVLGLGQAMVDFSG VDD+FL++LGLEKGTRKVVNHEERG+
Sbjct  91    DEEEEIEGVSPTSVLPDRWDVLGLGQAMVDFSGTVDDEFLKRLGLEKGTRKVVNHEERGR  150

Query  753   ILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLR  932
             +LRAMDGCSYKAAAGGSLSNSLVALARLG + +GGPAL++AMAGSVGSDPLG FYRSKL+
Sbjct  151   VLRAMDGCSYKAAAGGSLSNSLVALARLGCKSVGGPALNVAMAGSVGSDPLGGFYRSKLQ  210

Query  933   RANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVE  1112
             RANVNFLS P+KDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+P LA  I +TKILVVE
Sbjct  211   RANVNFLSEPLKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDPCLASIIPKTKILVVE  270

Query  1113  GYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSD  1292
             GYLFELPDTIKTI+KACE+ARR GALVAITASDVSCIERHYDDFWEI  N AD+VF NSD
Sbjct  271   GYLFELPDTIKTISKACEEARRSGALVAITASDVSCIERHYDDFWEIAGNCADVVFANSD  330

Query  1293  EARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCG  1472
             EARA C+  + +S  SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC P+DTCG
Sbjct  331   EARALCNITAKDSSISATRYLSHFVPLVSVTDGHRGSYIGVKGEAVYIPPSPCAPVDTCG  390

Query  1473  AGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNN  1652
             AGDAYASGILYGILRGVSDL+ +GTLAA+VA+ VVGQQGTRL+VQDA EL E F     +
Sbjct  391   AGDAYASGILYGILRGVSDLRAMGTLAARVAATVVGQQGTRLKVQDAVELVESFALHFEH  450

Query  1653  SSIWSDIASDQISSL  1697
             S+I SDI SD ISSL
Sbjct  451   SAIGSDIGSDHISSL  465



>ref|XP_009768568.1| PREDICTED: adenosine kinase-like [Nicotiana sylvestris]
Length=491

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/372 (82%), Positives = 339/372 (91%), Gaps = 0/372 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             +EED S  +S L  +WDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRKV+NHEERGK+LR
Sbjct  120   DEEDISLSSSDLPQKWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVINHEERGKVLR  179

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             AMDGCSYKAAAGGSLSNSLVALARLGGQPI  PAL++ MAGS+GSDPLG FYRSKLRRAN
Sbjct  180   AMDGCSYKAAAGGSLSNSLVALARLGGQPIASPALNVGMAGSIGSDPLGGFYRSKLRRAN  239

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSS I ++P LA AI++T ILVVEGYL
Sbjct  240   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSRINFDPCLADAITKTNILVVEGYL  299

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             FELPDT++TI+K CE+AR++G+LVAITASDVSCIERHYDD+WEI+ANYADIVF NS+EAR
Sbjct  300   FELPDTVRTISKVCEEARKWGSLVAITASDVSCIERHYDDYWEIMANYADIVFANSEEAR  359

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             AFCHF S ESP SA RYLSHFVPLVSVTDG +GSYIGVKGEA+Y+PPSPC+P+DTCGAGD
Sbjct  360   AFCHFSSKESPLSATRYLSHFVPLVSVTDGPKGSYIGVKGEAIYIPPSPCVPVDTCGAGD  419

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             AYASGILYGILRGVSDL+ +G++AAKVASVVVGQQGTRLRVQDA  LAE F     +S+ 
Sbjct  420   AYASGILYGILRGVSDLRTMGSVAAKVASVVVGQQGTRLRVQDAIGLAESFSSHCRDSTF  479

Query  1662  WSDIASDQISSL  1697
             WSDI SDQISSL
Sbjct  480   WSDIGSDQISSL  491



>ref|XP_008234539.1| PREDICTED: adenosine kinase [Prunus mume]
Length=521

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/364 (82%), Positives = 328/364 (90%), Gaps = 0/364 (0%)
 Frame = +3

Query  606   TSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYK  785
             +S+L  RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK+VNHEERG++LRAMDGCSYK
Sbjct  158   SSLLPERWDVLGLGQAMVDFSGIVDDEFLEKLGLEKGTRKLVNHEERGRVLRAMDGCSYK  217

Query  786   AAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV  965
             AAAGGSLSNSLVALARLG + IG   L++AMAGSVGSDPLG FYRSKLRRAN++FLSAP+
Sbjct  218   AAAGGSLSNSLVALARLGSRSIGSSPLNVAMAGSVGSDPLGGFYRSKLRRANLHFLSAPI  277

Query  966   KDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIK  1145
             KDGTTGTVIVLTT DAQRTMLAYQGTSST+ Y+P LA  +  TKILVVEGYLFELPDTIK
Sbjct  278   KDGTTGTVIVLTTSDAQRTMLAYQGTSSTVNYDPCLASTVCNTKILVVEGYLFELPDTIK  337

Query  1146  TIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSN  1325
             TI KACE+ARR GA+VA+TASDVSCIERHYDDFWEI+ NYADIVF NSDEARAFCHF S 
Sbjct  338   TITKACEEARRSGAVVAVTASDVSCIERHYDDFWEIVGNYADIVFANSDEARAFCHFSSK  397

Query  1326  ESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILY  1505
             ESP SA RYLSHFVPL SVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILY
Sbjct  398   ESPISATRYLSHFVPLASVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILY  457

Query  1506  GILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQ  1685
             GILRGVSDLK +GTLAA+VA+ VVGQQGTRLR+QDA ELAE F   L++S+I SDI SD 
Sbjct  458   GILRGVSDLKGIGTLAARVAATVVGQQGTRLRIQDAVELAESFAFNLDSSTIRSDIGSDH  517

Query  1686  ISSL  1697
             ISS 
Sbjct  518   ISSF  521



>ref|XP_009621736.1| PREDICTED: adenosine kinase isoform X1 [Nicotiana tomentosiformis]
Length=492

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/374 (82%), Positives = 340/374 (91%), Gaps = 1/374 (0%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             VDEE+ N S +S L  +WDVLGLGQAMVDFSGMVDD+FLE+LGLEK TRKV+NHEERGK+
Sbjct  120   VDEEDVNLS-SSALPQKWDVLGLGQAMVDFSGMVDDEFLERLGLEKCTRKVINHEERGKV  178

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             LRAMDGCSYKAAAGGSLSNSLVALARLGGQPI GPAL++ MAGS+GSDPLG FYRSKLRR
Sbjct  179   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIAGPALNVGMAGSIGSDPLGGFYRSKLRR  238

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSS I ++P LA AI++T ILVVEG
Sbjct  239   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSRINFDPCLADAITKTNILVVEG  298

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDE  1295
             YLFELPDT++TI+K CE+AR++G+L+AITASDVSCIERHYDD+WEI+ANYADIVF NS+E
Sbjct  299   YLFELPDTVRTISKVCEEARKWGSLIAITASDVSCIERHYDDYWEIMANYADIVFANSEE  358

Query  1296  ARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGA  1475
             ARAFCHF S ESP SA RYLSHFVPLVSVTDG +GSYIGVKGEA+Y+PPSPC+P+DTCGA
Sbjct  359   ARAFCHFSSKESPLSATRYLSHFVPLVSVTDGPKGSYIGVKGEAIYIPPSPCVPVDTCGA  418

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNS  1655
             GDAYASGILYGILR VSDLK +G++AAKVASVVVGQQGTRLRVQDA  LAE F     +S
Sbjct  419   GDAYASGILYGILRDVSDLKTMGSVAAKVASVVVGQQGTRLRVQDAIGLAESFSSHCRDS  478

Query  1656  SIWSDIASDQISSL  1697
             + WSDI SDQISSL
Sbjct  479   TFWSDIGSDQISSL  492



>ref|XP_007219014.1| hypothetical protein PRUPE_ppa004295mg [Prunus persica]
 gb|EMJ20213.1| hypothetical protein PRUPE_ppa004295mg [Prunus persica]
Length=518

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/364 (82%), Positives = 328/364 (90%), Gaps = 0/364 (0%)
 Frame = +3

Query  606   TSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYK  785
             +S+L  RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK+VNHEERG++LRAMDGCSYK
Sbjct  155   SSLLPERWDVLGLGQAMVDFSGIVDDEFLEKLGLEKGTRKLVNHEERGRVLRAMDGCSYK  214

Query  786   AAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV  965
             AAAGGSLSNSLVALARLG + IGG  L++AMAGSVGSDPLG FYRSKLRRAN++FLSAP+
Sbjct  215   AAAGGSLSNSLVALARLGSRSIGGSPLNVAMAGSVGSDPLGGFYRSKLRRANLHFLSAPI  274

Query  966   KDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIK  1145
              DGTTGTVIVLTT DAQRTMLAYQGTSST+ Y+P LA  +  TKILVVEGYLFELPDTIK
Sbjct  275   TDGTTGTVIVLTTSDAQRTMLAYQGTSSTVNYDPCLASTVCNTKILVVEGYLFELPDTIK  334

Query  1146  TIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSN  1325
             TI KACE+ARR GA+VA+TASDVSCIERHYDDFWEI+ NYADIVF NSDEARAFCHF S 
Sbjct  335   TITKACEEARRSGAVVAVTASDVSCIERHYDDFWEIVGNYADIVFANSDEARAFCHFSSK  394

Query  1326  ESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILY  1505
             ESP SA RYLSHFVPL SVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASG+LY
Sbjct  395   ESPISATRYLSHFVPLASVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGVLY  454

Query  1506  GILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQ  1685
             GILRGVSDLK +GTLAA+VA+ VVGQQGTRLR+QDA ELAE F   L++S+I SDI SD 
Sbjct  455   GILRGVSDLKGIGTLAARVAATVVGQQGTRLRIQDAVELAESFAFNLDSSTIRSDIGSDH  514

Query  1686  ISSL  1697
             ISS 
Sbjct  515   ISSF  518



>ref|XP_002319785.1| hypothetical protein POPTR_0013s07620g [Populus trichocarpa]
 gb|EEE95708.1| hypothetical protein POPTR_0013s07620g [Populus trichocarpa]
Length=465

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/375 (80%), Positives = 332/375 (89%), Gaps = 0/375 (0%)
 Frame = +3

Query  573   DVDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGK  752
             D +EE +  SPTSVL  RWDVLGLGQAMVDFSG VDD+FL++LGLEKGTRKVVNHEERG+
Sbjct  91    DEEEEIEGVSPTSVLPDRWDVLGLGQAMVDFSGTVDDEFLKRLGLEKGTRKVVNHEERGR  150

Query  753   ILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLR  932
             +LRAMDGCSYKAAAGGSLSNSLVALARLG + +GGPAL++AMAGSVGSDPLG FYRSKL+
Sbjct  151   VLRAMDGCSYKAAAGGSLSNSLVALARLGCKSVGGPALNVAMAGSVGSDPLGGFYRSKLQ  210

Query  933   RANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVE  1112
             RANVNFLS PVKDGTTGTVIVLTTPDAQRTMLA+QGTSST+ Y+P LA  IS+TKILVVE
Sbjct  211   RANVNFLSEPVKDGTTGTVIVLTTPDAQRTMLAHQGTSSTVNYDPCLASIISKTKILVVE  270

Query  1113  GYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSD  1292
             GYLFEL DTIKTI+KACE+ARR GALVAITASDVSCIERHYDDFWEI  N AD+VF NSD
Sbjct  271   GYLFELHDTIKTISKACEEARRSGALVAITASDVSCIERHYDDFWEIAGNCADVVFANSD  330

Query  1293  EARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCG  1472
             EARA C+  + +S  SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC P+DTCG
Sbjct  331   EARALCNITAKDSSISATRYLSHFVPLVSVTDGHRGSYIGVKGEAVYIPPSPCAPVDTCG  390

Query  1473  AGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNN  1652
             AGDAYASGILYGILRGVSDL+ +GTLAA+VA+ VVGQQGTRL+VQDA EL E F     +
Sbjct  391   AGDAYASGILYGILRGVSDLRAMGTLAARVAATVVGQQGTRLKVQDAVELVESFALHFEH  450

Query  1653  SSIWSDIASDQISSL  1697
             S+I SDI SD ISSL
Sbjct  451   SAIGSDIGSDHISSL  465



>emb|CBI26479.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/363 (81%), Positives = 322/363 (89%), Gaps = 0/363 (0%)
 Frame = +3

Query  609   SVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKA  788
             SV+  RWDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRKVVNHEERG++L+AMDGCSYKA
Sbjct  4     SVVPERWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVVNHEERGRVLQAMDGCSYKA  63

Query  789   AAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK  968
             AAGGSLSNSLVALARLGG+ IGGP L++AMAGS+GSDPLG FYR+KLRRANVNFLSAPVK
Sbjct  64    AAGGSLSNSLVALARLGGRSIGGPPLNVAMAGSIGSDPLGSFYRTKLRRANVNFLSAPVK  123

Query  969   DGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKT  1148
             DGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  IS+T ILVVEGYLFELPDTI+T
Sbjct  124   DGTTGTVIVLTTPDAQRTMLAYQGTSSTVDYDACLASTISKTNILVVEGYLFELPDTIRT  183

Query  1149  IAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNE  1328
             I KAC +A R G+LVA+TASDVSC ERHYDDFWEII NYA IVF NS+EARA CHF S E
Sbjct  184   ITKACREAHRNGSLVAVTASDVSCNERHYDDFWEIIGNYAGIVFANSEEARALCHFSSKE  243

Query  1329  SPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYG  1508
             SP SA RYLSHFVPLVSVTDG RGSYIG+KGEAVY+PPSPC P+DTCGAGDAYASGILY 
Sbjct  244   SPASATRYLSHFVPLVSVTDGPRGSYIGIKGEAVYIPPSPCEPVDTCGAGDAYASGILYS  303

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQI  1688
              LRGVSD+K +GTLAAKVA+ VV QQGTRL V DA ELAE F   LN+S+I SDI SD I
Sbjct  304   FLRGVSDVKGMGTLAAKVAATVVRQQGTRLSVHDAVELAESFAFHLNSSTIRSDIGSDHI  363

Query  1689  SSL  1697
             SSL
Sbjct  364   SSL  366



>gb|EYU44872.1| hypothetical protein MIMGU_mgv1a005512mg [Erythranthe guttata]
Length=481

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/386 (77%), Positives = 338/386 (88%), Gaps = 8/386 (2%)
 Frame = +3

Query  561   VMVHDVDEEE------DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTR  722
             + V D D+E+      DN SP S     W VLGLGQAMVDFSG+VDD+FL++LGLEKGTR
Sbjct  97    LAVSDSDDEDEPHPHHDNESPASS-PQGWHVLGLGQAMVDFSGVVDDEFLDRLGLEKGTR  155

Query  723   KVVNHEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDP  902
             KVVNHEERG++LRAMDGCSYKAAAGGSLSN+LVALARLGGQ IG P+L++AMAGSVGSDP
Sbjct  156   KVVNHEERGRVLRAMDGCSYKAAAGGSLSNTLVALARLGGQTIGRPSLNVAMAGSVGSDP  215

Query  903   LGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARA  1082
             LGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDA RTMLAYQGTSS + Y+P LA  
Sbjct  216   LGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAHRTMLAYQGTSSRVNYDPCLASL  275

Query  1083  ISRTKILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIAN  1262
             IS+T IL++EGYLFE PDTIKTIA  CE+ARR GAL+AITASDV+CIERHYDDFW+I+AN
Sbjct  276   ISKTSILIIEGYLFEFPDTIKTIAMVCEEARRCGALIAITASDVTCIERHYDDFWDIMAN  335

Query  1263  YADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP  1442
             YADI+F NSDEAR FCHF S ESP SA RYLSHFVP VSVTDG +GSYIGVKGEAVY+PP
Sbjct  336   YADIIFANSDEARTFCHFPSKESPVSATRYLSHFVPFVSVTDGPKGSYIGVKGEAVYIPP  395

Query  1443  SPCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             SPC+P+DTCGAGDAYASGILYG+L GVSDL+ +GTLA+KVASVVV QQGTRLRVQDA +L
Sbjct  396   SPCVPVDTCGAGDAYASGILYGLLHGVSDLRGMGTLASKVASVVVAQQGTRLRVQDAVKL  455

Query  1623  AEMFE-HQLNNSSIWSDIASDQISSL  1697
             A+ F  H+ ++S +WSD+ SDQISSL
Sbjct  456   AQSFSFHKESSSIMWSDVGSDQISSL  481



>ref|XP_002271653.1| PREDICTED: adenosine kinase [Vitis vinifera]
Length=461

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/374 (80%), Positives = 328/374 (88%), Gaps = 2/374 (1%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             V E+E+  +  SV+  RWDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRKVVNHEERG++
Sbjct  90    VAEKEEMGA--SVVPERWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVVNHEERGRV  147

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             L+AMDGCSYKAAAGGSLSNSLVALARLGG+ IGGP L++AMAGS+GSDPLG FYR+KLRR
Sbjct  148   LQAMDGCSYKAAAGGSLSNSLVALARLGGRSIGGPPLNVAMAGSIGSDPLGSFYRTKLRR  207

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  IS+T ILVVEG
Sbjct  208   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVDYDACLASTISKTNILVVEG  267

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDE  1295
             YLFELPDTI+TI KAC +A R G+LVA+TASDVSC ERHYDDFWEII NYA IVF NS+E
Sbjct  268   YLFELPDTIRTITKACREAHRNGSLVAVTASDVSCNERHYDDFWEIIGNYAGIVFANSEE  327

Query  1296  ARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGA  1475
             ARA CHF S ESP SA RYLSHFVPLVSVTDG RGSYIG+KGEAVY+PPSPC P+DTCGA
Sbjct  328   ARALCHFSSKESPASATRYLSHFVPLVSVTDGPRGSYIGIKGEAVYIPPSPCEPVDTCGA  387

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNS  1655
             GDAYASGILY  LRGVSD+K +GTLAAKVA+ VV QQGTRL V DA ELAE F   LN+S
Sbjct  388   GDAYASGILYSFLRGVSDVKGMGTLAAKVAATVVRQQGTRLSVHDAVELAESFAFHLNSS  447

Query  1656  SIWSDIASDQISSL  1697
             +I SDI SD ISSL
Sbjct  448   TIRSDIGSDHISSL  461



>ref|XP_004307845.1| PREDICTED: uncharacterized sugar kinase slr0537-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/374 (80%), Positives = 326/374 (87%), Gaps = 2/374 (1%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             +  EE ++ P   L  RWDVLGLGQAMVDFSGMVDD+FLEKLGLEKGTRK+VNHEERG++
Sbjct  77    IQYEELDADP--FLPERWDVLGLGQAMVDFSGMVDDEFLEKLGLEKGTRKLVNHEERGRV  134

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             LRAMDGCSYKAAAGGSLSNSLVALARLG   IGG  LS+AM GSVGSDPLG FYR+KLRR
Sbjct  135   LRAMDGCSYKAAAGGSLSNSLVALARLGSTSIGGSPLSVAMTGSVGSDPLGGFYRAKLRR  194

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             AN++FLS P+KDGTTGTVIVLT+ DA RTMLAYQGTSST+ Y+  LA A+  TKILVVEG
Sbjct  195   ANLHFLSPPIKDGTTGTVIVLTSSDAHRTMLAYQGTSSTVNYDSCLASAVCNTKILVVEG  254

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDE  1295
             YLFELPDTIKTI KACE+A R GALVA+TASDVSCIERHYDDFWEI+ NYADIVF NSDE
Sbjct  255   YLFELPDTIKTITKACEEAHRCGALVAVTASDVSCIERHYDDFWEIVGNYADIVFANSDE  314

Query  1296  ARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGA  1475
             ARAFCHF S ESP SA RYLSHFVP  SVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGA
Sbjct  315   ARAFCHFSSKESPISATRYLSHFVPFASVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGA  374

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNS  1655
             GDAYASGIL+GILRGVSDLK +GTLAA+VAS VVGQQGTRLRVQDA ELAE F   L++S
Sbjct  375   GDAYASGILFGILRGVSDLKGIGTLAARVASTVVGQQGTRLRVQDAVELAESFTFHLDSS  434

Query  1656  SIWSDIASDQISSL  1697
             +I SDI SD ISS 
Sbjct  435   TIRSDIGSDHISSF  448



>ref|XP_007029674.1| PfkB-like carbohydrate kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10176.1| PfkB-like carbohydrate kinase family protein isoform 1 [Theobroma 
cacao]
Length=483

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/368 (80%), Positives = 327/368 (89%), Gaps = 0/368 (0%)
 Frame = +3

Query  594   NSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDG  773
             N+    VL  RWDVLGLGQAMVDFSGMVDD+FLE+L LEKGTRKVVNHEERG++LRAMDG
Sbjct  116   NAGSFCVLPDRWDVLGLGQAMVDFSGMVDDEFLERLELEKGTRKVVNHEERGRVLRAMDG  175

Query  774   CSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFL  953
             CSYKAAAGGSLSNSLVALARLG +PIGGP L++AMAGS+GSDPLG FYR+KL RANVNFL
Sbjct  176   CSYKAAAGGSLSNSLVALARLGSKPIGGPMLNVAMAGSIGSDPLGGFYRAKLHRANVNFL  235

Query  954   SAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
             S P+KDGTTGTVIVLTTPDAQRTMLAYQGTSSTI Y+  LA A+S+T I VVEGYLFELP
Sbjct  236   SEPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSTINYDSCLAGAVSKTNIFVVEGYLFELP  295

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
             DTIKTI KACE+AR+ GALVA+TASD+SCIERHYDDFWEI+ NYADIVF NSDEA A CH
Sbjct  296   DTIKTILKACEEARQSGALVAVTASDISCIERHYDDFWEIVGNYADIVFANSDEAGALCH  355

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
             F S ESP SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYAS
Sbjct  356   FSSKESPISATRYLSHFVPLVSVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYAS  415

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
             GILYGILRGVSDLK +GTLAA++A+ VVGQ GTRLRVQDA +L+E F   L +S++ +D+
Sbjct  416   GILYGILRGVSDLKGMGTLAARIAATVVGQLGTRLRVQDAVDLSESFAFNLASSTVRTDV  475

Query  1674  ASDQISSL  1697
              SD ISSL
Sbjct  476   DSDHISSL  483



>ref|XP_009361139.1| PREDICTED: adenosine kinase [Pyrus x bretschneideri]
Length=501

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/376 (79%), Positives = 328/376 (87%), Gaps = 1/376 (0%)
 Frame = +3

Query  573   DVDEEEDNSSPTSVLSM-RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERG  749
             D DEEE+  +     S  RWDVLGLGQAMVDFSG VDD+FLEKLGLEKGTRK+VNHEERG
Sbjct  126   DTDEEEEEYADGDFGSPDRWDVLGLGQAMVDFSGTVDDEFLEKLGLEKGTRKLVNHEERG  185

Query  750   KILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKL  929
             ++LRAMDGCSYKAAAGGSLSN+LVALARLG   I G  L++AMAGSVGSDPLG+FYR+KL
Sbjct  186   RVLRAMDGCSYKAAAGGSLSNTLVALARLGSGSIAGSTLNVAMAGSVGSDPLGDFYRTKL  245

Query  930   RRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVV  1109
             RRAN++FLS P+KDGTTGTVIVLTT DAQRTMLAYQGTSST+ Y+P LA  +  TKI VV
Sbjct  246   RRANLHFLSEPIKDGTTGTVIVLTTSDAQRTMLAYQGTSSTVNYDPCLASTVCNTKIFVV  305

Query  1110  EGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNS  1289
             EGYLFELPDTIKTI KACE AR+ GALVA+TASDVSCIERHYDDFWEI+ NYADIVF NS
Sbjct  306   EGYLFELPDTIKTITKACEVARKSGALVAVTASDVSCIERHYDDFWEIVGNYADIVFANS  365

Query  1290  DEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTC  1469
             DEARAFCHF S ESP SA RYLSHFVPL SVTDG RGSYIGVKGEAVY+PPSPC+P+DTC
Sbjct  366   DEARAFCHFSSKESPVSATRYLSHFVPLASVTDGPRGSYIGVKGEAVYIPPSPCVPVDTC  425

Query  1470  GAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLN  1649
             GAGDAYASGILYGILRGVSDLK +GTLAA+VA+ VVGQQGTRLRVQDA ELAE F   ++
Sbjct  426   GAGDAYASGILYGILRGVSDLKGIGTLAARVAATVVGQQGTRLRVQDAVELAESFACHVD  485

Query  1650  NSSIWSDIASDQISSL  1697
             +S I SDI SD++SS 
Sbjct  486   SSRIRSDIGSDRLSSF  501



>ref|XP_010087455.1| putative sugar kinase [Morus notabilis]
 gb|EXB29136.1| putative sugar kinase [Morus notabilis]
Length=442

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 328/372 (88%), Gaps = 0/372 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             ++ D S  T +L  R+DVLGLGQAMVDFSG VDD FLEKLGLEKGTRKVVNHEERG++LR
Sbjct  71    KQYDTSHATFLLPDRFDVLGLGQAMVDFSGTVDDKFLEKLGLEKGTRKVVNHEERGRVLR  130

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             AMDGCSYKAAAGGSLSNSLVALARLG  P+GGP L++AMAGSVGSDPLG FYR+KLRRAN
Sbjct  131   AMDGCSYKAAAGGSLSNSLVALARLGISPVGGPPLNVAMAGSVGSDPLGGFYRAKLRRAN  190

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             V+FLSAP+KDGTTGTVIVLTTPDA RTMLAYQGTSSTI ++P L+  IS TKILVVEGYL
Sbjct  191   VHFLSAPIKDGTTGTVIVLTTPDAHRTMLAYQGTSSTINFDPCLSSMISSTKILVVEGYL  250

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             FELPDTI+TI KACE+A R G+LVA+TASDVSCIERHYD+FWEI+ NYAD+VF NSDEAR
Sbjct  251   FELPDTIETIKKACEEACRSGSLVAVTASDVSCIERHYDEFWEIVGNYADVVFANSDEAR  310

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             A C F   ESP +  RYLSHFVPLVSVTDG RGSYIGVKGEAVYVPPSPC+P+DTCGAGD
Sbjct  311   ALCDFSPKESPIAVTRYLSHFVPLVSVTDGPRGSYIGVKGEAVYVPPSPCVPIDTCGAGD  370

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             AYASGILYGILRGVSDLK +GTLAA++A+ VVGQQGTRLRVQDA +LAE F   L++SS+
Sbjct  371   AYASGILYGILRGVSDLKGMGTLAARIAATVVGQQGTRLRVQDAVKLAESFAFHLDSSSV  430

Query  1662  WSDIASDQISSL  1697
              SD+ SD ISS 
Sbjct  431   QSDVGSDHISSF  442



>ref|XP_009381953.1| PREDICTED: uncharacterized protein LOC103970046 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381954.1| PREDICTED: uncharacterized protein LOC103970046 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381955.1| PREDICTED: uncharacterized protein LOC103970046 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 329/372 (88%), Gaps = 0/372 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             + ED  S TSV + RWDVLGLGQAMVDFSGMV D+FLE+LGLEKGTRKVVNHEERG++LR
Sbjct  103   QVEDEESVTSVAAERWDVLGLGQAMVDFSGMVHDEFLERLGLEKGTRKVVNHEERGRVLR  162

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             AMDGCSYKAAAGGSLSN+LVALARLG + + GP L++A+AGSVGSDPLG FYR+KLRRAN
Sbjct  163   AMDGCSYKAAAGGSLSNTLVALARLGSRFVSGPNLNVALAGSVGSDPLGGFYRAKLRRAN  222

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             VNFLS PVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTI Y+ +LA  +S+T ILV+EGYL
Sbjct  223   VNFLSKPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTIDYDQYLAGIVSKTNILVIEGYL  282

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             FELP TIKTIAKACE+AR+ GALVA+TASDVSCIER YDDFWEII NY DIVF NS+EAR
Sbjct  283   FELPHTIKTIAKACEEARKNGALVAVTASDVSCIERCYDDFWEIIGNYTDIVFANSNEAR  342

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             AFC F S +SP SAARYLSHFVPLVSVTDG RGS+IGVKGEA+Y+PPSPC+P+DTCGAGD
Sbjct  343   AFCDFSSRDSPMSAARYLSHFVPLVSVTDGPRGSFIGVKGEAIYIPPSPCIPVDTCGAGD  402

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             AYASGILYGILRG SDLK +G LA+ VA+VVVGQQGTRLRVQDA  LAE F   L +S+ 
Sbjct  403   AYASGILYGILRGTSDLKGMGMLASCVAAVVVGQQGTRLRVQDACRLAESFTFHLESSNA  462

Query  1662  WSDIASDQISSL  1697
              SD++SD ISSL
Sbjct  463   LSDVSSDHISSL  474



>gb|KDO49204.1| hypothetical protein CISIN_1g011689mg [Citrus sinensis]
Length=479

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/355 (81%), Positives = 319/355 (90%), Gaps = 0/355 (0%)
 Frame = +3

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
             S   SVL  RWDVLGLGQAMVDFSGMVDDDFLE+LGLEKGTRK+VNHEERG++LRAMDGC
Sbjct  113   SGSASVLPERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGC  172

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
             SYKAAAGGSLSNSLVALARLGG+PIGGPAL++AM GSVGSDPLG FYR+KLRRANV F S
Sbjct  173   SYKAAAGGSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCS  232

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPD  1136
              P+KDGTTGTVIVLTTPDAQR MLAYQGTSSTI Y+P L   IS+T I +VEGYLFELPD
Sbjct  233   EPIKDGTTGTVIVLTTPDAQRAMLAYQGTSSTINYDPCLVNLISKTNIFIVEGYLFELPD  292

Query  1137  TIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHF  1316
             TI+TI KACE A R GALVA+TASDV+CIERHYDDFWEI+ NYADIVF NSDEARAFCHF
Sbjct  293   TIRTITKACEVAHRSGALVAVTASDVTCIERHYDDFWEIVGNYADIVFANSDEARAFCHF  352

Query  1317  RSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASG  1496
              S ESP+S  RYLSHFVPLVSVTDGARGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASG
Sbjct  353   SSKESPESTTRYLSHFVPLVSVTDGARGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASG  412

Query  1497  ILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             ILYGILRGVSDLK +G LAA++A+ VVGQQGTRL V+ ASELAE F +++ +S++
Sbjct  413   ILYGILRGVSDLKGMGALAARIAATVVGQQGTRLSVRHASELAESFAYRIKSSTV  467



>ref|XP_006437439.1| hypothetical protein CICLE_v10031395mg [Citrus clementina]
 gb|ESR50679.1| hypothetical protein CICLE_v10031395mg [Citrus clementina]
Length=479

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/355 (81%), Positives = 318/355 (90%), Gaps = 0/355 (0%)
 Frame = +3

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
             S   SVL  RWDVLGLGQAMVDFSGMVDDDFLE+LGLEKGTRK+VNHEERG++LRAMDGC
Sbjct  113   SGSASVLPERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGC  172

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
             SYKAAAGGSLSNSLVALARLGG+PIGGPAL++AM GSVGSDPLG FYR KLRRANV F S
Sbjct  173   SYKAAAGGSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYREKLRRANVAFCS  232

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPD  1136
              P+KDGTTGTVIVLTTPDAQR MLAYQGTSSTI Y+P L   IS+T I +VEGYLFELPD
Sbjct  233   EPIKDGTTGTVIVLTTPDAQRAMLAYQGTSSTINYDPCLVNLISKTNIFIVEGYLFELPD  292

Query  1137  TIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHF  1316
             TI+TI KACE A R GALVA+TASDV+CIERHYDDFWEI+ NYADIVF NSDEARAFCHF
Sbjct  293   TIRTITKACEVAHRSGALVAVTASDVTCIERHYDDFWEIVGNYADIVFANSDEARAFCHF  352

Query  1317  RSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASG  1496
              S ESP+S  RYLSHFVPLVSVTDGARGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASG
Sbjct  353   SSKESPESTTRYLSHFVPLVSVTDGARGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASG  412

Query  1497  ILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             ILYGILRGVSDLK +G LAA++A+ VVGQQGTRL V+ ASELAE F +++ +S++
Sbjct  413   ILYGILRGVSDLKGMGALAARIAATVVGQQGTRLSVRHASELAESFAYRIKSSTV  467



>ref|XP_006484603.1| PREDICTED: putative ribokinase-like [Citrus sinensis]
Length=479

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/355 (81%), Positives = 319/355 (90%), Gaps = 0/355 (0%)
 Frame = +3

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
             S   SVL  RWDVLGLGQAMVDFSGMVD+DFLE+LGLEKGTRK+VNHEERG++LRAMDGC
Sbjct  113   SGSASVLPERWDVLGLGQAMVDFSGMVDNDFLERLGLEKGTRKLVNHEERGRVLRAMDGC  172

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
             SYKAAAGGSLSNSLVALARLGG+PIGGPAL++AM GSVGSDPLG FYR+KLRRANV F S
Sbjct  173   SYKAAAGGSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCS  232

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPD  1136
              P+KDGTTGTVIVLTTPDAQR MLAYQGTSSTI Y+P L   IS+T I +VEGYLFELPD
Sbjct  233   EPIKDGTTGTVIVLTTPDAQRAMLAYQGTSSTINYDPCLVNLISKTNIFIVEGYLFELPD  292

Query  1137  TIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHF  1316
             TI+TI KACE A R GALVA+TASDV+CIERHYDDFWEI+ NYADIVF NSDEARAFCHF
Sbjct  293   TIRTITKACEVAHRSGALVAVTASDVTCIERHYDDFWEIVGNYADIVFANSDEARAFCHF  352

Query  1317  RSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASG  1496
              S ESP+S  RYLSHFVPLVSVTDGARGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASG
Sbjct  353   SSKESPESTTRYLSHFVPLVSVTDGARGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASG  412

Query  1497  ILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             ILYGILRGVSDLK +G LAA++A+ VVGQQGTRL V+ ASELAE F +++ +S++
Sbjct  413   ILYGILRGVSDLKGMGALAARIAATVVGQQGTRLSVRHASELAESFAYRIKSSTV  467



>ref|XP_008357070.1| PREDICTED: adenosine kinase-like [Malus domestica]
Length=501

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/376 (79%), Positives = 325/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  573   DVDEEEDNSSPTSVLSM-RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERG  749
             D DEEE+  +     S  RWDVLGLGQAMVDFSG VDD+FLEKLGLEKGTRK+VNHEERG
Sbjct  126   DTDEEEEEYADGDFGSPDRWDVLGLGQAMVDFSGTVDDEFLEKLGLEKGTRKLVNHEERG  185

Query  750   KILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKL  929
             ++LRAMDGCSYKAAAGGSLSN+LVALARLG   I G  L++AMAGSVGSDPLG+FYR+KL
Sbjct  186   RVLRAMDGCSYKAAAGGSLSNTLVALARLGSGSIAGSTLNVAMAGSVGSDPLGDFYRTKL  245

Query  930   RRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVV  1109
             RRAN++FLS P+KDGTTGTVIVLTT DAQRTMLAYQGTSST+ Y+P LA  +  TKI VV
Sbjct  246   RRANLHFLSEPIKDGTTGTVIVLTTSDAQRTMLAYQGTSSTVNYDPCLASTVCNTKIFVV  305

Query  1110  EGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNS  1289
             EGYLFELPDTIKTI KACE AR+ GALVA+TASDVSCIERHYDDFWEI+ NYADIVF NS
Sbjct  306   EGYLFELPDTIKTITKACEVARKSGALVAVTASDVSCIERHYDDFWEIVGNYADIVFANS  365

Query  1290  DEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTC  1469
             DEARAFCHF S ESP SA RYLSHFVPL SVTDG RGSYIGVK EAVY+PPSPC+P DTC
Sbjct  366   DEARAFCHFSSKESPVSATRYLSHFVPLSSVTDGPRGSYIGVKXEAVYIPPSPCVPADTC  425

Query  1470  GAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLN  1649
             GAGDAYASGILYGILRGVSDLK +GTLAA+VA+ VVGQQGTRLRVQDA ELAE F   ++
Sbjct  426   GAGDAYASGILYGILRGVSDLKGIGTLAARVAATVVGQQGTRLRVQDAVELAESFACHVD  485

Query  1650  NSSIWSDIASDQISSL  1697
             +S I SDI SD +SS 
Sbjct  486   SSRIRSDIGSDHLSSF  501



>ref|XP_010063481.1| PREDICTED: adenosine kinase [Eucalyptus grandis]
 gb|KCW90973.1| hypothetical protein EUGRSUZ_A02987 [Eucalyptus grandis]
Length=489

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 317/358 (89%), Gaps = 0/358 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             R DVLGLGQAMVDFSGMVDD FLE+LGL KGTRK+VNHEERG++LRAMDGCSYKAAAGGS
Sbjct  132   RLDVLGLGQAMVDFSGMVDDAFLERLGLLKGTRKLVNHEERGRVLRAMDGCSYKAAAGGS  191

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
             LSNSLVAL+RL  +P GGP L+IAMAGSVGSDPLG FYR+KLRRANVNFLSAPV DGTTG
Sbjct  192   LSNSLVALSRLCTRPFGGPPLNIAMAGSVGSDPLGGFYRAKLRRANVNFLSAPVNDGTTG  251

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             TVIVLTTPDAQRTMLAYQGTSS++ Y+  LA  +S+T + +VEGYLFE PDTIKTI KAC
Sbjct  252   TVIVLTTPDAQRTMLAYQGTSSSVNYDSSLAGMVSKTDVFIVEGYLFEFPDTIKTIVKAC  311

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E+ARR GALVAITASDVSCIE HYDDFWE++  YADIVF NS+EARAFCHF S ESP SA
Sbjct  312   EEARRGGALVAITASDVSCIENHYDDFWEVVGEYADIVFANSEEARAFCHFSSKESPVSA  371

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              RYLSHFVPLVSVTDG RGSY GVKGEA+Y+PPSPC+P+DTCGAGDAYASG+LYGILRG 
Sbjct  372   TRYLSHFVPLVSVTDGPRGSYFGVKGEAIYIPPSPCIPVDTCGAGDAYASGVLYGILRGA  431

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
             SDLK VG LAA+VAS VVGQQGTRLRVQDA+ELAE F   + NS I SD+ASD +SSL
Sbjct  432   SDLKGVGALAARVASTVVGQQGTRLRVQDAAELAESFAFNVENSGILSDVASDHVSSL  489



>ref|XP_010273147.1| PREDICTED: adenosine kinase-like [Nelumbo nucifera]
Length=419

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/359 (79%), Positives = 320/359 (89%), Gaps = 1/359 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMD-GCSYKAAAGG  800
             RWDVLGLGQAMVDFSGMVDD+FLE++ +EKGTRK+VNHEERG++LRAMD GCSYKAAAGG
Sbjct  61    RWDVLGLGQAMVDFSGMVDDEFLERVEIEKGTRKLVNHEERGRVLRAMDDGCSYKAAAGG  120

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             SLSN+LVALARLGGQP+GGP L++AMAGSVGSDPLG FYR KL RANVNFLSAP+KDGTT
Sbjct  121   SLSNTLVALARLGGQPLGGPVLNVAMAGSVGSDPLGGFYREKLHRANVNFLSAPIKDGTT  180

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  L   IS+TKIL+VEGYL E P TI+TI KA
Sbjct  181   GTVIVLTTPDAQRTMLAYQGTSSTVSYDSCLDSVISKTKILIVEGYLLEFPHTIRTIIKA  240

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             C++A R GALVA+TASDVSCIER+YDDFW+I+ N+ADIVF N DEARAFCHF SNESP S
Sbjct  241   CQNAHRHGALVAVTASDVSCIERNYDDFWDIVGNHADIVFANGDEARAFCHFSSNESPLS  300

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             A RYLSHFVPLVSVTDG RGSYIGVKGE+VY+PPSPC+P+D+CGAGDAYASGILYGILRG
Sbjct  301   ATRYLSHFVPLVSVTDGPRGSYIGVKGESVYIPPSPCVPVDSCGAGDAYASGILYGILRG  360

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
              SDLK +GTLAA+VAS++V QQGT L+VQDA ELAE F   + +S I SD+ SD ISS 
Sbjct  361   ASDLKGMGTLAARVASIIVRQQGTHLQVQDAIELAESFTFHIESSVIRSDVGSDHISSF  419



>ref|XP_008796285.1| PREDICTED: adenosine kinase isoform X1 [Phoenix dactylifera]
Length=491

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/427 (68%), Positives = 337/427 (79%), Gaps = 25/427 (6%)
 Frame = +3

Query  417   GKDALLCRVASSPSPSFRCNSDEGSGDHVSCaneadgaedseddehggVMVHDVDEEEDN  596
             G   + C +  S +  + C+  EG G+ V                        V++EE+ 
Sbjct  90    GLSRVFCLLGGSEAERYPCSESEGEGEQVG-----------------------VEDEEEM  126

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
              +  SV   RWDVLGLGQAMVDFSGMVDD+FL++LG+EKGTRKVVNHEERG++LRAMDGC
Sbjct  127   MA--SVAPERWDVLGLGQAMVDFSGMVDDEFLKRLGIEKGTRKVVNHEERGRVLRAMDGC  184

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
              YKAAAGGSLSN+LVALARLG  P  GP L++AMAGSVGSDPLG FYR+KL+RANVNF S
Sbjct  185   CYKAAAGGSLSNTLVALARLGRWPGSGPVLNVAMAGSVGSDPLGGFYRAKLQRANVNFFS  244

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPD  1136
               VKDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+P+LA  IS+   LV+EGYLFELP 
Sbjct  245   KAVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVDYDPYLASIISKANALVIEGYLFELPH  304

Query  1137  TIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHF  1316
             TI+TI KACEDARR G L+A+TASDVSCIER YDDFWE+I N+AD+VF NS+EARAFC  
Sbjct  305   TIETILKACEDARRNGVLIAVTASDVSCIERCYDDFWEVIGNFADVVFANSNEARAFCDL  364

Query  1317  RSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASG  1496
              S +SP SAARYLSHFVPLVSVTDG RGSYIG+KGEA+Y+PPSPC+P+DTCGAGDAYASG
Sbjct  365   SSKDSPMSAARYLSHFVPLVSVTDGPRGSYIGIKGEAIYIPPSPCIPVDTCGAGDAYASG  424

Query  1497  ILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIA  1676
             ILYGILRG SDLK +G LA++VA+VVVGQQGTRLRVQDA  L E F   L +S +WSD+ 
Sbjct  425   ILYGILRGASDLKGMGMLASQVAAVVVGQQGTRLRVQDACRLTESFAFHLESSKVWSDVG  484

Query  1677  SDQISSL  1697
             SD ISS 
Sbjct  485   SDHISSF  491



>ref|XP_010671085.1| PREDICTED: adenosine kinase [Beta vulgaris subsp. vulgaris]
Length=479

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/363 (79%), Positives = 320/363 (88%), Gaps = 0/363 (0%)
 Frame = +3

Query  573   DVDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGK  752
             D D EE++         RWDV+GLGQAMVDFSG+VDD+FLE+LGLEKGTR++V+HEERGK
Sbjct  117   DSDAEEEDHCFNFPEVDRWDVVGLGQAMVDFSGVVDDEFLERLGLEKGTRRLVHHEERGK  176

Query  753   ILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLR  932
             +LRAMDGCSYKAAAGGSLSNSLVALARLG  P GGP L++AMAGS+GSDPLG FYR+KLR
Sbjct  177   VLRAMDGCSYKAAAGGSLSNSLVALARLGSLPAGGPVLNVAMAGSIGSDPLGGFYRAKLR  236

Query  933   RANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVE  1112
             RA+VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  L+  +SRT ILVVE
Sbjct  237   RASVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSKVYYDSGLSDIVSRTSILVVE  296

Query  1113  GYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSD  1292
             GYLFE PDTIK+I KAC+DA   GALVA+TASDVSCIERHYDDFWEII NYADIVF N+D
Sbjct  297   GYLFEFPDTIKSITKACKDAHSNGALVAVTASDVSCIERHYDDFWEIIGNYADIVFANND  356

Query  1293  EARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCG  1472
             EARA C+F   ESP SA RYLSHFVPLVSVTDG RGSYIGV+GEA+Y+PPSPC+P+DTCG
Sbjct  357   EARALCNFSLQESPISATRYLSHFVPLVSVTDGPRGSYIGVRGEAIYIPPSPCVPVDTCG  416

Query  1473  AGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNN  1652
             AGDAYASGILYGILRGVSDLKD+GTLAA++A+VVVGQQGTRLRVQDA ELAE F+  L N
Sbjct  417   AGDAYASGILYGILRGVSDLKDMGTLAARIAAVVVGQQGTRLRVQDAVELAESFDFHLEN  476

Query  1653  SSI  1661
             S+ 
Sbjct  477   SAF  479



>ref|XP_010553829.1| PREDICTED: adenosine kinase-like [Tarenaya hassleriana]
Length=482

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/380 (74%), Positives = 326/380 (86%), Gaps = 4/380 (1%)
 Frame = +3

Query  570   HDVDEEEDNSSPTSVLSM----RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNH  737
             H+ +E+E+++  + V S     RWDVLGLGQAMVDFSG+VD  FL KLGLEKGTRK++NH
Sbjct  103   HESEEDEEDTQSSDVSSPSSPERWDVLGLGQAMVDFSGVVDYGFLTKLGLEKGTRKIINH  162

Query  738   EERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFY  917
             EERGK+L+AMDGCSYKAAAGGSLSN+LVALARLG + IGGP L++AMAGS+G DPLG FY
Sbjct  163   EERGKVLQAMDGCSYKAAAGGSLSNTLVALARLGSRSIGGPPLNVAMAGSIGGDPLGSFY  222

Query  918   RSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTK  1097
             R+KLRRANVNFLS P+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T 
Sbjct  223   RTKLRRANVNFLSTPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSAVNYDSCLASLISKTS  282

Query  1098  ILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIV  1277
             I VVEGYLFELPDTI+TI KACE+ARR GALVA+TASDVSCIERH+DDFWEI+ NYADIV
Sbjct  283   IFVVEGYLFELPDTIRTITKACEEARRCGALVAVTASDVSCIERHFDDFWEIVGNYADIV  342

Query  1278  FTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP  1457
             F NS+EARAFC F   ESP SA RYLSHFVP VSVTDG +GSYIGVKGEA+Y+PP PC+P
Sbjct  343   FANSEEARAFCDFSPEESPVSATRYLSHFVPFVSVTDGHKGSYIGVKGEAIYIPPYPCVP  402

Query  1458  LDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFE  1637
              DTCGAGDAYASGILYGILRGVSD+K  G+LAA+ A+ VVGQQGTRLRVQDA ++A  + 
Sbjct  403   ADTCGAGDAYASGILYGILRGVSDIKGTGSLAARTAATVVGQQGTRLRVQDAVDIARSYA  462

Query  1638  HQLNNSSIWSDIASDQISSL  1697
              +LN+S   +D+ SDQISSL
Sbjct  463   FRLNSSGFRNDVGSDQISSL  482



>gb|KHG24465.1| Sugar kinase [Gossypium arboreum]
Length=482

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/346 (82%), Positives = 312/346 (90%), Gaps = 0/346 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             VL  RWDVLGLGQAMVDFSGMV+D+ LE+LGLEKGTRKVVNHEERG++L+AMDGCSYKAA
Sbjct  119   VLPDRWDVLGLGQAMVDFSGMVNDELLERLGLEKGTRKVVNHEERGRVLQAMDGCSYKAA  178

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSNSLVALARLG +PIGGPAL++AMAGSVGSDPLG FYR+KL RANVNFLS P+KD
Sbjct  179   AGGSLSNSLVALARLGYKPIGGPALNVAMAGSVGSDPLGGFYRAKLHRANVNFLSEPIKD  238

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
             GTTGTVIVLTTPDAQRTMLAYQGTSSTI Y+  LA  +S+T I VVEGYLFELPDTIKTI
Sbjct  239   GTTGTVIVLTTPDAQRTMLAYQGTSSTINYDSCLAGIVSKTNIFVVEGYLFELPDTIKTI  298

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              +ACE+A R GAL+A+TASDVSCIERHYDD+WEI+ NYADI+F NSDEARA CHF S ES
Sbjct  299   IRACEEACRSGALIAVTASDVSCIERHYDDYWEIVGNYADILFANSDEARALCHFSSKES  358

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
             P SA RYLSHFVPLVSVTDG +GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYGI
Sbjct  359   PISATRYLSHFVPLVSVTDGPKGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGI  418

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLN  1649
             LRGVSDLK +GTLAA++A+ VV QQGTRLRVQDA +LAE F   L 
Sbjct  419   LRGVSDLKGMGTLAARIAATVVRQQGTRLRVQDAVDLAESFAFNLE  464



>ref|XP_006284998.1| hypothetical protein CARUB_v10006305mg [Capsella rubella]
 gb|EOA17896.1| hypothetical protein CARUB_v10006305mg [Capsella rubella]
Length=471

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/373 (75%), Positives = 322/373 (86%), Gaps = 3/373 (1%)
 Frame = +3

Query  570   HDVDEEE---DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHE  740
             HD D++E    +++ +S    RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK++NHE
Sbjct  99    HDEDDDELILGHANGSSASPERWDVLGLGQAMVDFSGVVDDEFLEKLGLEKGTRKLINHE  158

Query  741   ERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYR  920
             ERGK+L+AMDGCSYKAAAGGSLSN+LVALARLG Q IG   L++AMAGS+G DPLG FY 
Sbjct  159   ERGKLLQAMDGCSYKAAAGGSLSNTLVALARLGSQSIGDRPLNVAMAGSIGGDPLGSFYG  218

Query  921   SKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKI  1100
             +KLRRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T +
Sbjct  219   TKLRRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNV  278

Query  1101  LVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVF  1280
              VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADIVF
Sbjct  279   FVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIVF  338

Query  1281  TNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPL  1460
              NSDEARAFCHF + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC+P+
Sbjct  339   ANSDEARAFCHFSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPCVPV  398

Query  1461  DTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEH  1640
             DTCGAGDAYASGILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA ELA    +
Sbjct  399   DTCGAGDAYASGILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVELARSHAY  458

Query  1641  QLNNSSIWSDIAS  1679
             +LN S + +DI S
Sbjct  459   RLNGSGVRTDIGS  471



>ref|XP_004148345.1| PREDICTED: uncharacterized sugar kinase slr0537-like [Cucumis 
sativus]
 gb|KGN60487.1| hypothetical protein Csa_3G915160 [Cucumis sativus]
Length=471

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 319/371 (86%), Gaps = 6/371 (2%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             ++   D +  +S L  RWDVLGLGQAMVDFSGMVDD+FL+KLGLEKGTRKVVNHEERG++
Sbjct  107   IEHLHDINPSSSCLPDRWDVLGLGQAMVDFSGMVDDEFLKKLGLEKGTRKVVNHEERGRV  166

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             LRAMDG SYKAAAGGSLSNSLVALARLG +P+ GP  ++AM GS+GSDPLG FYRSKLRR
Sbjct  167   LRAMDGRSYKAAAGGSLSNSLVALARLGIRPMKGPTFNVAMTGSIGSDPLGSFYRSKLRR  226

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             ANV+FLS PVKDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y P LA  IS+T +LVVEG
Sbjct  227   ANVHFLSPPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVNYSPALASVISKTNVLVVEG  286

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDE  1295
             YLFELPDTIKTI KACE+A R GALVA+TASDVSCIERH+DDFWEI+ N+ADIVF N +E
Sbjct  287   YLFELPDTIKTIQKACEEAHRSGALVAVTASDVSCIERHFDDFWEIVGNFADIVFANHEE  346

Query  1296  ARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGA  1475
             A A CHF S ES  SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PP PC+PLDTCGA
Sbjct  347   AAALCHFDSKESSISAVRYLSHFVPLVSVTDGHRGSYIGVKGEAVYIPPCPCVPLDTCGA  406

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNS  1655
             GDAYASGILYGIL+GVSDLK++GT+AAK+A+ VVGQQGTRLRVQDA ELA+ F      S
Sbjct  407   GDAYASGILYGILQGVSDLKEMGTIAAKIAARVVGQQGTRLRVQDAMELADAF------S  460

Query  1656  SIWSDIASDQI  1688
             S  SDI S  +
Sbjct  461   SFQSDIGSSHV  471



>ref|XP_010240880.1| PREDICTED: adenosine kinase-like [Nelumbo nucifera]
Length=471

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/358 (80%), Positives = 322/358 (90%), Gaps = 0/358 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LG+EKGTRK+VNHEERG++LRAMDGCSYKAAAGGS
Sbjct  114   RWDVLGLGQAMVDFSGMVDDEFLERLGIEKGTRKLVNHEERGRVLRAMDGCSYKAAAGGS  173

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
             LSN+LVALARLGG+P GGP L+IAM GSVGSDPLG FYR+KL RANV+FLSAPVKDGTTG
Sbjct  174   LSNTLVALARLGGRPNGGPMLNIAMVGSVGSDPLGGFYRAKLHRANVSFLSAPVKDGTTG  233

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             TVIVLTTPDAQRTMLAYQGTSS ++Y+  LA  +S+TKIL+VEGYLFELP TI+TIAKAC
Sbjct  234   TVIVLTTPDAQRTMLAYQGTSSIVSYDSCLASVVSKTKILIVEGYLFELPHTIRTIAKAC  293

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             EDA R GALVA+TASDVSCIERHYDDFWEII NY DIVF NSDEARA C F S ESP SA
Sbjct  294   EDAHRHGALVAVTASDVSCIERHYDDFWEIIGNYGDIVFANSDEARALCDFSSKESPVSA  353

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              RYLSHFVPLVSVTDG +GSYIGVKG++VY+PPSPC+P+DTCGAGDAYASGILYGIL G 
Sbjct  354   TRYLSHFVPLVSVTDGPKGSYIGVKGQSVYIPPSPCVPVDTCGAGDAYASGILYGILCGA  413

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
             SDLK +GTLAA+VA+VVVGQQGTRLRVQDA++L+E F   + +S++  D+ SD ISS 
Sbjct  414   SDLKGMGTLAARVAAVVVGQQGTRLRVQDAAKLSESFAFHIESSTVHLDVGSDHISSF  471



>ref|XP_002867493.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH43752.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=468

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/372 (75%), Positives = 319/372 (86%), Gaps = 2/372 (1%)
 Frame = +3

Query  570   HDVDEEE--DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEE  743
             HD D++E     + ++    RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK++NHEE
Sbjct  97    HDEDDDEFIQVHASSAASPERWDVLGLGQAMVDFSGVVDDEFLEKLGLEKGTRKLINHEE  156

Query  744   RGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRS  923
             RGK+L+AMDGCSYKAAAGGSLSN+LVALARLG Q IG   L++AMAGS+G DPLG FY +
Sbjct  157   RGKLLQAMDGCSYKAAAGGSLSNTLVALARLGSQSIGDRPLNVAMAGSIGGDPLGSFYGT  216

Query  924   KLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKIL  1103
             KLRRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  I++T + 
Sbjct  217   KLRRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLIAKTNVF  276

Query  1104  VVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFT  1283
             VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADIVF 
Sbjct  277   VVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIVFA  336

Query  1284  NSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLD  1463
             NSDEARAFCHF + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC+P+D
Sbjct  337   NSDEARAFCHFSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPCVPVD  396

Query  1464  TCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQ  1643
             TCGAGDAYASGILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA ELA     +
Sbjct  397   TCGAGDAYASGILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVELARSHAFR  456

Query  1644  LNNSSIWSDIAS  1679
             LN S + +D+ S
Sbjct  457   LNGSGVRTDVGS  468



>ref|XP_008465855.1| PREDICTED: adenosine kinase 2 [Cucumis melo]
Length=479

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/371 (77%), Positives = 317/371 (85%), Gaps = 6/371 (2%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             ++   D +  +S L  RWDVLGLGQAMVDFSGMVDD+FL+KLGLEKGTRKVVNHEERG++
Sbjct  115   IEHLHDINPSSSRLPDRWDVLGLGQAMVDFSGMVDDEFLKKLGLEKGTRKVVNHEERGRV  174

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             LRAMDG SYKAAAGGSLSNSLVALARLG +P+ GP  ++AM GS+GSDPLG FYRSKL R
Sbjct  175   LRAMDGRSYKAAAGGSLSNSLVALARLGIRPMKGPTFNVAMTGSIGSDPLGSFYRSKLSR  234

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             ANV+FLS PVKDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y P LA  IS+T +LVVEG
Sbjct  235   ANVHFLSPPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVNYSPALASVISKTNVLVVEG  294

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDE  1295
             YLFELPDTIKTI KACE+A R GALVA+TASDVSCIERH+DDFWEI+ N+ADIVF N +E
Sbjct  295   YLFELPDTIKTIQKACEEAHRSGALVAVTASDVSCIERHFDDFWEIVGNFADIVFANHEE  354

Query  1296  ARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGA  1475
             A A CHF S ES  SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PP PC+PLDTCGA
Sbjct  355   AAALCHFDSKESSISAVRYLSHFVPLVSVTDGHRGSYIGVKGEAVYIPPCPCVPLDTCGA  414

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNS  1655
             GDAYASGILYGIL+GVSDLK++GT AAK+A+ VVGQQGTRLRVQDA ELA+ F      S
Sbjct  415   GDAYASGILYGILQGVSDLKEMGTFAAKIAARVVGQQGTRLRVQDAMELADAF------S  468

Query  1656  SIWSDIASDQI  1688
             S  SDI S  +
Sbjct  469   SFQSDIGSSHV  479



>ref|XP_010550983.1| PREDICTED: uncharacterized protein LOC104821716 [Tarenaya hassleriana]
Length=489

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/363 (77%), Positives = 313/363 (86%), Gaps = 5/363 (1%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSG+VDD FL KLGLEKGTRKVVNHEERGK+L+AMDGCSYKAAAGGS
Sbjct  127   RWDVLGLGQAMVDFSGVVDDGFLAKLGLEKGTRKVVNHEERGKVLQAMDGCSYKAAAGGS  186

Query  804   LSNSLVALARLGGQPIG-----GPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK  968
             LSN+LVALARLGG+ +      GP L++AMAGS+G DPLG FYR+KL RANVNFLSAP+K
Sbjct  187   LSNTLVALARLGGRSVAFKCSDGPPLNVAMAGSIGGDPLGSFYRTKLLRANVNFLSAPIK  246

Query  969   DGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKT  1148
             DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T I VVEGYLFELPDTI+T
Sbjct  247   DGTTGTVIVLTTPDAQRTMLAYQGTSSAVNYDSCLASLISKTSIFVVEGYLFELPDTIRT  306

Query  1149  IAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNE  1328
             I KAC++ARR GALVA+TASDVSCIERHYDDFW I+ NYADIVF NSDEARAFC F   E
Sbjct  307   ITKACQEARRCGALVAVTASDVSCIERHYDDFWNIVGNYADIVFANSDEARAFCDFSPEE  366

Query  1329  SPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYG  1508
             SP SA RYLSHFVP VSVTDG +GSYIGV+GEA+Y+PP PC+P+DTCGAGDAYASGILYG
Sbjct  367   SPISATRYLSHFVPFVSVTDGHKGSYIGVRGEAIYIPPFPCVPVDTCGAGDAYASGILYG  426

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQI  1688
             ILRGVS+LK +G LAA+ A+ VVGQQGTRLRVQDA +LA+ +    N+S +  D+ SD I
Sbjct  427   ILRGVSELKGMGNLAARTAATVVGQQGTRLRVQDAVQLAQSYTFHSNSSGVRKDVGSDPI  486

Query  1689  SSL  1697
             SSL
Sbjct  487   SSL  489



>emb|CAB38272.1| carbohydrate kinase-like protein [Arabidopsis thaliana]
 emb|CAB81410.1| carbohydrate kinase-like protein [Arabidopsis thaliana]
Length=406

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/376 (74%), Positives = 319/376 (85%), Gaps = 8/376 (2%)
 Frame = +3

Query  570   HDVDEEE------DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVV  731
              D D++E      +NSS  S    RWDVLGLGQAMVDFSG+VDD+FL+KLGLEKGTRK++
Sbjct  33    EDEDDDEFIQVHANNSSAAS--PERWDVLGLGQAMVDFSGVVDDEFLKKLGLEKGTRKLI  90

Query  732   NHEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGE  911
             NHEERGK+L+AMDGCSYKAAAGGSLSN+LVALARLG Q I    L++AMAGS+G DPLG 
Sbjct  91    NHEERGKLLQAMDGCSYKAAAGGSLSNTLVALARLGSQSICDRPLNVAMAGSIGGDPLGS  150

Query  912   FYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISR  1091
             FY +KLRRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  I++
Sbjct  151   FYGTKLRRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLIAK  210

Query  1092  TKILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYAD  1271
             T + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYAD
Sbjct  211   TNVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYAD  270

Query  1272  IVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPC  1451
             IVF NSDEARAFCHF + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC
Sbjct  271   IVFANSDEARAFCHFSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPC  330

Query  1452  MPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
             +P+DTCGAGDAYASGILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA ELA  
Sbjct  331   VPVDTCGAGDAYASGILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVELARS  390

Query  1632  FEHQLNNSSIWSDIAS  1679
                +LN S + +D+ S
Sbjct  391   HAFRLNGSGVRTDVGS  406



>ref|XP_010438586.1| PREDICTED: adenosine kinase-like [Camelina sativa]
Length=457

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/378 (74%), Positives = 319/378 (84%), Gaps = 12/378 (3%)
 Frame = +3

Query  567   VHDVDEEED-------NSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRK  725
             + + DE++D       N+SP      RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK
Sbjct  85    IGNQDEDDDDFIIGHSNTSPE-----RWDVLGLGQAMVDFSGVVDDEFLEKLGLEKGTRK  139

Query  726   VVNHEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPL  905
             ++NHEERGK+L+AMDGCSYKAAAGGSLSN+LVALARLG   I    L++AMAGS+G DPL
Sbjct  140   LINHEERGKLLQAMDGCSYKAAAGGSLSNTLVALARLGSHSIVDRPLNVAMAGSIGGDPL  199

Query  906   GEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAI  1085
             G FY +KLRRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  I
Sbjct  200   GSFYGTKLRRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLI  259

Query  1086  SRTKILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANY  1265
             S+T + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NY
Sbjct  260   SKTNVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNY  319

Query  1266  ADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPS  1445
             ADIVF NSDEARAFCHF + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPS
Sbjct  320   ADIVFANSDEARAFCHFSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPS  379

Query  1446  PCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELA  1625
             PC+P+DTCGAGDAYASGILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA +LA
Sbjct  380   PCVPVDTCGAGDAYASGILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVDLA  439

Query  1626  EMFEHQLNNSSIWSDIAS  1679
                 ++L  S + +DI S
Sbjct  440   RSHAYRLKGSGVRTDIGS  457



>ref|XP_010448105.1| PREDICTED: adenosine kinase-like [Camelina sativa]
Length=468

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/362 (76%), Positives = 312/362 (86%), Gaps = 5/362 (1%)
 Frame = +3

Query  594   NSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDG  773
             N+SP      RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK++NHEERGK+L+AMDG
Sbjct  112   NTSPE-----RWDVLGLGQAMVDFSGVVDDEFLEKLGLEKGTRKLINHEERGKLLQAMDG  166

Query  774   CSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFL  953
             CSYKAAAGGSLSN+LVALARLG   I    L++AMAGS+G DPLG FY +KLRRANVNFL
Sbjct  167   CSYKAAAGGSLSNTLVALARLGSHSIIDRPLNVAMAGSIGGDPLGSFYGTKLRRANVNFL  226

Query  954   SAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
             SAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T + VVEGYLFELP
Sbjct  227   SAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNVFVVEGYLFELP  286

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
             DTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADIVF NSDEARAFCH
Sbjct  287   DTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIVFANSDEARAFCH  346

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
             F + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC+P+DTCGAGDAYAS
Sbjct  347   FSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPCVPVDTCGAGDAYAS  406

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
             GILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA +LA    ++L  S + +DI
Sbjct  407   GILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVDLARSHAYRLKGSGVRTDI  466

Query  1674  AS  1679
              S
Sbjct  467   GS  468



>ref|NP_567780.1| pfkB-like carbohydrate kinase family protein [Arabidopsis thaliana]
 gb|AAK96546.1| AT4g27600/T29A15_90 [Arabidopsis thaliana]
 gb|AAL31151.1| AT4g27600/T29A15_90 [Arabidopsis thaliana]
 gb|AEE85364.1| pfkB-like carbohydrate kinase family protein [Arabidopsis thaliana]
Length=471

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/376 (74%), Positives = 319/376 (85%), Gaps = 8/376 (2%)
 Frame = +3

Query  570   HDVDEEE------DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVV  731
              D D++E      +NSS  S    RWDVLGLGQAMVDFSG+VDD+FL+KLGLEKGTRK++
Sbjct  98    EDEDDDEFIQVHANNSSAAS--PERWDVLGLGQAMVDFSGVVDDEFLKKLGLEKGTRKLI  155

Query  732   NHEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGE  911
             NHEERGK+L+AMDGCSYKAAAGGSLSN+LVALARLG Q I    L++AMAGS+G DPLG 
Sbjct  156   NHEERGKLLQAMDGCSYKAAAGGSLSNTLVALARLGSQSICDRPLNVAMAGSIGGDPLGS  215

Query  912   FYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISR  1091
             FY +KLRRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  I++
Sbjct  216   FYGTKLRRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLIAK  275

Query  1092  TKILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYAD  1271
             T + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYAD
Sbjct  276   TNVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYAD  335

Query  1272  IVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPC  1451
             IVF NSDEARAFCHF + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC
Sbjct  336   IVFANSDEARAFCHFSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPC  395

Query  1452  MPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
             +P+DTCGAGDAYASGILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA ELA  
Sbjct  396   VPVDTCGAGDAYASGILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVELARS  455

Query  1632  FEHQLNNSSIWSDIAS  1679
                +LN S + +D+ S
Sbjct  456   HAFRLNGSGVRTDVGS  471



>ref|XP_010433342.1| PREDICTED: adenosine kinase-like [Camelina sativa]
Length=468

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/362 (76%), Positives = 312/362 (86%), Gaps = 5/362 (1%)
 Frame = +3

Query  594   NSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDG  773
             N+SP      RWDVLGLGQAMVDFSG+VDD+FLEKLGLEKGTRK++NHEERGK+L+AMDG
Sbjct  112   NTSPE-----RWDVLGLGQAMVDFSGVVDDEFLEKLGLEKGTRKLINHEERGKLLQAMDG  166

Query  774   CSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFL  953
             CSYKAAAGGSLSN+LVALARLG   I    L++AMAGS+G DPLG FY +KLRRANVNFL
Sbjct  167   CSYKAAAGGSLSNTLVALARLGSHSIVDRPLNVAMAGSIGGDPLGSFYGTKLRRANVNFL  226

Query  954   SAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
             SAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T + VVEGYLFELP
Sbjct  227   SAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNVFVVEGYLFELP  286

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
             DTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADIVF NSDEARAFCH
Sbjct  287   DTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIVFANSDEARAFCH  346

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
             F + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC+P+DTCGAGDAYAS
Sbjct  347   FSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPCVPVDTCGAGDAYAS  406

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
             GILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA +LA    ++L  S + +DI
Sbjct  407   GILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVDLARSHAYRLKGSGVRTDI  466

Query  1674  AS  1679
              S
Sbjct  467   GS  468



>gb|AAM66103.1| carbohydrate kinase-like protein [Arabidopsis thaliana]
Length=471

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/376 (74%), Positives = 319/376 (85%), Gaps = 8/376 (2%)
 Frame = +3

Query  570   HDVDEEE------DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVV  731
              D D++E      +NSS  S    RWDVLGLGQAMVDFSG+VDD+FL+KLGL+KGTRK++
Sbjct  98    EDEDDDEFIQVHANNSSAAS--PERWDVLGLGQAMVDFSGVVDDEFLKKLGLKKGTRKLI  155

Query  732   NHEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGE  911
             NHEERGK+L+AMDGCSYKAAAGGSLSN+LVALARLG Q I    L++AMAGS+G DPLG 
Sbjct  156   NHEERGKLLQAMDGCSYKAAAGGSLSNTLVALARLGSQSICDRPLNVAMAGSIGGDPLGS  215

Query  912   FYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISR  1091
             FY +KLRRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  I++
Sbjct  216   FYGTKLRRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLIAK  275

Query  1092  TKILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYAD  1271
             T + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYAD
Sbjct  276   TNVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYAD  335

Query  1272  IVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPC  1451
             IVF NSDEARAFCHF + ESP SA RY+SHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC
Sbjct  336   IVFANSDEARAFCHFSAEESPISATRYMSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPC  395

Query  1452  MPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
             +P+DTCGAGDAYASGILYGILRGVSDLK +G +AA +A+ VVGQQGTRLRVQDA ELA  
Sbjct  396   VPVDTCGAGDAYASGILYGILRGVSDLKGMGDMAATIAATVVGQQGTRLRVQDAVELARS  455

Query  1632  FEHQLNNSSIWSDIAS  1679
                +LN S + +D+ S
Sbjct  456   HAFRLNGSGVRTDVGS  471



>ref|XP_006413058.1| hypothetical protein EUTSA_v10025109mg [Eutrema salsugineum]
 gb|ESQ54511.1| hypothetical protein EUTSA_v10025109mg [Eutrema salsugineum]
Length=469

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/370 (74%), Positives = 315/370 (85%), Gaps = 0/370 (0%)
 Frame = +3

Query  570   HDVDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERG  749
              D DE  +    +S    RWDVLGLGQAMVDFSG+VDD FL+KL LEKGTRK++NHEERG
Sbjct  100   EDDDELIEGHHVSSSSPERWDVLGLGQAMVDFSGVVDDGFLKKLDLEKGTRKLINHEERG  159

Query  750   KILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKL  929
             K+L+AMDGCSYKAAAGGSLSN+LVALARLG + I    L++AMAGS+  DPLG FYR+KL
Sbjct  160   KVLQAMDGCSYKAAAGGSLSNTLVALARLGCRSISDRPLNVAMAGSIAGDPLGSFYRTKL  219

Query  930   RRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVV  1109
             RRANVNFLSAP+KDGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T + VV
Sbjct  220   RRANVNFLSAPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNVFVV  279

Query  1110  EGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNS  1289
             EGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI+F NS
Sbjct  280   EGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIIFANS  339

Query  1290  DEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTC  1469
             DEARAFCHF + ESP SA RYLSHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC+P+DTC
Sbjct  340   DEARAFCHFSAEESPISATRYLSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPCVPVDTC  399

Query  1470  GAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLN  1649
             GAGDAYASGILYGILRGV+DLK +G LAA +A+ VVGQQGTRLRVQDA ELA   + +LN
Sbjct  400   GAGDAYASGILYGILRGVTDLKGMGDLAATIAATVVGQQGTRLRVQDAVELARSHDFRLN  459

Query  1650  NSSIWSDIAS  1679
             +S + +D+ S
Sbjct  460   SSGVRTDVGS  469



>emb|CDX89233.1| BnaA01g16600D [Brassica napus]
Length=460

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/375 (74%), Positives = 320/375 (85%), Gaps = 7/375 (2%)
 Frame = +3

Query  570   HDVDEEE-----DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVN  734
              D D+EE     D++SP+S    RWDVLGLGQAMVDFSG+VDDDFL+KLGLEKGTRK+++
Sbjct  88    QDEDDEELIEGHDDNSPSS--PDRWDVLGLGQAMVDFSGVVDDDFLKKLGLEKGTRKLID  145

Query  735   HEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEF  914
             HEERG++L+AMDGCSYKAAAGGSLSN+LVALARLG + I    L++AMAGS+  DPLG F
Sbjct  146   HEERGRVLQAMDGCSYKAAAGGSLSNTLVALARLGCRSISDRPLNVAMAGSIAGDPLGSF  205

Query  915   YRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRT  1094
             YR+KLRRANVNFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T
Sbjct  206   YRTKLRRANVNFLSAPIMDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKT  265

Query  1095  KILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADI  1274
              + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI
Sbjct  266   NVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADI  325

Query  1275  VFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCM  1454
             +F NSDEARAFCHF ++ESP SA RYLSHFVP VSVTDG  GSYIGVKGEA+Y+PPSPC+
Sbjct  326   IFANSDEARAFCHFSADESPISATRYLSHFVPFVSVTDGINGSYIGVKGEAIYIPPSPCV  385

Query  1455  PLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             P+DTCGAGDAYASGILYGILRGV+DLK +G LAA +A+ VVGQQGTRLRVQDA  LA   
Sbjct  386   PVDTCGAGDAYASGILYGILRGVTDLKGMGDLAATIAATVVGQQGTRLRVQDAVRLARSH  445

Query  1635  EHQLNNSSIWSDIAS  1679
             E  + +S + +D+ S
Sbjct  446   EFLIKSSGVRTDVGS  460



>ref|XP_009143609.1| PREDICTED: uncharacterized protein LOC103867304 [Brassica rapa]
Length=460

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/375 (73%), Positives = 319/375 (85%), Gaps = 7/375 (2%)
 Frame = +3

Query  570   HDVDEEE-----DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVN  734
              D D+EE     D++SP+S    RWDVLGLGQAMVDFSG+VDDDFL+KLGLEKGTRK+++
Sbjct  88    QDEDDEELVEGHDDNSPSS--PDRWDVLGLGQAMVDFSGVVDDDFLKKLGLEKGTRKLID  145

Query  735   HEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEF  914
             HEERG++L+AMDGCSYKAAAGGSLSN+LVALARLG + I    L++AMAGS+  DPLG F
Sbjct  146   HEERGRVLQAMDGCSYKAAAGGSLSNTLVALARLGCRSISDRPLNVAMAGSIAGDPLGSF  205

Query  915   YRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRT  1094
             YR+KLRRANVNFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T
Sbjct  206   YRTKLRRANVNFLSAPIMDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKT  265

Query  1095  KILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADI  1274
              + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI
Sbjct  266   NVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADI  325

Query  1275  VFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCM  1454
             +F NSDEARAFCHF ++ESP SA RYLSHFVP VSVTDG  GSYIGVKGEA+Y+PPS C+
Sbjct  326   IFANSDEARAFCHFSADESPISATRYLSHFVPFVSVTDGINGSYIGVKGEAIYIPPSTCV  385

Query  1455  PLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             P+DTCGAGDAYASGILYGILRGV+DLK +G LAA +A+ VVGQQGTRLRVQDA  LA   
Sbjct  386   PVDTCGAGDAYASGILYGILRGVTDLKGMGDLAATIAATVVGQQGTRLRVQDAVRLARSH  445

Query  1635  EHQLNNSSIWSDIAS  1679
             E  + +S + +D+ S
Sbjct  446   EFLIKSSGVRTDVGS  460



>gb|KFK29284.1| hypothetical protein AALP_AA7G113600 [Arabis alpina]
Length=443

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/370 (74%), Positives = 312/370 (84%), Gaps = 0/370 (0%)
 Frame = +3

Query  570   HDVDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERG  749
              D D++E      +    RWDVLGLGQAMVDFSG+VDD FLEKLGLEKGTR+++NHEERG
Sbjct  74    QDEDDDEFMQGHAANSPERWDVLGLGQAMVDFSGVVDDGFLEKLGLEKGTRRLINHEERG  133

Query  750   KILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKL  929
             K+L+AMDGCSYKAAAGGSLSN+LVALARLG   I     ++AMAGS+  DPLG FYR+KL
Sbjct  134   KVLQAMDGCSYKAAAGGSLSNTLVALARLGCPSITDRPFNVAMAGSIAGDPLGSFYRTKL  193

Query  930   RRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVV  1109
             RRANVNFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T + VV
Sbjct  194   RRANVNFLSAPINDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNVFVV  253

Query  1110  EGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNS  1289
             EGYLFELPDTI+TI KACE+A + GALVA+TASDVSCIERHYDDFW+I+ NYADI+F NS
Sbjct  254   EGYLFELPDTIRTITKACEEAHKNGALVAVTASDVSCIERHYDDFWDIVGNYADIIFANS  313

Query  1290  DEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTC  1469
             DEARAFCHF + ESP SA RYLSHFVP VSVTDG  GSYIGVKGEA+Y+ PSPC+P+DTC
Sbjct  314   DEARAFCHFSAEESPISATRYLSHFVPFVSVTDGINGSYIGVKGEAIYIAPSPCVPVDTC  373

Query  1470  GAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLN  1649
             GAGDAYASGILYGILRGVSDLK +G LAA +A+ VVGQQGTRLRVQDA ELA   + +LN
Sbjct  374   GAGDAYASGILYGILRGVSDLKGMGDLAATIAATVVGQQGTRLRVQDAVELARSHDFRLN  433

Query  1650  NSSIWSDIAS  1679
             +S + +D+ S
Sbjct  434   SSGVRTDVGS  443



>emb|CDY56323.1| BnaC07g50370D [Brassica napus]
Length=380

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/367 (74%), Positives = 312/367 (85%), Gaps = 2/367 (1%)
 Frame = +3

Query  579   DEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKIL  758
             DEE   +  +S    RWDVLGLGQAMVDFSG+VDD FLEKL LEKGTRK++NHEERG++L
Sbjct  16    DEEWTQAHASSSSPERWDVLGLGQAMVDFSGVVDDAFLEKLDLEKGTRKLINHEERGRVL  75

Query  759   RAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRA  938
             +AMDGCSYKAAAGGSLSN+LVALARLG   I    L++AMAGS+  DPLG FYR+KLRRA
Sbjct  76    QAMDGCSYKAAAGGSLSNTLVALARLGCPSITDRPLNVAMAGSIAGDPLGSFYRTKLRRA  135

Query  939   NVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGY  1118
             N+NFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T + VVEGY
Sbjct  136   NINFLSAPIMDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNVFVVEGY  195

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             LFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI+F NSDEA
Sbjct  196   LFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIIFANSDEA  255

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAG  1478
             RAFCHF ++ESP SA RYLSHFVP VSVTDG  GSYIG KGEA+Y+PPSPC+P+DTCGAG
Sbjct  256   RAFCHFSADESPISATRYLSHFVPFVSVTDGINGSYIGAKGEAIYIPPSPCVPVDTCGAG  315

Query  1479  DAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSS  1658
             DAYASGILYGILRGV+DLK +G LAA +A+ VVGQQGTRLRVQDA ELA   + +LN  S
Sbjct  316   DAYASGILYGILRGVTDLKGMGELAATIAATVVGQQGTRLRVQDAVELARSHDFRLN--S  373

Query  1659  IWSDIAS  1679
             + +D+ S
Sbjct  374   VGTDVGS  380



>ref|XP_003540095.1| PREDICTED: putative ribokinase-like [Glycine max]
Length=461

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 311/353 (88%), Gaps = 0/353 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             V   RWDVLGLGQAMVDFSGMVDD+FL+ LGLEKGTRKVVNHEERG++L+AMDGCSYKAA
Sbjct  103   VFPERWDVLGLGQAMVDFSGMVDDNFLKNLGLEKGTRKVVNHEERGRVLQAMDGCSYKAA  162

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARLG +    PA+++AM GSVGSD LG FYR KLRRANV FLSAP+KD
Sbjct  163   AGGSLSNTLVALARLGSRSEKVPAINVAMTGSVGSDLLGGFYREKLRRANVQFLSAPIKD  222

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
             GTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA A+S+T ILVVEGYLFELPDTIKTI
Sbjct  223   GTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDASLANAVSKTNILVVEGYLFELPDTIKTI  282

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KACE AR  GALVAITASDVSCIERH+DDFWEII N  D+VF N +EARA C+F + ES
Sbjct  283   TKACEKARSNGALVAITASDVSCIERHFDDFWEIIGNCVDLVFANGNEARALCNFEAKES  342

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
               SAARYLSHFVPLVSVTDG  GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  343   AASAARYLSHFVPLVSVTDGPTGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGL  402

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSD  1670
             LRG+SDL+ +G+LAAKVA+ VVGQQGTRLR+ DA +LAE FE QL++SS+ +D
Sbjct  403   LRGISDLRSIGSLAAKVAATVVGQQGTRLRISDAVKLAESFEFQLDSSSVGTD  455



>gb|KHN46468.1| Putative sugar kinase [Glycine soja]
Length=461

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 311/353 (88%), Gaps = 0/353 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             V   RWDVLGLGQAMVDFSGMVDD+FL+ LGLEKGTRKVVNHEERG++L+AMDGCSYKAA
Sbjct  103   VFPERWDVLGLGQAMVDFSGMVDDNFLKNLGLEKGTRKVVNHEERGRVLQAMDGCSYKAA  162

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARLG +    PA+++AM GSVGSD LG FYR KLRRANV FLSAP+KD
Sbjct  163   AGGSLSNTLVALARLGSRSEKVPAINVAMTGSVGSDLLGGFYREKLRRANVQFLSAPIKD  222

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
             GTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA A+S+T ILVVEGYLFELPDTIKTI
Sbjct  223   GTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDASLANAVSKTNILVVEGYLFELPDTIKTI  282

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KACE AR  GALVAITASDVSCIERH+DDFWEII N  D+VF N +EARA C+F + ES
Sbjct  283   TKACEKARSNGALVAITASDVSCIERHFDDFWEIIGNCVDLVFANGNEARALCNFEAKES  342

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
               SAARYLSHFVPLVSVTDG  GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  343   AASAARYLSHFVPLVSVTDGPTGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGL  402

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSD  1670
             LRG+SDL+ +G+LAAKVA+ VVGQQGTRLR+ DA +LAE FE QL++SS+ +D
Sbjct  403   LRGISDLRSIGSLAAKVAATVVGQQGTRLRISDAVKLAESFEFQLDSSSVGTD  455



>ref|XP_009137672.1| PREDICTED: uncharacterized protein LOC103861704 [Brassica rapa]
Length=457

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/373 (73%), Positives = 314/373 (84%), Gaps = 5/373 (1%)
 Frame = +3

Query  570   HDVDEEE---DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHE  740
              D D+EE    ++  +S    RWDVLGLGQAMVDFSG+VDD FLEKL LEKGTRK++NHE
Sbjct  87    QDEDDEEWTQAHAPSSSSSPERWDVLGLGQAMVDFSGVVDDAFLEKLDLEKGTRKLINHE  146

Query  741   ERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYR  920
             ERG++L+AMDGCSYKAAAGGSLSN+LVALARLG   I    L++AMAGS+  DPLG FYR
Sbjct  147   ERGRVLQAMDGCSYKAAAGGSLSNTLVALARLGCPSITDRPLNVAMAGSIAGDPLGSFYR  206

Query  921   SKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKI  1100
             +KLRRANVNFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T +
Sbjct  207   TKLRRANVNFLSAPIMDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTNV  266

Query  1101  LVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVF  1280
              VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI+F
Sbjct  267   FVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADIIF  326

Query  1281  TNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPL  1460
              NSDEARAFCHF + ESP SA RYLSHFVP VSVTDG  GSYIG KGEA+Y+PPSPC+P+
Sbjct  327   ANSDEARAFCHFSAEESPISATRYLSHFVPFVSVTDGINGSYIGAKGEAIYIPPSPCVPV  386

Query  1461  DTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEH  1640
             DTCGAGDAYASGILYGILRGV+DLK +G LAA +A+ VVGQQGTRLRVQDA ELA   + 
Sbjct  387   DTCGAGDAYASGILYGILRGVTDLKGMGELAATIAATVVGQQGTRLRVQDAVELARSHDF  446

Query  1641  QLNNSSIWSDIAS  1679
             +LN  S+ +D+ S
Sbjct  447   RLN--SVGTDVGS  457



>emb|CDY29847.1| BnaA03g48680D [Brassica napus]
Length=456

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/374 (73%), Positives = 313/374 (84%), Gaps = 9/374 (2%)
 Frame = +3

Query  579   DEEEDNSSPTSVLSM-------RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNH  737
             D++ED+   T   +        RWDVLGLGQAMVDFSG+VDD FLEKL LEKGTRK++NH
Sbjct  85    DQDEDDEEWTQAHASSSSSSPERWDVLGLGQAMVDFSGVVDDAFLEKLDLEKGTRKLINH  144

Query  738   EERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFY  917
             EERG++L+AMDGCSYKAAAGGSLSN+LVALARLG   I    L++AMAGS+  DPLG FY
Sbjct  145   EERGRVLQAMDGCSYKAAAGGSLSNTLVALARLGCPSITDRPLNVAMAGSIAGDPLGSFY  204

Query  918   RSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTK  1097
             R+KLRRANVNFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T 
Sbjct  205   RTKLRRANVNFLSAPIMDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKTN  264

Query  1098  ILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIV  1277
             + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI+
Sbjct  265   VFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADII  324

Query  1278  FTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP  1457
             F NSDEARAFCHF + ESP SA RYLSHFVP VSVTDG  GSYIG KGEA+Y+PPSPC+P
Sbjct  325   FANSDEARAFCHFSAEESPISATRYLSHFVPFVSVTDGINGSYIGAKGEAIYIPPSPCVP  384

Query  1458  LDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFE  1637
             +DTCGAGDAYASGILYGILRGV+DLK +G LAA +A+ VVGQQGTRLRVQDA ELA   +
Sbjct  385   VDTCGAGDAYASGILYGILRGVTDLKGMGELAATIAATVVGQQGTRLRVQDAVELARSHD  444

Query  1638  HQLNNSSIWSDIAS  1679
              +LN  S+ +D+ S
Sbjct  445   FRLN--SVGTDVGS  456



>emb|CDP04921.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/338 (83%), Positives = 311/338 (92%), Gaps = 1/338 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LGLEKGTRKVVNHEERG++L+AMDGCSYKAAAGGS
Sbjct  99    RWDVLGLGQAMVDFSGMVDDEFLERLGLEKGTRKVVNHEERGRVLQAMDGCSYKAAAGGS  158

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
             LSN+LVALARLGG P+GGP+L++AMAGSVGSDPLG FYRSKL+RANV+FLSAPV +GTTG
Sbjct  159   LSNTLVALARLGGLPVGGPSLNVAMAGSVGSDPLGGFYRSKLKRANVSFLSAPVNEGTTG  218

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             TV+VLTTPDAQRTMLAYQGTSSTI+Y+  LA +I +T +L+VEGYLFE PDTIKTI+KAC
Sbjct  219   TVVVLTTPDAQRTMLAYQGTSSTISYDSSLASSICKTDVLIVEGYLFEFPDTIKTISKAC  278

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E AR FGALVA+TASD+SCIERHYDDFW+I+ANYADIVF NSDEARAFCHF S ESP SA
Sbjct  279   EVARSFGALVAVTASDISCIERHYDDFWDIMANYADIVFANSDEARAFCHFSSKESPVSA  338

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCM-PLDTCGAGDAYASGILYGILRG  1520
              RYLSHFVPLVSVTDG RGSYIGVKGEAVY+P  PC  P+DTCGAGDAYASGILYGILRG
Sbjct  339   TRYLSHFVPLVSVTDGPRGSYIGVKGEAVYIPAPPCTPPVDTCGAGDAYASGILYGILRG  398

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             VSDLK +G  AAKVASVVVGQQGTRLRVQDA +LA  F
Sbjct  399   VSDLKGMGGFAAKVASVVVGQQGTRLRVQDAVKLARSF  436



>ref|XP_010919935.1| PREDICTED: adenosine kinase [Elaeis guineensis]
Length=489

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/373 (75%), Positives = 320/373 (86%), Gaps = 3/373 (1%)
 Frame = +3

Query  579   DEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKIL  758
             DEEE  +S T     RWDVLGLGQAMVDFSG+VDD+FL++LG+EKGTRKVVNHEERG +L
Sbjct  120   DEEEMMASITP---ERWDVLGLGQAMVDFSGVVDDEFLKRLGIEKGTRKVVNHEERGSVL  176

Query  759   RAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRA  938
             RAMDGC YKAAAGGSLSN+LVALARLG   + GP L++AMAGSVGSDPLG FYR+KL RA
Sbjct  177   RAMDGCCYKAAAGGSLSNTLVALARLGRWSVSGPVLNVAMAGSVGSDPLGGFYRAKLHRA  236

Query  939   NVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGY  1118
             NVNFLS PV+DGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+P+LA  IS+T +LV+EGY
Sbjct  237   NVNFLSKPVEDGTTGTVIVLTTPDAQRTMLAYQGTSSTVDYDPYLASVISKTNVLVIEGY  296

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             LFELP TI+TI KACEDARR G L+A+TASDVSCIER YDDFWE+I N+AD+VF NS+EA
Sbjct  297   LFELPHTIETILKACEDARRNGVLIAVTASDVSCIERCYDDFWEVIGNFADVVFANSNEA  356

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAG  1478
             RAFC   S +SP SAARYLSHFVPLVSVTDG RGSYIG+KGEA+Y+PPS C+P+DTCGAG
Sbjct  357   RAFCDLSSKDSPMSAARYLSHFVPLVSVTDGPRGSYIGIKGEAIYIPPSSCIPVDTCGAG  416

Query  1479  DAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSS  1658
             DAYASGILYGILRG SDLK +G LA++VA+VVV QQGTRLRVQDA  L E F   L +S 
Sbjct  417   DAYASGILYGILRGASDLKGMGMLASQVAAVVVAQQGTRLRVQDACRLTESFAFHLESSK  476

Query  1659  IWSDIASDQISSL  1697
             + SD+ SD ISS 
Sbjct  477   VCSDVGSDHISSF  489



>ref|XP_006662622.1| PREDICTED: adenosine kinase-like [Oryza brachyantha]
Length=461

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/359 (75%), Positives = 313/359 (87%), Gaps = 1/359 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LG+EKGTRKVVNHEERG++LRAMDGCSYKAAAGGS
Sbjct  103   RWDVLGLGQAMVDFSGMVDDEFLERLGIEKGTRKVVNHEERGRVLRAMDGCSYKAAAGGS  162

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVAL+RLG  +    P L IAMAGSVGSDPLG FYR KL RANV+FLS PV+DGTT
Sbjct  163   LSNSLVALSRLGSSRSTSYPKLRIAMAGSVGSDPLGSFYRGKLNRANVHFLSKPVEDGTT  222

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  LA  +S++ IL+VEGYLFELP TI+ I +A
Sbjct  223   GTVIVLTTPDAQRTMLAYQGTSSTLSYDSDLASLVSKSNILIVEGYLFELPHTIEAIKQA  282

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA + G+L+A+TASDVSCI+R Y+DFW+I+ANYADI+F N++EARAFC   S +SP S
Sbjct  283   CEDAHKNGSLIAVTASDVSCIKRCYNDFWDIVANYADILFANANEARAFCELSSTDSPMS  342

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AARYLSH VPLVSVTDG +GSYIGVKGEA+Y+PP PC+P+DTCGAGDAYASGILYGILRG
Sbjct  343   AARYLSHSVPLVSVTDGVQGSYIGVKGEAIYIPPPPCVPVDTCGAGDAYASGILYGILRG  402

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
              SDLK +G LA++VA+VVVGQQGTRLRVQDA +LAE F H L+N    SDI +D +S+ 
Sbjct  403   SSDLKGIGLLASRVAAVVVGQQGTRLRVQDADKLAESFAHHLDNLEFCSDIETDHVSNF  461



>ref|XP_003537819.1| PREDICTED: putative ribokinase-like [Glycine max]
Length=446

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/349 (79%), Positives = 306/349 (88%), Gaps = 0/349 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             VL  RWDVLGLGQAMVDFSGMVDD+FL+ LGLEKGTRKVVNHEERG++L+AMDGCSYKAA
Sbjct  87    VLPERWDVLGLGQAMVDFSGMVDDNFLKNLGLEKGTRKVVNHEERGRVLQAMDGCSYKAA  146

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARL  +    PA+++AM GSVGSD LG FYR KLRRANV FLSAP+KD
Sbjct  147   AGGSLSNTLVALARLASRSQKVPAINVAMTGSVGSDLLGGFYREKLRRANVQFLSAPMKD  206

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
             GTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA A+S+T ILVVEGYLFELPDTIK I
Sbjct  207   GTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDASLASAVSKTNILVVEGYLFELPDTIKAI  266

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KACE AR  GALVAITASDVSCIERH+DDFWEII N  D+VF N DEARA C+F + ES
Sbjct  267   TKACEKARTNGALVAITASDVSCIERHFDDFWEIIGNCVDLVFANGDEARALCNFEAKES  326

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
               SAARYLSHFVPL SVTDG  GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  327   AASAARYLSHFVPLASVTDGPTGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGL  386

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSS  1658
             LRG+SDL+ +G+LAAKVA+ VVGQQGTRLR+ DA +LAE FE QL++SS
Sbjct  387   LRGISDLRSIGSLAAKVAATVVGQQGTRLRISDAVKLAESFEFQLDSSS  435



>gb|KHN39864.1| Putative sugar kinase [Glycine soja]
Length=446

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/349 (78%), Positives = 306/349 (88%), Gaps = 0/349 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             VL  RWDVLGLGQAMVDFSGMVDD+FL+ LGLEKGTRKVVNHEERG++L+AMDGCSYKAA
Sbjct  87    VLPERWDVLGLGQAMVDFSGMVDDNFLKNLGLEKGTRKVVNHEERGRVLQAMDGCSYKAA  146

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARL  +    PA+++AM GSVGSD LG FYR KLRRANV FLSAP+KD
Sbjct  147   AGGSLSNTLVALARLASRSQKVPAINVAMTGSVGSDLLGGFYREKLRRANVQFLSAPMKD  206

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
             GTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA A+S+T ILVVEGYLFELPDTIK I
Sbjct  207   GTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDASLASAVSKTNILVVEGYLFELPDTIKAI  266

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KACE AR  GALVAITASDVSCIERH+DDFWEII N  D+VF N +EARA C+F + ES
Sbjct  267   TKACEKARTNGALVAITASDVSCIERHFDDFWEIIGNCVDLVFANGNEARALCNFEAKES  326

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
               SAARYLSHFVPL SVTDG  GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  327   AASAARYLSHFVPLASVTDGPTGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGL  386

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSS  1658
             LRG+SDL+ +G+LAAKVA+ VVGQQGTRLR+ DA +LAE FE QL++SS
Sbjct  387   LRGISDLRSIGSLAAKVAATVVGQQGTRLRISDAVKLAESFEFQLDSSS  435



>ref|XP_007131505.1| hypothetical protein PHAVU_011G018700g [Phaseolus vulgaris]
 gb|ESW03499.1| hypothetical protein PHAVU_011G018700g [Phaseolus vulgaris]
Length=456

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/362 (78%), Positives = 312/362 (86%), Gaps = 2/362 (1%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             VL  RWDVLGLGQAMVDFSGMVDD+FLE LGLEKGTRKVVNHEERG++L+AMDGCSYKAA
Sbjct  97    VLPERWDVLGLGQAMVDFSGMVDDNFLENLGLEKGTRKVVNHEERGRVLQAMDGCSYKAA  156

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARLG +    PA+++AM GSVGSD LG FYR KLRRANV FLS P+KD
Sbjct  157   AGGSLSNTLVALARLGSRSAKAPAINVAMTGSVGSDLLGGFYREKLRRANVQFLSEPIKD  216

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
             GTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA A+S+T ILVVEGYLFELPDTIKTI
Sbjct  217   GTTGTVIVLTTPDAQRTMLAYQGTSSTVNYDASLASAVSKTNILVVEGYLFELPDTIKTI  276

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KACE ARR GALVAITASDVSCIERH+DDFWE I N  D+VF N DEARA C+F + ES
Sbjct  277   TKACEKARRNGALVAITASDVSCIERHFDDFWEFIGNSVDLVFANGDEARALCNFEAKES  336

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
               SAARYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  337   AASAARYLSHFVPLVSVTDGLRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGL  396

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQIS  1691
             LRG+SDL+  GT AA VA+ VV QQGTRLR+ DA +LAE FE QL++SS  S + +D IS
Sbjct  397   LRGISDLRSTGTFAASVAATVVAQQGTRLRISDAVKLAESFEFQLDSSS--SSVGTDHIS  454

Query  1692  SL  1697
             S 
Sbjct  455   SF  456



>ref|XP_004983571.1| PREDICTED: adenosine kinase 2-like [Setaria italica]
Length=448

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/351 (76%), Positives = 306/351 (87%), Gaps = 1/351 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSG VDD+FLE+LG+EKGTRKVVNHEERG++LRAMDGCSYKAAAGGS
Sbjct  98    RWDVLGLGQAMVDFSGTVDDEFLERLGIEKGTRKVVNHEERGRVLRAMDGCSYKAAAGGS  157

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVALARLG  +  G P L IAMAGSVGSDPLG FYR+KLRRANV+FLS PVKDGTT
Sbjct  158   LSNSLVALARLGSSRSAGYPELKIAMAGSVGSDPLGSFYRAKLRRANVHFLSKPVKDGTT  217

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  LA  +S++ +L+VEGYLFELP TI+ I +A
Sbjct  218   GTVIVLTTPDAQRTMLAYQGTSSTLSYDSDLANLVSKSNVLIVEGYLFELPHTIEAIKQA  277

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA + GAL+A+TASDVSCI+R Y+DFW+I+ NYADI+F N++EARAFC   S +SP S
Sbjct  278   CEDAHKNGALIAVTASDVSCIKRCYNDFWDIVGNYADILFANANEARAFCELPSTDSPMS  337

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             A RYLSH VPLVSVTDG  GSYIGVKGEA+Y+PP PC+P+DTCGAGDAYASGILYGILRG
Sbjct  338   ATRYLSHSVPLVSVTDGVHGSYIGVKGEAIYIPPPPCLPVDTCGAGDAYASGILYGILRG  397

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
              SDLK +G LA++VA+VVVGQQGTRLRVQDA  LAE F H L++    SD+
Sbjct  398   ASDLKGIGLLASRVAAVVVGQQGTRLRVQDADRLAESFAHHLDSLEFCSDV  448



>ref|XP_004505583.1| PREDICTED: uncharacterized sugar kinase slr0537-like [Cicer arietinum]
Length=475

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/362 (74%), Positives = 312/362 (86%), Gaps = 0/362 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             V   RWDVLGLGQAMVDFSG VDD+FL+ LGLEKGTRK+VNHEERG++L+AMDGCSYKAA
Sbjct  114   VFPERWDVLGLGQAMVDFSGTVDDEFLKNLGLEKGTRKLVNHEERGRVLQAMDGCSYKAA  173

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARLG +    PA+++AMAGSV SD LG FYR KLRRANV FLSAP+KD
Sbjct  174   AGGSLSNTLVALARLGNRSARAPAINVAMAGSVASDLLGGFYREKLRRANVQFLSAPIKD  233

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
              TTGTVIVLTTPDAQRTMLAYQGTSST+ ++  LA A+S+T ILVVEGYLFELPDTIK I
Sbjct  234   ATTGTVIVLTTPDAQRTMLAYQGTSSTVNFDASLASAVSKTNILVVEGYLFELPDTIKAI  293

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KAC++AR  GALVA+TASDVSCIERH+D FWEI+ NYAD++F N DEARA C+F + ES
Sbjct  294   TKACKEARSNGALVAVTASDVSCIERHFDHFWEIVGNYADLIFANVDEARALCNFDAKES  353

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
                  RYLS FVPLVSVTDG +GSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  354   TVCVTRYLSQFVPLVSVTDGIKGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGV  413

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQIS  1691
             LRG+SDL+ +GT+AAKVA+ VV QQGTRLR+ DA +LAE FE QL+ +++ SDI +D IS
Sbjct  414   LRGMSDLRSIGTIAAKVAATVVAQQGTRLRISDAVKLAESFEFQLDKTTVRSDIGTDHIS  473

Query  1692  SL  1697
             S+
Sbjct  474   SV  475



>ref|XP_003607450.1| Carbohydrate kinase-like protein [Medicago truncatula]
 gb|AES89647.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=464

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/356 (75%), Positives = 311/356 (87%), Gaps = 0/356 (0%)
 Frame = +3

Query  612   VLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAA  791
             V   RWDVLGLGQAMVDFSG VD++FL+ LGLEKGTRK+VNHEERG++L+AMDGCSYKAA
Sbjct  108   VFPERWDVLGLGQAMVDFSGTVDEEFLKNLGLEKGTRKLVNHEERGRVLQAMDGCSYKAA  167

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
             AGGSLSN+LVALARLGG+ +  PA+++AMAGSV SD LG FYR KLRRANV FLSAP+KD
Sbjct  168   AGGSLSNTLVALARLGGRSLRDPAINVAMAGSVASDLLGGFYREKLRRANVQFLSAPIKD  227

Query  972   GTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
              TTGTVIVLTTPDAQRTMLAYQGTSST+ ++  LA A+S+T ILVVEGYLFELPDTIK I
Sbjct  228   ATTGTVIVLTTPDAQRTMLAYQGTSSTVNFDTSLASAVSKTNILVVEGYLFELPDTIKAI  287

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KAC++AR  GALVA+TASDV+CIERHYD FWEI+ NYAD++F N+DEARA C+F + ES
Sbjct  288   TKACKEARSNGALVAVTASDVTCIERHYDHFWEIVGNYADLIFANADEARALCNFDAKES  347

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
               S  RYLS FVPLVSVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+
Sbjct  348   TVSVTRYLSQFVPLVSVTDGLRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGV  407

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIAS  1679
             LRGVSDL+++GT+AAKVA+ VV QQGTRLR+ DA +LAE FE QL+ S + SDI +
Sbjct  408   LRGVSDLRNIGTIAAKVAATVVAQQGTRLRISDAVKLAESFEFQLDTSVVRSDIGT  463



>ref|NP_001065468.1| Os10g0573000 [Oryza sativa Japonica Group]
 gb|AAK00437.1|AC060755_7 putative adenosine kinase [Oryza sativa Japonica Group]
 gb|AAP55118.1| carbohydrate kinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27305.1| Os10g0573000 [Oryza sativa Japonica Group]
 gb|EAZ17057.1| hypothetical protein OsJ_32551 [Oryza sativa Japonica Group]
 dbj|BAG93125.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67487.1| hypothetical protein OsI_34745 [Oryza sativa Indica Group]
Length=458

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/359 (73%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FL +LG++KGTRKVVNHEERG++LRAMDGCSYKAAAGGS
Sbjct  100   RWDVLGLGQAMVDFSGMVDDEFLHRLGIQKGTRKVVNHEERGRVLRAMDGCSYKAAAGGS  159

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVAL+RLG  +    P L IAMAGSVGSDPLG FYR+KLRRAN++FLS PVKDGTT
Sbjct  160   LSNSLVALSRLGSSRSTNYPELRIAMAGSVGSDPLGSFYRAKLRRANLHFLSKPVKDGTT  219

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  LA  +S++ +++VEGYLFELP TI+ I +A
Sbjct  220   GTVIVLTTPDAQRTMLAYQGTSSTLSYDSDLASLVSKSNVVIVEGYLFELPHTIEAIKQA  279

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA + G+L+A+TASDVSCI+R Y+DFW+I+ NYADI+F N++EARAFC   S +SP S
Sbjct  280   CEDAHKNGSLIAVTASDVSCIKRCYNDFWDIVTNYADILFANANEARAFCELSSTDSPMS  339

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AARYLSH VPLVSVTDG  GSYIGVKGEA+Y+PP PC+P+DTCGAGDAYASGILYGILRG
Sbjct  340   AARYLSHSVPLVSVTDGVHGSYIGVKGEAIYIPPPPCVPIDTCGAGDAYASGILYGILRG  399

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
              SDLK +G LA++VA++VV QQGTRLRVQDA  LAE F   L+N    SDI +D +S+ 
Sbjct  400   SSDLKSIGLLASRVAAIVVAQQGTRLRVQDADRLAESFTLHLDNLEFCSDIETDHVSNF  458



>ref|XP_002467453.1| hypothetical protein SORBIDRAFT_01g028370 [Sorghum bicolor]
 gb|EER94451.1| hypothetical protein SORBIDRAFT_01g028370 [Sorghum bicolor]
Length=466

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/351 (75%), Positives = 304/351 (87%), Gaps = 1/351 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FL++L +EKGTRKV+NHEERG++LRAMDGCSYKAAAGGS
Sbjct  116   RWDVLGLGQAMVDFSGMVDDEFLQRLSIEKGTRKVINHEERGRVLRAMDGCSYKAAAGGS  175

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVALARLG  Q  G P L IAMAGSVGSDPLG FYR+KLRRANV+FLS PVKDGTT
Sbjct  176   LSNSLVALARLGSSQSAGYPELKIAMAGSVGSDPLGSFYRAKLRRANVHFLSKPVKDGTT  235

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  LA  +S++ +L+VEGYLFELP TI+ I +A
Sbjct  236   GTVIVLTTPDAQRTMLAYQGTSSTLSYDSDLASLVSKSNVLIVEGYLFELPHTIEAIRQA  295

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA + GAL+A+TASDVSCI+R Y+DF +I+ NYADI+F N++EARAFC   S ESP S
Sbjct  296   CEDAHKNGALIAVTASDVSCIKRCYNDFRDIVGNYADILFANANEARAFCELPSTESPMS  355

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             A RYLSH VPLVSVTDG  GSYIGVKGEA+Y+PP  C+P+DTCGAGDAYASGILYGILRG
Sbjct  356   ATRYLSHSVPLVSVTDGMHGSYIGVKGEAIYIPPPSCIPVDTCGAGDAYASGILYGILRG  415

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
              SDLK +G LA++VA+VVVGQQGTRLRVQDA  LAE F H L++    SD+
Sbjct  416   ASDLKGIGLLASRVAAVVVGQQGTRLRVQDADRLAESFAHHLDSLEFCSDV  466



>ref|NP_001141360.1| uncharacterized protein LOC100273451 [Zea mays]
 gb|ACF86168.1| unknown [Zea mays]
 gb|ACG41486.1| carbohydrate kinase-like protein [Zea mays]
 tpg|DAA46428.1| TPA: carbohydrate kinase-like protein [Zea mays]
Length=458

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/351 (74%), Positives = 302/351 (86%), Gaps = 1/351 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FL++LG+EKGTRKV+NHEERG++LRAMDGCSYKAAAGGS
Sbjct  108   RWDVLGLGQAMVDFSGMVDDEFLDRLGIEKGTRKVINHEERGRVLRAMDGCSYKAAAGGS  167

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVALARLG  Q  G P L+I M GSVGSDPLG FYR+KLRRANV+FLS PVKDGTT
Sbjct  168   LSNSLVALARLGSSQSAGYPELNIVMGGSVGSDPLGSFYRAKLRRANVHFLSKPVKDGTT  227

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  LA  +S++ +L+VEGYLFELP TI+ I +A
Sbjct  228   GTVIVLTTPDAQRTMLAYQGTSSTLSYDSDLASLVSKSNVLIVEGYLFELPHTIEAIKQA  287

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA + GA++A+TASDVSCI+R Y+DF +I+ NYADI+F N++EARA C   S +SP S
Sbjct  288   CEDAHKNGAIIAVTASDVSCIKRCYNDFRDIVRNYADILFANANEARALCELPSTDSPMS  347

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             A RYLSH VPLVSVTDG  GSYIGVKGEA+Y+PP  C+ +DTCGAGDAYASGILYG+LRG
Sbjct  348   ATRYLSHSVPLVSVTDGMHGSYIGVKGEAIYIPPPQCVAVDTCGAGDAYASGILYGVLRG  407

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
              SDLK +G LA++VA+VVVGQQGTRLRVQDA  LA  FEH L++    SD+
Sbjct  408   ASDLKGIGLLASRVAAVVVGQQGTRLRVQDADRLAGSFEHHLDSLEFCSDV  458



>ref|XP_006837407.1| hypothetical protein AMTR_s00111p00144320 [Amborella trichopoda]
 gb|ERN00261.1| hypothetical protein AMTR_s00111p00144320 [Amborella trichopoda]
Length=380

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/369 (72%), Positives = 304/369 (82%), Gaps = 0/369 (0%)
 Frame = +3

Query  579   DEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKIL  758
             D  E  +S  S +  RWDVLGLGQAMVDFSGMVD++FLE+LGLEKGTRKVVNHEERGK+L
Sbjct  10    DVAEVQASGASAVPDRWDVLGLGQAMVDFSGMVDEEFLERLGLEKGTRKVVNHEERGKVL  69

Query  759   RAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRA  938
             RAMDGCS+KAAAGGSLSN+LVALARLG      P L +AMAGS+GSDPLG FY SKLRRA
Sbjct  70    RAMDGCSFKAAAGGSLSNTLVALARLGNGSSRCPDLHVAMAGSIGSDPLGGFYSSKLRRA  129

Query  939   NVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGY  1118
             NVNFLS+P+KDGTTGTVIVLTTPDAQRTMLAYQGTSS +TY+  LA  +S+  ILV+EGY
Sbjct  130   NVNFLSSPIKDGTTGTVIVLTTPDAQRTMLAYQGTSSAVTYDSCLAGIVSKINILVIEGY  189

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             LFE P T + I KACE A + GAL+A+TASDVSCI R+++ FWEII  YADI+F NSDEA
Sbjct  190   LFEFPQTTEAILKACEAAHKHGALIAVTASDVSCIRRYHNHFWEIIERYADILFANSDEA  249

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAG  1478
             RAFC+F  NE+P SA RYLSH +PLVSVTDG  GSYIGVKGE VY+PP PC+P+DT GAG
Sbjct  250   RAFCNFTLNENPASATRYLSHMIPLVSVTDGQHGSYIGVKGEVVYIPPYPCVPIDTSGAG  309

Query  1479  DAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSS  1658
             DAYASGILYGIL G  D K VG+LAA+VA+VVVGQQGTRLRV DA ELA+ F  +L  + 
Sbjct  310   DAYASGILYGILTGAPDWKCVGSLAARVAAVVVGQQGTRLRVHDALELAQWFAPRLGGAG  369

Query  1659  IWSDIASDQ  1685
             +WSD+  + 
Sbjct  370   LWSDVGCEN  378



>ref|XP_007029675.1| Ribokinase, putative isoform 2 [Theobroma cacao]
 gb|EOY10177.1| Ribokinase, putative isoform 2 [Theobroma cacao]
Length=394

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/368 (72%), Positives = 294/368 (80%), Gaps = 40/368 (11%)
 Frame = +3

Query  594   NSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDG  773
             N+    VL  RWDVLGLGQAMVDFSGMVDD+FLE+L LEKGTRKVVNHEERG++LRAMDG
Sbjct  67    NAGSFCVLPDRWDVLGLGQAMVDFSGMVDDEFLERLELEKGTRKVVNHEERGRVLRAMDG  126

Query  774   CSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFL  953
             CSYKAAAGGSLSNSLVALARLG +PIGGP L++AMAGS+GSDPLG FYR+KL RANVNFL
Sbjct  127   CSYKAAAGGSLSNSLVALARLGSKPIGGPMLNVAMAGSIGSDPLGGFYRAKLHRANVNFL  186

Query  954   SAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
             S P+KDGTTGTVIVLTTPDAQRTMLAYQ                                
Sbjct  187   SEPIKDGTTGTVIVLTTPDAQRTMLAYQ--------------------------------  214

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
                     ACE+AR+ GALVA+TASD+SCIERHYDDFWEI+ NYADIVF NSDEA A CH
Sbjct  215   --------ACEEARQSGALVAVTASDISCIERHYDDFWEIVGNYADIVFANSDEAGALCH  266

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
             F S ESP SA RYLSHFVPLVSVTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYAS
Sbjct  267   FSSKESPISATRYLSHFVPLVSVTDGPRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYAS  326

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDI  1673
             GILYGILRGVSDLK +GTLAA++A+ VVGQ GTRLRVQDA +L+E F   L +S++ +D+
Sbjct  327   GILYGILRGVSDLKGMGTLAARIAATVVGQLGTRLRVQDAVDLSESFAFNLASSTVRTDV  386

Query  1674  ASDQISSL  1697
              SD ISSL
Sbjct  387   DSDHISSL  394



>ref|XP_003574373.1| PREDICTED: adenosine kinase [Brachypodium distachyon]
Length=457

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/359 (73%), Positives = 306/359 (85%), Gaps = 1/359 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LG+EKGTR +VNHEERG++LRAMDGC+YKAAAGGS
Sbjct  99    RWDVLGLGQAMVDFSGMVDDEFLERLGIEKGTRTLVNHEERGRVLRAMDGCTYKAAAGGS  158

Query  804   LSNSLVALARLGGQPIGG-PALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVAL+RLG   I   P L IAMAGSVGSDPLG FYR KL+RANV FLS PVKDGTT
Sbjct  159   LSNSLVALSRLGSSQITSYPELRIAMAGSVGSDPLGSFYRQKLQRANVQFLSKPVKDGTT  218

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  +S++ ILVVEGYLFE   TI+ I +A
Sbjct  219   GTVIVLTTPDAQRTMLAYQGTSSTLAYDSDLADTVSKSNILVVEGYLFEFAHTIEAIKQA  278

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA++ GAL+A++ASDVSCI+R + DFW+I+ NYADI+F N++EARAFC   S ES  S
Sbjct  279   CEDAKKNGALIAVSASDVSCIKRCHSDFWDIVGNYADILFANANEARAFCELTSEESTMS  338

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AARYLSH +PLVSVTDG  GSYIGVKGEA+Y+PP  C+P+DTCGAGDAYASGILYGI+RG
Sbjct  339   AARYLSHSIPLVSVTDGNHGSYIGVKGEAIYIPPPSCIPVDTCGAGDAYASGILYGIVRG  398

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
              SDLK +G LAA+VA+VVVGQQGTRLRV+DA  LAE+FE  L+N  + SD  +DQ+S+ 
Sbjct  399   ASDLKGIGLLAARVAAVVVGQQGTRLRVKDADRLAELFESHLDNLEVCSDAETDQVSNF  457



>ref|XP_003607451.1| Carbohydrate kinase-like protein [Medicago truncatula]
 gb|AES89648.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=351

 Score =   526 bits (1354),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 298/340 (88%), Gaps = 0/340 (0%)
 Frame = +3

Query  660   DFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSNSLVALARLG  839
             DFSG VD++FL+ LGLEKGTRK+VNHEERG++L+AMDGCSYKAAAGGSLSN+LVALARLG
Sbjct  11    DFSGTVDEEFLKNLGLEKGTRKLVNHEERGRVLQAMDGCSYKAAAGGSLSNTLVALARLG  70

Query  840   GQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQR  1019
             G+ +  PA+++AMAGSV SD LG FYR KLRRANV FLSAP+KD TTGTVIVLTTPDAQR
Sbjct  71    GRSLRDPAINVAMAGSVASDLLGGFYREKLRRANVQFLSAPIKDATTGTVIVLTTPDAQR  130

Query  1020  TMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACEDARRFGALVAI  1199
             TMLAYQGTSST+ ++  LA A+S+T ILVVEGYLFELPDTIK I KAC++AR  GALVA+
Sbjct  131   TMLAYQGTSSTVNFDTSLASAVSKTNILVVEGYLFELPDTIKAITKACKEARSNGALVAV  190

Query  1200  TASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVS  1379
             TASDV+CIERHYD FWEI+ NYAD++F N+DEARA C+F + ES  S  RYLS FVPLVS
Sbjct  191   TASDVTCIERHYDHFWEIVGNYADLIFANADEARALCNFDAKESTVSVTRYLSQFVPLVS  250

Query  1380  VTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAK  1559
             VTDG RGSYIGVKGEAVY+PPSPC+P+DTCGAGDAYASGILYG+LRGVSDL+++GT+AAK
Sbjct  251   VTDGLRGSYIGVKGEAVYIPPSPCVPVDTCGAGDAYASGILYGVLRGVSDLRNIGTIAAK  310

Query  1560  VASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIAS  1679
             VA+ VV QQGTRLR+ DA +LAE FE QL+ S + SDI +
Sbjct  311   VAATVVAQQGTRLRISDAVKLAESFEFQLDTSVVRSDIGT  350



>dbj|BAJ86279.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   520 bits (1339),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 303/359 (84%), Gaps = 1/359 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LG+EKGTRKVVNHEERG++LRAMDGC+YKAAAGGS
Sbjct  15    RWDVLGLGQAMVDFSGMVDDEFLERLGIEKGTRKVVNHEERGRVLRAMDGCTYKAAAGGS  74

Query  804   LSNSLVALARLGGQPIGG-PALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVALARLG       P L IAMAGSVGSDPLG FYR KL RANV FLS PVKDGTT
Sbjct  75    LSNSLVALARLGSSRASSYPELRIAMAGSVGSDPLGSFYRQKLHRANVQFLSKPVKDGTT  134

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  +S++ +L+VEGYLFE   TI+ I +A
Sbjct  135   GTVIVLTTPDAQRTMLAYQGTSSTLAYDSDLAEIVSKSNLLIVEGYLFEFSHTIEAIKQA  194

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA++ GAL+A++ASDVSCI+R + DFW+I+ NYADI+F N++EARAFC   S ES  S
Sbjct  195   CEDAKKNGALIAVSASDVSCIKRCHSDFWDIVGNYADILFANANEARAFCELTSEESTVS  254

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AARYLSH +PLVSVTDG  GSYIGVKGEA+Y+PP  C+P+DTCGAGDAYASGILYGILRG
Sbjct  255   AARYLSHSIPLVSVTDGMHGSYIGVKGEAIYIPPPACIPVDTCGAGDAYASGILYGILRG  314

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
              SDLK +G LAA+VA+VVVGQQGTRLRV+DA  LAE FE  L+N    SD  +DQ+ +L
Sbjct  315   ASDLKGIGLLAAQVAAVVVGQQGTRLRVKDADRLAESFEFHLDNLEFCSDAGTDQVPNL  373



>dbj|BAJ95584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/359 (73%), Positives = 303/359 (84%), Gaps = 1/359 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LG+EKGTRKVVNHEERG++LRAMDGC+YKAAAGGS
Sbjct  104   RWDVLGLGQAMVDFSGMVDDEFLERLGIEKGTRKVVNHEERGRVLRAMDGCTYKAAAGGS  163

Query  804   LSNSLVALARLGGQPIGG-PALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVALARLG       P L IAMAGSVGSDPLG FYR KL RANV FLS PVKDGTT
Sbjct  164   LSNSLVALARLGSSRASSYPELRIAMAGSVGSDPLGSFYRQKLHRANVQFLSKPVKDGTT  223

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  +S++ +L+VEGYLFE   TI+ I +A
Sbjct  224   GTVIVLTTPDAQRTMLAYQGTSSTLAYDSDLAEIVSKSNLLIVEGYLFEFSHTIEAIKQA  283

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA++ GAL+A++ASDVSCI+R + DFW+I+ NYADI+F N++EARAFC   S ES  S
Sbjct  284   CEDAKKNGALIAVSASDVSCIKRCHSDFWDIVGNYADILFANANEARAFCELTSEESTVS  343

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AARYLSH +PLVSVTDG  GSYIGVKGEA+Y+PP  C+P+DTCGAGDAYASGILYGILRG
Sbjct  344   AARYLSHSIPLVSVTDGMHGSYIGVKGEAIYIPPPACIPVDTCGAGDAYASGILYGILRG  403

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQISSL  1697
              SDLK +G LAA+VA+VVVGQQGTRLRV+DA  LAE FE  L+N    SD  +DQ+ +L
Sbjct  404   ASDLKGIGLLAAQVAAVVVGQQGTRLRVKDADRLAESFEFHLDNLEFCSDAGTDQVPNL  462



>gb|EMT09267.1| hypothetical protein F775_18306 [Aegilops tauschii]
Length=609

 Score =   514 bits (1325),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 263/355 (74%), Positives = 301/355 (85%), Gaps = 1/355 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FLE+LG+EKGTRKVVNHEERG++LRAMDGC+YKAAAGGS
Sbjct  105   RWDVLGLGQAMVDFSGMVDDEFLERLGIEKGTRKVVNHEERGRVLRAMDGCTYKAAAGGS  164

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVALARLG  Q    P L IAMAGSVGSDPLG FYR KL RANV FLS PVKDGTT
Sbjct  165   LSNSLVALARLGSSQASSYPELRIAMAGSVGSDPLGSFYRQKLHRANVQFLSKPVKDGTT  224

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST+ Y+  LA  +S++ +L+VEGYLFE   TI+ I +A
Sbjct  225   GTVIVLTTPDAQRTMLAYQGTSSTLAYDSDLAEIVSKSNLLIVEGYLFEFSHTIEAIKQA  284

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             CEDA++ GAL+A++ASDVSCI+R + DFW+I+ NYADI+F N++EARAFC   S ES  S
Sbjct  285   CEDAKKNGALIAVSASDVSCIKRCHSDFWDIVGNYADILFANANEARAFCELTSEESTVS  344

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AARYLSH +PLVSVTDG  GSYIGVKGEA+Y+PP  C+P+DTCGAGDAYASGILYGILRG
Sbjct  345   AARYLSHSIPLVSVTDGMHGSYIGVKGEAIYIPPPACIPVDTCGAGDAYASGILYGILRG  404

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIASDQ  1685
              SDLK +G LAA+VA+VVVGQQGTRLRV+DA  LAE FE  L+N    SD  +DQ
Sbjct  405   ASDLKGIGLLAAQVAAVVVGQQGTRLRVKDADRLAESFEFHLDNLEFCSDAGTDQ  459



>gb|EPS67248.1| hypothetical protein M569_07525, partial [Genlisea aurea]
Length=342

 Score =   499 bits (1286),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 287/350 (82%), Gaps = 13/350 (4%)
 Frame = +3

Query  600   SPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS  779
             SP S    +W VLGLGQAMVDFSGMVDD F+E+LGLEKG RKV+NHEERG++L AMDGCS
Sbjct  1     SPISTPEKKWHVLGLGQAMVDFSGMVDDAFVERLGLEKGKRKVINHEERGRVLGAMDGCS  60

Query  780   YKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSA  959
             YKAAAGGSLSN+LVALARLG      P+ ++AMAGSVGSDPLG FYRSKL RANV FLSA
Sbjct  61    YKAAAGGSLSNTLVALARLG------PSFNVAMAGSVGSDPLGGFYRSKLSRANVEFLSA  114

Query  960   PVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDT  1139
             PV+DG TGTVIVLTTPDAQRTMLAYQGTS+ I Y+  LA  IS+T ILVVEGYLFE P+T
Sbjct  115   PVRDGMTGTVIVLTTPDAQRTMLAYQGTSARINYDLCLANWISQTSILVVEGYLFEFPNT  174

Query  1140  IKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFR  1319
             I+ IA AC+ ARR GALVAI ASDV CI+RHY DFW+II NY+DI+F N DEARA C   
Sbjct  175   IEAIALACKQARRCGALVAIAASDVGCIQRHYHDFWDIILNYSDILFANGDEARALCQ--  232

Query  1320  SNESPDSAARYLSHFVPLVSVTDGARGSYIGVK-GEAVYVPPSPCMPLDTCGAGDAYASG  1496
               + P SAARYLS FVPLVSVTDG  GSY+G+K GEAVY+PPSPC+P+DTCGAGDAYASG
Sbjct  233   -KDGPASAARYLSRFVPLVSVTDGPEGSYVGMKGGEAVYIPPSPCVPVDTCGAGDAYASG  291

Query  1497  ILYGILRG---VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFE  1637
             ILYG+LRG    SD++ +G  A+KVA+ VV Q+GTRL + DASELAE F 
Sbjct  292   ILYGLLRGGRDNSDVERMGRFASKVAATVVSQRGTRLTIGDASELAEAFR  341



>gb|ADE76449.1| unknown [Picea sitchensis]
Length=470

 Score =   488 bits (1256),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 310/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             E E + +   V    WDVLGLGQAMVDFSGMV+D+FLEKLGL+KG RKVVNHEERGK+LR
Sbjct  95    EVEPDGAQEIVAPETWDVLGLGQAMVDFSGMVEDEFLEKLGLQKGIRKVVNHEERGKVLR  154

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             AMDGCS+KAAAGGSLSN+LVALARLG    G P L++AM+GSVGSDPLGEFYR+KLRRAN
Sbjct  155   AMDGCSFKAAAGGSLSNTLVALARLGTGLNGEPGLNVAMSGSVGSDPLGEFYRAKLRRAN  214

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             V+FLS PVKDGTTGTV+VLTTPDAQR ML+YQG SS I ++  L+  IS+++ILVVEGYL
Sbjct  215   VSFLSMPVKDGTTGTVVVLTTPDAQRAMLSYQGMSSIINFDSSLSDLISKSRILVVEGYL  274

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             +E P TI+ IA+ACE A + G LVAITASDVSC+ RH+  FW+II  +ADIVF NS+EAR
Sbjct  275   WEFPQTIEAIAQACEAAHKNGVLVAITASDVSCVTRHHKKFWDIIVEHADIVFANSNEAR  334

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             A C F S++S   AA+++SH+ PL SVTDG  GSYI VKGE +Y+PPSPC+P+DTCGAGD
Sbjct  335   ALCGFSSSKSTALAAKHISHYSPLTSVTDGVSGSYIAVKGEVIYIPPSPCVPVDTCGAGD  394

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQL--NN-  1652
             AYA+GILYG+LRG S+LK +G LAA+VA+VVVGQQGTRL+ +DA+EL+ +F H L  NN 
Sbjct  395   AYAAGILYGLLRGSSNLKGMGNLAARVAAVVVGQQGTRLKEEDATELSAIFSHSLFSNNQ  454

Query  1653  -SSIWSDIASDQISSL  1697
              + I SD  SDQISS+
Sbjct  455   ITDICSDFQSDQISSI  470



>ref|XP_001777742.1| predicted protein [Physcomitrella patens]
 gb|EDQ57404.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 222/354 (63%), Positives = 285/354 (81%), Gaps = 2/354 (1%)
 Frame = +3

Query  570   HDVDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERG  749
             H+ +E+    S   VL  RWDV+GLGQAMVDFSG VDD+FLE   L KGTRKVVNHEERG
Sbjct  6     HNGNEQPHGISTKRVLE-RWDVVGLGQAMVDFSGTVDDEFLEGFKLVKGTRKVVNHEERG  64

Query  750   KILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKL  929
             K++RA+DG  YK +AGGSLSN+LV  ARLG      PAL++AM GSVGSDPLG+FYR+KL
Sbjct  65    KVVRALDGSDYKLSAGGSLSNTLVVFARLGMASSQNPALNVAMTGSVGSDPLGDFYRAKL  124

Query  930   RRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQ-GTSSTITYEPFLARAISRTKILV  1106
             +RANV FLS PV +GTTGTVIVLT+PDAQRTML+YQ G SST++++P LA AI+++++L+
Sbjct  125   QRANVCFLSQPVANGTTGTVIVLTSPDAQRTMLSYQQGMSSTVSFDPVLAGAIAKSRVLI  184

Query  1107  VEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTN  1286
             VEGYL+E+  TI+ IA+AC+ ARR G LVA+TASDVSC+ RH   FW ++ + +DI+F N
Sbjct  185   VEGYLWEISQTIEAIAQACDAARRQGVLVALTASDVSCVTRHRPQFWSVMRHSSDILFAN  244

Query  1287  SDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDT  1466
             +DEARA C    + + +   +YL+HF PLVSVTDGARGSYIG++GE V++PP+PC+P+DT
Sbjct  245   ADEARALCASGEDITLEQVTKYLNHFCPLVSVTDGARGSYIGLRGEVVFIPPAPCVPVDT  304

Query  1467  CGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAE  1628
             CGAGDAYA+G+LYG+LRGV +LK +G LAA+VA++VVGQ GTR+  + A E AE
Sbjct  305   CGAGDAYAAGVLYGLLRGVPELKGIGYLAARVAAIVVGQLGTRITEEVAVEFAE  358



>gb|AFK48701.1| unknown [Medicago truncatula]
Length=316

 Score =   461 bits (1186),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/307 (74%), Positives = 264/307 (86%), Gaps = 0/307 (0%)
 Frame = +3

Query  759   RAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRA  938
             +  DGCSYKAAAGGSLSN+LVALARLGG+ +  PA+++AMAGSV SD LG FYR KLRRA
Sbjct  9     KPWDGCSYKAAAGGSLSNTLVALARLGGRSLRDPAINVAMAGSVASDLLGGFYREKLRRA  68

Query  939   NVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGY  1118
             NV FLSAP+KD TTGTVIVLTTPDAQRTMLAYQGTSST+ ++  LA A+S+T ILVVEGY
Sbjct  69    NVQFLSAPIKDATTGTVIVLTTPDAQRTMLAYQGTSSTVNFDTSLASAVSKTNILVVEGY  128

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             LFELPDTIK I KAC++AR  GALVA+TASDV+CIERHYD FWEI+ NYAD++F N+DEA
Sbjct  129   LFELPDTIKAITKACKEARSNGALVAVTASDVTCIERHYDHFWEIVGNYADLIFANADEA  188

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAG  1478
             RA C+F + ES  S  RYLS FVPLVSVTDG RGSYIGVKGEA+Y+PPSPC+P+DTCGAG
Sbjct  189   RALCNFDAKESTVSVTRYLSQFVPLVSVTDGLRGSYIGVKGEAIYIPPSPCVPVDTCGAG  248

Query  1479  DAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSS  1658
             DAYASGILYG+LRGVSDL+++G +AAKVA+ VV QQGTRLR+ DA +LAE FE QL+ S 
Sbjct  249   DAYASGILYGVLRGVSDLRNIGIIAAKVAATVVAQQGTRLRISDAVKLAESFEFQLDTSV  308

Query  1659  IWSDIAS  1679
             + SDI +
Sbjct  309   VRSDIGT  315



>ref|XP_001764515.1| predicted protein [Physcomitrella patens]
 gb|EDQ70782.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   458 bits (1178),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/349 (65%), Positives = 282/349 (81%), Gaps = 0/349 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             EE+    P   +  RWDV+GLGQAMVDFSG V DDFLE+LGL KGTRKVV HEERGK+LR
Sbjct  117   EEQPYGIPDKEVPKRWDVVGLGQAMVDFSGTVGDDFLEELGLVKGTRKVVGHEERGKVLR  176

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             A+DG  YK +AGGSLSN+LVALARLG       A ++AM GSVGSD LG+FYR+KL RAN
Sbjct  177   ALDGRHYKLSAGGSLSNTLVALARLGFGSSQNSAQNVAMTGSVGSDALGDFYRTKLLRAN  236

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             V+FLS PV +GTTGTVIVLTTPDAQRTML+YQG SS + ++  LA AIS++++LVVEGYL
Sbjct  237   VHFLSQPVVEGTTGTVIVLTTPDAQRTMLSYQGMSSIVNFDSALANAISKSRVLVVEGYL  296

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             +E+  TI+ IA+ACE AR+ G LVA+TASDVSC+ RH   FW+++    DI+F N+DEAR
Sbjct  297   WEINQTIEAIAQACEAARQQGVLVALTASDVSCVTRHRQQFWDVMCQSTDILFANADEAR  356

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             A C F  + +P+ A ++L+ F PLVSVTDG RGSYIG++GE V++PP+PC+P+DTCGAGD
Sbjct  357   ALCAFGDDSTPEQATKHLNQFCPLVSVTDGPRGSYIGLRGEVVFIPPAPCVPVDTCGAGD  416

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAE  1628
             AYA+G+LYG+LRGV D+K +G LAA+VA+VVVGQQGTRL+ + A ELAE
Sbjct  417   AYAAGVLYGLLRGVPDVKGMGDLAARVAAVVVGQQGTRLKEEAALELAE  465



>ref|XP_001764628.1| predicted protein [Physcomitrella patens]
 gb|EDQ70610.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 218/350 (62%), Positives = 281/350 (80%), Gaps = 1/350 (0%)
 Frame = +3

Query  582   EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
             EE+    P   +   W V+GLGQAMVDFSG++ DDFL++LGL KGTRKVVNHEERGK+LR
Sbjct  11    EEQPYGIPEKRVPEHWGVVGLGQAMVDFSGIIGDDFLKELGLVKGTRKVVNHEERGKVLR  70

Query  762   AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRAN  941
             A+DG +YK +AGGSLSN+LVALARLG       A ++AM GSVGSD LG+FYR+KL RAN
Sbjct  71    ALDGRNYKLSAGGSLSNTLVALARLGVASSHNSAQNVAMTGSVGSDALGDFYRTKLLRAN  130

Query  942   VNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQ-GTSSTITYEPFLARAISRTKILVVEGY  1118
             V+FLS PV  GTTGTVIVLTTPDAQRTML+YQ G SS + ++  LA AI+++++LVVEGY
Sbjct  131   VHFLSQPVVGGTTGTVIVLTTPDAQRTMLSYQQGMSSIVNFDSVLADAIAKSRVLVVEGY  190

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             L+E+  TI+ IA+ACE AR+ G LVA+TASDVSC+ RH   FW+++   +DI+F N+DEA
Sbjct  191   LWEINQTIEAIAQACETARQQGVLVALTASDVSCVTRHRQQFWDVMCQSSDILFANADEA  250

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAG  1478
             RA C   ++ +P+ A ++L+ F  LVSVTDGARGSYIG++GE  ++PP+PC+P+DTCGAG
Sbjct  251   RALCALGNDCTPEQATKHLNQFCSLVSVTDGARGSYIGLRGEVFFIPPAPCVPVDTCGAG  310

Query  1479  DAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAE  1628
             DAYA+GILYG+LRG+ D++ +G LAA+VA+VVVGQQG RL+ + A ELAE
Sbjct  311   DAYAAGILYGLLRGMPDVRGMGDLAARVAAVVVGQQGARLKEEAALELAE  360



>ref|XP_002975657.1| hypothetical protein SELMODRAFT_174960 [Selaginella moellendorffii]
 gb|EFJ23286.1| hypothetical protein SELMODRAFT_174960 [Selaginella moellendorffii]
Length=388

 Score =   439 bits (1130),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 215/353 (61%), Positives = 278/353 (79%), Gaps = 6/353 (2%)
 Frame = +3

Query  579   DEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKIL  758
             D ++    P + +  +WDV+GLGQAMVD S MV +D LE+L LEKG R V++HE+RGK+L
Sbjct  12    DGDQPYGVPETAVPSQWDVVGLGQAMVDCSAMVGNDALERLQLEKGVRTVIDHEQRGKVL  71

Query  759   RAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRA  938
             +A+DG SYK +AGGSLSN+LVALARLG   I     ++AM GSVG DPLG+FYR+KL RA
Sbjct  72    QALDGRSYKVSAGGSLSNTLVALARLGTGRI-----NVAMTGSVGKDPLGDFYRTKLLRA  126

Query  939   NVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGY  1118
             NV+FLS+P+  GTTGTVIVLTTPDAQRTML+YQG SS I Y+  LA+A+S +++LVVEGY
Sbjct  127   NVHFLSSPMVRGTTGTVIVLTTPDAQRTMLSYQGMSSVIEYDQVLAKALSASRLLVVEGY  186

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             L+E+P TI+ +++AC++AR+   LVA+TASD SCI RH D FW+++ + ADI+F NSDEA
Sbjct  187   LWEIPQTIQALSRACQEARKANVLVALTASDASCISRHRDQFWDVMESSADILFANSDEA  246

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPS-PCMPLDTCGA  1475
             RA C F S+ SP  AA++LS +  LVSVTDGARGSYI + G  VYVPPS  C P+DTCGA
Sbjct  247   RALCGFGSSTSPSFAAQHLSRYCKLVSVTDGARGSYIALAGSVVYVPPSRRCKPVDTCGA  306

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             GDAYA+G+LYG+L    +L+ +G+LAAKVA++VV QQG RLR +DA++LA  F
Sbjct  307   GDAYAAGLLYGLLCNAPNLRGIGSLAAKVAAMVVSQQGARLRHEDANQLAMEF  359



>ref|XP_002978840.1| hypothetical protein SELMODRAFT_109255 [Selaginella moellendorffii]
 gb|EFJ20287.1| hypothetical protein SELMODRAFT_109255 [Selaginella moellendorffii]
Length=388

 Score =   437 bits (1125),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 278/353 (79%), Gaps = 6/353 (2%)
 Frame = +3

Query  579   DEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKIL  758
             D ++    P + +  +WDV+GLGQAMVD S MV +D LE+L LEKG R V++HE+RGK+L
Sbjct  12    DGDQPYGVPETAVPSQWDVVGLGQAMVDCSAMVGNDALERLQLEKGVRTVIDHEQRGKVL  71

Query  759   RAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRA  938
             +A+DG SYK +AGGSLSN+LVALARLG   I     ++AM GSVG DPLG+FYR+KL RA
Sbjct  72    QALDGRSYKVSAGGSLSNTLVALARLGMGRI-----NVAMTGSVGKDPLGDFYRTKLLRA  126

Query  939   NVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGY  1118
             NV+FLS+P+  GTTGTVIVLTTPDAQRTML+YQG SS I Y+  LA+A+S +++LVVEGY
Sbjct  127   NVHFLSSPMVRGTTGTVIVLTTPDAQRTMLSYQGMSSVIEYDQVLAKALSASRLLVVEGY  186

Query  1119  LFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEA  1298
             L+E+P TI+ +++AC++AR+   LVA+TASDVSCI RH D FW+++ + AD++F NS EA
Sbjct  187   LWEIPQTIQALSRACQEARKANVLVALTASDVSCISRHRDQFWDVMESSADVLFANSGEA  246

Query  1299  RAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPS-PCMPLDTCGA  1475
             RA C F S+ SP  AA++LS +  LVSVTDGARGSYI + G  VYVPPS  C P+DTCGA
Sbjct  247   RALCGFGSSTSPSFAAQHLSRYCKLVSVTDGARGSYIALAGSVVYVPPSRRCKPVDTCGA  306

Query  1476  GDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             GDAYA+G+LYG+L    +L+ +G+LAAKVA++VV QQG RLR +DA++LA  F
Sbjct  307   GDAYAAGLLYGLLCNAPNLRGIGSLAAKVAAMVVSQQGARLRHEDANQLAMEF  359



>emb|CDY19050.1| BnaC01g20180D [Brassica napus]
Length=1574

 Score =   426 bits (1095),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/265 (74%), Positives = 227/265 (86%), Gaps = 7/265 (3%)
 Frame = +3

Query  570   HDVDEEE-----DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVN  734
              D D+EE     D+ SP+S    RWDVLGLGQAMVDFSG+VDDDFL+KLGL+KGTRK++N
Sbjct  93    QDEDDEELIQGHDDHSPSS--PDRWDVLGLGQAMVDFSGVVDDDFLKKLGLQKGTRKLIN  150

Query  735   HEERGKILRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEF  914
             HEERG++L+AMDGC+YKAAAGGSLSN+LVALARLG + I    L++AMAGS+  DPLG F
Sbjct  151   HEERGRVLQAMDGCTYKAAAGGSLSNTLVALARLGCRSISDRPLNVAMAGSIAGDPLGSF  210

Query  915   YRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRT  1094
             YR+KLRRANVNFLSAP+ DGTTGTVIVLTTPDAQRTMLAYQGTSS + Y+  LA  IS+T
Sbjct  211   YRTKLRRANVNFLSAPIMDGTTGTVIVLTTPDAQRTMLAYQGTSSVVNYDSCLASLISKT  270

Query  1095  KILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADI  1274
              + VVEGYLFELPDTI+TI KACE+A R GALVA+TASDVSCIERHYDDFW+I+ NYADI
Sbjct  271   NVFVVEGYLFELPDTIRTITKACEEAHRNGALVAVTASDVSCIERHYDDFWDIVGNYADI  330

Query  1275  VFTNSDEARAFCHFRSNESPDSAAR  1349
             +F NSDEARAFCHF ++ESP SA R
Sbjct  331   IFANSDEARAFCHFSADESPISATR  355



>ref|XP_009621737.1| PREDICTED: uncharacterized protein LOC104113319 isoform X2 [Nicotiana 
tomentosiformis]
Length=356

 Score =   382 bits (982),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 207/223 (93%), Gaps = 1/223 (0%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             VDEE+ N S +S L  +WDVLGLGQAMVDFSGMVDD+FLE+LGLEK TRKV+NHEERGK+
Sbjct  120   VDEEDVNLS-SSALPQKWDVLGLGQAMVDFSGMVDDEFLERLGLEKCTRKVINHEERGKV  178

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             LRAMDGCSYKAAAGGSLSNSLVALARLGGQPI GPAL++ MAGS+GSDPLG FYRSKLRR
Sbjct  179   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIAGPALNVGMAGSIGSDPLGGFYRSKLRR  238

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEG  1115
             ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSS I ++P LA AI++T ILVVEG
Sbjct  239   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSRINFDPCLADAITKTNILVVEG  298

Query  1116  YLFELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDF  1244
             YLFELPDT++TI+K CE+AR++G+L+AITASDVSCIERHYDD+
Sbjct  299   YLFELPDTVRTISKVCEEARKWGSLIAITASDVSCIERHYDDY  341



>gb|KDO49205.1| hypothetical protein CISIN_1g011689mg [Citrus sinensis]
Length=343

 Score =   374 bits (959),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = +3

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
             S   SVL  RWDVLGLGQAMVDFSGMVDDDFLE+LGLEKGTRK+VNHEERG++LRAMDGC
Sbjct  113   SGSASVLPERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGC  172

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
             SYKAAAGGSLSNSLVALARLGG+PIGGPAL++AM GSVGSDPLG FYR+KLRRANV F S
Sbjct  173   SYKAAAGGSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCS  232

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPD  1136
              P+KDGTTGTVIVLTTPDAQR MLAYQGTSSTI Y+P L   IS+T I +VEGYLFELPD
Sbjct  233   EPIKDGTTGTVIVLTTPDAQRAMLAYQGTSSTINYDPCLVNLISKTNIFIVEGYLFELPD  292

Query  1137  TIKTIAKACEDARRFGALVAITASDVSCIERHYDDFW  1247
             TI+TI KACE A R GALVA+TASDV+CIERHYDDFW
Sbjct  293   TIRTITKACEVAHRSGALVAVTASDVTCIERHYDDFW  329



>ref|XP_008796286.1| PREDICTED: uncharacterized protein LOC103711784 isoform X2 [Phoenix 
dactylifera]
Length=358

 Score =   353 bits (907),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 211/283 (75%), Gaps = 25/283 (9%)
 Frame = +3

Query  417   GKDALLCRVASSPSPSFRCNSDEGSGDHVSCaneadgaedseddehggVMVHDVDEEEDN  596
             G   + C +  S +  + C+  EG G+ V                        V++EE+ 
Sbjct  90    GLSRVFCLLGGSEAERYPCSESEGEGEQVG-----------------------VEDEEEM  126

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
              +  SV   RWDVLGLGQAMVDFSGMVDD+FL++LG+EKGTRKVVNHEERG++LRAMDGC
Sbjct  127   MA--SVAPERWDVLGLGQAMVDFSGMVDDEFLKRLGIEKGTRKVVNHEERGRVLRAMDGC  184

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
              YKAAAGGSLSN+LVALARLG  P  GP L++AMAGSVGSDPLG FYR+KL+RANVNF S
Sbjct  185   CYKAAAGGSLSNTLVALARLGRWPGSGPVLNVAMAGSVGSDPLGGFYRAKLQRANVNFFS  244

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPD  1136
               VKDGTTGTVIVLTTPDAQRTMLAYQGTSST+ Y+P+LA  IS+   LV+EGYLFELP 
Sbjct  245   KAVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTVDYDPYLASIISKANALVIEGYLFELPH  304

Query  1137  TIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANY  1265
             TI+TI KACEDARR G L+A+TASDVSCIER YDDF  +   +
Sbjct  305   TIETILKACEDARRNGVLIAVTASDVSCIERCYDDFCSLALTF  347



>gb|ABG66284.1| carbohydrate kinase, putative, expressed [Oryza sativa Japonica 
Group]
Length=308

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 187/209 (89%), Gaps = 1/209 (0%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FL +LG++KGTRKVVNHEERG++LRAMDGCSYKAAAGGS
Sbjct  100   RWDVLGLGQAMVDFSGMVDDEFLHRLGIQKGTRKVVNHEERGRVLRAMDGCSYKAAAGGS  159

Query  804   LSNSLVALARLGG-QPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVAL+RLG  +    P L IAMAGSVGSDPLG FYR+KLRRAN++FLS PVKDGTT
Sbjct  160   LSNSLVALSRLGSSRSTNYPELRIAMAGSVGSDPLGSFYRAKLRRANLHFLSKPVKDGTT  219

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GTVIVLTTPDAQRTMLAYQGTSST++Y+  LA  +S++ +++VEGYLFELP TI+ I +A
Sbjct  220   GTVIVLTTPDAQRTMLAYQGTSSTLSYDSDLASLVSKSNVVIVEGYLFELPHTIEAIKQA  279

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFW  1247
             CEDA + G+L+A+TASDVSCI+R Y+DFW
Sbjct  280   CEDAHKNGSLIAVTASDVSCIKRCYNDFW  308



>ref|XP_005846464.1| hypothetical protein CHLNCDRAFT_16922, partial [Chlorella variabilis]
 gb|EFN54362.1| hypothetical protein CHLNCDRAFT_16922, partial [Chlorella variabilis]
Length=356

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/358 (45%), Positives = 217/358 (61%), Gaps = 27/358 (8%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             +D LGL QAMVD +  VDDD L +L +EKG+R++V+ EERG +L  ++G  Y  AAGGSL
Sbjct  1     YDCLGLAQAMVDIASAVDDDMLARLQVEKGSRRLVSLEERGAVLAQLEGREYSVAAGGSL  60

Query  807   SNSLVALARLG---GQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             SN+L+ LARLG    +  G P L +AMAG +G D LGEFYR+++  A V+  S P+  G 
Sbjct  61    SNTLLGLARLGRAAAEARGEPPLRVAMAGLLGDDLLGEFYRAQMEAAGVHVASPPLAGGA  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGTV+VLT+PDAQRTM ++ GT++ +  +  L  AI+R+++LVVEGYL+ELP   +T+AK
Sbjct  121   TGTVVVLTSPDAQRTMCSHLGTAAEVAVDAALQAAIARSRLLVVEGYLWELPGAQRTVAK  180

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSN----  1325
             A   ARR G +VA+TA D   + RH    W  I    D++FTN+ EA A           
Sbjct  181   AIAAARRHGCVVAMTAGDAGVVRRHAAAMWAAIDAGVDLLFTNAGEAEALLLHEPRGEAC  240

Query  1326  -------------ESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP----SPCM  1454
                           + +  A  L     +V VTDG RGSY+   G+   VPP    +P  
Sbjct  241   QGGGAAAAAAGHCATGEQLALRLGPHCSVVVVTDGDRGSYMTALGQLHCVPPCWMDAP--  298

Query  1455  PLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAE  1628
             P+DTCGAGDAYA+G+LY  LR   DL  +G  AA+VA+ V+ + G  L  + A  LA 
Sbjct  299   PVDTCGAGDAYAAGLLYAYLRH-HDLVSMGRTAARVATAVISKHGATLTPEAADALAR  355



>gb|KDO49206.1| hypothetical protein CISIN_1g011689mg [Citrus sinensis]
Length=270

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
             S   SVL  RWDVLGLGQAMVDFSGMVDDDFLE+LGLEKGTRK+VNHEERG++LRAMDGC
Sbjct  113   SGSASVLPERWDVLGLGQAMVDFSGMVDDDFLERLGLEKGTRKLVNHEERGRVLRAMDGC  172

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
             SYKAAAGGSLSNSLVALARLGG+PIGGPAL++AM GSVGSDPLG FYR+KLRRANV F S
Sbjct  173   SYKAAAGGSLSNSLVALARLGGKPIGGPALNVAMTGSVGSDPLGGFYRAKLRRANVAFCS  232

Query  957   APVKDGTTGTVIVLTTPDAQRTMLAYQ  1037
              P+KDGTTGTVIVLTTPDAQR MLAYQ
Sbjct  233   EPIKDGTTGTVIVLTTPDAQRAMLAYQ  259



>ref|XP_005646173.1| Ribokinase-like protein, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE21629.1| Ribokinase-like protein, partial [Coccomyxa subellipsoidea C-169]
Length=325

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/325 (45%), Positives = 199/325 (61%), Gaps = 9/325 (3%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             WDV+GLGQAMVD S  VDDDF+ + GL+KG+R++++ EER K+L A+DG +Y+ +AGGSL
Sbjct  4     WDVVGLGQAMVDISAAVDDDFVARAGLDKGSRRIISVEERAKLLEALDGSAYQVSAGGSL  63

Query  807   SNSLVA---LARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             +N+LVA   L+R      GG    I M    G D  G F+ ++++ A +  LS P+   +
Sbjct  64    ANTLVAASHLSRADHCNRGGGLPRIGMLSVSGDDLQGSFHCAQMQHAGIRLLSEPLPGTS  123

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGTVIVLTTPDA RT L+Y G+S T+T       AI RT++L+VEGYL+E+    + I  
Sbjct  124   TGTVIVLTTPDANRTFLSYLGSSQTLTLSAAAEAAICRTRVLIVEGYLWEMLGAKEAIGA  183

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANY-ADIVFTNSDEARAFCHFRSNESP  1334
             A   AR  GALVA+T  D   + RH  +FW +++    D++F N  EA A        S 
Sbjct  184   AVRLARESGALVAMTTGDPGLVARHRGEFWRLLSGGDVDVLFANRAEASAL--LEHPVSA  241

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP--SPCMPLDTCGAGDAYASGILYG  1508
               AA  L     L ++TDGA GS I   G    VPP  +   P+DTCGAGDAY +G+LY 
Sbjct  242   AEAASELGSLCSLAAITDGANGSCISALGRLQVVPPYWTTDTPVDTCGAGDAYCAGLLYA  301

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQ  1583
              L G+ DL  +G  +A+VAS V+ +
Sbjct  302   YLSGL-DLASMGRCSARVASAVLSR  325



>ref|XP_004173245.1| PREDICTED: uncharacterized protein LOC101230396, partial [Cucumis 
sativus]
Length=260

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  576   VDEEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKI  755
             ++   D +  +S L  RWDVLGLGQAMVDFSGMVDD+FL+KLGLEKGTRKVVNHEERG++
Sbjct  107   IEHLHDINPSSSCLPDRWDVLGLGQAMVDFSGMVDDEFLKKLGLEKGTRKVVNHEERGRV  166

Query  756   LRAMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRR  935
             LRAMDG SYKAAAGGSLSNSLVALARLG +P+ GP  ++AM GS+GSDPLG FYRSKLRR
Sbjct  167   LRAMDGRSYKAAAGGSLSNSLVALARLGIRPMKGPTFNVAMTGSIGSDPLGSFYRSKLRR  226

Query  936   ANVNFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQ  1037
             ANV+FLS PVKDGTTGTVIVLTTPDAQRTMLAYQ
Sbjct  227   ANVHFLSPPVKDGTTGTVIVLTTPDAQRTMLAYQ  260



>gb|EAY79604.1| hypothetical protein OsI_34744 [Oryza sativa Indica Group]
Length=246

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             RWDVLGLGQAMVDFSGMVDD+FL +LG++KGTRKVVNHEERG++LRAMDGCSYKAAAGGS
Sbjct  100   RWDVLGLGQAMVDFSGMVDDEFLHRLGIQKGTRKVVNHEERGRVLRAMDGCSYKAAAGGS  159

Query  804   LSNSLVALARLG-GQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             LSNSLVAL+RLG  +    P L IAMAGSVGSDPLG FYR+KLRRAN++FLS PVKDGTT
Sbjct  160   LSNSLVALSRLGSSRSTNYPELRIAMAGSVGSDPLGSFYRAKLRRANLHFLSKPVKDGTT  219

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTIT  1058
             GTVIVLTTPDAQRTMLAYQG S  I+
Sbjct  220   GTVIVLTTPDAQRTMLAYQGLSVAIS  245



>ref|XP_009768566.1| PREDICTED: adenosine kinase-like [Nicotiana sylvestris]
Length=148

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1254  IANYADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVY  1433
             +ANYADIVF NS+EARAFCHF S ESP SA RYLSHFVPLVSVTDG +GSYIGVKGEA+Y
Sbjct  1     MANYADIVFANSEEARAFCHFSSKESPLSATRYLSHFVPLVSVTDGPKGSYIGVKGEAIY  60

Query  1434  VPPSPCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDA  1613
             +PPSPC+P+DTCGAGDAYASGILYGILRGVSDL+ +G++AAKVASVVVGQQGTRLRVQDA
Sbjct  61    IPPSPCVPVDTCGAGDAYASGILYGILRGVSDLRTMGSVAAKVASVVVGQQGTRLRVQDA  120

Query  1614  SELAEMFEHQLNNSSIWSDIASDQISSL  1697
               LAE F     +S+ WSDI SDQISSL
Sbjct  121   IGLAESFSSHCRDSTFWSDIGSDQISSL  148



>ref|XP_002946747.1| hypothetical protein VOLCADRAFT_103178 [Volvox carteri f. nagariensis]
 gb|EFJ51973.1| hypothetical protein VOLCADRAFT_103178 [Volvox carteri f. nagariensis]
Length=493

 Score =   223 bits (569),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/396 (36%), Positives = 212/396 (54%), Gaps = 61/396 (15%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMD--GCSYKAAAGGS  803
             D+LGLGQA+VD S  V DD L +  + KG R+V+  +ER  I+  +D  G   + +AGGS
Sbjct  80    DILGLGQAIVDLSSSVSDDVLFQFNVPKGGRRVITVDERASIMETLDDVGAPSQVSAGGS  139

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFL----------  953
             L+N+LV +A+L         + + + GS+G+D LG+F+ S+++RA V  L          
Sbjct  140   LANTLVGIAKL--SRAAAKDVRVLLGGSLGTDTLGQFFNSQMKRAGVRCLLETQQHHYHH  197

Query  954   -----------------------------SAPVKDGTTGTVIVLTTPDAQRTMLAYQGTS  1046
                                          +    +G TGTV+VLTTPDAQR+ L++  TS
Sbjct  198   HHHPHSPYREDPEELRHQHQQDSEAAAAPAIASSNGHTGTVMVLTTPDAQRSFLSFF-TS  256

Query  1047  STITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACEDARRFGALVAITASDVSCIE  1226
              ++     +  A+  ++++VVEGYL+E+P   + I +  + A   GA VA+TA D   + 
Sbjct  257   ESLVLSERIRTAVRASRMVVVEGYLWEMPGAEEYIRQVQDLAHAAGAQVAMTAGDPGVVS  316

Query  1227  RHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS-------------AARYLSHFV  1367
             RH +    ++++  D++FTN DEA A    ++ +   S              A  L+   
Sbjct  317   RHREAMLRVLSHGVDLLFTNEDEASALVGLQAEQGSGSSSSEEAVVSNGARVAAALAELC  376

Query  1368  PLVSVTDGARGSYIGVKGEAVYVPPS--PCMPLDTCGAGDAYASGILYGILRGVSDLKDV  1541
             P+V VT G++GSYIG  GE   VPP   P  P+DTCGAGDAYA+G LY +L G  D++  
Sbjct  377   PMVVVTAGSKGSYIGAMGEIHAVPPYWLPQGPVDTCGAGDAYAAGWLYALLTGY-DIRTA  435

Query  1542  GTLAAKVASVVVGQQGTRLRVQDASELA-EMFEHQL  1646
             G  A++VAS V+GQ G  L   DA  L  E+ EH L
Sbjct  436   GEFASRVASAVIGQYGPHLSDDDAELLVRELPEHHL  471



>ref|WP_020770930.1| carbohydrate kinase, PfkB family [Leptospira sp. B5-022]
 gb|EMJ97952.1| carbohydrate kinase, PfkB family [Leptospira sp. B5-022]
Length=331

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 187/329 (57%), Gaps = 13/329 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D FL+K+G  KG   +V+ E +G +L A+DG   +  +GGS
Sbjct  3     HYDVFGIGNALVDILIPTEDSFLQKMGWNKGIMTLVDAEVQGGVLTALDGHKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  + +A + F   P K+G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVTEDTYGEFYKQDMEKAGILFEVPPSKEGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML + G SST+T E      +  +    VEGYL++ P T +    A 
Sbjct  115   TCVILTTPDAERTMLTHLGISSTLTKEDLDLERLKASSYSYVEGYLWDRPSTKEACLLAM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF ++   Y D++F N++EA+A     + ES + A
Sbjct  175   EESKKAGVKVAFTFSDPFCVNRSREDFLKLTKEYCDLIFCNAEEAKALA---ATESKEDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILRG  1520
              +++S     V +TD A G+++ V G   +V   P    LDT GAGD +A+G+LYG+  G
Sbjct  232   LKFISSLCKNVMMTDSANGAFVSVNGTISHVGGFPAQNLLDTTGAGDCFAAGVLYGLTHG  291

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
              S L++       VAS +V + G RL V+
Sbjct  292   FS-LENAARWGNYVASRIVQEIGPRLSVR  319



>ref|WP_008590648.1| ribokinase [Leptospira licerasiae]
 gb|EIE00728.1| carbohydrate kinase, PfkB family [Leptospira licerasiae serovar 
Varillal str. VAR 010]
 gb|EJZ43028.1| carbohydrate kinase, PfkB family [Leptospira licerasiae str. 
MMD4847]
Length=334

 Score =   214 bits (544),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/329 (37%), Positives = 186/329 (57%), Gaps = 13/329 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D FL+K+G  KG   +V+ E +G +L ++DG   +  +GGS
Sbjct  3     HYDVFGIGNALVDILIPTEDSFLQKMGWNKGIMTLVDAEVQGGVLTSLDGHKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  + +A + F   P KDG TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSEDTYGEFYKQDMEKAGILFEVPPSKDGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML + G SST+T +      +  +    VEGYL++ P T +    A 
Sbjct  115   TCVILTTPDAERTMLTHLGISSTLTKQDLDLDKLKASSYSYVEGYLWDGPSTKEACLLAM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF ++   Y D++F N++EA+A     + ES + A
Sbjct  175   EESKKAGVKVAFTFSDPFCVNRSREDFLKLTKEYCDLIFCNAEEAKALA---ATESKEDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILRG  1520
              +++S     V +TD A G+++ V G   +V   P    LDT GAGD +A+G+LYG+  G
Sbjct  232   LKFISSLCKNVMMTDSANGAFVSVDGTISHVGGFPAQNLLDTTGAGDCFAAGVLYGLTHG  291

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
              S  ++       VAS +V + G RL V+
Sbjct  292   FSQ-ENAARWGNYVASRIVQEIGPRLSVR  319



>ref|WP_017719427.1| ribokinase [Oscillatoria sp. PCC 10802]
Length=339

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 129/336 (38%), Positives = 181/336 (54%), Gaps = 14/336 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A+VD    V DDF+ +  L +G+  +++ E++G +L  ++    +  +GGS +
Sbjct  12    DVFGVGNALVDILAFVGDDFVREHALNRGSMTLMDAEKQGGLLVNLEHTPVQLRSGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF--LSAPVKDGTTG  983
             N+++ALA+ GG            +G V  D  GEFYR  + +A ++F    AP   G TG
Sbjct  72    NTMIALAQSGGNGF--------YSGKVARDTNGEFYRQDMLQAGIHFDVHPAPETGGPTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTM  + G S+T+         +SR K   VEGYL++ PD  K   +  
Sbjct  124   TCLVLTTPDAERTMCTHLGVSTTLAATDIDTDRLSRCKYSYVEGYLWDAPDPRKACIETM  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E +RR G  V+ T SD   ++R   DF   ++ Y D+VF N+DE R FC     ES    
Sbjct  184   EQSRRNGVKVSFTFSDSFLVDRFAGDFHGAVSEYCDVVFCNADEVRRFCQ---EESLQEC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             AR L   V L  +T GARG  +    +   VP  P  PLDT GAGDA+A G+LYG+  G+
Sbjct  241   ARKLGEIVDLAFITAGARGCLVVENKQISEVPGFPVQPLDTVGAGDAFAGGVLYGLTHGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
             S  K        +AS VVG  G RL    A  L E+
Sbjct  301   S-AKQAARWGNFLASRVVGVHGPRLEESCAHRLEEV  335



>ref|XP_001691836.1| PfkB-type carbohydrate kinase [Chlamydomonas reinhardtii]
 gb|EDP04326.1| PfkB-type carbohydrate kinase [Chlamydomonas reinhardtii]
Length=345

 Score =   212 bits (539),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 194/350 (55%), Gaps = 24/350 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMD--GCSYKAAAGGS  803
             D+LGLGQA+VD+S  VD   L    +  G R+V+  EER  ++  +D  G   + +AGGS
Sbjct  1     DILGLGQAIVDWSASVDFSLLSTFNVPLGGRRVITVEERASVMETLDEIGAPSQVSAGGS  60

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
             L+N+LV +ARL      G  L +A+ GS+G+D LG+++ S+LR A       P  +G TG
Sbjct  61    LANTLVGVARLA--RAAGKDLRVALGGSLGTDTLGQYFNSQLRSAGQQ-QQHPSPEGHTG  117

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             TV+VLTTPDAQR+ L++  TS  +     L  A+   +++V+EGYL+E+      +A+  
Sbjct  118   TVMVLTTPDAQRSFLSFF-TSDRLALSERLRSAVRGCRLVVMEGYLWEMEGAEAYMAEVI  176

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRS----NES  1331
               A   GA VA+TA D   + RH ++    IA   D+VFTN DEA              S
Sbjct  177   RIAHAAGAQVAMTAGDPGVVARHREEMLRTIARGVDMVFTNEDEAANLAGLPGPAALASS  236

Query  1332  PDSAARY-----------LSHFVPLVSVTDGARGSYIGVKGEAVYVPPS--PCMPLDTCG  1472
             P ++              L+   P+  VT G++GSY+   GE   VPP   P  P+DTCG
Sbjct  237   PTASEEELEEAGERAALALAELCPVAVVTAGSKGSYVCAMGEIHAVPPYWLPQGPVDTCG  296

Query  1473  AGDAYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             AGDAY +G  Y ++ G  D +  G  A++VAS V+G+ G  L  +DA +L
Sbjct  297   AGDAYMAGFTYAMMAGY-DARTAGEFASRVASAVIGRYGPHLSDEDAEDL  345



>ref|WP_037220024.1| ribokinase [Richelia intracellularis]
 emb|CDN13241.1| Fructokinase [Richelia intracellularis]
Length=336

 Score =   211 bits (538),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 186/336 (55%), Gaps = 14/336 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G AMVD   +V+DDF+ +  L +G   +++ E++G++L+ +   S + ++GGS +
Sbjct  10    DVFGVGNAMVDILALVEDDFVREHDLNRGGMTLMDSEKQGRLLQELKHHSLELSSGGSAA  69

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD--GTTG  983
             N+++A+A+ GG+           +G V  D  GEFYR  L  A ++F   P  +  GTTG
Sbjct  70    NTMIAIAQSGGKGF--------YSGKVSRDTNGEFYRQDLLEAGIHFDVHPTDENHGTTG  121

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTM  + G S+T+         +++ K   VEGYL++ PD  K   +  
Sbjct  122   TCLVLTTPDAERTMCTHLGVSTTLAPTDIDVEKLAQCKYSYVEGYLWDAPDPKKASIQTM  181

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E ++R    +A T SD+  + R  DDF E++  Y D+VF N+DEAR FC     ES +  
Sbjct  182   EQSKRHDVKIAFTFSDLFLVSRFSDDFHELVTKYCDVVFCNADEARHFCQ---TESLEDC  238

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             A  +   V    +TDGA G  +    E V +P  P   +DT GAGD +A G LYG+  G+
Sbjct  239   ASKIGSMVDTAFITDGADGCLVVQDKEIVRIPGFPAKAVDTVGAGDYFAGGTLYGLTNGL  298

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
              +++        +AS +V   G RL    A ++ E+
Sbjct  299   -NVQQSARWGNYMASCIVQVHGARLDKSMADQIGEI  333



>ref|WP_010411497.1| ribokinase [Leptospira inadai]
 gb|EQA37492.1| carbohydrate kinase, PfkB family [Leptospira inadai serovar Lyme 
str. 10]
Length=332

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 184/329 (56%), Gaps = 13/329 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD   + DD FL+ LG  KG   +V+   +GK+L A+DG   +  +GGS
Sbjct  3     HYDVFGIGNALVDILVLTDDPFLKDLGWTKGIMTLVDSLTQGKVLTALDGHKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   PV +G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSEDTYGEFYKQDMENAGILFEVPPVTNGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML + G SST+T +      +  +    +EGYL+++P T +      
Sbjct  115   TCVILTTPDAERTMLTHLGISSTLTKQDIDLTRLKASSYSYLEGYLWDVPSTKEACILTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF ++   Y D+VF N DE +A      +ES + A
Sbjct  175   EESKKAGVKVAFTYSDPFCVNRSREDFIKLTKEYCDVVFCNVDEVKALA---GSESKEEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILRG  1520
              ++++   P V +TD + G+++  +G   +V   P    LDT GAGD++A+G LYG+  G
Sbjct  232   LKFVASLCPTVFMTDSSNGAFVSEQGSIRHVGGFPAQNLLDTTGAGDSFAAGALYGLTHG  291

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
              S L+        VAS +V + G RL V+
Sbjct  292   FS-LERSTKWGNYVASRIVQEIGPRLTVR  319



>ref|WP_016549272.1| carbohydrate kinase, PfkB family [Leptospira fainei]
 gb|EPG74711.1| carbohydrate kinase, PfkB family [Leptospira fainei serovar Hurstbridge 
str. BUT 6]
Length=331

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 182/329 (55%), Gaps = 13/329 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD   + DD FL+ LG  KG   +V+   +GK+L A++G      +GGS
Sbjct  3     HYDVFGVGNALVDILVLTDDPFLKNLGWTKGIMTLVDSPTQGKVLTALEGHKKDLRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG  I          G V  D  GEFY+  +  A + F   PV DG TG
Sbjct  63    AANTMIALANSGGTGI--------YTGKVSEDTYGEFYKQDMENAGILFEVPPVTDGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML   G SST+T +      +  +    +EGYL+++P T +      
Sbjct  115   TCVILTTPDAERTMLTNLGISSTLTKQDIDLARLKTSSYSYLEGYLWDVPSTKEACVLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++R+ G  VA T SD  C+ R  +DF ++   Y D+VF N +EA+A       ES + A
Sbjct  175   EESRKAGVKVAFTYSDPFCVNRSREDFVKLTKEYCDVVFCNVEEAKALAGL---ESKEEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILRG  1520
              ++++     V +TD A G+++   G+  +V   P    LDT GAGD++A+G LYG+  G
Sbjct  232   LKFVASLCSTVFMTDSANGAFVSENGKIRHVGGFPAQNLLDTTGAGDSFAAGALYGLTHG  291

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
              S L+        VAS +V + G RL V+
Sbjct  292   FS-LERATKWGNYVASRIVQEIGPRLTVR  319



>ref|WP_004500259.1| MULTISPECIES: carbohydrate kinase, PfkB family [Leptospira]
 gb|EKR63116.1| carbohydrate kinase, PfkB family [Leptospira weilii str. 2006001853]
 gb|EMJ67561.1| carbohydrate kinase, PfkB family [Leptospira sp. P2653]
 gb|EMN43529.1| carbohydrate kinase, PfkB family [Leptospira weilii str. LNT 
1234]
Length=328

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 181/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  + RA + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMERAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDVDLDRLKSSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGVVAHVDGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSARWGNYVASRIVQEIGPRLGIK  318



>gb|AFW87768.1| hypothetical protein ZEAMMB73_369666 [Zea mays]
Length=174

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  825   LARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTT  1004
             LA    Q  G P L IA+AGSVGSDPLG FYR+KLRRANV+FLS PVKDG TGTVIVLTT
Sbjct  34    LALGSSQSAGCPELKIALAGSVGSDPLGSFYRAKLRRANVHFLSKPVKDGATGTVIVLTT  93

Query  1005  PDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACEDARRFG  1184
             PDAQR+MLAYQGTSST++Y+  LA ++S++ +++VEGYLFELP TI+ I +ACEDA + G
Sbjct  94    PDAQRSMLAYQGTSSTLSYDSDLASSVSKSNVVIVEGYLFELPHTIEAIKQACEDAHQNG  153

Query  1185  ALVAITASDVSCIERHYDDF  1244
             ALVA+TASDVSCIE  Y+DF
Sbjct  154   ALVAVTASDVSCIEHCYNDF  173



>ref|WP_002628400.1| carbohydrate kinase, PfkB family [Leptospira weilii]
 gb|EMY13121.1| carbohydrate kinase, PfkB family [Leptospira weilii str. Ecochallenge]
Length=328

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 181/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  + RA + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMERAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDVDLDRLKSSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTEDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGVVAHVDGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004503959.1| carbohydrate kinase, PfkB family [Leptospira weilii]
 gb|EMN88940.1| carbohydrate kinase, PfkB family [Leptospira weilii str. UI 13098]
Length=328

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 181/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  + RA + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMERAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDVDLDRLKSSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFVENGVVAHVDGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSARWGNYVASRIVQEIGPRLGIK  318



>ref|WP_015179322.1| Adenosine kinase [Oscillatoria nigro-viridis]
 ref|YP_007118537.1| Adenosine kinase [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ10121.1| Adenosine kinase [Oscillatoria nigro-viridis PCC 7112]
Length=363

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 194/355 (55%), Gaps = 22/355 (6%)
 Frame = +3

Query  588   EDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAM  767
             E+N +  +  S   DV G+G A+VD   +V+D+F+   GL +G   ++N E +G IL  +
Sbjct  23    ENNQAKNNQDSRSVDVFGVGNALVDILALVEDEFVLGHGLNRGGMTLMNSERQGGILHDL  82

Query  768   DGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVN  947
             +  S +  +GGS +N+++ LA+ GG+           +G V  D  GEFYR  L  A ++
Sbjct  83    EHNSLQMRSGGSAANTMIGLAQSGGKAY--------YSGKVAKDTNGEFYRQDLLAAGID  134

Query  948   FLSAPV--KDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             F   P    +G TGT +VLTTPDA+RTM    G S+T+         ++  K   VEGYL
Sbjct  135   FNVHPAAESNGPTGTCVVLTTPDAERTMCTNLGVSTTLAATDIDVDRLAHCKYSYVEGYL  194

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             ++ PD  K   +  E ++R G  VA T SD   ++R  DDF ++++ Y D++F NSDE R
Sbjct  195   WDAPDPRKASIETMEQSKRLGVKVAFTFSDGFLVDRFADDFHKVVSEYCDVIFCNSDEVR  254

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             +F  F+  ES +  AR +S    L  +T+G +G  +    + V V   P   +DT GAGD
Sbjct  255   SF--FKE-ESLEECARKMSEISDLAFITNGEKGCMVVENKQIVDVAGFPVKAIDTVGAGD  311

Query  1482  AYASGILYGILRGVSDLKDVGTLAAK----VASVVVGQQGTRLRVQDASELAEMF  1634
             A+A G+L+GI  G+S      T AA+    +AS+VV   G RL    A  L+E+ 
Sbjct  312   AFAGGVLFGITNGLSS-----TQAARWGNFLASLVVQIHGPRLEGSQAHLLSEVI  361



>ref|WP_000683570.1| ribokinase [Leptospira interrogans]
 gb|EMJ52540.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Valbuzzi str. Duyster]
 gb|ENO74025.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Valbuzzi str. Valbuzzi]
Length=328

 Score =   206 bits (524),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 180/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     ++ F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTENVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S F  LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI  G 
Sbjct  232   LKFISGFSALVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGITHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        +AS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYIASRIVQEVGPRLGIK  318



>ref|WP_020774432.1| carbohydrate kinase, PfkB family [Leptospira alstonii]
 gb|EMJ92801.1| carbohydrate kinase, PfkB family [Leptospira alstonii serovar 
Sichuan str. 79601]
 gb|EQA79002.1| carbohydrate kinase, PfkB family [Leptospira alstonii serovar 
Pingchang str. 80-412]
Length=328

 Score =   206 bits (523),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D  +++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVLIKRLGFEKGIMTLVDAEKQGEVLTALEGRKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKQDMENAGILFEVAPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++ P T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLERLKTSSISYIEGYLWDGPGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   + DIVF N +EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKEFFDIVFCNVEEAKALSQ---KEDKMEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G++    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAFFAENGNVSHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S  K  G     VAS +V + G RL ++
Sbjct  292   SLEKSAG-WGNYVASRIVQEIGPRLGIK  318



>ref|WP_004495408.1| ribokinase [Leptospira weilii]
 gb|EMM74173.1| carbohydrate kinase, PfkB family [Leptospira weilii str. 2006001855]
Length=328

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 180/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  + RA + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMERAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDVDLDRLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++    LV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSSLVFMTDSANGAYFAENGVVAHVDGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSARWGNYVASRIVQEIGPRLGIK  318



>ref|WP_002751661.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii]
 gb|EMO64068.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Pomona str. 200901868]
Length=328

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 181/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGGKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P  +G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFDVVPEDNGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLDKLKSSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E+++R G  VA T SD  C+ R  +DF  I  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKRNGVKVAYTYSDPFCVNRSREDFVRITKDYFDIVFCNAEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++++  PLV +TD A G+Y    G   +V   P   +DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIANLSPLVFMTDSANGAYFAENGVVAHVGGFPTKAIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004504818.1| carbohydrate kinase, PfkB family [Leptospira weilii]
 gb|EMF83829.1| carbohydrate kinase, PfkB family [Leptospira weilii serovar Topaz 
str. LT2116]
Length=328

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 180/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGNKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMESAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDVDLDRLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGVVAHVGGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSARWGNYVASRIVQEIGPRLGIK  318



>ref|WP_002764112.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii]
 gb|EKR99088.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
200901122]
Length=328

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 181/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+  ++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSGKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG          A  G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------AYTGKVSKDTYGEFYKKDMENAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + +  +EGYL++   T +    A 
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLDKLKSSSVSYIEGYLWDGQGTKEASLLAM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGVVAHVGGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_003000981.1| carbohydrate kinase, PfkB family [Leptospira weilii]
 gb|EMY78051.1| carbohydrate kinase, PfkB family [Leptospira weilii serovar Ranarum 
str. ICFT]
Length=328

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 180/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D  +++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDGLIKRLGFEKGIMTLVDAEKQGEVLTALEGRKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  + + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKQDMENSGILFEVAPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++ P T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLPKLKASGISYIEGYLWDGPGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  ++ DIVF N +EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDFFDIVFCNVEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAALSPLVFMTDSANGAYFAENGNVSHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        +AS +V + G RL ++
Sbjct  292   S-LEKSARWGNYIASRIVQEIGPRLGIK  318



>ref|WP_010578622.1| ribokinase [Leptospira alexanderi]
 gb|EQA63276.1| carbohydrate kinase, PfkB family [Leptospira alexanderi serovar 
Manhao 3 str. L 60]
Length=328

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMESAGIFFEVAPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDVDLDKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+    
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGVVTHVGGFPTKPIDTTGAGDCFAAGVLYGLTHSF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL + 
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIN  318



>ref|WP_010570354.1| ribokinase [Leptospira broomii]
 gb|EQA45281.1| carbohydrate kinase, PfkB family [Leptospira broomii serovar 
Hurstbridge str. 5399]
Length=331

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 184/329 (56%), Gaps = 13/329 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD   + DD FL+ LG  KG   +V+ + +GK+L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVLTDDPFLKDLGWTKGIMTLVDSQTQGKVLTALEGHKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   PV +G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKQDMENAGILFEVPPVTNGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML + G SST+T +      +  +    +EGYL+++P T +      
Sbjct  115   TCVILTTPDAERTMLTHLGISSTLTKQDIDLTRLKASSYSYLEGYLWDVPSTKEACILTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++R+ G  VA T SD  C+ R  +DF ++   Y D+VF N +EA+A      +ES + A
Sbjct  175   EESRKAGVKVAFTYSDPFCVNRSREDFIKLTKEYCDVVFCNVEEAKALA---GSESKEEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILRG  1520
              ++++     V +TD + G+++   G   +V   P    LDT GAGD++A+G L+G+  G
Sbjct  232   LKFVASLCSTVFMTDSSNGAFVSEDGVIRHVGGFPAQNLLDTTGAGDSFAAGSLFGLTHG  291

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
              S L+        VAS +V + G RL V+
Sbjct  292   FS-LERATKWGNYVASRIVQEIGPRLNVR  319



>ref|WP_008396489.1| MULTISPECIES: carbohydrate kinase, PfkB family [Leptospira]
 gb|EKO78520.1| carbohydrate kinase, PfkB family [Leptospira sp. Fiocruz LV3954]
 gb|EMI64338.1| carbohydrate kinase, PfkB family [Leptospira sp. Fiocruz LV4135]
Length=328

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 180/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLTELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +T     
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKVSGISYIEGYLWDGQGTKETSLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_016753536.1| ribokinase [Leptospira kirschneri]
Length=328

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSNISYIEGYLWDDQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004753706.1| ribokinase [Leptospira kirschneri]
 gb|EJO68694.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Grippotyphosa str. RM52]
 gb|EKO50705.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
200802841]
 gb|EKQ82480.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Grippotyphosa str. Moskva]
 gb|EKR07432.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Valbuzzi str. 200702274]
 gb|EMK03543.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
MMD1493]
 gb|EMK15573.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Bim str. PUO 1247]
 gb|EMN03395.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Bim str. 1051]
 gb|EMN26111.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Sokoine str. RM1]
 gb|EMO67418.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
200803703]
 gb|EMO82693.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
200801774]
 gb|EPG51332.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Cynopteri str. 3522 CT]
 gb|KGR65986.1| Carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Mozdok]
Length=328

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_000683571.1| ribokinase [Leptospira interrogans]
 gb|EYU62588.1| ribokinase [Leptospira interrogans serovar Manilae]
Length=328

 Score =   204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     ++ F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTENVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI  G 
Sbjct  232   LKFISGLSALVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGITHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_000683574.1| ribokinase [Leptospira interrogans]
 ref|NP_711573.1| ribokinase [Leptospira interrogans serovar Lai str. 56601]
 ref|YP_002278.1| ribokinase [Leptospira interrogans serovar Copenhageni str. Fiocruz 
L1-130]
 ref|YP_005987899.1| ribokinase [Leptospira interrogans serovar Lai str. IPAV]
 gb|AAN48591.1|AE011318_9 ribokinase [Leptospira interrogans serovar Lai str. 56601]
 gb|AAS70915.1| ribokinase [Leptospira interrogans serovar Copenhageni str. Fiocruz 
L1-130]
 gb|AER01916.1| ribokinase [Leptospira interrogans serovar Lai str. IPAV]
 gb|EJO78230.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pomona str. Kennewicki LC82-25]
 gb|EJP05192.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Bulgarica str. Mallika]
 gb|EKN86617.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2002000624]
 gb|EKN96921.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pomona str. Pomona]
 gb|EKO71802.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Canicola str. Fiocruz LV133]
 gb|EKO95475.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
Brem 329]
 gb|EKP22371.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Icterohaemorrhagiae str. Verdun LP]
 gb|EKP74868.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
HAI1594]
 gb|EKQ40119.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2002000621]
 gb|EKQ48064.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2002000623]
 gb|EKR26438.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Bataviae str. L1111]
 gb|EKR34643.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Hebdomadis str. R499]
 gb|EKR56108.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
UI 12758]
 gb|EKR81069.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
UI 08452]
 gb|EMF32212.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pomona str. Fox 32256]
 gb|EMF42650.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Lora str. TE 1992]
 gb|EMG23955.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Copenhageni str. LT2050]
 gb|EMI71533.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pomona str. CSL10083]
 gb|EMJ38798.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
FPW1039]
 gb|EMJ64244.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pomona str. CSL4002]
 gb|EMJ73470.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2003000735]
 gb|EMJ75651.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2002000632]
 gb|EMJ85275.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2002000631]
 gb|EMK21820.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
Kito]
 gb|EMM84619.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2006001854]
 gb|EMM97421.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Zanoni str. LT2156]
 gb|EMN10034.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Muenchen str. Brem 129]
 gb|EMN37315.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Medanensis str. L0448]
 gb|EMN37912.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
L0996]
 gb|EMN50600.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
L1207]
 gb|EMN54478.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Autumnalis str. LP101]
 gb|EMN72107.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Bataviae str. UI 08561]
 gb|EMN76716.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
UI 09600]
 gb|EMN93976.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Medanensis str. UT053]
 gb|EMO01304.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pomona str. UT364]
 gb|EMO03432.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Icterohaemorrhagiae str. Verdun HP]
 gb|EMO16943.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Copenhageni str. HAI0188]
 gb|EMO38448.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
MMD3731]
 gb|EMY06163.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
2002000626]
 gb|EMY24432.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Australis str. 200703203]
 gb|EMY53435.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Copenhageni str. M20]
 gb|KGE25533.1| ribokinase [Leptospira interrogans serovar Lai]
Length=328

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     ++ F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTENVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI  G 
Sbjct  232   LKFISGLSALVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGITHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_002725176.1| MULTISPECIES: ribokinase [Leptospira]
 ref|YP_798562.1| sugar kinase [Leptospira borgpetersenii serovar Hardjo-bovis 
str. L550]
 ref|YP_801469.1| sugar kinase [Leptospira borgpetersenii serovar Hardjo-bovis 
str. JB197]
 gb|ABJ79629.1| Sugar kinase [Leptospira borgpetersenii serovar Hardjo-bovis 
str. L550]
 gb|ABJ76711.1| Sugar kinase [Leptospira borgpetersenii serovar Hardjo-bovis 
str. JB197]
 gb|EKP13766.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
200801926]
 gb|EKQ90431.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
UI 09149]
 gb|EKR01442.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Castellonis str. 200801910]
 gb|EMG02229.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
200701203]
 gb|EMJ78378.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Hardjo-bovis str. Sponselee]
 gb|EMK08633.1| carbohydrate kinase, PfkB family [Leptospira sp. serovar Kenya 
str. Sh9]
 gb|EMN13377.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
Brem 307]
 gb|EMN15656.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
Brem 328]
 gb|EMN57034.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Javanica str. MK146]
 gb|EMO10574.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii str. 
Noumea 25]
 gb|ENO65576.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Mini str. 201000851]
 gb|EPG56707.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Javanica str. UI 09931]
 gb|KGE22976.1| ribokinase [Leptospira borgpetersenii serovar Ballum]
Length=328

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 181/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQGEVLTALEGGKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P  +G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFDVVPEDNGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLDKLKSSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E+++R G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKRNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++++  PLV +TD A G+Y    G   +V   P   +DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIANLSPLVFMTDSANGAYFAENGVVAHVGGFPTKAIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004778749.1| carbohydrate kinase, PfkB family [Leptospira kirschneri]
 gb|EKO62181.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
H2]
Length=328

 Score =   204 bits (518),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLIALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG          A  G V  D  GEFY+  +  A + F + P     TG
Sbjct  63    AANTMIALANSGGTG--------AYTGKVSKDTYGEFYKKDMENAGIFFEATPEDKDHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_015118416.1| sugar kinase [Rivularia sp. PCC 7116]
 ref|YP_007055388.1| sugar kinase [Rivularia sp. PCC 7116]
 gb|AFY54841.1| sugar kinase, ribokinase [Rivularia sp. PCC 7116]
Length=338

 Score =   204 bits (518),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 185/336 (55%), Gaps = 14/336 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G AMVD   MV+DDF++K  L KG   +++ E++G +LR +   S + ++GGS +
Sbjct  12    DVFGVGNAMVDILAMVEDDFVKKNDLSKGGMTLMDSEKQGHLLRELKHHSLELSSGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD--GTTG  983
             N+++A+A+ GG+           +G V  D  GEFYR  L  A + F   P ++  G+TG
Sbjct  72    NTMIAIAQSGGKGF--------YSGKVSRDTNGEFYREDLIEAGIGFDVHPTEENHGSTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTM  + G S+ +         +++ K   VEGYL++ PD  K   +  
Sbjct  124   TCLVLTTPDAERTMCTHLGVSTNLATTDIDVDKLAQCKYSYVEGYLWDAPDPKKASIETM  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E ++R    VA T SD+  + R  DDF ++++ Y D+VF N+DE R   +F  +ES +  
Sbjct  184   EQSKRHDVKVAFTFSDLFLVSRFNDDFHKLVSEYCDVVFCNADEVR---NFFGSESLEDC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             A  L   V    VTD A G  +      V VP      +DT GAGD++A G+LYG+  G+
Sbjct  241   ASKLGEIVDTAFVTDSANGCLVVENKNVVRVPGFQVKAIDTVGAGDSFAGGVLYGLTNGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
              + +        +AS +V   G RL    A +++E+
Sbjct  301   -NAQQSARWGNYMASCIVEVHGARLDKSMADKVSEI  335



>ref|WP_002745525.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii]
 gb|EMO51299.1| carbohydrate kinase, PfkB family [Leptospira borgpetersenii serovar 
Mini str. 200901116]
Length=328

 Score =   204 bits (518),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 180/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+  ++G++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSGKQGEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG          A  G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------AYTGKVSKDTYGEFYKKDMENAGILFEVVPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + +  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLDKLKSSSVSYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGVVAHVGGFPTKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004457203.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EMS82235.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. Hook]
Length=328

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISGLTALVFMTDSANGAYFAENGKISHVDGFPIKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_000683572.1| ribokinase [Leptospira interrogans]
 gb|EJP16853.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
FPW2026]
 gb|EKO07504.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
C10069]
 gb|EKO25885.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
UI 12621]
 gb|EKO89769.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. Andaman]
 gb|EKP84237.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. 2006006986]
 gb|EKR18300.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pyrogenes str. 2006006960]
 gb|EKR45180.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. UI 08368]
 gb|EMF71634.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Canicola str. LT1962]
 gb|EMG10590.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. LT2186]
 gb|EMJ47390.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
UT126]
 gb|EMM90398.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Djasiman str. LT1649]
 gb|EMN32916.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pyrogenes str. L0374]
 gb|EMN61935.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pyrogenes str. R168]
 gb|EMN65177.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. UI 08434]
 gb|EMN79502.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. UI 12764]
 gb|EMN87758.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Grippotyphosa str. UI 12769]
 gb|EMO91930.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
UI 13372]
 gb|EMP07622.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Pyrogenes str. 200701872]
Length=328

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     ++ F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTENVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI  G 
Sbjct  232   LKFISGLSALVFMTDSANGAYFAEDGKISHVDGFPVKPIDTTGAGDCFAAGVLYGITHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004767076.1| carbohydrate kinase, PfkB family [Leptospira kirschneri]
 gb|EKO13526.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
H1]
Length=328

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLIALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG          A  G V  D  GEFY+  +  A + F + P     TG
Sbjct  63    AANTMIALANSGGTG--------AYTGKVSKDTYGEFYKKDIENAGIFFEATPEDKDHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004452232.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EMS88346.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. Cascata]
Length=328

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVTPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISGLTALVFMTDSANGAYFAENGKISHVEGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_000683575.1| ribokinase [Leptospira interrogans]
Length=328

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 118/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     ++ F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTENVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGYTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI  G 
Sbjct  232   LKFISGLSALVFMTDSANGAYFAEDGKISHVDGFPVKPIDTTGAGDCFAAGVLYGITHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004450102.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EMI66978.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. Bonito]
Length=328

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 180/330 (55%), Gaps = 13/330 (4%)
 Frame = +3

Query  621   MR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             MR +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L A++G   +  +G
Sbjct  1     MRHYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLTALEGSKKELRSG  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G 
Sbjct  61    GSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDQGH  112

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +    
Sbjct  113   TGTCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLL  172

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
               E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E   
Sbjct  173   TMEESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKL  229

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  
Sbjct  230   EALKFISGLTALVFMTDSANGAYFAENGKISHVDGFPIKPIDTTGAGDCFAAGVLYGLTH  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             G S L+        VAS +V + G RL ++
Sbjct  290   GFS-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004438610.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EMO40849.1| carbohydrate kinase, PfkB family [Leptospira noguchii serovar 
Autumnalis str. ZUN142]
Length=328

 Score =   203 bits (516),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 180/330 (55%), Gaps = 13/330 (4%)
 Frame = +3

Query  621   MR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             MR +DV G+G A+VD     +D F+++LG EKG   +V  E++  +L A++G   +  +G
Sbjct  1     MRHYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVESEKQAGVLTALEGSKKELRSG  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS +N+++ALA  GG             G V  D  GEFY+  + +A + F   P   G 
Sbjct  61    GSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMEKAGIFFEVTPEDQGH  112

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +    
Sbjct  113   TGTCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLL  172

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
               E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E   
Sbjct  173   TMEESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKL  229

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  
Sbjct  230   EALKFISGLTSLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGLTH  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             G  +L+        VAS +V + G RL ++
Sbjct  290   GF-NLEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_016544786.1| carbohydrate kinase, PfkB family [Leptospira wolffii]
 gb|EPG67081.1| carbohydrate kinase, PfkB family [Leptospira wolffii Serovar 
Khorat Str. Khorat-H2]
Length=331

 Score =   203 bits (516),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/329 (34%), Positives = 184/329 (56%), Gaps = 13/329 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD   + ++  L+KLG  KG   +V+ E +GK+L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILALTEESILKKLGWSKGVMTLVDAETQGKVLTELEGIKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++++A  GG             G V  D  GEFY+  + +A + F   P  +G TG
Sbjct  63    AANTMISIANSGGTG--------CYTGKVSEDAYGEFYKQDMEKAGIVFEVKPSNEGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML + G SST+T        +  +    +EGYL++ P T +      
Sbjct  115   TCVILTTPDAERTMLTHLGISSTLTKNDLDLDRLKVSGYSYLEGYLWDGPSTKEACLVTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  V++T SD  C+ R  +DF  +  +Y D+VF N++EA+A       ES + A
Sbjct  175   EESKKAGVKVSMTYSDPFCVNRSREDFIRLTKDYCDLVFCNAEEAKALAE---TESKEEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILRG  1520
              ++++     V +TD A G+++  KG   +V   P    LDT GAGD++A+G+LYG+  G
Sbjct  232   LKFIAGLCDTVMMTDSANGAFVSEKGNIRHVSGFPVNKLLDTTGAGDSFAAGVLYGLTHG  291

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
              S  ++       VAS +V + G RL V+
Sbjct  292   YSS-ENSAKWGNYVASRIVQEIGPRLSVR  319



>gb|KFM23276.1| putative sugar kinase [Auxenochlorella protothecoides]
Length=405

 Score =   205 bits (522),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 179/310 (58%), Gaps = 13/310 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DVLG GQAMVDFS     ++LE+LG++ G R++++   R  +L  +    Y   A GS
Sbjct  34    EFDVLGWGQAMVDFSAHASSEYLEELGVQSGERRLIDLGRRTSLLSQLSEGGYAVHAAGS  93

Query  804   LSNSLVALARLG---GQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG  974
             LSN+L+ALARL     +  G P L + MA  +GSD LG FY + LR A +  +  P    
Sbjct  94    LSNTLLALARLSDASARLHGRPPLRVGMAPLLGSDSLGAFYAASLRGAGLGLVGDPSPGS  153

Query  975   TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIA  1154
             +TGTVIVLT  DAQRTML+Y G    +      ARAI R+++LV+EGYL+E+P     I 
Sbjct  154   STGTVIVLTGEDAQRTMLSYLGHIPALEVSDGFARAIRRSRLLVIEGYLWEMPGAAAAID  213

Query  1155  KACEDARRFGALVAITASDVSCIERHYDDFWEIIANY-ADIVF-------TNSDEARAFC  1310
             +A   AR  G L+A+T+ D   I R+ +     +A + AD++F         + E  A C
Sbjct  214   QAMGIAREAGTLIALTSGDAGVISRNREPVRACLARHGADLLFANAAEAWALASEDGAAC  273

Query  1311  HFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP--SPCMPLDTCGAGDA  1484
                 +    +AA  L+    LVSVTDG+ GS I   G A+ VPP  S   P+DTCGAGDA
Sbjct  274   APSQDLPARAAALALAPLAGLVSVTDGSAGSCIAALGAAITVPPPWSRRPPVDTCGAGDA  333

Query  1485  YASGILYGIL  1514
             YA+G+L G L
Sbjct  334   YAAGLLLGFL  343



>ref|WP_017850955.1| ribokinase [Leptospira interrogans]
Length=328

 Score =   203 bits (516),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLIALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKTDIDLGKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI  G 
Sbjct  232   LKFISDLSALVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGITHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_002152849.1| carbohydrate kinase, PfkB family [Leptospira interrogans]
 gb|EMO27385.1| carbohydrate kinase, PfkB family [Leptospira interrogans serovar 
Bataviae str. HAI135]
Length=328

 Score =   202 bits (515),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDRLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISGLTSLVFMTDSANGAYFAENGKISHVDGFPIKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_020766792.1| MULTISPECIES: carbohydrate kinase, PfkB family [Leptospira]
 gb|EMJ85514.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
JB]
 gb|EMK04223.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
CBC613]
Length=328

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 177/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLTTLEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004445863.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EMO89393.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. 2001034031]
Length=328

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 179/330 (54%), Gaps = 13/330 (4%)
 Frame = +3

Query  621   MR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             MR +DV G+G A+VD     +D F+++LG EKG   +V  E++  +L A++G   +  +G
Sbjct  1     MRHYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVESEKQAGVLTALEGSKKELRSG  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G 
Sbjct  61    GSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDQGH  112

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +    
Sbjct  113   TGTCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLL  172

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
               E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E   
Sbjct  173   TMEESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKL  229

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  
Sbjct  230   EALKFISGLTSLVFMTDSANGAYFAENGKISHVDGFPIKPIDTTGAGDCFAAGVLYGLTH  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             G  +L+        VAS +V + G RL ++
Sbjct  290   GF-NLEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_020762479.1| carbohydrate kinase, PfkB family [Leptospira kirschneri]
 gb|EMK26142.1| carbohydrate kinase, PfkB family [Leptospira kirschneri serovar 
Bulgarica str. Nikolaevo]
Length=328

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLIALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F + P     TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEATPEDKDHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSNISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004474738.1| carbohydrate kinase, PfkB family [Leptospira santarosai]
 gb|EMO70178.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
200403458]
 gb|EMO97396.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
200702252]
Length=328

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISVTLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_010575277.1| ribokinase [Leptospira kmetyi]
 gb|EQA55129.1| carbohydrate kinase, PfkB family [Leptospira kmetyi serovar Malaysia 
str. Bejo-Iso9]
Length=328

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG +KG   +V+ E++  +L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFDKGIMTLVDSEKQAGVLVALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSMDTYGEFYKQDMENAGILFEVAPEDQGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDIDISKLKASSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---KEDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G   +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGTISHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004782893.1| carbohydrate kinase, PfkB family [Leptospira kirschneri]
 gb|EKP03816.1| carbohydrate kinase, PfkB family [Leptospira kirschneri str. 
2008720114]
Length=328

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 177/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++     +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSNISYIEGYLWDGQGIKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFISDLSTLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGMTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004466088.1| ribokinase [Leptospira santarosai]
 gb|EMM76569.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
2000030832]
Length=328

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKDYFDIVFCNAEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_007353415.1| MULTISPECIES: ribokinase [Kamptonema]
 emb|CBN54188.1| PfkB [ [[Oscillatoria] sp. PCC 6506]
Length=336

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 179/336 (53%), Gaps = 14/336 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A+VD    V+DDF++   L +G+  +++ E++G IL  ++  S +  +GGS +
Sbjct  10    DVFGVGNALVDILAFVEDDFVQHHALNRGSMTLMDAEKQGGILHDLEHTSLQLRSGGSAA  69

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF--LSAPVKDGTTG  983
             N+++ALA+ GG            +G V  D  GEFYR  L  A + F    AP   G TG
Sbjct  70    NTMIALAQSGGSGF--------YSGKVAKDTNGEFYRQDLLAAGIEFNVHPAPELSGPTG  121

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTM  + G S+T+         +SR K   +EGYL++  D  K   +  
Sbjct  122   TCVVLTTPDAERTMCTHLGVSTTLAATDIDLDRLSRAKYSYIEGYLWDAADPRKASIETM  181

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E ++R G  VA T SD   ++R  DDF ++IANY D++F N+DE R F      ES +  
Sbjct  182   EHSKRKGVKVAFTFSDAFLVDRFADDFRQVIANYCDVLFCNADEVRRFFEL---ESLEKC  238

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             A+ L   V L  +TD A G  +    +   V   P   +DT GAGDA+A G+L+G+   +
Sbjct  239   AQNLGELVNLAFITDSANGCLVVENKQITKVAGFPVQAIDTVGAGDAFAGGVLFGLTNNL  298

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
             S  +  G     +AS VV   G RL       + E+
Sbjct  299   SP-QQAGRWGNYLASRVVEVHGPRLEESQRDRIWEV  333



>ref|WP_004428525.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EMN01517.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. 2007001578]
 gb|EPE86674.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. 1993005606]
Length=328

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 180/330 (55%), Gaps = 13/330 (4%)
 Frame = +3

Query  621   MR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             MR +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L A++G   +  +G
Sbjct  1     MRHYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLTALEGSKKELRSG  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G 
Sbjct  61    GSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVTPEDQGH  112

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +    
Sbjct  113   TGTCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLL  172

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
               E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E   
Sbjct  173   TMEESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKL  229

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  
Sbjct  230   EALKFISGLTSLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGLTH  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             G  +L+        VAS +V + G RL ++
Sbjct  290   GF-NLEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004470257.1| carbohydrate kinase, PfkB family [Leptospira santarosai]
 gb|EKO34323.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
MOR084]
 gb|EKR93228.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
CBC379]
 gb|EMM85310.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
2000027870]
 gb|EMN23149.1| carbohydrate kinase, PfkB family [Leptospira santarosai serovar 
Arenal str. MAVJ 401]
 gb|EMO32911.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
HAI821]
 gb|EMO45112.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
ZUN179]
 gb|EMO59443.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
CBC1416]
 gb|EMP02989.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
HAI1380]
Length=328

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_006635787.1| ribokinase [Microcoleus vaginatus]
 gb|EGK83692.1| Adenosine kinase [Microcoleus vaginatus FGP-2]
Length=338

 Score =   201 bits (512),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 126/351 (36%), Positives = 189/351 (54%), Gaps = 19/351 (5%)
 Frame = +3

Query  588   EDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAM  767
             E+N    SV     DV G+G A+VD   +V+D+F+   GL +G   ++N E +G IL  +
Sbjct  3     ENNQESGSV-----DVFGVGNALVDILALVEDEFVLGHGLNRGGMTLMNSETQGGILHDL  57

Query  768   DGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVN  947
             +  S +  +GGS +N+++ LA+ GG+           +G V  D  GEFYR  L  A ++
Sbjct  58    EHNSLQMRSGGSAANTMIGLAQSGGKAY--------YSGKVAKDTNGEFYRQDLLAAGID  109

Query  948   FLSAPVKDGT--TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYL  1121
             F   P  +    TGT +VLTTPDA+RTM    G S+T+         +S  K   VEGYL
Sbjct  110   FNVHPAAESKEPTGTCVVLTTPDAERTMCTNLGVSTTLAATDIDVDRLSHCKYSYVEGYL  169

Query  1122  FELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEAR  1301
             ++ PD  K   +  E ++R G  VA T SD   ++R  DDF ++++ Y D++F N+DE R
Sbjct  170   WDAPDPRKASIETMEQSKRLGVKVAFTFSDGFLVDRFADDFHKVVSEYCDVIFCNADEVR  229

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             +F  F+  ES +  AR +S    L  +T+G +G  +    + V V   P   +DT GAGD
Sbjct  230   SF--FKE-ESLEECARKMSEISDLAFITNGDKGCMVVENKQIVDVAGFPVKAIDTVGAGD  286

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             A+A G+L+GI  G+S ++        +AS VV   G RL    A  L+E+ 
Sbjct  287   AFAGGVLFGITNGLSSVQ-AARWGNYLASRVVQIHGPRLEGSQAHLLSEVI  336



>ref|WP_004491703.1| carbohydrate kinase, PfkB family [Leptospira santarosai]
 gb|EMO84473.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
AIM]
Length=328

 Score =   201 bits (512),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 179/328 (55%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS ++ + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIIQEVGPRLGIK  318



>ref|WP_004479070.1| carbohydrate kinase, PfkB family [Leptospira santarosai]
 gb|EMJ49057.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
HAI1349]
 gb|EMO12983.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
CBC523]
 gb|EMO24471.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
HAI134]
 gb|EMP80693.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
CBC1531]
Length=328

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSTDTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISVTLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N +EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNVEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004422117.1| carbohydrate kinase, PfkB family [Leptospira noguchii]
 gb|EKR73703.1| carbohydrate kinase, PfkB family [Leptospira noguchii str. 2006001870]
Length=328

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 178/330 (54%), Gaps = 13/330 (4%)
 Frame = +3

Query  621   MR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             MR +DV G+G A+VD     +D F+++LG EKG   +V  E++  +L  ++G   +  +G
Sbjct  1     MRHYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVESEKQAGVLTVLEGSKKELRSG  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS +N+++ALA  GG             G V  D  GEFY+  +  A + F   P   G 
Sbjct  61    GSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGIFFEVTPEDQGH  112

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +    
Sbjct  113   TGTCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLL  172

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
               E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N++EA+A       E   
Sbjct  173   TMEESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNAEEAKALSQ---REDKL  229

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  
Sbjct  230   EALKFISGLTSLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGLTH  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             G S L+        VAS +V + G RL ++
Sbjct  290   GFS-LEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_002177371.1| MULTISPECIES: carbohydrate kinase, PfkB family [Leptospira]
 gb|EMO54725.1| carbohydrate kinase, PfkB family [Leptospira interrogans str. 
HAI1536]
 gb|EQA71281.1| carbohydrate kinase, PfkB family [Leptospira noguchii serovar 
Panama str. CZ214]
Length=328

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 178/330 (54%), Gaps = 13/330 (4%)
 Frame = +3

Query  621   MR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             MR +DV G+G A+VD     +D F+++LG EKG   +V  E++  +L  ++G   +  +G
Sbjct  1     MRHYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVESEKQAGVLTVLEGSKKELRSG  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS +N+++ALA  GG             G V  D  GEFY+  + +A + F   P   G 
Sbjct  61    GSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMEKAGIFFEVTPEDQGH  112

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +    
Sbjct  113   TGTCVVLTTPDAERTMLTHLGISITLQKSDIDLEKLKSSSISYIEGYLWDGQGTKEASLL  172

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
               E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E   
Sbjct  173   TMEESKKNGVKVAYTYSDPFCVNRSREDFVRLTKEYFDIVFCNAEEAKALSQ---REDKL  229

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYG+  
Sbjct  230   EALKFISGLTSLVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGLTH  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             G  +L+        VAS +V + G RL ++
Sbjct  290   GF-NLEKSTRWGNYVASRIVQEIGPRLGIK  318



>ref|WP_004462069.1| ribokinase [Leptospira santarosai]
 gb|EKT85714.1| ribokinase [Leptospira santarosai serovar Shermani str. LT 821]
 gb|EMF89106.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
ST188]
 gb|EPG80555.1| carbohydrate kinase, PfkB family [Leptospira santarosai serovar 
Shermani str. 1342KT]
Length=328

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISVTLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N +EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNVEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_004489649.1| carbohydrate kinase, PfkB family [Leptospira santarosai]
 gb|EKS09014.1| carbohydrate kinase, PfkB family [Leptospira santarosai str. 
JET]
Length=328

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 178/328 (54%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     +D F+++LG EKG   +V+ E++  +L  ++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTEDVFIKRLGFEKGIMTLVDSEKQAGVLAELEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V +D  GEFY+  +  A + F   P   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSADTYGEFYKKDMENAGILFEVLPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKVSGISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +  +Y DIVF N +EA+A       E    A
Sbjct  175   EESKKSGVKVAYTYSDPFCVNRSREDFVRLTKDYFDIVFCNVEEAKALSQ---REDKLDA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              ++++   PLV +TD A G+Y    G  ++V   P  P+DT GAGD +A+G+LYG+  G 
Sbjct  232   LKFIAGLSPLVFMTDSANGAYFAENGNIIHVDGFPVKPIDTTGAGDCFAAGVLYGLTHGF  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S L+        VAS +V + G RL ++
Sbjct  292   S-LEKSTRWGNYVASRIVQEVGPRLGIK  318



>ref|WP_002646856.1| adenosine kinase [Planctomyces maris]
 gb|EDL59100.1| predicted ribokinase family sugar kinase [Planctomyces maris 
DSM 8797]
Length=328

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 176/327 (54%), Gaps = 12/327 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M++DV G+G A+VD    V D  L+KLG  KG   +V+ E + K+L  +DG      AGG
Sbjct  1     MQYDVYGVGNALVDIQARVSDATLQKLGFAKGIMTLVDEEIQQKVLGELDGAPISQCAGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N+++ +A  GG+         A AG VGSD LGEF  + +R+  V     P  +G T
Sbjct  61    SAANTILGIADFGGKA--------AYAGKVGSDMLGEFDLADMRKLGVTIEVPPAAEGQT  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VL T DAQRTML   G S+T++ +      I ++K + VEGYLF      +   +A
Sbjct  113   GTCVVLITDDAQRTMLTNLGVSATLSVDDINEEHIKQSKYVYVEGYLFTGETQKRAAYRA  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A++ G  VA T SD   I    D+F E+I    D++F N +EAR+            
Sbjct  173   IELAKKHGVKVAFTVSDPFLINLFRDEFQELIEGPVDLLFCNLEEARSLT---GKHDAVD  229

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  + + VP +++T G  GS +  +G  + +       +DT GAGD YA+GILYGI  G
Sbjct  230   CAHVIHNHVPNLALTLGGDGSILMHEGRVIPIEGVDVEAIDTTGAGDMYAAGILYGITNG  289

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLR  1601
             ++     G LA+  A+ +V Q G RL+
Sbjct  290   LT-WHQAGHLASHAAARIVSQLGARLK  315



>ref|WP_015677599.1| carbohydrate kinase, PfkB family [Leptospira yanagawae]
 gb|EOQ90036.1| carbohydrate kinase, PfkB family [Leptospira yanagawae serovar 
Saopaulo str. Sao Paulo = ATCC 700523]
Length=333

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 175/328 (53%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD    +D  FLEK  + KG   +V+   +G+IL  +     +  +GGS
Sbjct  3     HYDVFGVGNALVDIIAFIDPKFLEKQNITKGVMTLVDESRQGQILADLHDEKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++A+A  GG        +    G V  D  GEFY+  +  A V F + P K G TG
Sbjct  63    AANTMIAIANSGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDKAGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML     S+++         + ++K + VEGYL++   T K      
Sbjct  115   TCVVLTTPDAERTMLTNLAISTSLGPNDIDKENLKKSKFVYVEGYLWDGDSTKKASELTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     V+ T SD  C+ R  D+F  +   Y D+VF N++E  A       + P+ A
Sbjct  175   KLAKENNIKVSFTYSDPFCVNRSRDEFIHLTKEYVDVVFCNTEEGLA---ISGGKKPEEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S   P+V +T G  G+Y+   G+   VP  P  P+DT GAGDA+A+G+LYG+ +G 
Sbjct  232   IQFVSKLCPMVFMTAGKDGAYVAENGKITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGY  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S  K        VAS +V + G RL V+
Sbjct  292   SAQKS-ARWGNYVASRIVCEVGPRLSVK  318



>ref|WP_002971867.1| carbohydrate kinase, PfkB family [Leptospira terpstrae]
 gb|EMY63488.1| carbohydrate kinase, PfkB family [Leptospira terpstrae serovar 
Hualin str. LT 11-33 = ATCC 700639]
Length=346

 Score =   198 bits (504),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 183/344 (53%), Gaps = 13/344 (4%)
 Frame = +3

Query  609   SVLSMR-WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYK  785
             S++ M+ +DV G+G A+VD    +D +FL+K  + KG   +V+   +G+IL  +     +
Sbjct  10    SIVPMKHYDVFGVGNALVDIIAFIDPNFLQKQNITKGVMTLVDESRQGQILADLHDEKKE  69

Query  786   AAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV  965
               +GGS +N+++A+A  GG        +    G V  D  GEFY+  +  A V F + P 
Sbjct  70    LRSGGSAANTMIAIANSGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPD  121

Query  966   KDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIK  1145
              +G TGT +VLTTPDA+RTML     S ++         + ++K + VEGYL++   T K
Sbjct  122   VNGHTGTCVVLTTPDAERTMLTNLAISISLGPNDIDVENLKKSKFVYVEGYLWDGDSTKK  181

Query  1146  TIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSN  1325
                   + A+     V+ T SD  C+ R  D+F  +   Y D++F N++E  A    ++ 
Sbjct  182   ASELTMKVAKENKVKVSFTYSDPFCVNRSRDEFIHLTKEYVDVIFCNTEEGLALSGAKTA  241

Query  1326  ESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILY  1505
             E    A +++S   PLV +T G  G+Y+   G+   VP  P  P+DT GAGDA+A+G+LY
Sbjct  242   E---EAVQFISKLCPLVFMTAGKEGAYVAENGKITLVPGFPVKPIDTTGAGDAFAAGVLY  298

Query  1506  GILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFE  1637
             G+ +G S  K        VAS +V + G RL V+      E+ E
Sbjct  299   GLTQGYSSQKS-ARWGNYVASRIVCEVGPRLSVRLMGRQDEILE  341



>ref|WP_000683573.1| ribokinase, partial [Leptospira interrogans]
Length=288

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 164/296 (55%), Gaps = 11/296 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD     ++ F+++LG EKG   +V+ E++ ++L A++G   +  +GGS
Sbjct  3     HYDVFGVGNALVDILVPTENVFIKRLGFEKGIMTLVDSEKQAEVLTALEGSKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG             G V  D  GEFY+  +  A + F  AP   G TG
Sbjct  63    AANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGILFEVAPEDKGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML + G S T+         +  + I  +EGYL++   T +      
Sbjct  115   TCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSSISYIEGYLWDGQGTKEASLLTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A       E    A
Sbjct  175   EESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKALSQ---REDKLEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
              +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD +A+G+LYGI
Sbjct  232   LKFISGLSALVFMTDSANGAYFAENGKISHVDGFPVKPIDTTGAGDCFAAGVLYGI  287



>ref|WP_023065161.1| pfkB carbohydrate kinase family protein [Lyngbya aestuarii]
 gb|ERT08568.1| pfkB carbohydrate kinase family protein [Lyngbya aestuarii BL 
J]
Length=338

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 175/324 (54%), Gaps = 14/324 (4%)
 Frame = +3

Query  633   VLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSN  812
             V G+G A++D   +VDD+F++   L +G   +++ + +GK+L+ ++  S +   GGS +N
Sbjct  13    VFGVGNALLDILALVDDNFIQNHSLNRGAMTLMDVQNQGKLLQELENQSLELRCGGSAAN  72

Query  813   SLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV--KDGTTGT  986
             +++A+A+ GG             G V  D  GEFYR  +    + F  AP    D  TGT
Sbjct  73    TMIAIAQSGGTGY--------YTGKVAEDTNGEFYRQDMAALGIGFEVAPHLHPDNPTGT  124

Query  987   VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACE  1166
              +VLTTPDA+RTM    G ++ ++        +S+ +   VEGYL++  D  K   +  E
Sbjct  125   CLVLTTPDAERTMCTNLGVATQLSVSDINLEHLSQCQYSYVEGYLWDAADPRKACIETME  184

Query  1167  DARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAA  1346
              ++R G  VA T SD   ++R  DDF ++ + Y D+VF N+DE R FC    +ES +  A
Sbjct  185   QSKRHGVKVAFTFSDGFLLDRFTDDFHKLTSEYCDVVFCNADEVRHFCQ---SESLEDCA  241

Query  1347  RYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVS  1526
               L   V L  +TDG +G  +  KG+   V   P  P+DT GAGDA+A G+LYG+  G++
Sbjct  242   SKLGKIVDLAFITDGDKGCLVVEKGQITPVAGFPVKPVDTVGAGDAFAGGVLYGLTNGLT  301

Query  1527  DLKDVGTLAAKVASVVVGQQGTRL  1598
              L+          S+VV   G RL
Sbjct  302   -LQQAARWGNYFGSLVVQIHGPRL  324



>ref|WP_008190583.1| ribokinase [Moorea producens]
 gb|EGJ28804.1| sugar kinase, ribokinase family [Moorea producens 3L]
Length=339

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 177/336 (53%), Gaps = 14/336 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A+VD   +VDDDF+ +  L +G   +++ +++  IL  ++  S + ++GGS +
Sbjct  12    DVFGVGNALVDILALVDDDFIRQHDLNRGAMTLMDAQKQAMILHNLEHHSLELSSGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK--DGTTG  983
             N+++A+A+ GG+           +G V  D  GEFYR  L  A + F   P +   G TG
Sbjct  72    NTMIAIAQSGGKGF--------YSGKVSRDTNGEFYRQDLLEAGIQFDVHPAELSSGPTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTM  + G S+T+         +S+ K   VEGYL+    T K   +A 
Sbjct  124   TCVVLTTPDAERTMCTHLGVSTTLAPTDIDVERLSQCKYSYVEGYLWTGDGTRKACIEAM  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             E ++  G   A T SD   +E   DDF ++I +Y D+VF N++EAR FC     ES    
Sbjct  184   EQSKLKGVKSAFTFSDFFLVENFADDFRQLITDYCDVVFCNAEEARHFCGL---ESLSDC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             A  +S  V    +TDG+ G  +        VP  P   +DT GAGDA+A G+L+GI  G+
Sbjct  241   AGKISELVDTAFITDGSNGCLVVENKTIFQVPGFPAKAVDTVGAGDAFAGGVLFGITNGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEM  1631
             +  K         AS VV   G RL    A  + E+
Sbjct  301   T-TKQAARWGNYFASKVVQTHGPRLEGSQAESVKEV  335



>ref|WP_013631072.1| adenosine kinase [Planctomyces brasiliensis]
 ref|YP_004272390.1| PfkB domain-containing protein [Planctomyces brasiliensis DSM 
5305]
 gb|ADY62368.1| PfkB domain protein [Planctomyces brasiliensis DSM 5305]
Length=329

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/329 (35%), Positives = 176/329 (53%), Gaps = 13/329 (4%)
 Frame = +3

Query  615   LSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAA  794
             ++  +DV G+G ++VD    V DDFL  LG  +G   +V+   +  +L  +DG S    A
Sbjct  1     MAKTYDVYGVGNSLVDIQASVSDDFLAALGYPRGGMSLVDENTQIDVLGKLDGISVSRCA  60

Query  795   GGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG  974
             GGS +N+++ +A  GG+         A  G   +D +G+F+   +R   V  +  P  DG
Sbjct  61    GGSAANTIMGIADFGGKA--------AYVGKTATDEIGQFFLKDMREYGVR-IEVPPTDG  111

Query  975   TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIA  1154
              +GT ++L T DA+RTML   G S++++ +      I++ K + +EGYLF    T     
Sbjct  112   LSGTCVILITDDAERTMLTNLGVSASLSPDDIDPAEIAQAKYVYIEGYLFTGESTKAAAL  171

Query  1155  KACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESP  1334
             KA E A+  G  VA T SD   I+   D+FWE+I    D++F N DEAR+       E P
Sbjct  172   KAIEVAKAQGVKVAFTVSDPFLIDLFRDEFWELIEGPVDLLFCNLDEARSLTKL---EDP  228

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGIL  1514
                A  +      V++T GA GS +  + +A+ +   PC  +DT GAGD YA+G+LYGI 
Sbjct  229   IECANKIHQHAENVAMTLGADGSILMHENKAIPIEGVPCKAIDTTGAGDMYAAGVLYGIT  288

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLR  1601
              G+S  +  G LA+  AS +V Q G R+ 
Sbjct  289   NGLS-WQQAGHLASHAASRIVSQLGARME  316



>ref|WP_012387526.1| ribokinase [Leptospira biflexa]
 ref|YP_001837915.1| PfkB family carbohydrate kinase [Leptospira biflexa serovar Patoc 
strain 'Patoc 1 (Paris)']
 gb|ABZ96639.1| Putative carbohydrate kinase, PfkB family [Leptospira biflexa 
serovar Patoc strain 'Patoc 1 (Paris)']
Length=353

 Score =   195 bits (496),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 175/328 (53%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD    +D  FLEK  + KG   +V+   +G+IL  +     +  +GGS
Sbjct  23    HYDVFGVGNALVDIIAFIDPKFLEKQNITKGVMTLVDESRQGQILADLHDEKKELRSGGS  82

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++A+A  GG        +    G V  D  GEFY+  +  A V F + P K G TG
Sbjct  83    AANTMIAIANSGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDKLGHTG  134

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML     S+++  +      + ++K + VEGYL++   T K      
Sbjct  135   TCVVLTTPDAERTMLTNLAISTSLGPDDIDIENLKKSKYVYVEGYLWDGDSTKKASELTM  194

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     V+ T SD  C+ R  D+F  +   Y D+VF N++E  A    ++ E    A
Sbjct  195   KIAKENKVKVSFTYSDPFCVNRSRDEFIHLTKEYVDVVFCNTEEGLALSGAKTAE---EA  251

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +T G  G+Y+   G+   VP  P  P+DT GAGDA+A+G+LYG+ +G 
Sbjct  252   VQFISKLCSLVFMTAGKEGAYVAENGKITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGY  311

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S  K        VAS +V + G RL V+
Sbjct  312   SAQKS-ARWGNYVASRIVCEVGPRLSVK  338



>ref|WP_012476126.1| ribokinase [Leptospira biflexa]
 ref|YP_001961598.1| sugar kinase [Leptospira biflexa serovar Patoc strain 'Patoc 
1 (Ames)']
 gb|ABZ93020.1| Sugar kinase [Leptospira biflexa serovar Patoc strain 'Patoc 
1 (Ames)']
Length=333

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 175/328 (53%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD    +D  FLEK  + KG   +V+   +G+IL  +     +  +GGS
Sbjct  3     HYDVFGVGNALVDIIAFIDPKFLEKQNITKGVMTLVDESRQGQILADLHDEKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++A+A  GG        +    G V  D  GEFY+  +  A V F + P K G TG
Sbjct  63    AANTMIAIANSGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDKLGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML     S+++  +      + ++K + VEGYL++   T K      
Sbjct  115   TCVVLTTPDAERTMLTNLAISTSLGPDDIDIENLKKSKYVYVEGYLWDGDSTKKASELTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     V+ T SD  C+ R  D+F  +   Y D+VF N++E  A    ++ E    A
Sbjct  175   KIAKENKVKVSFTYSDPFCVNRSRDEFIHLTKEYVDVVFCNTEEGLALSGAKTAE---EA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
              +++S    LV +T G  G+Y+   G+   VP  P  P+DT GAGDA+A+G+LYG+ +G 
Sbjct  232   VQFISKLCSLVFMTAGKEGAYVAENGKITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGY  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S  K        VAS +V + G RL V+
Sbjct  292   SAQKS-ARWGNYVASRIVCEVGPRLSVK  318



>ref|WP_009783090.1| ribokinase [Lyngbya sp. PCC 8106]
 gb|EAW38209.1| ribokinase [Lyngbya sp. PCC 8106]
Length=338

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/324 (35%), Positives = 174/324 (54%), Gaps = 14/324 (4%)
 Frame = +3

Query  633   VLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSN  812
             V G+G A++D   +VDD+F++   L +G   +++ + +GK+L+ ++  S +   GGS +N
Sbjct  13    VFGVGNALLDILALVDDNFIQNHSLNRGAMTLMDAQNQGKLLQELENQSLELRCGGSAAN  72

Query  813   SLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV--KDGTTGT  986
             +++A+A+ GG             G V  D  GEFYR  +    + F  AP    D  TGT
Sbjct  73    TMIAIAQSGGTGY--------YTGKVAEDTNGEFYRQDMAALGIGFEIAPHLHPDNPTGT  124

Query  987   VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACE  1166
              +VLTTPDA+RTM    G ++ ++        +S+ +   VEGYL++  D  K   +  E
Sbjct  125   CLVLTTPDAERTMCTNLGVATQLSVSDINLEHLSQCQYSYVEGYLWDAADPRKACIETME  184

Query  1167  DARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAA  1346
              ++R G  VA T SD   ++R  DDF ++ + Y D+VF N+ E R FC    +ES +  A
Sbjct  185   QSKRHGVKVAFTFSDGFLLDRFTDDFHKLTSEYCDVVFCNASEVRHFCQ---SESLEDCA  241

Query  1347  RYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVS  1526
               L   V L  +TDG +G  +  KG+   V   P  P+DT GAGDA+A G+LYG+  G++
Sbjct  242   SKLGKIVDLAFITDGDKGCLVVEKGQITPVAGFPVKPVDTVGAGDAFAGGVLYGLTNGLT  301

Query  1527  DLKDVGTLAAKVASVVVGQQGTRL  1598
              L+          S+VV   G RL
Sbjct  302   -LQQAARWGNYFGSLVVQIHGPRL  324



>ref|WP_013108841.1| adenosine kinase [Planctomyces limnophilus]
 ref|YP_003628609.1| PfkB domain-containing protein [Planctomyces limnophilus DSM 
3776]
 gb|ADG66410.1| PfkB domain protein [Planctomyces limnophilus DSM 3776]
Length=328

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/326 (36%), Positives = 176/326 (54%), Gaps = 13/326 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M++DV G+G A+ D    + D+ LEK+G  KG   +V  +++G +L +++G      AGG
Sbjct  1     MKFDVYGVGNAITDIQARISDELLEKIGFTKGVMTLVESDKQGHVLASLEGHPVNRCAGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S SN++  +A  GG        + A AG +  D +G F+ S ++   V  +  P+  G +
Sbjct  61    SASNTIAGIADFGG--------TAAYAGKLADDEIGRFWLSDMQALGVT-VDTPLGTGVS  111

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT ++L T DAQRTML + G S+T+  E      I+ ++ + VEGYLF    T     +A
Sbjct  112   GTSVILITEDAQRTMLTHLGISATLGPEDLSEEQIAASQYVYVEGYLFTGESTRAAAYRA  171

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A++    VA T SD   I    D+F ++IA   D++F N +EAR+         P  
Sbjct  172   IELAKKHQVKVAFTVSDPFLIHLFRDEFLKLIAGPVDLLFCNLEEARSLT---GKTEPVD  228

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A+ L H    V++T G  GS I    + + +  +P  P+DT GAGD YA+GILYG+  G
Sbjct  229   CAQQLHHLAADVALTLGGDGSLILRDNQVIPIEATPVRPIDTTGAGDMYAAGILYGLSNG  288

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             +S  +  G LA++ A  VV Q G RL
Sbjct  289   LS-YRQAGHLASQAAGRVVSQLGARL  313



>ref|XP_006347648.1| PREDICTED: uncharacterized protein LOC102579206 [Solanum tuberosum]
Length=236

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +3

Query  582  EEEDNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILR  761
            +EED     S L  RWDVLGLGQAMVDFSGMVD++FLE+LGLEKGTRKVVNHEERGK+L 
Sbjct  124  DEEDVGYSNSDLPQRWDVLGLGQAMVDFSGMVDNEFLERLGLEKGTRKVVNHEERGKVLS  183

Query  762  AMDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYR  920
            AMDGCSYKAAAGGSLSNSLVALARLGGQ I GPAL++A+AGS+GSDPLG FYR
Sbjct  184  AMDGCSYKAAAGGSLSNSLVALARLGGQSIAGPALNVALAGSIGSDPLGGFYR  236



>ref|WP_006622099.1| ribokinase [Arthrospira platensis]
 gb|EKD10294.1| PfkB domain protein [Arthrospira platensis C1]
Length=338

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/337 (34%), Positives = 181/337 (54%), Gaps = 14/337 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A++D    V+DDFLE   L +G   +++  +RG +L+ ++    K + GGS +
Sbjct  12    DVFGVGNALLDILAFVEDDFLETHQLGRGGMTLMDAHQRGTLLQELENSPLKLSCGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF--LSAPVKDGTTG  983
             N+++A+A+ GG            A  VGSD  GEFYR  +  A + F   SA  + G TG
Sbjct  72    NTMMAIAQSGGTGY--------FAAKVGSDTNGEFYRQDMTAAGIEFGVKSATEEQGPTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RT+    G S  ++       A  R++ + +EGYL++ P+         
Sbjct  124   TCLVLTTPDAERTLCTNLGVSIALSPADIDWEAFRRSQYVYIEGYLWDAPEPRLACLDIL  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     VA+T SD+  +ERH ++  ++ A YAD++F N+DE +AFC        ++ 
Sbjct  184   QQAQTHNIKVALTFSDLFLVERHGEELRQLSAEYADVIFCNADEVKAFCQ---ETDLEAC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             AR +S    L+ +T+G +G  +        V   P  P+DT GAGDA+A G+LYG+  G+
Sbjct  241   ARQMSSLADLIFITNGGQGCLVVQNQTITPVSGFPVKPIDTVGAGDAFAGGVLYGLTNGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             +  K        + S +V  +G RL     S+L ++ 
Sbjct  301   TTEK-AARWGNYLGSQIVQVRGPRLSESYRSQLEKII  336



>ref|WP_006618006.1| ribokinase [Arthrospira platensis]
 ref|YP_005072894.1| possible carbohydrate kinase [Arthrospira platensis NIES-39]
 dbj|BAI94356.1| possible carbohydrate kinase [Arthrospira platensis NIES-39]
 gb|KDR57023.1| ribokinase [Arthrospira platensis str. Paraca]
Length=338

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/337 (33%), Positives = 182/337 (54%), Gaps = 14/337 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A++D    V+DDFL+   L +G   +++  ++G +L+ ++    K + GGS +
Sbjct  12    DVFGVGNALLDILAFVEDDFLKTHQLGRGGMTLMDAHQQGTLLQELENSPLKLSCGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF--LSAPVKDGTTG  983
             N+++A+A+ GG            A  VGSD  GEFYR  +  A + F   SA  + G TG
Sbjct  72    NTMMAIAQSGGTGY--------FAAKVGSDTNGEFYRQDMTAAGIEFGVKSATEEQGPTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RT+    G S  ++        + R++ + +EGYL++ P+  +      
Sbjct  124   TCLVLTTPDAERTLCTNLGVSIALSQADIDWEQLRRSQYVYIEGYLWDAPEPRQACLDIL  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     VA+T SD+  +ERH D+  ++ A YAD++F N+DE + FC        ++ 
Sbjct  184   QQAKSHNVKVALTFSDLFLVERHGDELRQLSAEYADVIFCNADEVKRFCQ---ETDLEAC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             AR +S    L+ +T+G +G  +        V   P  P+DT GAGDA+A G+LYGI  G+
Sbjct  241   ARQMSSLADLIFITNGGQGCLVVQNKTITPVSGFPVKPIDTVGAGDAFAGGVLYGITNGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             +  ++       + S +V  +G RL    +S L ++ 
Sbjct  301   TT-EEAALWGNYLGSQIVQVRGPRLSESYSSHLEKII  336



>gb|AID56158.1| fructokinase [Leptospira sp. GIMC2001:Bairam-Ali]
Length=330

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 171/328 (52%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             ++DV G+G A+VD    ++D FL+   L+KG   +++   +G +L  +        +GGS
Sbjct  3     KYDVFGVGNALVDIIVFLEDQFLQAKKLQKGIMTLMDESTQGSLLSDLHEYKKNLRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ALA  GG        +    G V  D  GEFY+  +  A + F + P K+G TG
Sbjct  63    AANTMIALANSGG--------TGCYTGKVSHDTYGEFYKKDIEEAGIVFETKPDKEGHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T ++LTTPDA+RTML   G S T+  E      +  ++ + VEGYL++   T        
Sbjct  115   TCLILTTPDAERTMLTSLGISITLKPEDIDQERLKASQFVYVEGYLWDGVTTKAASELTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+  G  V+ T SD  C+ R  ++F ++   Y D+VF N +EA A        SP  A
Sbjct  175   KLAKENGVKVSFTYSDPFCVNRAKEEFIKLTKEYVDVVFCNLEEAYALT---GKTSPIEA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
                L    PL  +T G  GSY+   G+   VP  P  PLDT GAGD++A+G+LYG+  G 
Sbjct  232   LEVLGTLAPLCFMTAGREGSYVIENGKHSLVPGFPVKPLDTTGAGDSFAAGVLYGLTHGY  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S  K        VAS VV + G RL V+
Sbjct  292   SPEKS-ARWGNYVASRVVQEVGPRLTVK  318



>ref|WP_027249848.1| ribokinase [Planktothrix agardhii]
Length=333

 Score =   190 bits (482),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 183/338 (54%), Gaps = 14/338 (4%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             ++V G+G A++D   +V+D+F++   L +G   +++  ++GK+L+ ++  S +   GGS 
Sbjct  7     FNVFGVGNALLDILALVEDNFIQSHDLNRGAMTLMDTVKQGKLLQQLENNSLELRCGGSA  66

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD--GTT  980
             +N+++A+A+ GG  I         +G V +D  GEFY+  +  A + F   P  +  G T
Sbjct  67    ANTMIAIAQSGGTGI--------YSGKVSTDTNGEFYQQDMVAAGIGFEIEPADNSQGPT  118

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VLTTPDA+RTM    G S+T++        +S+ +   +EGYL++ P+  K   + 
Sbjct  119   GTCLVLTTPDAERTMCTNLGVSTTLSVTDINLDHLSQCQYSYIEGYLWDAPEPRKASIET  178

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E ++R G  VA T SD+  + R  DDF  ++  Y D++F N+DE R FC    +E  + 
Sbjct  179   MEHSKRLGVKVAFTFSDMFLVGRFGDDFRSVLTKYCDVLFCNADEVRHFC---GSEDLEV  235

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              AR L   V  V +T+  +G  +      ++V   P  P+DT GAGDA+A G+LYG+  G
Sbjct  236   CARQLGEKVNFVFITNSDKGCLVVENQTLIHVHGFPVKPVDTVGAGDAFAGGVLYGLTNG  295

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             ++  +        + S +V   G RL      +L E+ 
Sbjct  296   LTTTQ-AARWGNYLGSQIVQIHGPRLPGSQRDKLKEII  332



>ref|WP_008051861.1| ribokinase [Arthrospira sp. PCC 8005]
 emb|CCE17387.1| putative pfkB family carbohydrate kinase; Adenosine kinase [Arthrospira 
sp. PCC 8005]
 emb|CDM92525.1| putative pfkB family carbohydrate kinase; Adenosine kinase [Arthrospira 
sp. PCC 8005]
Length=338

 Score =   189 bits (481),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 112/337 (33%), Positives = 181/337 (54%), Gaps = 14/337 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A++D    V+DDFLE   L +G   +++  ++G +L+ ++    K + GGS +
Sbjct  12    DVFGVGNALLDILAFVEDDFLETHQLGRGGMTLMDAHQQGTLLQELENSPLKLSCGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF--LSAPVKDGTTG  983
             N+++A+A+ GG            A  VGSD  GEFYR  +  A + F   SA  + G TG
Sbjct  72    NTMIAIAQSGGTGY--------FAAKVGSDTNGEFYRQDMTAAGIEFGVKSATEEQGPTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RT+    G S  ++       A  R++ + +EGYL++ P+         
Sbjct  124   TCLVLTTPDAERTLCTNLGVSIALSPADIDWEAFRRSQYVYIEGYLWDAPEPRLACLDIL  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     VA+T SD+  +ERH ++  ++ A YAD++F N+DE +AFC        ++ 
Sbjct  184   QQAQTHNIKVALTFSDLFLVERHGEELRQLSAEYADVIFCNADEVKAFCQ---ETDLEAC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             AR +S    L+ +T+G +G  +        V   P  P+DT GAGDA+A G+LYG+  G+
Sbjct  241   ARQMSSLADLIFITNGGQGCLVVQNQTITPVSGFPVKPIDTVGAGDAFAGGVLYGLTNGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             +  K        + S +V  +G RL     S+L ++ 
Sbjct  301   TTEK-AARWGNYLGSQIVQVRGPRLSESYRSQLEKII  336



>ref|WP_035982988.1| ribokinase [Leptospira meyeri]
Length=333

 Score =   189 bits (481),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 172/328 (52%), Gaps = 12/328 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
              +DV G+G A+VD    +  +FL+K  + KG   +V+   +G+IL  +     +  +GGS
Sbjct  3     HYDVFGVGNALVDIIAFITPNFLQKQNITKGVMTLVDEARQGQILADLHDEKKELRSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++A+A  GG        +    G V  D  GEFY+  +  A V F + P     TG
Sbjct  63    AANTMIAIANSGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDSQSHTG  114

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RTML     S+++         + ++K + VEGYL++   T K      
Sbjct  115   TCVVLTTPDAERTMLTNLAISTSLGPNDIDVDNLKKSKFVYVEGYLWDGDSTKKASELTM  174

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     V+ T SD  C+ R  D+F  +   Y D+VF N++E  A    ++ E    A
Sbjct  175   KVAKENNVKVSFTYSDPFCVNRSKDEFIHLTKEYVDVVFCNTEEGLALSGAKTAE---EA  231

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
               ++S   PLV +T G  G+Y+   G+   VP  P  P+DT GAGDA+A+G+LYG+ +G 
Sbjct  232   VTFISKLCPLVFMTAGKDGAYVAENGKITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGY  291

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             S  K        VAS +V + G RL V+
Sbjct  292   SAQKS-ARWGNYVASRIVCEVGPRLSVR  318



>ref|WP_002771420.1| ribokinase [Leptonema illini]
 gb|EHQ06160.1| PfkB domain protein [Leptonema illini DSM 21528]
Length=334

 Score =   189 bits (480),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 172/327 (53%), Gaps = 18/327 (6%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A+VD    V+DDF+ +  L K    + + E++  IL+A+   S +  +GGS +
Sbjct  8     DVFGVGNALVDTVVFVEDDFIREHNLNKAAMTLADSEKQATILQALGKHSLELKSGGSAA  67

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD--GTTG  983
             N+++ +AR GG             G V SDP GEFYR  L +A + F   P  +  G TG
Sbjct  68    NTMIGVARCGGTGF--------YTGKVASDPNGEFYRMDLLKAGIRFDIHPEPETAGATG  119

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +V+TTPDA+RTM  + G S  +T        I+ ++ + VEGYL++  D  +   K  
Sbjct  120   TCVVMTTPDAERTMYTHLGVSVQLTERDIDVERIASSRFVYVEGYLWDAEDPRRACIKTL  179

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD--  1337
             ++ARR G   + T SD   + R+  D   ++ +  D+VF N +EA++F      E PD  
Sbjct  180   QEARRLGTKASFTFSDPFLVNRYRADLHGMVRDLCDVVFMNEEEAKSFT-----EIPDLQ  234

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
                 YL +  P   VT G  G+Y+   G    VP  P   +DT GAGD +A+G+LYG+  
Sbjct  235   RTLDYLKNLKPKFFVTAGKHGAYVVEDGNVYSVPGYPVEAIDTNGAGDNFAAGVLYGLSH  294

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRL  1598
             G S  +    L   VAS +V  +G R+
Sbjct  295   GYSS-QAAARLGNYVASEIVQVKGARM  320



>gb|AFW87769.1| hypothetical protein ZEAMMB73_779135 [Zea mays]
Length=142

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +3

Query  1302  AFCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGD  1481
             A+C   S +SP SA R LSH VPLVSVTDG  GSYIGVKGEA+YVPP PC+P+DTCGAGD
Sbjct  16    AYCELPSTDSPMSATRCLSHSVPLVSVTDGMHGSYIGVKGEAIYVPPPPCIPVDTCGAGD  75

Query  1482  AYASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSI  1661
             AYASGILYGILRG SDLK +G LA++VA+VVVGQQGT LRVQDA  LAE F H L++   
Sbjct  76    AYASGILYGILRGASDLKGIGLLASRVAAVVVGQQGTHLRVQDADRLAESFAHHLDSLEF  135

Query  1662  WSDI  1673
              SD+
Sbjct  136   CSDV  139



>ref|WP_006668650.1| ribokinase [Arthrospira maxima]
 gb|EDZ95952.1| PfkB domain protein [Arthrospira maxima CS-328]
Length=338

 Score =   189 bits (480),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/337 (33%), Positives = 181/337 (54%), Gaps = 14/337 (4%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLS  809
             DV G+G A++D    V+DDFLE   L +G   +++  ++G +L+ ++    K + GGS +
Sbjct  12    DVFGVGNALLDILAFVEDDFLETHQLGRGGMTLMDAHQQGTLLQELENSPLKLSCGGSAA  71

Query  810   NSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF--LSAPVKDGTTG  983
             N+++A+A+ GG            A  VGSD  GEFYR  +  A + F   SA  + G TG
Sbjct  72    NTMMAIAQSGGTGY--------FAAKVGSDTNGEFYRQDMTAAGIEFGVKSATEEQGPTG  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             T +VLTTPDA+RT+    G S  ++       A  R++ + +EGYL++ P+         
Sbjct  124   TCLVLTTPDAERTLCTNLGVSIALSPADIDWEAFRRSQYVYIEGYLWDAPEPRLACLDIL  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A+     VA+T SD+  +ERH ++  ++ A YAD++F N+DE +AFC        ++ 
Sbjct  184   QQAQTHNIKVALTFSDLFLVERHGEELRQLSAEYADVIFCNADEVKAFCQ---ETDLEAC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
             AR +S    L+ +T+G +G  +        V   P  P+DT GAGDA+A G+LYG+  G+
Sbjct  241   ARQMSSLADLIFITNGGQGCLVVQNQTITPVSGFPVKPIDTVGAGDAFAGGVLYGLTNGL  300

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             +  K        + S +V  +G RL     S+L ++ 
Sbjct  301   TTEK-AARWGNYLGSQIVQVRGPRLSESYRSQLEKII  336



>ref|WP_010587274.1| adenosine kinase [Schlesneria paludicola]
Length=331

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/342 (36%), Positives = 174/342 (51%), Gaps = 14/342 (4%)
 Frame = +3

Query  615   LSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAA  794
             +S  +DV G+G ++VD    +DD  LE L   KG   +V+   + ++L  + G      A
Sbjct  1     MSTSYDVYGVGNSLVDIQAQIDDSVLETLQFPKGIMTLVDEATQKRVLETIRGAKITRCA  60

Query  795   GGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG  974
             GGS +N++  LA  GG+         A AG  G D LGEF+   +R   V     P   G
Sbjct  61    GGSAANTIAGLADFGGKG--------AYAGKTGVDELGEFWLKDMRDLGVTN-EVPPAAG  111

Query  975   TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIA  1154
              TG  +VL + DAQRTML + G S+T+  +      I + K + +EGYLF    T     
Sbjct  112   QTGACVVLISDDAQRTMLTHLGVSATLGPDDISEAEIRKAKYVYIEGYLFAGDSTKVAAM  171

Query  1155  KACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESP  1334
             KA E A++    VA T SD   I  H D FW +I +  D++F N DEAR+         P
Sbjct  172   KAIELAKKNNVKVAFTVSDPFLINMHRDLFWSLIQDSVDLLFCNLDEARSLTGLV---DP  228

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGIL  1514
                A+ + H    V++T GA GS +   G A+ +       +DT GAGD YA+G+LYGI 
Sbjct  229   VDCAQKIHHHAADVALTLGADGSLLMTGGAAIPIEGVTTKAVDTTGAGDMYAAGVLYGIT  288

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQ-DASELAEMFE  1637
              G++  K  G LA+  A+ VV Q G RL      +E+A++ E
Sbjct  289   NGLT-WKQAGHLASHAAARVVAQLGARLATPFTRAEVAKLIE  329



>gb|KEI67830.1| PfkB [Planktothrix agardhii NIVA-CYA 126/8]
Length=334

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 179/326 (55%), Gaps = 14/326 (4%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             ++V G+G A++D   +V+D+F++   L +G   +++  ++GK+L+ ++  S +   GGS 
Sbjct  7     FNVFGVGNALLDILALVEDNFIQSHDLNRGAMTLMDTVKQGKLLQQLENNSLELRCGGSA  66

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK--DGTT  980
             +N+++A+A+ GG  I         +G V +D  GEFY+  +  A + F   P +   G T
Sbjct  67    ANTMIAIAQSGGTGI--------YSGKVSTDTNGEFYQQDMVAAGIGFEIEPAESSQGPT  118

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VLTTPDA+RTM    G S+T++        +S+ +   +EGYL++ P+  K   + 
Sbjct  119   GTCLVLTTPDAERTMCTNLGVSTTLSVADINLDHLSQCEYSYIEGYLWDAPEPRKASIET  178

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E ++R G  VA T SD+  + R  DDF  ++  Y D++F N+DE R FC    +E  + 
Sbjct  179   MEQSKRLGVKVAFTFSDMFLVGRFGDDFRSVLTEYCDVLFCNADEVRHFC---GSEDLEV  235

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              AR L   V  V +T+  +G  +      ++V   P  P+DT GAGDA+A G+LYG+  G
Sbjct  236   CARQLGEKVNFVFITNSDKGCLVVENQTLIHVHGFPVKPVDTVGAGDAFAGGVLYGLTNG  295

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             ++  +        + S +V   G RL
Sbjct  296   LTTTQ-AARWGNYLGSQIVQIHGPRL  320



>ref|WP_026795087.1| MULTISPECIES: ribokinase [Planktothrix]
Length=333

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/338 (32%), Positives = 183/338 (54%), Gaps = 14/338 (4%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             ++V G+G A++D   +V+D+F++   L +G   +++  ++GK+L+ ++  S +   GGS 
Sbjct  7     FNVFGVGNALLDILALVEDNFIQSHDLNRGAMTLMDTVKQGKLLQQLENNSLELRCGGSA  66

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD--GTT  980
             +N+++A+A+ GG  I         +G V +D  GEFY+  +  A + F   P  +  G T
Sbjct  67    ANTMIAIAQSGGTGI--------YSGKVSTDTNGEFYQQDMVAAGIGFEIEPADNSQGPT  118

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VLTTPDA+RTM    G S+T++        +S+ +   +EGYL++ P+  K   + 
Sbjct  119   GTCLVLTTPDAERTMCTNLGVSTTLSVTDINLDHLSQCQYSYIEGYLWDAPEPRKASIET  178

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E ++R G  VA T SD+  + R  DDF  ++  Y +++F N+DE R FC    +E  + 
Sbjct  179   MEHSKRLGVKVAFTFSDMFLVGRFGDDFRSVLTEYCNVLFCNADEVRHFC---GSEDLEV  235

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              AR L   V  V +T+  +G  +      ++V   P  P+DT GAGDA+A G+LYG+  G
Sbjct  236   CARQLGEKVNFVFITNSDKGCLVVENQTLIHVHGFPVKPVDTVGAGDAFAGGVLYGLTNG  295

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             ++  +        + S +V   G RL      +L E+ 
Sbjct  296   LTTTQ-AARWGNYLGSQIVQIHGPRLPESQRDKLKEII  332



>ref|WP_026788306.1| ribokinase [Planktothrix rubescens]
Length=333

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/338 (32%), Positives = 182/338 (54%), Gaps = 14/338 (4%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             ++V G+G A++D   +V+D+F++   L +G   +++  ++GK+L+ ++  S +   GGS 
Sbjct  7     FNVFGVGNALLDILALVEDNFIQSHDLNRGAMTLMDTVKQGKLLQQLENNSLELRCGGSA  66

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD--GTT  980
             +N+++A+A+ GG  I         +G V +D  GEFY+  +  A + F   P  +  G T
Sbjct  67    ANTMIAIAQSGGTGI--------YSGKVSTDTNGEFYQQDMVAAGIGFEIEPADNSQGPT  118

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VLTTPDA+RTM    G S+T++        +S+ +   +EGYL++ P+  K   + 
Sbjct  119   GTCLVLTTPDAERTMCTNLGVSTTLSVTDINLDHLSQCQYSYIEGYLWDAPEPRKASIET  178

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E ++R    VA T SD+  + R  DDF  ++  Y D++F N+DE R FC    +E  + 
Sbjct  179   MEHSKRLEVKVAFTFSDMFLVGRFGDDFRSVLTEYCDVLFCNADEVRHFC---GSEDLEV  235

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              AR L   V  V +T+  +G  +      ++V   P  P+DT GAGDA+A G+LYG+  G
Sbjct  236   CARQLGEKVNFVFITNSDKGCLVVENQTLIHVHGFPVKPVDTVGAGDAFAGGVLYGLTNG  295

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             ++  +        + S +V   G RL      +L E+ 
Sbjct  296   LTTTQ-AARWGNYLGSQIVQIHGPRLPESQRDKLKEII  332



>ref|WP_026796818.1| ribokinase [Planktothrix prolifica]
Length=333

 Score =   186 bits (473),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/338 (32%), Positives = 182/338 (54%), Gaps = 14/338 (4%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             ++V G+G A++D   +V+D+F++   L +G   +++  ++GK+L+ ++  S +   GGS 
Sbjct  7     FNVFGVGNALLDILALVEDNFIQSHDLNRGAMTLMDTVKQGKLLQQLENNSLELRCGGSA  66

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK--DGTT  980
             +N+++A+A+ GG  I         +G V +D  GEFY+  +  A + F   P +   G T
Sbjct  67    ANTMIAIAQSGGTGI--------YSGKVSTDTNGEFYQQDMVAAGIGFEIEPAESSQGPT  118

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VLTTPDA+RTM    G S+T++        +S+ +   +EGYL++ P+  K   + 
Sbjct  119   GTCLVLTTPDAERTMCTNLGVSTTLSVADINLDHLSQCEYSYIEGYLWDAPEPRKASIET  178

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E ++R    VA T SD+  + R  DDF  ++  Y D++F N+DE R FC    +E  + 
Sbjct  179   MEQSKRLEVKVAFTFSDMFLVGRFGDDFRSVLTEYCDVLFCNADEVRHFC---GSEDLEV  235

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              AR L   V  V +T+  +G  +      ++V   P  P+DT GAGDA+A G+LYG+  G
Sbjct  236   CARQLGEKVNFVFITNSDKGCLVVENQTLIHVHGFPVKPVDTVGAGDAFAGGVLYGLTNG  295

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             ++  +        + S +V   G RL      +L E+ 
Sbjct  296   LTTTQ-AARWGNYLGSQIVQIHGPRLPGSQRDKLKEII  332



>ref|WP_015682315.1| carbohydrate kinase, PfkB family [Leptospira wolbachii]
 gb|EOQ96996.1| carbohydrate kinase, PfkB family [Leptospira wolbachii serovar 
Codice str. CDC]
Length=321

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/328 (34%), Positives = 170/328 (52%), Gaps = 12/328 (4%)
 Frame = +3

Query  654   MVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSNSLVALAR  833
             MVD    +D +FL+K  + KG   +V+   +G+IL  +     +  +GGS +N+++A+A 
Sbjct  1     MVDIIAFIDPNFLQKQNITKGVMTLVDESRQGQILADLHDEKKELRSGGSAANTMIAIAN  60

Query  834   LGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDA  1013
              GG        +    G V  D  GEFY+  +  A V F + P  +G TGT +VLTTPDA
Sbjct  61    SGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDVNGHTGTCVVLTTPDA  112

Query  1014  QRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACEDARRFGALV  1193
             +RTML     S+++         + ++K + VEGYL++   T K      + A+     V
Sbjct  113   ERTMLTNLAISTSLAPNDIDVDNLKKSKFVYVEGYLWDGDSTKKASELTMKVAKENNVKV  172

Query  1194  AITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPL  1373
             + T SD  C+ R  D+F  +   Y D++F N++E  A    ++ E    A  ++S   PL
Sbjct  173   SFTYSDPFCVNRSRDEFIHLTKEYVDVIFCNTEEGLALSGAKTAE---EAVEFISKLCPL  229

Query  1374  VSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLA  1553
             V +T G  G+Y+   G    VP  P  P+DT GAGDA+A+G+LYG+ +G S  K      
Sbjct  230   VFMTAGKEGAYVAENGTITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGYSSQKS-ARWG  288

Query  1554  AKVASVVVGQQGTRLRVQDASELAEMFE  1637
               VAS +V + G RL V+      E+ +
Sbjct  289   NYVASRIVCEVGPRLSVRLMGRQEEILD  316



>ref|WP_002990587.1| carbohydrate kinase, PfkB family [Leptospira vanthielii]
 gb|EMY67898.1| carbohydrate kinase, PfkB family [Leptospira vanthielii serovar 
Holland str. Waz Holland = ATCC 700522]
Length=321

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 168/318 (53%), Gaps = 12/318 (4%)
 Frame = +3

Query  654   MVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSNSLVALAR  833
             MVD    ++ +FL+K  + KG   +V+   +G+IL  +     +  +GGS +N+++A+A 
Sbjct  1     MVDIIAFINPNFLQKQNITKGVMTLVDESRQGQILADLHDEKKELRSGGSAANTMIAIAN  60

Query  834   LGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDA  1013
              GG        +    G V  D  GEFY+  +  A V F + P  +G TGT +VLTTPDA
Sbjct  61    SGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDVNGHTGTCVVLTTPDA  112

Query  1014  QRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACEDARRFGALV  1193
             +RTML     S+++         + ++K + VEGYL++   T K      + A+     V
Sbjct  113   ERTMLTNLAISTSLGPNDIDVENLKKSKFVYVEGYLWDGDSTKKASELTMKVAKENNVKV  172

Query  1194  AITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPL  1373
             + T SD  C+ R  D+F  +   Y D+VF N++E  A    ++ E    A +++S   PL
Sbjct  173   SFTYSDPFCVNRTRDEFIHLTKEYVDVVFCNTEEGLALSGAKTAE---EAVQFISKLCPL  229

Query  1374  VSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLA  1553
             V +T G  G+Y+   G    VP  P  P+DT GAGDA+A+G+LYG+ +G S  K      
Sbjct  230   VFMTAGKEGAYVAENGNITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGYSSQKS-ARWG  288

Query  1554  AKVASVVVGQQGTRLRVQ  1607
               VAS +V + G RL V+
Sbjct  289   NYVASRIVCEVGPRLSVR  306



>ref|WP_011612741.1| ribokinase [Trichodesmium erythraeum]
 ref|YP_722869.1| PfkB protein [Trichodesmium erythraeum IMS101]
 gb|ABG52396.1| PfkB [Trichodesmium erythraeum IMS101]
Length=336

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/345 (33%), Positives = 178/345 (52%), Gaps = 14/345 (4%)
 Frame = +3

Query  606   TSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYK  785
             T+V + + DV G+G A+VD   +V++DF+ K  L+K    +++ +++G IL  +   S K
Sbjct  2     TAVNTQKLDVYGVGNALVDILALVEEDFITKFSLQKSGMTLMDAQKQGGILAGLKDISLK  61

Query  786   AAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLR--RANVNFLSA  959
               +GGS +NS++ALA+ GG  I            V SDP GE YR  +   + + N   A
Sbjct  62    KRSGGSAANSMIALAQSGGTGI--------FVAKVASDPNGELYRQDMLNFKMDFNVPPA  113

Query  960   PVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDT  1139
             P  D  TGT +VLTTPDA+RTM    G S  ++        I R K   VEGYL+    T
Sbjct  114   PTADNPTGTCVVLTTPDAERTMCTNLGVSVNLSVSDIDVEQIKRCKYSYVEGYLWTGDST  173

Query  1140  IKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFR  1319
              +   +A + ++     V  T SD   ++   D+F  ++ +Y D++F N+DEAR+FC   
Sbjct  174   KEACKQAMQYSKDEKVKVCFTFSDQFLVDMFADEFRSLLLDYCDVLFCNADEARSFCK--  231

Query  1320  SNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGI  1499
               +S D +A+ +   V    +T+G  G  +    +   VP      +DT GAGDA+A G+
Sbjct  232   -KDSLDDSAKSIGELVETAFITNGKEGCLVVKDKQITSVPGFNATAIDTVGAGDAFAGGV  290

Query  1500  LYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMF  1634
             LYG+  G    +        +AS VV  QG RL    A ++ ++ 
Sbjct  291   LYGLTHGYEPTQ-AARWGNYLASNVVQIQGPRLEGSWADKVQQII  334



>ref|WP_018282632.1| hypothetical protein [zeta proteobacterium SCGC AB-137-C09]
Length=340

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 170/326 (52%), Gaps = 12/326 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M +DV G+G A++D     DD FL + G+EKG   +V+ +++ +IL+A+        +GG
Sbjct  1     MSYDVYGVGNAIMDIQVQCDDAFLTQHGIEKGIMTLVDEQQQAQILKALSNHEVHYCSGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++V +A +GGQ         A A   G D  G  Y  ++    ++   AP   G T
Sbjct  61    SAANTIVGIADMGGQ--------CAYACKTGKDNYGTQYVEEMHHLGISTNVAPAATGAT  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VL TPDAQRTML   G SS++T +      I++ + + +EGYLF    T     KA
Sbjct  113   GTCVVLITPDAQRTMLTCLGASSSLTADDISETEIAKAQYVYIEGYLFAGEQTRAAALKA  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A +    VA+T SD   I+   D+F  +I    D++F N +EA+A         P +
Sbjct  173   IELATQNCVKVALTISDPFLIDICRDEFTRLIEGPVDLLFCNEEEAKA---LTGESDPIA  229

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A+ +      V++T G  GS I   GE   +       +DT GAGD YA+G+L+GI   
Sbjct  230   CAKAMHQHCENVAMTLGKHGSIIMHGGEVFPIEGVSVQAIDTTGAGDMYAAGVLFGITNN  289

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             +S  +  G +A+  A+ VV Q G RL
Sbjct  290   LS-WQQAGHIASHAAARVVAQLGARL  314



>ref|WP_038247299.1| adenosine kinase [Zetaproteobacteria bacterium TAG-1]
Length=327

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 171/326 (52%), Gaps = 13/326 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M  +V G+G A++D     DD FLE   +EKG   + + E++ KIL A+        +GG
Sbjct  1     MTINVYGVGNAIMDLQVQCDDAFLEANAIEKGIMTLTSEEDQQKILDALQTHKVNTCSGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++V +A +GG+        +A  G  GSD  G  Y ++L+   ++F  A   + TT
Sbjct  61    SAANTIVGIADMGGK--------VAYCGKTGSDNFGLQYATELQDLGIHF-GAKASNETT  111

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT +VL TPDAQRTML   G S+T++       AI++   + VEGYLF    T +    A
Sbjct  112   GTCVVLITPDAQRTMLTNLGVSATLSPSDIDEAAIAKADYIYVEGYLFAGESTKEAALHA  171

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              + A + G  +A+T SD   I+   D+F  +I    D++F N DEA A       + P  
Sbjct  172   IDIANQCGTKIALTISDPFLIDICRDEFKYLIEGPVDLLFCNEDEAAA---LTGEDDPVH  228

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             AA  +      V++T G  GS I   GE + +       +DT GAGD YA+G+LYGI  G
Sbjct  229   AAHAIHKTCDNVALTLGKNGSIIMHGGEVIAIEGVTVDAVDTTGAGDMYAAGVLYGITNG  288

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             +S  K  G L +  A+ +V Q G RL
Sbjct  289   LS-WKQAGHLGSHAAAKIVAQLGARL  313



>ref|WP_004787611.1| ribokinase [Leptospira meyeri]
 gb|EKJ88387.1| carbohydrate kinase, PfkB family [Leptospira meyeri serovar Hardjo 
str. Went 5]
 gb|EMJ88972.1| carbohydrate kinase, PfkB family [Leptospira meyeri serovar Semaranga 
str. Veldrot Semarang 173]
Length=321

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 165/318 (52%), Gaps = 12/318 (4%)
 Frame = +3

Query  654   MVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSNSLVALAR  833
             MVD    +  +FL+K  + KG   +V+   +G+IL  +     +  +GGS +N+++A+A 
Sbjct  1     MVDIIAFITPNFLQKQNITKGVMTLVDEARQGQILADLHDEKKELRSGGSAANTMIAIAN  60

Query  834   LGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGTVIVLTTPDA  1013
              GG        +    G V  D  GEFY+  +  A V F + P     TGT +VLTTPDA
Sbjct  61    SGG--------TCCYTGKVTHDTYGEFYKKDMEDAGVLFETTPDSQSHTGTCVVLTTPDA  112

Query  1014  QRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACEDARRFGALV  1193
             +RTML     S+++         + ++K + VEGYL++   T K      + A+     V
Sbjct  113   ERTMLTNLAISTSLGPNDIDVDNLKKSKFVYVEGYLWDGDSTKKASELTMKVAKENNVKV  172

Query  1194  AITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAARYLSHFVPL  1373
             + T SD  C+ R  D+F  +   Y D+VF N++E  A    ++ E    A  ++S   PL
Sbjct  173   SFTYSDPFCVNRSKDEFIHLTKEYVDVVFCNTEEGLALSGAKTAE---EAVTFISKLCPL  229

Query  1374  VSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVSDLKDVGTLA  1553
             V +T G  G+Y+   G+   VP  P  P+DT GAGDA+A+G+LYG+ +G S  K      
Sbjct  230   VFMTAGKDGAYVAENGKITLVPGFPVKPIDTTGAGDAFAAGVLYGLTQGYSAQKS-ARWG  288

Query  1554  AKVASVVVGQQGTRLRVQ  1607
               VAS +V + G RL V+
Sbjct  289   NYVASRIVCEVGPRLSVR  306



>ref|WP_013300155.1| PfkB family protein carbohydrate kinase [Parvularcula bermudensis]
 ref|YP_003854323.1| PfkB family protein carbohydrate kinase [Parvularcula bermudensis 
HTCC2503]
 gb|ADM09181.1| carbohydrate kinase, PfkB family protein [Parvularcula bermudensis 
HTCC2503]
Length=332

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/342 (36%), Positives = 180/342 (53%), Gaps = 21/342 (6%)
 Frame = +3

Query  615   LSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAA  794
             ++ ++DV+ +G A+VD    V D F E   + +G   +++ E+   + RAM G   +  A
Sbjct  1     MAPQFDVIAIGNAIVDLLAHVPDGFPEAHDVPRGGMVLIDSEKAAAMTRAMPGS--EQVA  58

Query  795   GGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG  974
             GGS  NS+V L+RLGG   GG        G V +D LG+ YR  +  A V F++AP+  G
Sbjct  59    GGSAGNSMVCLSRLGGA--GG------FVGKVANDELGDAYRRSMEEAGVQFIAAPLDQG  110

Query  975   T-TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLF--ELPDTIK  1145
               TG   +  T DA+R+M  Y G +  ++        I R +++  EGYLF  ELP +  
Sbjct  111   PPTGRCHIAVTADAERSMATYLGAAGEVSEADIDDDMIRRAEMVFFEGYLFDGELPRS--  168

Query  1146  TIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSN  1325
                KA   A + G   A+T SDV  +ER+ D+   I+  + D++F N DEARA   F  +
Sbjct  169   AFEKAAAIAHKAGKRAALTLSDVGVVERNRDELIRILEKHVDLIFANEDEARAL--FGHH  226

Query  1326  ESPDSAARYLSHFVPLVSVTDGARGSYI-GVKGEAVYVPP-SPCMPLDTCGAGDAYASGI  1499
             E+P   A  ++  VP  ++T   RGS + G   +A  VP  +P   +DT GAGDAYA G 
Sbjct  227   ETPAELAAEMAKLVPFGAITCSERGSIVYGPDQDATTVPAVAPVQLVDTTGAGDAYAGGF  286

Query  1500  LYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELA  1625
              YG  RG   L    TL + +AS V+   G R  V D  ++A
Sbjct  287   FYGFTRG-KPLPSCATLGSVIASEVISHMGPR-PVADIRQMA  326



>ref|WP_007325340.1| adenosine kinase [Rhodopirellula baltica]
 gb|EGF28641.1| ribokinase-like domain-containing protein [Rhodopirellula baltica 
WH47]
 gb|EKK00717.1| ribokinase-like domain-containing protein [Rhodopirellula baltica 
SH28]
Length=331

 Score =   179 bits (453),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 117/327 (36%), Positives = 164/327 (50%), Gaps = 12/327 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M  DV  +G A+VD   MV DD L +L L+KG   +V+ E++  +L   D  S    AGG
Sbjct  1     MTHDVYAVGNALVDIQTMVADDLLSELKLDKGIMTLVDDEKQATVLSRFDLPSLSRCAGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++ A+A  GG+         A  G +G D  G+F+   LR   V     P     +
Sbjct  61    SAANTIAAVADFGGKA--------AFVGKIGDDETGQFFLKDLRALGVTIDVDPQPGTPS  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT  VL T DAQRTML     S+ ++        I+ +K + +EGYLF    T     KA
Sbjct  113   GTCAVLITEDAQRTMLTNLAASTALSEADIDEDVIAASKYVYIEGYLFTGEQTKAAAYKA  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A++    VA TASD   +    D+ W++I    D+ F N +EA++       E P +
Sbjct  173   IELAKKNDVKVAFTASDPFLVNMMKDEMWDLIRGPVDLFFCNEEEAKSLTGL---EDPIA  229

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  +      V++T G  GS +   GEA+ V       +DT GAGD YA GILYGI  G
Sbjct  230   CANKIHESAENVAMTLGPNGSILMHGGEAIPVEGVKVKAIDTTGAGDMYAGGILYGITNG  289

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLR  1601
             + D +  G LA+  A+ VV Q G RL+
Sbjct  290   L-DWRQSGHLASHAAARVVAQMGARLQ  315



>ref|WP_007339822.1| ribokinase-like domain-containing protein [Rhodopirellula baltica]
 gb|ELP30917.1| ribokinase-like domain-containing protein [Rhodopirellula baltica 
SWK14]
Length=331

 Score =   179 bits (453),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 117/327 (36%), Positives = 164/327 (50%), Gaps = 12/327 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M  DV  +G A+VD   MV DD L +L L+KG   +V+ E++  +L   D  S    AGG
Sbjct  1     MTHDVYAVGNALVDIQTMVADDLLSELKLDKGIMTLVDDEKQATVLSRFDLPSLSRCAGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++ A+A  GG+         A  G +G D  G+F+   LR   V     P     +
Sbjct  61    SAANTIAAVADFGGKA--------AFVGKIGDDETGQFFLKDLRALGVTIDVDPQPGTPS  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT  VL T DAQRTML     S+ ++        I+ +K + +EGYLF    T     KA
Sbjct  113   GTCAVLITEDAQRTMLTNLAASTALSEADIDEAVIAASKYVYIEGYLFTGEQTKAAAYKA  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A++    VA TASD   +    D+ W++I    D+ F N +EA++       E P +
Sbjct  173   IELAKKNDVKVAFTASDPFLVNMMKDEMWDLIRGPVDLFFCNEEEAKSLTGL---EDPIA  229

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  +      V++T G  GS +   GEA+ V       +DT GAGD YA GILYGI  G
Sbjct  230   CANKIHESAENVAMTLGPNGSILMHGGEAIPVEGVKVKAIDTTGAGDMYAGGILYGITNG  289

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLR  1601
             + D +  G LA+  A+ VV Q G RL+
Sbjct  290   L-DWRQSGHLASHAAARVVAQMGARLQ  315



>ref|WP_008886664.1| adenosine kinase [Citreicella sp. SE45]
 gb|EEX12844.1| PfkB [Citreicella sp. SE45]
Length=337

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 109/328 (33%), Positives = 166/328 (51%), Gaps = 16/328 (5%)
 Frame = +3

Query  618   SMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             + ++ V+G+G A+VD     DD FLE +G+EKG  ++V  E   ++  AM+  S   A G
Sbjct  9     TKKYQVVGIGNAIVDVLTRADDSFLEHMGIEKGIMQLVERERAEQLYGAME--SRVQAPG  66

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS++N+L  L  LG        L     G V  D LG FY   + +   +F++APV  G 
Sbjct  67    GSVANTLAGLGNLG--------LRTGFIGRVHDDALGRFYADAMEKDGSDFVNAPVPGGE  118

Query  978   --TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
               T   ++  +PD +R+M  Y G SS +  E       ++ +I+ +EGYLF+ P   +  
Sbjct  119   LPTSRSMIFVSPDGERSMNTYLGISSELGPEDVSEDVSAQAEIIFLEGYLFDKPKGKEAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              +A    R  G +  I  SD  C+ERH DDF  +IAN  D V  N  E R+      ++ 
Sbjct  179   LRAARTCRAAGGMAGIAISDPFCVERHRDDFLRLIANEMDYVIGNEAEIRSLYQ---DDH  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
              D     ++   PLV  T    G  I  +GE + +P +  +P+D  GAGD +A+G LYG+
Sbjct  236   LDKDLARVAEVCPLVVCTRSGDGVTIVREGERIDIPVTKVVPVDATGAGDQFAAGFLYGL  295

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
               G +D++  G +    AS V+   G R
Sbjct  296   ATG-ADMETAGRMGTVAASEVIAHMGPR  322



>ref|WP_011123698.1| adenosine kinase [Rhodopirellula baltica]
 ref|NP_870464.1| ribokinase sugar kinase [Rhodopirellula baltica SH 1]
 emb|CAD77541.1| predicted ribokinase family sugar kinase [Rhodopirellula baltica 
SH 1]
Length=351

 Score =   179 bits (453),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 117/327 (36%), Positives = 164/327 (50%), Gaps = 12/327 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M  DV  +G A+VD   MV DD L +L L+KG   +V+ E++  +L   D  S    AGG
Sbjct  21    MTHDVYAVGNALVDIQTMVADDLLSELKLDKGIMTLVDDEKQATVLSRFDLPSLSRCAGG  80

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++ A+A  GG+         A  G +G D  G+F+   LR   V     P     +
Sbjct  81    SAANTIAAVADFGGKA--------AFVGKIGDDETGQFFLKDLRALGVTIDVDPQPGTPS  132

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT  VL T DAQRTML     S+ ++        I+ +K + +EGYLF    T     KA
Sbjct  133   GTCAVLITEDAQRTMLTNLAASTALSEADIDEAVIAASKYVYIEGYLFTGEQTKAAAYKA  192

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A++    VA TASD   +    D+ W++I    D+ F N +EA++       E P +
Sbjct  193   IELAKKNDVKVAFTASDPFLVNMMKDEMWDLIRGPVDLFFCNEEEAKSLTGL---EDPIA  249

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  +      V++T G  GS +   GEA+ V       +DT GAGD YA GILYGI  G
Sbjct  250   CANKIHESAENVAMTLGPNGSILMHGGEAIPVEGVKVKAIDTTGAGDMYAGGILYGITNG  309

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRLR  1601
             + D +  G LA+  A+ VV Q G RL+
Sbjct  310   L-DWRQSGHLASHAAARVVAQMGARLQ  335



>ref|WP_008655254.1| ribokinase-like domain-containing protein [Rhodopirellula europaea]
 gb|EMB17677.1| ribokinase-like domain-containing protein [Rhodopirellula europaea 
6C]
 gb|EMI27056.1| ribokinase-like domain-containing protein [Rhodopirellula europaea 
SH398]
Length=331

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/326 (36%), Positives = 164/326 (50%), Gaps = 12/326 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M  DV  +G A+VD   MV DD L +L L+KG   +V+ E++  +L   D  S    AGG
Sbjct  1     MTHDVYAVGNALVDIQTMVADDLLSELKLDKGIMTLVDDEKQATVLSRFDLPSLSRCAGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++ A+A  GG+         A  G +G D  G+F+   LR   V     P  +  +
Sbjct  61    SAANTIAAVADFGGKA--------AFVGKIGDDETGQFFLKDLRALGVTIDVDPQPETPS  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT  VL T DAQRTML     S+ ++        I+ +K + +EGYLF    T     KA
Sbjct  113   GTCAVLITEDAQRTMLTNLAASTALSEADIDEDVIAASKYVYIEGYLFTGEQTKAAAYKA  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A++    VA TASD   +    D+ W++I    D+ F N +EA++       + P +
Sbjct  173   IELAKKNDVKVAFTASDPFLVNMMKDEMWDLIRGPVDLFFCNEEEAKSLTGL---DDPIA  229

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  +      V++T G  GS +   GEA+ V       +DT GAGD YA GILYGI  G
Sbjct  230   CANKIHESAENVAMTLGPNGSILMHGGEAIPVEGVKVKAIDTTGAGDMYAGGILYGITNG  289

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             + D +  G LA+  A+ VV Q G RL
Sbjct  290   L-DWRQSGHLASHAAARVVAQMGARL  314



>ref|WP_025973199.1| carbohydrate kinase [Prochlorococcus sp. scB241_528P18]
Length=334

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/336 (35%), Positives = 178/336 (53%), Gaps = 23/336 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY-KAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N  E  ++L   + C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSAESQRLL---ENCKVVKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-TG  983
             +N++V LA LG Q        +   G V +D  G+F+   ++++N  F + P  +G  T 
Sbjct  72    ANTVVCLAELGNQ--------VQFIGRVKNDQFGDFFSDDIKKSNTIFNTPPTIEGAPTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K   K
Sbjct  124   HSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAFIK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A   A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F++N+   
Sbjct  182   AARIAKQSNTKIILSLSDSFCVDRHRESFLELIHEYVDIVFCNESEVLSL--FKNNKLA-  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S   YLS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  239   SCQEYLSSLCELVIVTLGSNGSLIFNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLV  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
                S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  299   NNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  332



>ref|WP_025894155.1| MULTISPECIES: carbohydrate kinase [Prochlorococcus]
Length=334

 Score =   176 bits (447),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 117/336 (35%), Positives = 177/336 (53%), Gaps = 23/336 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY-KAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N  E  ++L   + C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSAESQRLL---ENCKVVKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-TG  983
             +N++V LA LG Q        +   G V +D  G+F+   ++++N  F + P  +G  T 
Sbjct  72    ANTVVCLAELGNQ--------VQFIGRVKNDQFGDFFSDDIKKSNTIFNTPPTIEGAPTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K   K
Sbjct  124   HSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAFIK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A   A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   
Sbjct  182   AARIAKQSNTKIILSLSDSFCVDRHRESFLELIHEYVDIVFCNESEVLSL--FK-NDKLA  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S   YLS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  239   SCQEYLSSLCELVIVTLGSNGSLIFNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLV  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
                S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  299   NNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  332



>ref|WP_025924266.1| carbohydrate kinase [Prochlorococcus sp. scB243_495L20]
Length=334

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 117/336 (35%), Positives = 177/336 (53%), Gaps = 23/336 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY-KAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N  E  ++L   + C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSAESQRLL---ENCKVVKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-TG  983
             +N++V LA LG Q        +   G V +D  G+F+   ++++N  F + P  +G  T 
Sbjct  72    ANTVVCLAELGNQ--------VQFIGRVKNDQFGDFFSDDIKKSNTIFNTPPTIEGAPTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K   K
Sbjct  124   HSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAFIK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A   A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   
Sbjct  182   AARIAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEMLSL--FK-NDKLA  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S   YLS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  239   SCQEYLSSLCELVIVTLGSNGSLIFNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLV  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
                S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  299   NNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  332



>ref|WP_013950141.1| MULTISPECIES: carbohydrate kinase [Hyphomicrobium]
 ref|YP_004678315.1| PfkB domain-containing protein [Hyphomicrobium sp. MC1]
 emb|CCB67751.1| PfkB domain protein [Hyphomicrobium sp. MC1]
Length=332

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 173/326 (53%), Gaps = 16/326 (5%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             R+DV+G+G A+VD  G  D+ FL  +G+ KG+ ++V+ +E  KI   M G + + + GGS
Sbjct  5     RYDVIGIGNAIVDIIGRCDEAFLADVGVAKGSMRLVDADEIKKIYSGM-GPAIETS-GGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-T  980
              +N++  +A  GG        S A  G++  D  G  +   +R   V F ++P+ +GT T
Sbjct  63    AANTIAGVASFGG--------SAAFIGTIADDEFGRIFSHDIRSIGVEFGASPISNGTPT  114

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
                ++L TPD +RTM  Y G S+ I         I  + IL +EGYLF+ P  +     A
Sbjct  115   SRSLILVTPDGERTMNTYLGISTNIEETQLDLELIRASSILYLEGYLFDQPQAMTAFRSA  174

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              + A+  G   A+T SD  C++RH D+F ++I +  DI+F N  E ++       ES D 
Sbjct  175   HKAAKAAGRKTALTLSDGFCVDRHRDEFLKLIRSGIDILFANESEIKSLYQ---TESFDF  231

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMP-LDTCGAGDAYASGILYGILR  1517
             AA        L  +T  A+GS I  +GE + +   P    +DT GAGD YA+G L+G  +
Sbjct  232   AAEKARADAKLAVLTRSAKGSEIHFEGETIRIGTFPVEEVVDTTGAGDLYAAGFLFGYAK  291

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G+  L+  G LA+  AS ++   G R
Sbjct  292   GLH-LETAGRLASLAASEIISHTGAR  316



>ref|WP_025929230.1| carbohydrate kinase [Prochlorococcus sp. scB243_496A2]
Length=334

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/336 (35%), Positives = 176/336 (52%), Gaps = 23/336 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY-KAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N  E  ++L   + C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSAESQRLL---ENCKVVKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-TG  983
             +N++V LA LG          +   G V +D  G+F+   ++++N  F + P  +G  T 
Sbjct  72    ANTVVCLAELGNH--------VQFIGRVKNDQFGDFFSDDIKKSNTIFNTPPTIEGAPTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K   K
Sbjct  124   HSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAFIK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A   A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   
Sbjct  182   AARIAKQSNTKIILSLSDSFCVDRHRESFLELIHEYVDIVFCNESEVLSL--FK-NDKLA  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S   YLS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  239   SCQEYLSSLCELVIVTLGSNGSLIFNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLV  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
                S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  299   NNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  332



>ref|WP_025971846.1| carbohydrate kinase [Prochlorococcus sp. scB241_527L22]
Length=334

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/336 (35%), Positives = 176/336 (52%), Gaps = 23/336 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY-KAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N +E     R ++ C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQ---RLLENCKVVKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-TG  983
             +N++V LA LG          +   G V +D  G+F+   ++++N  F + P  +G  T 
Sbjct  72    ANTVVCLAELGNH--------VQFIGRVKNDQFGDFFSDDIKKSNTIFNTPPTIEGAPTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K   K
Sbjct  124   HSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIEESKYLYLEGYLWDSELAKKAFIK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A   A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   
Sbjct  182   AARIAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDKLA  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S   YLS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  239   SCQEYLSSLCELVIVTLGSDGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLV  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
                S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  299   NNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  332



>ref|WP_007796080.1| adenosine kinase [Pelagibaca bermudensis]
 gb|EAU46441.1| kinase, pfkB family protein [Roseovarius sp. HTCC2601]
Length=337

 Score =   174 bits (440),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/328 (33%), Positives = 162/328 (49%), Gaps = 16/328 (5%)
 Frame = +3

Query  618   SMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             + ++ VLG+G A+VD     DD FLE +G+EKG  ++V  E   ++  AM+  +   AAG
Sbjct  9     TKKYQVLGIGNAIVDVLTRSDDSFLEMMGIEKGIMQLVERERAEQLYGAME--NRVQAAG  66

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT  977
             GS++N+L  L  LG        L     G V  D LG FY   + +   +F++ PV  G 
Sbjct  67    GSVANTLAGLGNLG--------LRTGFFGRVRDDALGRFYADAMEKGGTDFVNPPVTGGE  118

Query  978   --TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTI  1151
               T   ++  +PD +R+M  Y G S+ +  E        +  I+ +EGYL++ P   +  
Sbjct  119   LPTSRSMIFVSPDGERSMNTYLGISAELGPEDVAEEIAGQADIIFLEGYLYDKPKGKEAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              +A    R+ G L  I  SD  C+ERH DDF  +IAN  D V  N  E R+      ++ 
Sbjct  179   LRAARTCRKAGGLAGIAISDPFCVERHRDDFLRLIANEMDYVIGNEAEIRSLYQ---DDH  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
              D     ++   PLV  T    G  I   G    VP +  +P+D  GAGD +A+G LYG+
Sbjct  236   LDKDLARVAEVCPLVVCTRSGDGVSIIKDGVRTDVPVTKVVPVDATGAGDQFAAGFLYGL  295

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
               G +D++  G +    AS V+   G R
Sbjct  296   ATG-ADMETAGRMGTVAASEVISHMGPR  322



>ref|WP_015599643.1| carbohydrate kinase [Hyphomicrobium denitrificans]
 ref|YP_007916127.1| PfkB domain-containing protein [Hyphomicrobium denitrificans 
1NES1]
 gb|AGK59628.1| PfkB domain-containing protein [Hyphomicrobium denitrificans 
1NES1]
Length=331

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 175/326 (54%), Gaps = 16/326 (5%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             R+DV+G+G A+VD  G  D+ +L  +G  KG+ ++V  +E  KI   M G + + + GGS
Sbjct  5     RFDVIGIGNAIVDIIGRCDEAYLATIGATKGSMRLVGADEVKKIYATM-GPAVEIS-GGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV-KDGTT  980
              +N++  +A  GG+         A  G+V SD  G+ +   +R   V F   P+  +  T
Sbjct  63    AANTIAGIASFGGKA--------AFIGTVASDEFGKIFTHDIRSIGVAFDVEPISNEAPT  114

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
                ++L TPD +RTM  + G S++++        I  + IL +EGYLF+ P   +   KA
Sbjct  115   SRSLILVTPDGERTMNTFLGISTSLSESQLKLDLIRDSAILYLEGYLFDEPQAKQAFRKA  174

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              + A+  G  VA+T SD  C++RH  +F E+I +  DI+F N  E ++       ES D 
Sbjct  175   LQAAKTAGRKVALTLSDGFCVDRHRAEFLELIRSGIDILFANESEIKSLYQ---TESFDL  231

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPL-DTCGAGDAYASGILYGILR  1517
             AA+  S+   L  +T  A+GS +  +G A+ + P P   L DT GAGD YASG L+G  +
Sbjct  232   AAKNASNDTKLAVLTRSAKGSVLFGEGRAIEIAPEPISELIDTTGAGDLYASGFLFGYSQ  291

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G   L+  G LA+  AS ++   G R
Sbjct  292   GYR-LEICGRLASFAASEIISHIGAR  316



>ref|WP_008702140.1| ribokinase-like domain-containing protein [Rhodopirellula maiorica]
 gb|EMI18045.1| ribokinase-like domain-containing protein [Rhodopirellula maiorica 
SM1]
Length=337

 Score =   173 bits (438),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 111/340 (33%), Positives = 169/340 (50%), Gaps = 19/340 (6%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             +DVLG+G A+VD    V+D  L +L ++KG   +V+ +++  +L  ++G      AGGS 
Sbjct  10    YDVLGVGNALVDIQAQVEDSILSELSIDKGIMTLVDDQQQASVLSRLNGRPLNRCAGGSA  69

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGT  986
             +N++VALA  GG          A    +G D +GEF+   +R   V     P     TGT
Sbjct  70    ANTIVALAEFGGAG--------AFIAKIGDDEVGEFFIKDMRDLGVKMDVEPANGSPTGT  121

Query  987   VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACE  1166
               VL T DAQR+M+   G S+T+         I   K + +EGYL     T     +A +
Sbjct  122   CAVLITEDAQRSMMTNLGASATLQSSDIDESLIKAAKYVYIEGYLLTGETTKAAAYRAMD  181

Query  1167  DARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAA  1346
              A++ G  VA TASD   +    D+ W++I    D+ F N +EA++         P + A
Sbjct  182   IAKQHGVKVAFTASDPFLVNMIRDEIWDLITGPVDLFFCNEEEAKSLT---GESDPIACA  238

Query  1347  RYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVS  1526
               +      V++T G +GS +   GEA  +       +DT GAGD YA  +LYGI  G++
Sbjct  239   AKIHDHAENVALTLGPKGSIVMHGGEAFPIEGVEVKAIDTTGAGDMYAGALLYGITNGMT  298

Query  1527  DLKDVGTLAAKVASVVVGQQGTRL-------RVQDASELA  1625
               +  G LA++ ++ VV Q G RL        +Q  S+LA
Sbjct  299   -WRQAGHLASQASARVVSQMGARLERKFTQEEIQSLSKLA  337



>ref|WP_034279184.1| sugar kinase [Alkanindiges illinoisensis]
Length=338

 Score =   172 bits (437),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 119/356 (33%), Positives = 182/356 (51%), Gaps = 22/356 (6%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY--KAAA  794
             M  D+  +G A+VD    VDD FL++  L KGT ++     + ++L  ++   +  + A+
Sbjct  1     MSVDLYVIGNALVDLEYSVDDQFLQQHQLLKGTMQLAEQTAQQQLLAHLNQNHHAQEQAS  60

Query  795   GGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG  974
             GGS +NS VA   +GG        S   A  VG+D  G FY + L +ANV   S+ + +G
Sbjct  61    GGSAANSTVAFTAMGG--------SAFYACRVGNDDFGRFYLNGLSQANVQTSSSSMSEG  112

Query  975   TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIA  1154
              TGT +VL TPD++RTM  Y G ++ ++        +   K L +EGYL   P     + 
Sbjct  113   ETGTCVVLVTPDSERTMQTYLGITAELSAAQIDFEPLKTAKYLYIEGYLATSPTARLAVK  172

Query  1155  KACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESP  1334
              A E A+      AIT SD + ++   +   ++IA+  DI+F N  EAR +      E  
Sbjct  173   HAREIAKDSNIATAITLSDPAMVQYAREGLDDLIADGVDILFCNEHEARMYT---GTEQL  229

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVK-GEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
             D     L +   +V +T   +G+ I  + G+ + +   PC  +DT GAGDA+A   LYG+
Sbjct  230   DDTVAALLNLGNIVIITRSEQGAIIATRSGKRLTIEAVPCNAIDTLGAGDAFAGAFLYGL  289

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIAS  1679
              +G + L++ G LAA  AS VV Q G RL V       E ++  L   S  SD+A+
Sbjct  290   NKGYT-LENCGKLAAATASKVVSQYGPRLSV-------EQYQAILQAGSFASDLAA  337



>ref|WP_005637436.1| carbohydrate kinase [Parabacteroides merdae]
 gb|EDN87166.1| kinase, PfkB family [Parabacteroides merdae ATCC 43184]
 gb|EKN30551.1| hypothetical protein HMPREF1078_02370 [Parabacteroides merdae 
CL09T00C40]
Length=325

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 174/322 (54%), Gaps = 19/322 (6%)
 Frame = +3

Query  630   DVLGLGQAMVD-FSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             + +GLG A+VD    + +DD L ++G++KG   ++N E+  KI ++ +G     A GGS+
Sbjct  2     NTIGLGNALVDVLLKLENDDVLAEVGIQKGAMDMINQEQMIKIRKSQEGLERSQAPGGSV  61

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGT  986
              N++ A+A LG +            G +GSD +GE+Y   L++ANV+   A   DG +G+
Sbjct  62    CNTMRAMAILGAKA--------GFIGKIGSDSVGEYYEEALKKANVSPYFAKT-DGISGS  112

Query  987   VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACE  1166
               VL +PD +RTM  + G + TIT +      +S  + + +EGYL    + ++T     +
Sbjct  113   CTVLISPDGERTMGTFLGPAPTITPDEITEEMLSAYQCIYIEGYLLVNEELVRT---TMQ  169

Query  1167  DARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAA  1346
              A++ G  VA+  S+ + +        +II  Y DI+F+N  EA AF   +++E    A 
Sbjct  170   KAKKLGLKVALDLSNFNIVNAFRGLLDDIIPEYVDILFSNESEAEAFTGLKAHE----AV  225

Query  1347  RYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVS  1526
             + LS  V +  VT G  G+ +G KG+ + VP     P+DT GAGD +A+G LYG   G +
Sbjct  226   KVLSEQVEISLVTLGKEGALVGSKGQVIAVPAEGGKPVDTTGAGDHFAAGFLYGQSVGAT  285

Query  1527  DLKD--VGTLAAKVASVVVGQQ  1586
               +   +G+L A     V+G Q
Sbjct  286   LEQSARIGSLLAGYIIDVIGAQ  307



>ref|WP_013217240.1| carbohydrate kinase [Hyphomicrobium denitrificans]
 ref|YP_003757402.1| PfkB domain-containing protein [Hyphomicrobium denitrificans 
ATCC 51888]
 gb|ADJ25081.1| PfkB domain protein [Hyphomicrobium denitrificans ATCC 51888]
Length=331

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/326 (33%), Positives = 173/326 (53%), Gaps = 16/326 (5%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             R+DV+G+G A+VD  G  D+ +L  +G  KG+ ++V  ++   I   M   S    +GGS
Sbjct  5     RFDVIGIGNAIVDIIGRCDEAYLATIGASKGSMRLVGADDVKNIYATMG--SAVEVSGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-T  980
              +N++  +A  GG+         A  G++ +D  G+ +   +R   V F  AP+ +G  T
Sbjct  63    AANTIAGVASFGGKA--------AFIGTIANDEFGKIFTHDIRSIGVEFDVAPIANGAPT  114

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
                ++L TPD +RTM  + G S+++         I  + IL +EGYLF+ P   +   KA
Sbjct  115   SRSLILVTPDGERTMNTFLGISTSLDESQLNLDLIRDSAILYLEGYLFDEPQAKQAFRKA  174

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              + A+  G  VA+T SD  C++RH  +F E+I +  DI+F N  E ++       ES + 
Sbjct  175   LQTAKAAGRKVALTLSDGFCVDRHRAEFLELIRSGIDILFANESEIKSLYQ---TESFEL  231

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPL-DTCGAGDAYASGILYGILR  1517
             A++  S    L  +T  A+GS I   G+A+ + P P   L DT GAGD YA+G L+G  +
Sbjct  232   ASKNASKDAKLAVLTRSAKGSVIFSDGDAIEISPEPISELIDTTGAGDLYAAGFLFGYSK  291

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G S L+  G LA+  A+ ++   G R
Sbjct  292   GYS-LEICGRLASLAAAEIISHIGAR  316



>ref|WP_012007329.1| carbohydrate kinase [Prochlorococcus marinus]
 ref|YP_001483788.1| carbohydrate kinase [Prochlorococcus marinus str. MIT 9215]
 gb|ABV50202.1| Possible carbohydrate kinase [Prochlorococcus marinus str. MIT 
9215]
Length=334

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 169/325 (52%), Gaps = 18/325 (6%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N +E     R ++ C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQ---RLLENCKVIKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG-TTG  983
             +N++V LA LG Q        +   G V +D  G+F+   ++++   F + P  +G +T 
Sbjct  72    ANTVVCLAELGNQ--------VQFIGRVKNDQFGDFFSEDIKQSKTIFNTPPTIEGASTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
               I+L TPDAQRTM  Y G S     E      I  +K L +EGYL++     K   KA 
Sbjct  124   HSIILITPDAQRTMCTYLGASIEFEPEDIDFNVIKESKYLYLEGYLWDSKLAKKAFIKAA  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   S 
Sbjct  184   QIAKQSNTKIILSLSDSFCVDRHRESFLELIDEYVDIVFCNESEVLSL--FK-NDKLVSC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGILRG  1520
                LS    L  VT G+ GS I  K     +   +    +DT GAGD YA G ++G++  
Sbjct  241   QEDLSSLCELFIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLINN  300

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTR  1595
              S LK  G +A+  A  ++ Q G+R
Sbjct  301   CS-LKKCGEIASICAGQIITQLGSR  324



>ref|WP_008154315.1| carbohydrate kinase [Parabacteroides johnsonii]
 gb|EKN15333.1| hypothetical protein HMPREF1077_00309 [Parabacteroides johnsonii 
CL02T12C29]
Length=325

 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/324 (34%), Positives = 174/324 (54%), Gaps = 23/324 (7%)
 Frame = +3

Query  630   DVLGLGQAMVD-FSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             + +GLG A+VD    + +DD L ++G++KG   ++N E+  KI ++ +G     A GGS+
Sbjct  2     NTIGLGNALVDVLLRLENDDVLAEVGIQKGAMDMINQEQMIKIRKSQEGLERSQAPGGSV  61

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVN--FLSAPVKDGTT  980
              N++ A+A LG              G +GSD +GE+Y   LR+ANV+  F+     DG +
Sbjct  62    CNTMRAMAILGANA--------GFIGKIGSDCVGEYYEEALRKANVSPYFIKT---DGIS  110

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             G+  VL +PD +RTM  + G + TIT +      +S  + + +EGYL    + ++T    
Sbjct  111   GSCTVLISPDGERTMGTFLGPAPTITPDEITEEMLSSYQCIYIEGYLLVNEELVRT---T  167

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              + A++ G  VA+  S+ + +        +II  Y DI+F+N  EA AF   +++E    
Sbjct  168   MQKAKKLGLKVALDLSNFNIVNAFRGLLDDIIPQYVDILFSNESEAEAFTGLKAHE----  223

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             A + LS  V +  VT G  G+ +G KG+ V VP     P+DT GAGD +A+G LYG   G
Sbjct  224   AVKALSEQVEISLVTLGKEGALVGSKGQVVAVPAEGGKPVDTTGAGDHFAAGFLYGQSVG  283

Query  1521  VSDLKD--VGTLAAKVASVVVGQQ  1586
              +  +   +G+L A     V+G Q
Sbjct  284   ATLEQSARIGSLLAGYIIDVIGAQ  307



>ref|WP_022322601.1| kinase PfkB family [Parabacteroides merdae CAG:48]
 emb|CDD13882.1| kinase PfkB family [Parabacteroides merdae CAG:48]
Length=325

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 173/322 (54%), Gaps = 19/322 (6%)
 Frame = +3

Query  630   DVLGLGQAMVD-FSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             + +GLG A+VD    + +DD L ++G++KG   ++N E+  KI ++  G     A GGS+
Sbjct  2     NTIGLGNALVDVLLKLENDDVLAEVGIQKGAMDMINQEQMIKIRKSQSGLERSQAPGGSV  61

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGT  986
              N++ A+A LG +            G +GSD +GE+Y   L++ANV+   A   DG +G+
Sbjct  62    CNTMRAMAILGAKA--------GFIGKIGSDSVGEYYEEALKKANVSPYFAKT-DGISGS  112

Query  987   VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACE  1166
               VL +PD +RTM  + G + TIT +      +S  + + +EGYL    + ++T     +
Sbjct  113   CTVLISPDGERTMGTFLGPAPTITPDEITEEMLSAYQCIYIEGYLLVNEELVRT---TMQ  169

Query  1167  DARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAA  1346
              A++ G  VA+  S+ + +        +II  Y DI+F+N  EA AF   +++E    A 
Sbjct  170   KAKKLGLKVALDLSNFNIVNAFRGLLDDIIPEYVDILFSNESEAEAFTGLKAHE----AV  225

Query  1347  RYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVS  1526
             + LS  V +  VT G  G+ +G KG+ + VP     P+DT GAGD +A+G LYG   G +
Sbjct  226   KVLSEQVEISLVTLGKEGALVGSKGQVIAVPAEGGKPVDTTGAGDHFAAGFLYGQSVGAT  285

Query  1527  DLKD--VGTLAAKVASVVVGQQ  1586
               +   +G+L A     V+G Q
Sbjct  286   LEQSARIGSLLAGYIIDVIGAQ  307



>ref|WP_025942218.1| carbohydrate kinase [Prochlorococcus sp. scB245a_521A19]
Length=333

 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 176/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  I +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--IEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N++
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDN  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_000641867.1| ribokinase, partial [Leptospira interrogans]
Length=279

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/281 (36%), Positives = 148/281 (53%), Gaps = 12/281 (4%)
 Frame = +3

Query  765   MDGCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANV  944
             ++G   +  +GGS +N+++ALA  GG             G V  D  GEFY+  +  A +
Sbjct  1     LEGSKKELRSGGSAANTMIALANSGGTG--------TYTGKVSKDTYGEFYKKDMENAGI  52

Query  945   NFLSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLF  1124
              F  AP   G TGT +VLTTPDA+RTML + G S T+         +  + I  +EGYL+
Sbjct  53    LFEVAPEDKGHTGTCVVLTTPDAERTMLTHLGISITLQKSDVDLEKLKSSSISYIEGYLW  112

Query  1125  ELPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARA  1304
             +   T +      E++++ G  VA T SD  C+ R  +DF  +   Y DIVF N++EA+A
Sbjct  113   DGQGTKEASLLTMEESKKNGVKVAYTYSDPFCVNRSREDFIRLTKEYFDIVFCNTEEAKA  172

Query  1305  FCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDA  1484
                    E    A +++S    LV +TD A G+Y    G+  +V   P  P+DT GAGD 
Sbjct  173   LSQ---REDKLEALKFISGLSALVFMTDSANGAYFAEDGKISHVDGFPVKPIDTTGAGDC  229

Query  1485  YASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
             +A+G+LYGI  G S L+        VAS +V + G RL ++
Sbjct  230   FAAGVLYGITHGFS-LEKSTRWGNYVASRIVQEVGPRLGIK  269



>ref|WP_011818014.1| carbohydrate kinase [Prochlorococcus marinus]
 ref|YP_001008955.1| carbohydrate kinase [Prochlorococcus marinus str. AS9601]
 gb|ABM69848.1| Possible carbohydrate kinase [Prochlorococcus marinus str. AS9601]
Length=333

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 178/338 (53%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L+KG+  ++N +E  K+L   + C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINHLDKGSMNLINSDESQKLL---ENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G+F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGDFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQIAKQSSTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQEDLSSLCELVIVTLGSNGSLIVNKNNIEIIESITKGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  331



>ref|WP_025926146.1| carbohydrate kinase [Prochlorococcus sp. scB241_528J8]
Length=333

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L+KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KIDLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH   F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQIAKQSNTKIILSLSDSFCVDRHRKSFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQEELSSLCELVIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_008152707.1| MULTISPECIES: carbohydrate kinase [Parabacteroides]
 gb|EEC94577.1| kinase, PfkB family [Parabacteroides johnsonii DSM 18315]
 emb|CCX78913.1| putative uncharacterized protein [Parabacteroides johnsonii CAG:246]
Length=325

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 109/324 (34%), Positives = 174/324 (54%), Gaps = 23/324 (7%)
 Frame = +3

Query  630   DVLGLGQAMVD-FSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             + +GLG A+VD    + +DD L ++G++KG   ++N E+  KI ++ +G     A GGS+
Sbjct  2     NTIGLGNALVDVLLRLENDDVLAEVGIQKGAMDMINQEQMIKIRKSQEGLERSQAPGGSV  61

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVN--FLSAPVKDGTT  980
              N++ A+A LG              G +GSD +GE+Y   LR+ANV+  F+     DG +
Sbjct  62    CNTMRAMAILGANA--------GFIGKIGSDCVGEYYEEALRKANVSPYFVKT---DGIS  110

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             G+  VL +PD +RTM  + G + TIT +      +S  + + +EGYL    + ++T    
Sbjct  111   GSCTVLISPDGERTMGTFLGPAPTITPDEITEEMLSSYQCIYIEGYLLVNEELVRT---T  167

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              + A++ G  VA+  S+ + +        +II  Y DI+F+N  EA AF   +++E    
Sbjct  168   MQKAKKLGLKVALDLSNFNIVNAFRGLLDDIIPQYVDILFSNESEAEAFTGLKAHE----  223

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
             A + LS  V +  VT G  G+ +G KG+ V VP     P+DT GAGD +A+G LYG   G
Sbjct  224   AVKALSEQVEISLVTLGKEGALVGSKGQVVAVPAEGGKPVDTTGAGDHFAAGFLYGQSVG  283

Query  1521  VSDLKD--VGTLAAKVASVVVGQQ  1586
              +  +   +G+L A     V+G Q
Sbjct  284   ATLEQSARIGSLLAGYIIDVIGAQ  307



>ref|WP_018049324.1| hypothetical protein [Nitrospina sp. AB-629-B18]
Length=333

 Score =   171 bits (432),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 112/331 (34%), Positives = 169/331 (51%), Gaps = 17/331 (5%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M++D+LG+G A+VD    VDD+F+++  L KG   ++  E++ KIL+ + G S K ++GG
Sbjct  1     MKYDLLGIGNALVDIEVCVDDEFIKQNSLTKGGMTLLTVEKQNKILKELHGLSTKISSGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++  L+ LGG+            G V +D  G+ Y   +R   V+F         T
Sbjct  61    SAANTIHGLSILGGETY--------YIGRVANDVYGKHYIEDMRSCGVSFSGTGNSLSDT  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT ++L TPD++RTML + G SS +  +      I   +++ +EGYL+   DT     K 
Sbjct  113   GTCVILVTPDSERTMLTHLGASSLLHPDNVDKNVIKNARMVYIEGYLWAGEDTCNAAEKL  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             C+ A++    VA T SD   +        + I    DI+F N  EA+A       E+ D+
Sbjct  173   CKIAKKNKTPVAFTLSDAFIVNSFKKRLIDFIRQNVDILFCNDIEAKAMA-----ETEDT  227

Query  1341  AARY--LSHFVPLVSVTDGARGSYIGV-KGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
              A +  L   V  V VT G  GS+      E + V   P   +D  GAGD +A+G LYGI
Sbjct  228   QASFDALKGMVETVFVTKGENGSWASNPTEEKIIVNVFPTKAVDATGAGDLFAAGALYGI  287

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRV  1604
             +R  S LKD   + +  AS VV   G R+ V
Sbjct  288   IRNYS-LKDSAIIGSYCASKVVSHMGGRMPV  317



>ref|WP_032524689.1| carbohydrate kinase [Prochlorococcus marinus]
 gb|KGF86991.1| Fructokinase [Prochlorococcus marinus str. GP2]
Length=334

 Score =   171 bits (432),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 173/336 (51%), Gaps = 19/336 (6%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSY-KAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  13    KVDLIGLGNAIVDIIVNIEDEFLEINNLAKGSMNLINSDESQ---RLLENCKVVKQISGG  69

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V LA LG          +   G V +D  G+F+   ++++   F + P  +G+ 
Sbjct  70    SSANTVVCLAELGNH--------VQFIGRVKNDQFGDFFSEDIKQSKTIFNTPPTIEGSS  121

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             T   I+L TPDAQRTM  Y G S     E      I  +K L +EGYL++     K   K
Sbjct  122   TAHSIILITPDAQRTMCTYLGASIEFEPEDIDFTVIKESKYLYLEGYLWDSELAKKAFIK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   
Sbjct  182   AAQIAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDKLA  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  239   SCQEDLSSLCELVIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLI  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
                S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  299   NNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  332



>ref|WP_025957138.1| MULTISPECIES: carbohydrate kinase [Prochlorococcus]
Length=333

 Score =   170 bits (431),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  I +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--IEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025952498.1| carbohydrate kinase [Prochlorococcus sp. scB243_495P20]
Length=333

 Score =   170 bits (431),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 176/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L+KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFKTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILITPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQEKLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025970652.1| carbohydrate kinase [Prochlorococcus sp. scB245a_521M10]
Length=333

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFVGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025964660.1| carbohydrate kinase [Prochlorococcus sp. scB243_498P15]
Length=333

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDLTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025955345.1| carbohydrate kinase [Prochlorococcus sp. scB243_498I20]
Length=333

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 111/327 (34%), Positives = 172/327 (53%), Gaps = 22/327 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N +E     R ++ C   K  +GGS 
Sbjct  14    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQ---RLLENCKVIKQISGGSS  70

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-TG  983
             +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  T 
Sbjct  71    ANTVVSLAELGNY--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAPTA  122

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+L TPDAQRTM  Y G S  + +EP       I ++K L +EGYL++     K   K
Sbjct  123   HSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKKSKYLYLEGYLWDSELAKKAFIK  180

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+   
Sbjct  181   AAQIAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDKLA  237

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGIL  1514
             S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G++
Sbjct  238   SCQENLSSLCELVIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLI  297

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTR  1595
                S LK  G +A+  A  ++ Q G+R
Sbjct  298   NNCS-LKKCGEIASICAGQIITQLGSR  323



>ref|WP_025887753.1| carbohydrate kinase [Prochlorococcus sp. scB241_526B17]
Length=333

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSEDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025941427.1| carbohydrate kinase [Prochlorococcus sp. scB245a_518O7]
Length=333

 Score =   170 bits (430),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_034727758.1| sugar kinase [Bacteriovorax sp. BSW11_IV]
Length=331

 Score =   170 bits (430),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 106/332 (32%), Positives = 172/332 (52%), Gaps = 14/332 (4%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             ++DV G+G A+VD    V  +FL+K+ +EKG   +V+   + ++L  +D   +K + GGS
Sbjct  3     KYDVYGIGNALVDMEFEVTPEFLQKMNVEKGLMTLVDENRQEELLNNLDKLGHKRSCGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF-LSAPVKDGTT  980
              +N+++A+++ GG+           +  V SD  G+FY + L +  VN  ++   ++G T
Sbjct  63    AANTIIAVSQFGGKSF--------YSCKVASDETGDFYYTDLVKEGVNTNITDKREEGVT  114

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             G  +V  TPDA RTM  Y G ++T +    +   I ++K L +EGYL   P++++   +A
Sbjct  115   GKCMVFITPDADRTMNTYLGITATFSKNELVYDEIEKSKYLYIEGYLVTGPNSLEAAVEA  174

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYA-DIVFTNSDEARAFCHFRSNESPD  1337
                A + G   A+T SD   +    D F  I+     D++F N  EA AF   ++ E   
Sbjct  175   KAHAEKTGVKTALTFSDPGIVSYFKDGFKTILGQTGVDLLFCNESEALAFTDTKTFE---  231

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
              AA+ L       ++T G +G+YI      +++  +    +DT GAGD +A   LY I  
Sbjct  232   EAAKELKKVAKAFAITLGPKGAYIFDGQNEIHIITNKVEAIDTNGAGDLFAGSFLYAITN  291

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQDA  1613
             G S     G LA   ASV+V Q G RL  + A
Sbjct  292   GHS-FASAGRLACSAASVLVTQFGARLDKEQA  322



>ref|WP_025913503.1| carbohydrate kinase [Prochlorococcus sp. scB245a_520D2]
Length=333

 Score =   170 bits (430),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIINSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025890512.1| MULTISPECIES: carbohydrate kinase [Prochlorococcus]
Length=333

 Score =   170 bits (430),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_009850740.1| adenosine kinase [Mariprofundus ferrooxydans]
 gb|EAU55721.1| predicted ribokinase family sugar kinase [Mariprofundus ferrooxydans 
PV-1]
Length=327

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 169/326 (52%), Gaps = 13/326 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M ++V G+G A++D     +D+FL   G++KG   +V+ E + ++L A+ G      +GG
Sbjct  1     MGYNVYGVGNAIMDMQVRCEDNFLASTGIDKGIMTLVDEERQKQVLAALTGHDVNYCSGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++V +A +GG        + A A   G+D  G  Y  ++++  V    A    G T
Sbjct  61    SAANTIVGIADMGG--------TTAYACKTGTDAFGSRYLDEMKQLGVAIEVAQ-STGQT  111

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             G+ +VL TPDAQRTML   G S+ +  +      I++ + + VEGYLF    T +   KA
Sbjct  112   GSCVVLITPDAQRTMLTNLGISAALNADDICEAEIAKAEYVYVEGYLFAGDSTREAALKA  171

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A+     VA+T SD   I+   D F  +I    D++F N +EAR+       E P  
Sbjct  172   IELAKANNVKVALTISDPFLIDICRDQFQALIEGPVDLLFCNEEEARSLTGL---EDPID  228

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  +      V++T G  GS I  +GEA  +       +DT GAGD YA+G+LYGI  G
Sbjct  229   CAHAIHKHCANVALTLGKNGSIIMHQGEAYPIEGVSVDAIDTTGAGDMYAAGVLYGITNG  288

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             + + +  G L +  A+ VV Q G RL
Sbjct  289   L-NWQQAGHLGSHAAARVVSQLGARL  313



>ref|WP_005647033.1| carbohydrate kinase [Parabacteroides merdae]
 gb|EKN08715.1| hypothetical protein HMPREF1060_03161 [Parabacteroides merdae 
CL03T12C32]
Length=325

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 173/322 (54%), Gaps = 19/322 (6%)
 Frame = +3

Query  630   DVLGLGQAMVD-FSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSL  806
             + +GLG A+VD    + +DD L ++G++KG   ++N E+  KI ++ +G     A GGS+
Sbjct  2     NTIGLGNALVDVLLKLENDDVLAEVGIQKGAMDMINQEQMIKIRKSQEGLERSQAPGGSV  61

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTGT  986
              N++ A+A LG +            G +GSD +GE+Y   L++ANV+   A   DG +G+
Sbjct  62    CNTMRAMAILGAKA--------GFIGKIGSDSVGEYYEEALKKANVSPYFAKT-DGISGS  112

Query  987   VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKACE  1166
               VL +PD +RTM  + G + TIT +      +S  + + +EGYL    + ++T      
Sbjct  113   CTVLISPDGERTMGTFLGPAPTITPDEITEEMLSAYQCIYIEGYLLVNEELVRT---TML  169

Query  1167  DARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSAA  1346
              A++ G  VA+  S+ + +        +II  Y DI+F+N  EA AF   +++E    A 
Sbjct  170   KAKKLGLKVALDLSNFNIVNAFRGLLDDIIPEYVDILFSNESEAEAFTGLKAHE----AV  225

Query  1347  RYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGVS  1526
             + LS  V +  VT G  G+ +G KG+ + VP     P+DT GAGD +A+G LYG   G +
Sbjct  226   KVLSEQVEISLVTLGKEGALVGSKGQVIAVPAEGGKPVDTTGAGDHFAAGFLYGQSVGAT  285

Query  1527  DLKD--VGTLAAKVASVVVGQQ  1586
               +   +G+L A     V+G Q
Sbjct  286   LEQSARIGSLLAGYIIDVIGAQ  307



>gb|EQC49348.1| carbohydrate kinase, PfkB family [Bacteriovorax sp. BSW11_IV]
Length=365

 Score =   171 bits (432),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 109/343 (32%), Positives = 176/343 (51%), Gaps = 16/343 (5%)
 Frame = +3

Query  591   DNSSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMD  770
             DNS    +   ++DV G+G A+VD    V  +FL+K+ +EKG   +V+   + ++L  +D
Sbjct  28    DNSE--GLFMAKYDVYGIGNALVDMEFEVTPEFLQKMNVEKGLMTLVDENRQEELLNNLD  85

Query  771   GCSYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNF  950
                +K + GGS +N+++A+++ GG+           +  V SD  G+FY + L +  VN 
Sbjct  86    KLGHKRSCGGSAANTIIAVSQFGGKSF--------YSCKVASDETGDFYYTDLVKEGVNT  137

Query  951   -LSAPVKDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFE  1127
              ++   ++G TG  +V  TPDA RTM  Y G ++T +    +   I ++K L +EGYL  
Sbjct  138   NITDKREEGVTGKCMVFITPDADRTMNTYLGITATFSKNELVYDEIEKSKYLYIEGYLVT  197

Query  1128  LPDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANY-ADIVFTNSDEARA  1304
              P++++   +A   A + G   A+T SD   +    D F  I+     D++F N  EA A
Sbjct  198   GPNSLEAAVEAKAHAEKTGVKTALTFSDPGIVSYFKDGFKTILGQTGVDLLFCNESEALA  257

Query  1305  FCHFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDA  1484
             F   ++ E    AA+ L       ++T G +G+YI      +++  +    +DT GAGD 
Sbjct  258   FTDTKTFE---EAAKELKKVAKAFAITLGPKGAYIFDGQNEIHIITNKVEAIDTNGAGDL  314

Query  1485  YASGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDA  1613
             +A   LY I  G S     G LA   ASV+V Q G RL  + A
Sbjct  315   FAGSFLYAITNGHS-FASAGRLACSAASVLVTQFGARLDKEQA  356



>ref|WP_025964125.1| carbohydrate kinase [Prochlorococcus sp. scB243_498M14]
Length=333

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIIMQLGSRTDI-DLKEL  331



>ref|WP_032514878.1| carbohydrate kinase [Prochlorococcus marinus]
 gb|KGG03685.1| Fructokinase [Prochlorococcus marinus str. MIT 9314]
Length=333

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L+KG+  ++N +E  ++L+    C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQRLLK---NCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDRFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFNVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C+ RH + F E+I  Y DIVF N  EA +      N+ 
Sbjct  179   IKAAQIAKQSNTKIILSLSDSFCVGRHRESFLELIYEYIDIVFCNESEALSLL---KNDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQEDLSSLCELVIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  331



>ref|WP_025939793.1| carbohydrate kinase [Prochlorococcus sp. scB245a_520B18]
Length=333

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPNDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNYS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_018293509.1| adenosine kinase [Mariprofundus ferrooxydans]
Length=327

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 169/326 (52%), Gaps = 13/326 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M ++V G+G A++D     +D+FL   G++KG   +V+ E + ++L A+ G      +GG
Sbjct  1     MGYNVYGVGNAIMDMQVRCEDNFLASTGIDKGIMTLVDEERQKQVLAALTGHDVNYCSGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++V +A +GG        + A A   G+D  G  Y  ++++  V    A    G T
Sbjct  61    SAANTIVGIADMGG--------TTAYACKTGTDAFGSRYLDEMKQLGVAIEVAQ-SAGQT  111

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             G+ +VL TPDAQRTML   G S+ +  +      I++ + + VEGYLF    T +   KA
Sbjct  112   GSCVVLITPDAQRTMLTNLGISAALNADDICEAEIAKAEYVYVEGYLFAGDSTREAALKA  171

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              E A+     VA+T SD   I+   D F  +I    D++F N +EAR+       E P  
Sbjct  172   IELAKANNVKVALTISDPFLIDICRDQFQALIEGPVDLLFCNEEEARSLTGL---EDPID  228

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRG  1520
              A  +      V++T G  GS I  +GEA  +       +DT GAGD YA+G+LYGI  G
Sbjct  229   CAHAIHKHCANVALTLGKNGSIIMHQGEAYPIEGVSVDAIDTTGAGDMYAAGVLYGITNG  288

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTRL  1598
             + + +  G L +  A+ VV Q G RL
Sbjct  289   L-NWQQAGHLGSHAAARVVSQLGARL  313



>ref|WP_032519413.1| carbohydrate kinase [Prochlorococcus marinus]
 gb|KGG08023.1| Fructokinase [Prochlorococcus marinus str. SB]
Length=335

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    + D+FLE   L+KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIADEFLEINNLDKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTLPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQIAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LSSCQEDLSSLCELVIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  331



>ref|WP_036510529.1| carbohydrate kinase [Oceanicaulis sp. HL-87]
Length=336

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 175/328 (53%), Gaps = 16/328 (5%)
 Frame = +3

Query  618   SMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAG  797
             + R+DVLG+G A+VD     DD FL + G+EK    +++ E R + L A  G   + + G
Sbjct  3     ATRFDVLGVGNAIVDVIATADDAFLGQYGIEKAAMTLID-ETRAEALYAAMGPGQEVS-G  60

Query  798   GSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG-  974
             GS +N+L  +A LGG+  GG        G V  D LGE +   LR A V++ +AP++ G 
Sbjct  61    GSAANTLAGVASLGGR--GG------YIGKVADDQLGEIFAHDLRAAGVDYSTAPLRGGP  112

Query  975   TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIA  1154
              T   ++L TPDAQR+M  + G S+  +     A  I   +I  +EGYLF+  +      
Sbjct  113   ATARCLILVTPDAQRSMNTFLGASTMFSEADVDAERIGAAEITYLEGYLFDRDEAKAAFV  172

Query  1155  KACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESP  1334
              A + AR+ G  VA+T SD  C++RH D F  +IA + D+VF N  E ++       ++ 
Sbjct  173   AAADIARKAGRKVALTLSDGFCVDRHRDSFRALIAGHVDVVFANEVELKSLYQTDDFDAA  232

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPL-DTCGAGDAYASGILYGI  1511
              +  R  +H   + +VT   +G+ I    E+V VP  P   L DT GAGD +A+G L G+
Sbjct  233   LARIRTETH---IAAVTRSEKGAIIVSGDESVSVPADPVEKLVDTTGAGDLFAAGFLLGL  289

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
              RG +DL+  G L    A+ V+   G R
Sbjct  290   ARG-ADLQTCGRLGVLAAAEVISHVGAR  316



>ref|WP_019307461.1| hypothetical protein [SAR324 cluster bacterium SCGC AAA240-J09]
Length=332

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 166/326 (51%), Gaps = 15/326 (5%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDG--CSYKAAAGGS  803
             DV G+   ++D    V D FL + GL K +  ++  EE+   L A+     S + AAGGS
Sbjct  5     DVYGVCNPLIDLLSHVPDSFLTERGLNKNSMNLITLEEQQTFLLALAAGKISVEFAAGGS  64

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTTG  983
              +N+++ +A+LGG+         A +G +G D  G+ YR KL    VN +     DGTTG
Sbjct  65    GANTMIGIAQLGGRT--------AFSGKIGRDEHGKIYREKLEDLGVNAVLGE-GDGTTG  115

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
             + ++L + D  R M  Y G S  +         I  +K L + GYL++     KT+  A 
Sbjct  116   SCLILVSEDGSRAMNTYLGMSQELQVPDIDPEVIQASKYLYLTGYLWDTEVQKKTVINAL  175

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             ++A++    VA++ SD  C+ RH DDF +++  Y  +VF N +EA +            A
Sbjct  176   DEAKKREIKVALSLSDPFCVNRHKDDFKKLLQGYVSMVFCNQEEAFSLL---DTTVTQEA  232

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGILRGV  1523
                LS +   V +T G+ G+ I   G+  Y+ PS     DT GAGDA+A+G LYG+    
Sbjct  233   VEILSQWTETVVLTLGSNGALIKHLGQTFYIDPSQICVEDTTGAGDAFAAGFLYGMTHEF  292

Query  1524  SDLKDVGTLAAKVASVVVGQQGTRLR  1601
             S L+  G + A +A  V+ Q G R +
Sbjct  293   SPLES-GRIGAVLAGAVIEQTGPRYQ  317



>ref|WP_002805982.1| carbohydrate kinase [Prochlorococcus marinus]
 gb|EEE39830.1| possible carbohydrate kinase [Prochlorococcus marinus str. MIT 
9202]
Length=334

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/325 (34%), Positives = 169/325 (52%), Gaps = 18/325 (6%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGGSL  806
             D++GLG A+VD    ++D+FLE   L+KG+  ++N +E     R ++ C   K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNIEDEFLEINNLDKGSMNLINSDESQ---RLLEHCKVIKQISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG-TTG  983
             +N++V LA LG Q        +   G V +D  G+F+   ++++   F + P  +G +T 
Sbjct  72    ANTVVCLAELGNQ--------VQFIGRVKNDQFGDFFSEDIKKSKTIFNTPPTIEGASTA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKAC  1163
               I+L TPDAQRTM  Y G S     E      I  +K L +EGYL++     K   KA 
Sbjct  124   HSIILITPDAQRTMCTYLGASIEFEPEDIDFTVIKESKYLYLEGYLWDSKLAKKAFIKAA  183

Query  1164  EDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDSA  1343
             + A++    + ++ SD  C++RH + F ++I  Y DIVF N  E  +   F+ N+   S 
Sbjct  184   QIAKQSNTKIILSLSDSFCVDRHRESFLKLIDEYVDIVFCNESEVLSL--FK-NDKLVSC  240

Query  1344  ARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYGILRG  1520
                LS    L  VT G+ GS I  K     +   +    +DT GAGD YA G ++G++  
Sbjct  241   QEDLSSLCELFIVTLGSNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHGLINN  300

Query  1521  VSDLKDVGTLAAKVASVVVGQQGTR  1595
              S LK  G +A+  A  ++ Q G+R
Sbjct  301   CS-LKKCGEIASICAGQIITQLGSR  324



>ref|WP_013738664.1| carbohydrate kinase [Sphaerochaeta coccoides]
 ref|YP_004410650.1| PfkB domain-containing protein [Sphaerochaeta coccoides DSM 17374]
 gb|AEC01268.1| PfkB domain protein [Sphaerochaeta coccoides DSM 17374]
Length=338

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 166/340 (49%), Gaps = 22/340 (6%)
 Frame = +3

Query  633   VLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGSLSN  812
             V G+G  ++D    V DD L +LGL KGT  + +  +R ++   + G +     GG   N
Sbjct  8     VYGIGNTLIDIITSVTDDELARLGLHKGTMHLTDKRKRLELEAFLSGRTSVITPGGDCPN  67

Query  813   SLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLR----RANVNFLSAPVKDGTT  980
             +L+ L  +G        +   +AG +G D  G+ Y  +LR    R  +   S P     T
Sbjct  68    TLITLHAMG--------VDTTLAGKIGDDAFGKMYADRLRIMGVRNELALSSEP-----T  114

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             G+ I+L TPD++RTM  Y G +   +    +  ++  + +    GY+++ P+    I  A
Sbjct  115   GSSIILVTPDSERTMNTYLGANRFYSAHDIVLESLRLSDVFYFTGYMWDTPEQQNAIMTA  174

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
              ++ R    +VA   +D   + R+ D F  II +Y DIVF NS+EAR   +   N  P  
Sbjct  175   LKETRNRDIIVAFDVADSFAVGRYRDTFLRIITDYCDIVFANSEEARILFN---NYDPHE  231

Query  1341  AARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCM-PLDTCGAGDAYASGILYGILR  1517
               R +     +  V DG RGSYI   G+ V +P    + P+DT GAGD YA+G LYG+  
Sbjct  232   CCRSMGKLCRIAIVKDGKRGSYISRAGKVVRIPVLGSLEPVDTTGAGDIYAAGFLYGLCT  291

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFE  1637
             G +   D G +A+ +A   + QQG +   + A  L    E
Sbjct  292   GRT-TDDSGEIASFLAGETISQQGAQFTEEKALRLRTALE  330



>ref|WP_026873337.1| carbohydrate kinase [Inquilinus limosus]
Length=329

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 171/333 (51%), Gaps = 20/333 (6%)
 Frame = +3

Query  615   LSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAA  794
             +S R+D   +G A+VD     DD FL + GL KG   +++  ER + L A  G   +A+ 
Sbjct  1     MSARYDATCIGNAIVDVITKNDDAFLARHGLVKGAMTLID-AERAETLYAAMGPGLEAS-  58

Query  795   GGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG  974
             GGS  N+   LA LGG+         A  G V +D LG  YR  +R   V+F SAP+   
Sbjct  59    GGSAGNTAAGLASLGGKA--------AFIGKVTADQLGAVYRHDIRAVGVDFDSAPLDPA  110

Query  975   TTGT-----VIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDT  1139
               GT      +++ TPDAQRTM  Y G    +T +      IS +++  +EGYL++ P  
Sbjct  111   VPGTPPTARSLIIVTPDAQRTMNTYLGACVELTPDDVDEAVISGSQVTYLEGYLWDRPKA  170

Query  1140  IKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFR  1319
              +   KA + A   G  V++T SD  C+ERH D F  +I ++ D++F N  E +A     
Sbjct  171   KEAFIKAAQVAHAAGRKVSLTLSDSFCVERHRDSFLSLIDSHVDVLFANEAEIKALYQVD  230

Query  1320  SNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPL-DTCGAGDAYASG  1496
               E+  +A R       + ++T   +GS I   GE+  V  +P   L DT GAGD YASG
Sbjct  231   DFETAVAAVRGRCE---VAAITRSEKGSVIVTDGESHVVEAAPLAHLVDTTGAGDLYASG  287

Query  1497  ILYGILRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
              LYG+ RG+  L + G + +  A+ V+   G R
Sbjct  288   FLYGLTRGLG-LVECGRIGSIAAAEVISHVGPR  319



>ref|WP_025956537.1| carbohydrate kinase [Prochlorococcus sp. scB243_498L10]
Length=333

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               +    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LANCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_035380620.1| carbohydrate kinase [Acetobacter tropicalis]
Length=332

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/334 (32%), Positives = 166/334 (50%), Gaps = 19/334 (6%)
 Frame = +3

Query  609   SVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKA  788
             +V   ++D+LG+G A+ D    V+  FL++ GL  G+  +++ +    +   +   + + 
Sbjct  2     TVSETKYDILGIGNAITDILANVEPSFLQQQGLTPGSMTLIDVDRANALTATLK--TERV  59

Query  789   AAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK  968
               GGS +N+ V  A+ G +        +A  G V  D  G+ +   LR   + F SAP+ 
Sbjct  60    MGGGSAANTCVVAAQFGAR--------VAYLGKVARDQAGDTFAQDLRENGITFPSAPLD  111

Query  969   DGT-----TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
               T     T   IV+ TPD QRTM  Y G  +  T +  +  AI+ + I+ +EGYLF+ P
Sbjct  112   GHTYENLPTARCIVMVTPDGQRTMATYLGACTYFTPDDVIQEAIAASSIVYLEGYLFDPP  171

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
                +   +A   A + G  VA+T SD  C+ RH   F +++  + DI+F N DE    C 
Sbjct  172   HAQEAFRRAATLAHQNGRQVALTLSDPFCVGRHRQAFLDLLRGHIDILFANEDE---ICA  228

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
                 E  D+AAR+        ++T    GS I   G+   V P P   +DT GAGDAYA+
Sbjct  229   LYETEDFDTAARHTEQDTTFAALTRSGLGSVIIHDGQRTKVDPVPTQVVDTTGAGDAYAA  288

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G L G+  G + L + G LA+  AS ++   G R
Sbjct  289   GFLAGLTSGRT-LPECGRLASVAASEIISHVGAR  321



>ref|WP_025944513.1| carbohydrate kinase [Prochlorococcus sp. scB241_529C4]
Length=333

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 176/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E  ++L   + C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQRLL---ENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E++  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELMYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIINSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_025980884.1| carbohydrate kinase [Prochlorococcus sp. scB245a_519O11]
Length=333

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +D+ GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIFNKNNVEIIDSITRGKIIDSTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRTDI-DLKEL  331



>ref|WP_026398234.1| carbohydrate kinase [Acetobacter nitrogenifigens]
Length=329

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/359 (33%), Positives = 174/359 (48%), Gaps = 36/359 (10%)
 Frame = +3

Query  615   LSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAA  794
             ++  +D+LG+G A+ D    VD DFLE+ GL  G+  +++  +R   LRA      K + 
Sbjct  1     MNTLYDLLGIGNAITDIVARVDADFLERHGLTPGSMSLID-ADRAATLRAQIA-PEKESG  58

Query  795   GGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPV--K  968
             GGS +N+    A LG +        +A  G V  D  G  +   LR + + F S P+  +
Sbjct  59    GGSAANTCAVAAELGAR--------VAYLGKVADDKAGRAFSEDLRASGITFPSRPLDGR  110

Query  969   DG---TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDT  1139
             +G   +T   +VL TPD QRTM  Y G  +  + +  LA  +   K+  +EGYLF+ P  
Sbjct  111   EGANLSTACCVVLVTPDGQRTMNTYLGACTHFSPDDVLADVVGAAKVAYLEGYLFDPPQA  170

Query  1140  IKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFR  1319
              +   +A   A +    VA+T SD  C+ RH D F +++  + DI+F N DE    C   
Sbjct  171   QEAFRRAATIAHKAKRNVALTLSDPFCVARHRDAFRDLVHGHIDILFANEDE---ICSLY  227

Query  1320  SNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGI  1499
               ES + AA   S     V +T   +GS I   GE   +   P   +DT GAGDAYA+G 
Sbjct  228   QTESFEDAATQASRDASFVVLTRSEKGSVIIRDGERTNIAAVPTTVVDTTGAGDAYAAGF  287

Query  1500  LYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAEMFEHQLNNSSIWSDIA  1676
             L G+  G S +++ G LA+  AS V+   G R                   +S+W DIA
Sbjct  288   LAGLTAGRS-MEESGRLASVAASEVISHFGAR-----------------PLTSLWKDIA  328



>ref|WP_011819885.1| carbohydrate kinase [Prochlorococcus marinus]
 ref|YP_001010885.1| carbohydrate kinase [Prochlorococcus marinus str. MIT 9515]
 gb|ABM71778.1| Possible carbohydrate kinase [Prochlorococcus marinus str. MIT 
9515]
Length=338

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 176/338 (52%), Gaps = 22/338 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGGSL  806
             D++GLG A+VD    V+D+FLE   L+KG+  ++N  E   +L+    C+  K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNVNDNFLEINDLKKGSMNLINSNESETLLK---NCTVIKKISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG-TTG  983
             +N++V LA LG         ++   G V +D  G F+   ++++N  F + P++ G ++ 
Sbjct  72    ANTVVCLAELGN--------NVQFIGRVKNDNFGNFFSIDIKKSNTIFNTPPIEKGPSSA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+  TPDAQRTM  Y G S  I +EP       I  +K L +EGYL++     K   K
Sbjct  124   HSIIFITPDAQRTMCTYLGAS--IEFEPKDVDYNLIKESKYLYLEGYLWDSDLAKKAFLK  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A + A+     + ++ SD  C++RH + F E+I NY DIVF N  E  +   F  N +  
Sbjct  182   ASKLAKESDTKIILSLSDSFCVDRHRESFLELIDNYVDIVFCNESEVLSL--FEEN-NLQ  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPC-MPLDTCGAGDAYASGILYGIL  1514
             S  + +S    LV +T G++GS I   G+   + P      +DT GAGD YA G ++G++
Sbjct  239   SCQKSISSICELVIITLGSKGSLIINNGKLEEINPKILGKIIDTTGAGDLYAGGFIHGLI  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELAE  1628
                   K  G L +  A  ++ Q G+R  +   + L E
Sbjct  299   NNYPT-KKCGELGSICAGHIITQLGSRSNINLKNLLQE  335



>ref|WP_014019423.1| sugar kinase [Cyclobacterium marinum]
 ref|YP_004773357.1| PfkB domain-containing protein [Cyclobacterium marinum DSM 745]
 gb|AEL25126.1| PfkB domain protein [Cyclobacterium marinum DSM 745]
Length=332

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/334 (32%), Positives = 176/334 (53%), Gaps = 18/334 (5%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             ++DV G+G A+VD    V D FL+K G+EKG   +V+ + +G+++ A++  + K   GGS
Sbjct  4     KYDVTGIGNALVDIEFEVSDTFLDKYGIEKGLMTLVDEDRQGELMAAINTKTSKLQCGGS  63

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK--DGT  977
              +NS++A+++ GG+              V +D LG+F+   LR A VN    P K  +G 
Sbjct  64    AANSIIAVSQFGGKSY--------YCCKVANDELGKFFTDDLREAGVNHNLDPFKLEEGI  115

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TG  +V+ T DA+RTM  + G +   +       AI  +K L +EGYL   P+  + +  
Sbjct  116   TGKCLVMVTADAERTMNTFLGITEKFSTSQLNEEAIKASKYLYIEGYLITSPNAKEAMMA  175

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSN--ES  1331
             A + A      VAIT SD + ++   + F E+I +  D++F N +EA  +   + N  ++
Sbjct  176   AKKIAEENEVKVAITFSDPAMVKYFGEGFKEVIGSGVDMLFANEEEAMLYTG-KDNVADA  234

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
              ++  +   HFV    +T G  G+ I      + + P P + +D+ GAGD +A   +YGI
Sbjct  235   AEALKKIAKHFV----ITQGKNGALIFDGDTYIDIAPYPTVAVDSNGAGDMFAGAFMYGI  290

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDA  1613
               G S     G LA+  +S VV Q G RL  ++A
Sbjct  291   TNGHS-YASSGKLASMASSKVVSQFGPRLTWEEA  323



>gb|KGB22584.1| Fructokinase [Acetobacter tropicalis]
Length=356

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/334 (32%), Positives = 166/334 (50%), Gaps = 19/334 (6%)
 Frame = +3

Query  609   SVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKA  788
             +V   ++D+LG+G A+ D    V+  FL++ GL  G+  +++ +    +   +   + + 
Sbjct  26    TVSETKYDILGIGNAITDILANVEPSFLQQQGLTPGSMTLIDVDRANALTATLK--TERV  83

Query  789   AAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK  968
               GGS +N+ V  A+ G +        +A  G V  D  G+ +   LR   + F SAP+ 
Sbjct  84    MGGGSAANTCVVAAQFGAR--------VAYLGKVARDQAGDTFAQDLRENGITFPSAPLD  135

Query  969   DGT-----TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
               T     T   IV+ TPD QRTM  Y G  +  T +  +  AI+ + I+ +EGYLF+ P
Sbjct  136   GHTYENLPTARCIVMVTPDGQRTMATYLGACTYFTPDDVIQEAIAASSIVYLEGYLFDPP  195

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
                +   +A   A + G  VA+T SD  C+ RH   F +++  + DI+F N DE    C 
Sbjct  196   HAQEAFRRAATLAHQNGRQVALTLSDPFCVGRHRQAFLDLLRGHIDILFANEDE---ICA  252

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
                 E  D+AAR+        ++T    GS I   G+   V P P   +DT GAGDAYA+
Sbjct  253   LYETEDFDTAARHTEQDTTFAALTRSGLGSVIIHDGQRTKVDPVPTQVVDTTGAGDAYAA  312

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G L G+  G + L + G LA+  AS ++   G R
Sbjct  313   GFLAGLTSGRT-LPECGRLASVAASEIISHVGAR  345



>ref|WP_025953545.1| carbohydrate kinase [Prochlorococcus sp. scB243_497N18]
Length=333

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 175/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E  ++L   + C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQRLL---ENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSLIINKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++   G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEMASICAGQIITHLGSRTDI-DLKEL  331



>ref|WP_025963603.1| carbohydrate kinase [Prochlorococcus sp. scB245a_520F22]
Length=335

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 174/338 (51%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESE---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSQIHNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++   G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITHLGSRTDI-DLKEL  331



>ref|WP_020890709.1| Ribokinase [Cyclobacterium qasimii]
 gb|EPR67230.1| Ribokinase [Cyclobacterium qasimii M12-11B]
Length=331

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/336 (32%), Positives = 176/336 (52%), Gaps = 16/336 (5%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGGS  803
             ++DV G+G A+VD    V D FLEK G+EKG   +V+ + +G+++ A++  + K   GGS
Sbjct  3     KYDVTGIGNALVDIEFEVSDAFLEKYGIEKGLMTLVDEDRQGELMSAINTKTSKLQCGGS  62

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK--DGT  977
              +NS++A+++ GG+              V +D LG+F+   LR + VN    P K  +G 
Sbjct  63    AANSIIAVSQFGGKSY--------YCCKVANDELGKFFTDDLRESGVNHNLDPFKLEEGI  114

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAK  1157
             TG  +V+ T DA+RTM  + G +   +       AI  +K L +EGYL   P   + +  
Sbjct  115   TGKCLVMVTSDAERTMNTFLGITEKFSTAQINEEAIKASKFLYIEGYLITSPGAREAMLA  174

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRS-NESP  1334
             A + A      VA+T SD + ++   + F E+I +  D++F N +EA  +    + +E+ 
Sbjct  175   AKKIAEANDVKVALTFSDPAMVKYFGEGFKEVIGSGVDMLFANEEEAMLYTGKDNLSEAS  234

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYASGILYGIL  1514
             +   +   HFV    +T G  G+ I      + + P P + +DT GAGD +A   +YGI 
Sbjct  235   EDMKKLAKHFV----ITQGNNGALIYDGETFIDIAPYPTVAVDTNGAGDMFAGAFMYGIT  290

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
              G S     G LA+  +S +V Q G RL  ++A ++
Sbjct  291   NGHS-YASSGKLASMASSKIVSQFGPRLTWEEAKDV  325



>ref|WP_025954006.1| MULTISPECIES: carbohydrate kinase [Prochlorococcus]
Length=335

 Score =   167 bits (424),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 174/338 (51%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE   L KG+  ++N +E     R ++ C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLEINNLNKGSMNLINSDESQ---RLLENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA LG          +   G V +D  G F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELGNH--------VQFIGRVKNDQFGNFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFTVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F E+I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQVAKQSNTKIILSLSDSFCVDRHRESFLELIYEYVDIVFCNESEVLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G+ GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQENLSSLCELVIVTLGSNGSQIFNKNNVEIIDSITRGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++   G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITHLGSRTDI-DLKEL  331



>ref|WP_025931522.1| MULTISPECIES: carbohydrate kinase [Prochlorococcus]
Length=333

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 177/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  624   RWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGG  800
             + D++GLG A+VD    ++D+FLE+  L+KG+  ++N +E  ++L   + C   K  +GG
Sbjct  12    KVDLIGLGNAIVDIIVNIEDEFLERNNLDKGSMNLINSDESQRLL---ENCKVIKQISGG  68

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGT-  977
             S +N++V+LA L           +   G V +D  G+F+   ++++   F + P  +G  
Sbjct  69    SSANTVVSLAELDNH--------VQFIGRVKNDQFGDFFSDDIKKSKTIFNTPPTIEGAP  120

Query  978   TGTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTI  1151
             T   I+L TPDAQRTM  Y G S  + +EP       I  +K L +EGYL++     K  
Sbjct  121   TAHSIILVTPDAQRTMCTYLGAS--VEFEPKDIDFNVIKESKYLYLEGYLWDSELAKKAF  178

Query  1152  AKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNES  1331
              KA + A++    + ++ SD  C++RH + F ++I  Y DIVF N  E  +   F+ N+ 
Sbjct  179   IKAAQIAKQSNTKIILSLSDSFCVDRHRESFLKLIYEYVDIVFCNESEMLSL--FK-NDK  235

Query  1332  PDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPP-SPCMPLDTCGAGDAYASGILYG  1508
               S    LS    LV VT G  GS I  K     +   +    +DT GAGD YA G ++G
Sbjct  236   LASCQEDLSSLCELVIVTLGRNGSLIVNKNNVEIIESITKGKIIDTTGAGDIYAGGFIHG  295

Query  1509  ILRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASEL  1622
             ++   S LK  G +A+  A  ++ Q G+R  + D  EL
Sbjct  296   LINNCS-LKKCGEIASICAGQIITQLGSRSDI-DLKEL  331



>ref|WP_011132140.1| carbohydrate kinase [Prochlorococcus marinus]
 ref|NP_892623.1| carbohydrate kinase [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 emb|CAE18964.1| Possible carbohydrate kinase [Prochlorococcus marinus subsp. 
pastoris str. CCMP1986]
 gb|KGF86144.1| Ribokinase [Prochlorococcus marinus str. EQPAC1]
Length=338

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 175/331 (53%), Gaps = 22/331 (7%)
 Frame = +3

Query  630   DVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGGSL  806
             D++GLG A+VD    VDD+FLE   L+KG+  ++N  E   +L+    C+  K  +GGS 
Sbjct  15    DLIGLGNAIVDIIVNVDDEFLEINTLKKGSMNLINSNESEALLK---NCTVIKKISGGSS  71

Query  807   SNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG-TTG  983
             +N++V LA L          ++   G V +D  G F+ + ++R+N  F + P+  G ++ 
Sbjct  72    ANTVVCLAELDN--------NVQFIGRVKNDNFGNFFSTDIKRSNTIFNTPPIDKGPSSA  123

Query  984   TVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIAK  1157
               I+  TPDAQRTM  Y G S  I +EP     + I+ +K L +EGYL++         +
Sbjct  124   HSIIFITPDAQRTMCTYLGAS--IEFEPKDVNYKLIANSKYLYLEGYLWDSDLAKNAFLQ  181

Query  1158  ACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPD  1337
             A + A+     + ++ SD  C++RH + F E+I NY DIVF N  E  +   F+ N+   
Sbjct  182   AAKLAKESDTKIILSLSDSFCVDRHRESFLELIENYIDIVFCNESEVLSL--FQEND-LQ  238

Query  1338  SAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPC-MPLDTCGAGDAYASGILYGIL  1514
                  +S    LV +T G++GS +  K ++  + P      +DT GAGD YA G ++G++
Sbjct  239   RCQESISSICELVIITLGSKGSLVVNKDKSEEIKPKLLGKIIDTTGAGDLYAGGFIHGLI  298

Query  1515  RGVSDLKDVGTLAAKVASVVVGQQGTRLRVQ  1607
                S LK  G + +  A  ++ Q G+R  + 
Sbjct  299   NNYS-LKKCGEIGSICAGQIITQLGSRSNIN  328



>ref|WP_018308277.1| carbohydrate kinase [Acetobacter aceti]
Length=329

 Score =   167 bits (422),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 171/334 (51%), Gaps = 23/334 (7%)
 Frame = +3

Query  615   LSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKA-A  791
             +++ +D+ G+G A+ D    V  DFLE  GL  G+  +++ E+R K LR  D    +   
Sbjct  1     MTILYDLCGIGNAITDVLAKVSFDFLEAQGLVAGSMTLID-EDRVKTLR--DAVQVECET  57

Query  792   AGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKD  971
              GGS +N+ V  A+LG +        +A  G V  D  G  +   +R   V F S P+ D
Sbjct  58    GGGSAANTCVTAAQLGAR--------VAYLGKVSGDTAGNAFSDDMRGCGVTFPSKPL-D  108

Query  972   G------TTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
             G       T + IVL TPD QRTM  Y G  +  + E  L   I+ + I+ +EGYLF+ P
Sbjct  109   GRLGANLATASCIVLITPDGQRTMCTYLGACTQFSPEDVLPDVIASSSIVYLEGYLFDPP  168

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
                +   +A   A   G  V+++ SD  C+ RH D F ++I  + DI+F N +E    C 
Sbjct  169   HAQEAFRRAATLAHNAGRQVSLSLSDPFCVGRHRDAFLDLIKGHIDILFANENE---ICA  225

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
                 +  ++AAR+++      ++T   +GS +   GE V V P P   +DT GAGDAYA+
Sbjct  226   LYQTDKFETAARHVAEDTTFAALTRSEQGSVVIRGGERVDVAPVPTQVVDTTGAGDAYAA  285

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G L G+    S L++ G LA+  AS V+   G R
Sbjct  286   GFLTGLTSNRS-LEECGRLASLAASEVISHYGAR  318



>ref|WP_009505872.1| adenosine kinase [Citreicella sp. 357]
 gb|EIE49886.1| PfkB family kinase, putative [Citreicella sp. 357]
Length=338

 Score =   167 bits (423),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 163/338 (48%), Gaps = 20/338 (6%)
 Frame = +3

Query  597   SSPTSVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGC  776
             S PT     ++ V+G+G A+VD     DD FL+ +G+EKG  ++V  E   ++  AM   
Sbjct  4     SHPTK----KYAVVGIGNAIVDVLTRADDSFLDHMGIEKGIMQLVERERAEQLYGAM--S  57

Query  777   SYKAAAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLS  956
                 A GGS++N+L  L +LG        L     G V  D LG FY   L     +F++
Sbjct  58    DRVQAPGGSVANTLAGLGKLG--------LRTGFVGRVRDDALGRFYAKGLTDDGTDFVN  109

Query  957   APV--KDGTTGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFEL  1130
              P+   D  T   ++  +PD +R+M  Y G S+ +  +       S+ +I+ +EGYLF+ 
Sbjct  110   PPIAGNDLPTSRSMIFVSPDGERSMNTYLGISAELGPDDVSEDIASQAEIVFLEGYLFDK  169

Query  1131  PDTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFC  1310
             P   +   +     R  G +  I  SD  C+ERH DDF  +IAN  D V  N  E R+  
Sbjct  170   PKGKEAFTRMARGCRAAGGMAGIAISDPFCVERHRDDFLRLIANEMDYVIGNEAEIRSLY  229

Query  1311  HFRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYA  1490
                 ++  D     ++   PLV  T    G  +   GE + VP +   P+D  GAGD +A
Sbjct  230   Q---DDHLDKDLARVAAVCPLVVCTRSGDGVTVMHDGERIDVPVTKVTPVDATGAGDQFA  286

Query  1491  SGILYGILRGVSDLKDVGTLAAKVASVVVGQQGTRLRV  1604
             +G LYG+  G +DL+    +    AS V+G  G R  V
Sbjct  287   AGFLYGLATG-ADLQTAARMGVVAASEVIGHMGPRPEV  323



>ref|WP_032517792.1| carbohydrate kinase [Prochlorococcus marinus]
 gb|KGG03648.1| Fructokinase [Prochlorococcus marinus str. MIT 9321]
 gb|KGG04787.1| Fructokinase [Prochlorococcus marinus str. MIT 9322]
 gb|KGG07473.1| Fructokinase [Prochlorococcus marinus str. MIT 9401]
Length=336

 Score =   167 bits (423),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 176/338 (52%), Gaps = 23/338 (7%)
 Frame = +3

Query  627   WDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCS-YKAAAGGS  803
             +D++GLG A+VD    ++D+FL+   LEKG+  ++N +E  K+L   + C   K  +GGS
Sbjct  14    FDLIGLGNAIVDIIVNIEDEFLQINNLEKGSMNLINSDESKKLL---ENCKVIKQISGGS  70

Query  804   LSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDG-TT  980
              +N++V LA LG          +   G V +D  G+F+ S ++++N  F + P   G +T
Sbjct  71    SANTVVCLAELGNH--------VQFIGRVKNDQFGDFFSSDIKKSNTIFNTPPTNKGPST  122

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEP--FLARAISRTKILVVEGYLFELPDTIKTIA  1154
                I+L TPDAQRTM  Y G S  I +EP       +  +K L +EGYL++         
Sbjct  123   AHSIILITPDAQRTMCTYLGAS--IEFEPKDIDFTVLEESKYLYLEGYLWDSELAKNAFL  180

Query  1155  KACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESP  1334
             KA   A+     + ++ SD  C++RH + F ++I  Y DIVF N  E  +   F+ ++  
Sbjct  181   KAARIAKNSNTKIILSLSDSFCVDRHRESFLKLIDEYVDIVFCNESEVLSL--FKKDKLA  238

Query  1335  DSAARYLSHFVPLVSVTDGARGSYIGVKGE-AVYVPPSPCMPLDTCGAGDAYASGILYGI  1511
             +     LS    LV VT G+ GS I  K +  V    +    +DT GAGD YA G ++G+
Sbjct  239   NCQGD-LSSLCELVVVTLGSNGSLIINKNDIEVINSMTGEKVIDTTGAGDIYAGGFIHGL  297

Query  1512  LRGVSDLKDVGTLAAKVASVVVGQQGTRLRVQDASELA  1625
             +   S LK  G + +  A  ++ Q G+R  + D  EL 
Sbjct  298   INNYS-LKKCGEIGSICAGQIITQLGSRSNI-DLKELV  333



>ref|WP_006557422.1| carbohydrate kinase [Acetobacter tropicalis]
 dbj|GAA07408.1| sugar kinase PfkB [Acetobacter tropicalis NBRC 101654]
Length=356

 Score =   167 bits (424),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 106/334 (32%), Positives = 165/334 (49%), Gaps = 19/334 (6%)
 Frame = +3

Query  609   SVLSMRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKA  788
             +V   ++D+LG+G A+ D    V+  FL++ GL  G+  +++ +    +   +   + + 
Sbjct  26    TVSETKYDILGIGNAITDILANVEPSFLQQQGLTPGSMTLIDVDRANALTATLK--TERV  83

Query  789   AAGGSLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVK  968
               GGS +N+ V  A+ G +        +A  G V  D  G+ +   LR   + F SAP+ 
Sbjct  84    MGGGSAANTCVVAAQFGAR--------VAYLGKVARDQAGDTFAQDLRENGITFPSAPLD  135

Query  969   DGT-----TGTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELP  1133
               T     T   IV+ TPD QRTM  Y G  +  T +  +   I+ + I+ +EGYLF+ P
Sbjct  136   GHTYENLPTARCIVMVTPDGQRTMATYLGACTYFTPDDVIQETIAASSIVYLEGYLFDPP  195

Query  1134  DTIKTIAKACEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCH  1313
                +   +A   A + G  VA+T SD  C+ RH   F +++  + DI+F N DE    C 
Sbjct  196   HAQEAFRRAATLAHQNGRQVALTLSDPFCVGRHRQAFLDLVRGHIDILFANEDE---ICA  252

Query  1314  FRSNESPDSAARYLSHFVPLVSVTDGARGSYIGVKGEAVYVPPSPCMPLDTCGAGDAYAS  1493
                 E  D+AAR+        ++T    GS I   G+   V P P   +DT GAGDAYA+
Sbjct  253   LYETEDFDTAARHTEQDTTFAALTRSGLGSVIIHDGQRTKVDPVPTQVVDTTGAGDAYAA  312

Query  1494  GILYGILRGVSDLKDVGTLAAKVASVVVGQQGTR  1595
             G L G+  G + L + G LA+  AS ++   G R
Sbjct  313   GFLAGLTSGRT-LPECGRLASVAASEIISHVGAR  345



>ref|WP_017952531.1| hypothetical protein [Nitrospina sp. SCGC AAA288-L16]
Length=333

 Score =   167 bits (422),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 164/329 (50%), Gaps = 13/329 (4%)
 Frame = +3

Query  621   MRWDVLGLGQAMVDFSGMVDDDFLEKLGLEKGTRKVVNHEERGKILRAMDGCSYKAAAGG  800
             M++D+LG+G A+VD    VDD+F+++  L KG   +++ E++ KIL+ + G S K ++GG
Sbjct  1     MKYDLLGIGNALVDIEVCVDDEFIKQNSLTKGGMTLLSAEKQNKILKELHGLSTKISSGG  60

Query  801   SLSNSLVALARLGGQPIGGPALSIAMAGSVGSDPLGEFYRSKLRRANVNFLSAPVKDGTT  980
             S +N++  L+ LGG+            G V +D  G+ Y   +R   V+F         T
Sbjct  61    SAANTIHGLSILGGETY--------YIGRVANDIYGKHYVEDMRSCGVSFSGTGNSLSET  112

Query  981   GTVIVLTTPDAQRTMLAYQGTSSTITYEPFLARAISRTKILVVEGYLFELPDTIKTIAKA  1160
             GT ++L TPD++RTML + G SS +  +    + I    ++ +EGYL+   DT     K 
Sbjct  113   GTCVILVTPDSERTMLTHLGASSLLHPDNVDEKIIKNAGMVYIEGYLWTGEDTCNAAEKL  172

Query  1161  CEDARRFGALVAITASDVSCIERHYDDFWEIIANYADIVFTNSDEARAFCHFRSNESPDS  1340
             C+ A++    VA T SD   +        + I    DI+F N  EA+        E    
Sbjct  173   CKIAKKNKTPVAFTLSDAFIVNSFKKRLIDFIRQNVDILFCNDIEAKTMAE---TEDTQE  229

Query  1341  AARYLSHFVPLVSVTDGARGSYIGV-KGEAVYVPPSPCMPLDTCGAGDAYASGILYGILR  1517
             A   L   V  V VT G  GS       E + V   P   +D  GAGD +A+G LYGI+R
Sbjct  230   AFDALKRIVETVFVTRGENGSLASNPTEEKIIVNVFPTKAIDATGAGDLFAAGALYGIIR  289

Query  1518  GVSDLKDVGTLAAKVASVVVGQQGTRLRV  1604
               S LKD   + +  AS VV   G R+ V
Sbjct  290   NYS-LKDSAIIGSYCASKVVSHMGGRMPV  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5274346440832