BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21032_g2_i1 len=1025 path=[1007:0-1024]

Length=1025
                                                                      Score     E

ref|XP_010103479.1|  putative glutathione S-transferase                 254   1e-79   
ref|XP_004294220.1|  PREDICTED: probable glutathione S-transferas...    252   9e-79   
emb|CAN83043.1|  hypothetical protein VITISV_027913                     251   2e-78   Vitis vinifera
ref|XP_011082829.1|  PREDICTED: probable glutathione S-transferase      250   3e-78   
ref|XP_010087165.1|  putative glutathione S-transferase                 250   5e-78   
ref|XP_007149247.1|  hypothetical protein PHAVU_005G054100g             250   5e-78   
ref|XP_002265110.1|  PREDICTED: probable glutathione S-transferase      249   1e-77   Vitis vinifera
ref|XP_002262767.1|  PREDICTED: probable glutathione S-transferase      248   2e-77   Vitis vinifera
ref|XP_009757658.1|  PREDICTED: probable glutathione S-transferase      248   2e-77   
ref|XP_009616059.1|  PREDICTED: probable glutathione S-transferase      248   3e-77   
ref|XP_003634746.1|  PREDICTED: probable glutathione S-transferase      248   3e-77   
ref|XP_007212030.1|  hypothetical protein PRUPE_ppa011202mg             248   3e-77   
emb|CAN66702.1|  hypothetical protein VITISV_005451                     248   3e-77   Vitis vinifera
ref|XP_002264437.1|  PREDICTED: probable glutathione S-transferase      248   3e-77   Vitis vinifera
emb|CDP06112.1|  unnamed protein product                                248   4e-77   
ref|XP_007149246.1|  hypothetical protein PHAVU_005G054000g             247   6e-77   
ref|XP_002264825.1|  PREDICTED: probable glutathione S-transferas...    246   1e-76   Vitis vinifera
ref|XP_003634747.1|  PREDICTED: probable glutathione S-transferas...    246   1e-76   
ref|XP_003634751.1|  PREDICTED: probable glutathione S-transferase      246   1e-76   
gb|AEI01103.1|  glutathione transferase                                 246   2e-76   
emb|CDP20885.1|  unnamed protein product                                246   2e-76   
emb|CDP11579.1|  unnamed protein product                                246   2e-76   
emb|CAA45741.1|  C-7                                                    246   2e-76   Nicotiana tabacum [American tobacco]
gb|ABL84692.1|  glutathione S-transferase                               245   3e-76   Vitis vinifera
ref|XP_010537670.1|  PREDICTED: glutathione S-transferase U19-like      245   3e-76   
ref|XP_002263638.1|  PREDICTED: probable glutathione S-transferase      245   3e-76   Vitis vinifera
ref|XP_009781253.1|  PREDICTED: probable glutathione S-transferase      244   8e-76   
ref|XP_003634749.1|  PREDICTED: probable glutathione S-transferas...    244   9e-76   
ref|XP_003634752.1|  PREDICTED: probable glutathione S-transferas...    244   9e-76   
ref|XP_010103480.1|  putative glutathione S-transferase                 244   1e-75   
emb|CAI48072.1|  glutathione S-transferase/peroxidase                   244   1e-75   Capsicum chinense [bonnet pepper]
ref|XP_004251828.1|  PREDICTED: probable glutathione S-transferas...    243   2e-75   
gb|KDP24710.1|  hypothetical protein JCGZ_25701                         243   2e-75   
ref|XP_010062724.1|  PREDICTED: probable glutathione S-transferase      245   2e-75   
ref|XP_008382602.1|  PREDICTED: probable glutathione S-transferase      243   2e-75   
ref|XP_010103478.1|  putative glutathione S-transferase                 243   4e-75   
ref|XP_007149248.1|  hypothetical protein PHAVU_005G054200g             243   4e-75   
ref|XP_009776045.1|  PREDICTED: probable glutathione S-transferas...    242   4e-75   
ref|XP_010644726.1|  PREDICTED: probable glutathione S-transferas...    242   6e-75   
ref|NP_001237713.1|  2,4-D inducible glutathione S-transferase          242   7e-75   
pdb|2VO4|A  Chain A, Glutathione Transferase From Glycine Max           242   7e-75   
gb|KFK42224.1|  hypothetical protein AALP_AA2G227300                    241   8e-75   
ref|XP_011098135.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    241   9e-75   
ref|XP_010060812.1|  PREDICTED: probable glutathione S-transferase      241   1e-74   
ref|XP_006364366.1|  PREDICTED: probable glutathione S-transferas...    241   2e-74   
ref|XP_008226272.1|  PREDICTED: probable glutathione S-transferas...    241   2e-74   
ref|XP_009759836.1|  PREDICTED: probable glutathione S-transferase      241   2e-74   
ref|XP_004243192.1|  PREDICTED: probable glutathione S-transferase      241   2e-74   
ref|XP_007213483.1|  hypothetical protein PRUPE_ppa023395mg             241   2e-74   
ref|XP_009344316.1|  PREDICTED: probable glutathione S-transferase      241   2e-74   
ref|XP_009778021.1|  PREDICTED: probable glutathione S-transferase      240   2e-74   
ref|XP_002263395.1|  PREDICTED: probable glutathione S-transferase      240   3e-74   Vitis vinifera
gb|ABG90381.2|  glutathione S-transferase                               240   3e-74   Caragana korshinskii
gb|AEF79856.1|  glutathione-S-transferase tau 1                         239   4e-74   
ref|XP_008451810.1|  PREDICTED: probable glutathione S-transferas...    239   4e-74   
ref|XP_004147764.1|  PREDICTED: probable glutathione S-transferas...    239   5e-74   
gb|AFK35485.1|  unknown                                                 239   6e-74   
gb|AFK42157.1|  unknown                                                 239   8e-74   
ref|XP_006584638.1|  PREDICTED: glutathione S-transferase GST 9 i...    238   1e-73   
ref|XP_004488707.1|  PREDICTED: probable glutathione S-transferas...    238   2e-73   
ref|XP_009347994.1|  PREDICTED: probable glutathione S-transferase      238   2e-73   
ref|XP_010245130.1|  PREDICTED: probable glutathione S-transferas...    238   2e-73   
ref|XP_006389991.1|  hypothetical protein EUTSA_v10019118mg             238   3e-73   
ref|XP_006478015.1|  PREDICTED: probable glutathione S-transferas...    238   3e-73   
emb|CDP06113.1|  unnamed protein product                                237   3e-73   
ref|XP_009612277.1|  PREDICTED: probable glutathione S-transferas...    237   4e-73   
gb|AFK34240.1|  unknown                                                 237   5e-73   
ref|XP_002262644.1|  PREDICTED: probable glutathione S-transferase      237   5e-73   Vitis vinifera
ref|XP_003634776.1|  PREDICTED: probable glutathione S-transferas...    237   5e-73   
ref|XP_008226266.1|  PREDICTED: probable glutathione S-transferas...    236   9e-73   
gb|AFK49533.1|  unknown                                                 236   1e-72   
ref|XP_008226264.1|  PREDICTED: probable glutathione S-transferase      236   1e-72   
ref|XP_006364367.1|  PREDICTED: probable glutathione S-transferas...    236   1e-72   
ref|XP_004243193.1|  PREDICTED: probable glutathione S-transferas...    236   1e-72   
ref|XP_006442220.1|  hypothetical protein CICLE_v10022164mg             236   2e-72   
emb|CDP06114.1|  unnamed protein product                                235   2e-72   
gb|EYU26251.1|  hypothetical protein MIMGU_mgv1a013400mg                235   2e-72   
ref|XP_010087160.1|  putative glutathione S-transferase                 235   2e-72   
gb|ACL80571.1|  glutathione S-transferase                               235   3e-72   Glycine max [soybeans]
gb|ACA83740.1|  auxin-induced glutathione S transferase                 234   4e-72   Prosopis juliflora [algorrobo]
ref|XP_007149245.1|  hypothetical protein PHAVU_005G054000g             233   7e-72   
ref|NP_565178.1|  glutathione S-transferase TAU 19                      234   7e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238691.1|  glutathione S-transferase                          234   8e-72   
gb|AAR26529.1|  glutathione S-transferase 2                             234   8e-72   Glycine max [soybeans]
gb|KHN27773.1|  Putative glutathione S-transferase                      234   9e-72   
gb|ACJ85907.1|  unknown                                                 234   9e-72   Medicago truncatula
ref|XP_002300487.1|  hypothetical protein POPTR_0001s42820g             234   1e-71   Populus trichocarpa [western balsam poplar]
gb|ADB11314.1|  tau class glutathione transferase GSTU9                 234   1e-71   Populus trichocarpa [western balsam poplar]
emb|CAN81905.1|  hypothetical protein VITISV_006049                     233   1e-71   Vitis vinifera
gb|EYU26248.1|  hypothetical protein MIMGU_mgv1a023011mg                233   1e-71   
ref|XP_007212046.1|  hypothetical protein PRUPE_ppa011371mg             233   1e-71   
ref|NP_001236486.1|  glutathione S-transferase GST 9                    233   1e-71   
ref|XP_008372264.1|  PREDICTED: probable glutathione S-transferase      233   1e-71   
gb|EYU26247.1|  hypothetical protein MIMGU_mgv1a013356mg                233   2e-71   
ref|XP_009759844.1|  PREDICTED: probable glutathione S-transferas...    233   2e-71   
ref|XP_007022199.1|  Glutathione S-transferase TAU 19                   233   2e-71   
ref|NP_001236312.1|  glutathione transferase                            233   2e-71   
gb|KHG29593.1|  putative glutathione S-transferase                      233   3e-71   
ref|XP_010428964.1|  PREDICTED: glutathione S-transferase U19-like      233   3e-71   
sp|P50471.1|GSTX1_NICPL  RecName: Full=Probable glutathione S-tra...    233   3e-71   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002532823.1|  glutathione s-transferase, putative                232   3e-71   Ricinus communis
ref|XP_010472053.1|  PREDICTED: glutathione S-transferase U19-like      232   3e-71   
gb|KFK42223.1|  hypothetical protein AALP_AA2G227200                    232   3e-71   
gb|ACJ84159.1|  unknown                                                 232   3e-71   Medicago truncatula
sp|P49332.1|GSTXC_TOBAC  RecName: Full=Probable glutathione S-tra...    232   3e-71   Nicotiana tabacum [American tobacco]
ref|XP_004243196.1|  PREDICTED: probable glutathione S-transferase      233   3e-71   
gb|ABG73419.1|  glutathione S-transferase isoform 1                     232   4e-71   Castanea crenata [Japanese chestnut]
gb|KEH38385.1|  glutathione S-transferase, amino-terminal domain ...    232   4e-71   
gb|ACJ84004.1|  unknown                                                 232   5e-71   Medicago truncatula
ref|XP_007213037.1|  hypothetical protein PRUPE_ppa020220mg             232   5e-71   
gb|KDP43662.1|  hypothetical protein JCGZ_24120                         232   5e-71   
ref|XP_009616058.1|  PREDICTED: probable glutathione S-transferase      232   5e-71   
ref|XP_007212042.1|  hypothetical protein PRUPE_ppa011334mg             231   5e-71   
gb|ACU13552.1|  unknown                                                 231   6e-71   Glycine max [soybeans]
ref|XP_007214172.1|  hypothetical protein PRUPE_ppa019045mg             231   7e-71   
ref|XP_008226269.1|  PREDICTED: probable glutathione S-transferas...    231   8e-71   
ref|XP_010245128.1|  PREDICTED: probable glutathione S-transferase      231   8e-71   
gb|AAO61854.1|  glutathione S-transferase U1                            231   8e-71   Malva pusilla
ref|NP_001236181.1|  glutathione S-transferase 3                        231   9e-71   
gb|EYU26250.1|  hypothetical protein MIMGU_mgv1a022085mg                231   1e-70   
gb|KHN27770.1|  Putative glutathione S-transferase                      230   1e-70   
gb|KEH38377.1|  glutathione S-transferase, amino-terminal domain ...    231   1e-70   
gb|ACU15945.1|  unknown                                                 231   1e-70   Glycine max [soybeans]
gb|AAM64593.1|  glutathione transferase, putative                       231   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AEB77867.1|  glutathione S-transferase protein                       231   2e-70   
emb|CAA04391.1|  glutathione transferase                                230   2e-70   Carica papaya [mamon]
ref|XP_002300483.2|  hypothetical protein POPTR_0001s42760g             230   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_008383009.1|  PREDICTED: probable glutathione S-transferase      230   2e-70   
gb|ADC95628.1|  glutathione S-transferase                               230   2e-70   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009354819.1|  PREDICTED: probable glutathione S-transferas...    230   2e-70   
ref|XP_008451814.1|  PREDICTED: probable glutathione S-transferase      230   2e-70   
ref|XP_006366776.1|  PREDICTED: probable glutathione S-transferas...    230   3e-70   
ref|XP_002317608.1|  glutathione transferase family protein             230   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_002266007.2|  PREDICTED: probable glutathione S-transferase      230   3e-70   Vitis vinifera
ref|XP_010644811.1|  PREDICTED: probable glutathione S-transferase      230   3e-70   
ref|XP_011082832.1|  PREDICTED: glutathione S-transferase U25-like      230   4e-70   
ref|XP_006302801.1|  hypothetical protein CARUB_v10020928mg             229   5e-70   
ref|XP_004147761.1|  PREDICTED: probable glutathione S-transferas...    229   6e-70   
gb|KHG06513.1|  putative glutathione S-transferase                      229   6e-70   
gb|ACI42271.1|  glutathione S-transferase Tau2                          229   6e-70   Citrus sinensis [apfelsine]
gb|KHN27766.1|  Glutathione S-transferase 3                             229   7e-70   
ref|XP_009354827.1|  PREDICTED: probable glutathione S-transferase      229   7e-70   
ref|XP_010060817.1|  PREDICTED: glutathione S-transferase U19-like      229   9e-70   
gb|KDP37218.1|  hypothetical protein JCGZ_06274                         229   1e-69   
ref|XP_010694823.1|  PREDICTED: probable glutathione S-transferase      228   1e-69   
ref|XP_002269705.1|  PREDICTED: probable glutathione S-transferase      228   1e-69   Vitis vinifera
gb|KEH38383.1|  glutathione S-transferase, amino-terminal domain ...    228   1e-69   
ref|XP_002298938.2|  hypothetical protein POPTR_0001s42790g             228   1e-69   Populus trichocarpa [western balsam poplar]
gb|AHI54570.1|  glutathione S-transferase                               228   1e-69   
gb|EYU26253.1|  hypothetical protein MIMGU_mgv1a013454mg                228   1e-69   
ref|NP_001234157.1|  glutathione S-transferase-like protein             228   2e-69   
ref|XP_009344314.1|  PREDICTED: probable glutathione S-transferase      228   2e-69   
ref|XP_004243195.1|  PREDICTED: probable glutathione S-transferase      228   2e-69   
ref|XP_008226256.1|  PREDICTED: probable glutathione S-transferas...    227   3e-69   
gb|EYU26249.1|  hypothetical protein MIMGU_mgv1a013392mg                227   3e-69   
emb|CDY14615.1|  BnaC02g24980D                                          227   4e-69   
ref|XP_008226270.1|  PREDICTED: probable glutathione S-transferas...    227   4e-69   
emb|CDY26861.1|  BnaA02g18860D                                          227   5e-69   
ref|XP_002270159.1|  PREDICTED: probable glutathione S-transferase      227   5e-69   Vitis vinifera
ref|XP_006366777.1|  PREDICTED: probable glutathione S-transferas...    227   5e-69   
ref|XP_007212347.1|  hypothetical protein PRUPE_ppa014555mg             226   6e-69   
gb|KEH38382.1|  glutathione S-transferase, amino-terminal domain ...    226   7e-69   
ref|XP_009783951.1|  PREDICTED: probable glutathione S-transferas...    226   7e-69   
ref|XP_007214499.1|  hypothetical protein PRUPE_ppa018063mg             226   7e-69   
ref|XP_004248222.1|  PREDICTED: probable glutathione S-transferase      226   8e-69   
ref|XP_009354818.1|  PREDICTED: probable glutathione S-transferas...    226   9e-69   
ref|XP_011030768.1|  PREDICTED: probable glutathione S-transferase      226   1e-68   
gb|AAO61855.1|  glutathione S-transferase U2                            226   1e-68   Malva pusilla
gb|AFK44154.1|  unknown                                                 226   1e-68   
emb|CDX68016.1|  BnaA07g20560D                                          226   1e-68   
emb|CDX79261.1|  BnaC06g20420D                                          226   1e-68   
ref|XP_011013656.1|  PREDICTED: probable glutathione S-transferase      226   1e-68   
ref|XP_009104572.1|  PREDICTED: glutathione S-transferase U19           226   1e-68   
ref|XP_011036235.1|  PREDICTED: probable glutathione S-transferase      226   1e-68   
gb|ABZ80407.1|  tau glutathione S-transferase                           226   1e-68   Casuarina glauca
ref|XP_006442222.1|  hypothetical protein CICLE_v10022154mg             226   1e-68   
ref|XP_006477979.1|  PREDICTED: probable glutathione S-transferas...    226   1e-68   
ref|XP_003628404.1|  Glutathione S-transferase                          225   2e-68   
ref|XP_009591608.1|  PREDICTED: probable glutathione S-transferas...    225   2e-68   
ref|XP_008226260.1|  PREDICTED: probable glutathione S-transferase      225   2e-68   
ref|XP_010060810.1|  PREDICTED: probable glutathione S-transferas...    224   3e-68   
ref|XP_008226263.1|  PREDICTED: probable glutathione S-transferase      224   3e-68   
gb|ADB11350.1|  putative tau class glutathione transferase GSTU10       224   3e-68   Populus trichocarpa [western balsam poplar]
gb|KDP43660.1|  hypothetical protein JCGZ_24118                         225   3e-68   
ref|NP_001234379.1|  glutathione S-transferase/peroxidase               224   4e-68   
ref|XP_011098134.1|  PREDICTED: probable glutathione S-transferas...    224   4e-68   
gb|ACU15760.1|  unknown                                                 224   5e-68   Glycine max [soybeans]
ref|XP_007212678.1|  hypothetical protein PRUPE_ppa018428mg             224   5e-68   
ref|XP_007214387.1|  hypothetical protein PRUPE_ppb009345mg             224   5e-68   
gb|ADB11346.1|  tau class glutathione transferase GSTU4                 224   6e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010060811.1|  PREDICTED: probable glutathione S-transferas...    224   6e-68   
gb|KHF99304.1|  putative glutathione S-transferase                      224   6e-68   
ref|XP_003596129.1|  Glutathione S-transferase                          224   6e-68   
ref|XP_006360016.1|  PREDICTED: probable glutathione S-transferas...    224   7e-68   
ref|XP_008451812.1|  PREDICTED: glutathione S-transferase U25-like      224   7e-68   
gb|KDO38596.1|  hypothetical protein CISIN_1g027727mg                   224   7e-68   
ref|XP_002300482.1|  hypothetical protein POPTR_0001s42750g             224   8e-68   Populus trichocarpa [western balsam poplar]
ref|NP_173161.1|  glutathione S-transferase TAU 25                      224   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275790.1|  glutathione S-transferase                          223   8e-68   
gb|ABG73420.1|  glutathione S-transferase isoform 2                     224   8e-68   Castanea crenata [Japanese chestnut]
dbj|BAB32446.2|  glutathione S-transferase                              223   1e-67   Matricaria chamomilla
ref|XP_006389992.1|  hypothetical protein EUTSA_v10019114mg             223   1e-67   
ref|NP_001234094.1|  uncharacterized protein LOC543817                  223   1e-67   
ref|XP_006442221.1|  hypothetical protein CICLE_v10022193mg             223   1e-67   
ref|XP_007133435.1|  hypothetical protein PHAVU_011G178400g             223   1e-67   
ref|XP_007149244.1|  hypothetical protein PHAVU_005G053900g             223   2e-67   
gb|ADB11349.1|  tau class glutathione transferase GSTU8                 223   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_008451813.1|  PREDICTED: probable glutathione S-transferase      225   2e-67   
ref|XP_004510706.1|  PREDICTED: probable glutathione S-transferas...    223   2e-67   
ref|XP_006305593.1|  hypothetical protein CARUB_v10010257mg             223   2e-67   
gb|AFK35203.1|  unknown                                                 222   2e-67   
emb|CBI32903.3|  unnamed protein product                                226   3e-67   
ref|XP_008360299.1|  PREDICTED: probable glutathione S-transferase      222   3e-67   
gb|KHN26783.1|  Glutathione S-transferase 3                             222   3e-67   
ref|XP_008360298.1|  PREDICTED: probable glutathione S-transferase      222   4e-67   
ref|XP_002300485.1|  hypothetical protein POPTR_0001s42800g             222   5e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011036234.1|  PREDICTED: probable glutathione S-transferase      221   5e-67   
ref|XP_010923803.1|  PREDICTED: probable glutathione S-transferas...    222   5e-67   
ref|XP_008226262.1|  PREDICTED: probable glutathione S-transferase      221   6e-67   
ref|XP_004147762.1|  PREDICTED: glutathione S-transferase U19-like      221   6e-67   
ref|XP_009418988.1|  PREDICTED: probable glutathione S-transferas...    221   7e-67   
ref|XP_004294221.1|  PREDICTED: probable glutathione S-transferas...    221   7e-67   
ref|XP_009104573.1|  PREDICTED: glutathione S-transferase U20           221   8e-67   
ref|XP_011082830.1|  PREDICTED: glutathione S-transferase U25-like      221   8e-67   
ref|XP_011030763.1|  PREDICTED: probable glutathione S-transferas...    221   9e-67   
emb|CAC24549.1|  glutathione S-transferase                              221   1e-66   Cichorium intybus x Cichorium endivia
ref|XP_010087162.1|  putative glutathione S-transferase parC            221   1e-66   
gb|ADB11313.1|  tau class glutathione transferase GSTU6                 221   1e-66   Populus trichocarpa [western balsam poplar]
emb|CDX68017.1|  BnaA07g20570D                                          221   1e-66   
ref|XP_009117717.1|  PREDICTED: glutathione S-transferase U25-like      220   1e-66   
gb|KFK25183.1|  hypothetical protein AALP_AA8G077600                    220   1e-66   
gb|ABD36807.1|  glutathione S-transferase                               220   1e-66   Brassica napus [oilseed rape]
ref|XP_006370194.1|  hypothetical protein POPTR_0001s40510g             220   2e-66   
ref|XP_008226267.1|  PREDICTED: probable glutathione S-transferase      220   2e-66   
ref|XP_010498064.1|  PREDICTED: glutathione S-transferase U25-like      220   2e-66   
ref|XP_004147763.1|  PREDICTED: probable glutathione S-transferas...    220   3e-66   
ref|XP_008390702.1|  PREDICTED: probable glutathione S-transferase      220   3e-66   
gb|ACA83743.1|  auxin-induced glutathione S transferase                 219   3e-66   Prosopis juliflora [algorrobo]
gb|EYU38214.1|  hypothetical protein MIMGU_mgv1a013218mg                220   3e-66   
ref|XP_002264813.1|  PREDICTED: probable glutathione S-transferas...    219   4e-66   Vitis vinifera
ref|XP_010472052.1|  PREDICTED: glutathione S-transferase U20           219   4e-66   
gb|ADB11348.1|  tau class glutathione transferase GSTU7                 219   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010459291.1|  PREDICTED: glutathione S-transferase U25-like      219   4e-66   
ref|XP_010245129.1|  PREDICTED: probable glutathione S-transferas...    219   4e-66   
ref|XP_009117719.1|  PREDICTED: glutathione S-transferase U25           219   4e-66   
ref|XP_008390704.1|  PREDICTED: probable glutathione S-transferase      219   5e-66   
ref|XP_008226265.1|  PREDICTED: probable glutathione S-transferase      219   5e-66   
ref|XP_007212649.1|  hypothetical protein PRUPE_ppa018201mg             219   5e-66   
dbj|BAC21261.1|  glutathione S-transferase                              219   5e-66   Cucurbita maxima [Boston marrow]
ref|XP_009591606.1|  PREDICTED: probable glutathione S-transferase      219   5e-66   
ref|XP_010476862.1|  PREDICTED: glutathione S-transferase U25           219   6e-66   
ref|XP_011012342.1|  PREDICTED: probable glutathione S-transferase      219   6e-66   
ref|XP_010060816.1|  PREDICTED: glutathione S-transferase U25-like      219   6e-66   
ref|XP_010694833.1|  PREDICTED: probable glutathione S-transferase      218   8e-66   
ref|NP_177958.1|  glutathione S-transferase TAU 20                      218   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351205.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    218   1e-65   
ref|XP_002298937.1|  hypothetical protein POPTR_0001s42780g             218   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002298935.2|  hypothetical protein POPTR_0001s42770g             219   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004508074.1|  PREDICTED: glutathione S-transferase 3-like        218   1e-65   
ref|XP_006416731.1|  hypothetical protein EUTSA_v10008734mg             218   1e-65   
gb|AFK45916.1|  unknown                                                 218   1e-65   
ref|XP_009354820.1|  PREDICTED: probable glutathione S-transferase      218   2e-65   
ref|XP_002889189.1|  F3F9.11                                            229   2e-65   
gb|ADB11312.1|  tau class glutathione transferase GSTU3                 218   2e-65   Populus trichocarpa [western balsam poplar]
emb|CDP14180.1|  unnamed protein product                                217   3e-65   
ref|XP_008240792.1|  PREDICTED: probable glutathione S-transferas...    217   3e-65   
ref|XP_009110423.1|  PREDICTED: glutathione S-transferase U26           217   3e-65   
gb|KEH38379.1|  glutathione S-transferase, amino-terminal domain ...    217   3e-65   
ref|XP_004294219.1|  PREDICTED: probable glutathione S-transferas...    217   3e-65   
ref|XP_007149238.1|  hypothetical protein PHAVU_005G053300g             217   3e-65   
ref|XP_011048926.1|  PREDICTED: probable glutathione S-transferase      217   4e-65   
ref|XP_010428962.1|  PREDICTED: glutathione S-transferase U20-like      217   4e-65   
ref|XP_006305598.1|  hypothetical protein CARUB_v10010264mg             216   4e-65   
emb|CAN75492.1|  hypothetical protein VITISV_040292                     216   5e-65   Vitis vinifera
gb|AAM64587.1|  2,4-D inducible glutathione S-transferase, putative     216   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302800.1|  hypothetical protein CARUB_v10020927mg             216   6e-65   
gb|AAC28101.1|  glutathione S-transferase                               216   6e-65   Mesembryanthemum crystallinum
ref|XP_009149163.1|  PREDICTED: glutathione S-transferase U25-like      216   7e-65   
ref|XP_006366778.1|  PREDICTED: probable glutathione S-transferas...    216   7e-65   
ref|XP_011030762.1|  PREDICTED: probable glutathione S-transferas...    216   7e-65   
ref|XP_010476863.1|  PREDICTED: glutathione S-transferase U26           216   8e-65   
gb|ADB11329.1|  tau class glutathione transferase GSTU54                216   8e-65   
ref|XP_004243194.1|  PREDICTED: probable glutathione S-transferase      216   8e-65   
ref|XP_010459292.1|  PREDICTED: glutathione S-transferase U26-like      216   1e-64   
ref|XP_004295708.1|  PREDICTED: probable glutathione S-transferas...    216   1e-64   
ref|XP_002276792.1|  PREDICTED: probable glutathione S-transferas...    216   1e-64   
ref|XP_010923805.1|  PREDICTED: probable glutathione S-transferase      215   1e-64   
ref|XP_010923806.1|  PREDICTED: glutathione S-transferase U19-like      215   1e-64   
ref|NP_173162.1|  glutathione S-transferase tau 26                      215   1e-64   
gb|ADB11324.1|  tau class glutathione transferase GSTU33                215   1e-64   
ref|XP_010531898.1|  PREDICTED: glutathione S-transferase U25           215   1e-64   
ref|XP_008794506.1|  PREDICTED: probable glutathione S-transferas...    215   2e-64   
ref|XP_006302806.1|  hypothetical protein CARUB_v10020933mg             215   2e-64   
ref|XP_008390701.1|  PREDICTED: probable glutathione S-transferase      215   2e-64   
gb|ABK94892.1|  unknown                                                 215   2e-64   
ref|XP_002890209.1|  hypothetical protein ARALYDRAFT_471922             214   3e-64   
ref|XP_002262607.1|  PREDICTED: probable glutathione S-transferas...    214   3e-64   
gb|ADB11347.1|  tau class glutathione transferase GSTU5                 214   3e-64   
ref|XP_008809358.1|  PREDICTED: probable glutathione S-transferas...    214   4e-64   
ref|XP_003546774.1|  PREDICTED: probable glutathione S-transferas...    214   4e-64   
ref|XP_007205876.1|  hypothetical protein PRUPE_ppa011242mg             214   4e-64   
emb|CDX81808.1|  BnaC08g37930D                                          214   5e-64   
ref|XP_006598176.1|  PREDICTED: probable glutathione S-transferas...    214   5e-64   
emb|CDP04041.1|  unnamed protein product                                214   5e-64   
ref|XP_004295706.1|  PREDICTED: probable glutathione S-transferas...    214   6e-64   
gb|ADB11381.1|  tau class glutathione transferase GSTU58                214   6e-64   
ref|XP_011030766.1|  PREDICTED: probable glutathione S-transferase      214   6e-64   
ref|XP_010416820.1|  PREDICTED: glutathione S-transferase U20-like      213   7e-64   
ref|XP_002516074.1|  glutathione s-transferase, putative                213   7e-64   
ref|XP_006349999.1|  PREDICTED: probable glutathione S-transferas...    213   7e-64   
emb|CDX81810.1|  BnaC08g37910D                                          213   8e-64   
emb|CDY48476.1|  BnaC05g13360D                                          213   8e-64   
ref|XP_010472050.1|  PREDICTED: glutathione S-transferase U22           213   9e-64   
ref|XP_006387667.1|  hypothetical protein POPTR_0700s00200g             213   1e-63   
ref|XP_009106545.1|  PREDICTED: glutathione S-transferase U21           213   1e-63   
ref|XP_008451811.1|  PREDICTED: probable glutathione S-transferase      213   1e-63   
ref|XP_010428956.1|  PREDICTED: glutathione S-transferase U22-like      213   1e-63   
gb|AAF71798.1|AC013430_7  F3F9.11                                       224   1e-63   
ref|XP_008775490.1|  PREDICTED: probable glutathione S-transferas...    213   2e-63   
ref|XP_006432070.1|  hypothetical protein CICLE_v10002423mg             212   2e-63   
ref|XP_007154491.1|  hypothetical protein PHAVU_003G123300g             212   2e-63   
ref|XP_010923799.1|  PREDICTED: probable glutathione S-transferas...    213   2e-63   
ref|XP_009757657.1|  PREDICTED: probable glutathione S-transferas...    212   2e-63   
ref|XP_007149237.1|  hypothetical protein PHAVU_005G053200g             212   2e-63   
ref|XP_010060808.1|  PREDICTED: probable glutathione S-transferase      212   2e-63   
gb|KFK42222.1|  hypothetical protein AALP_AA2G227100                    212   3e-63   
gb|ACH87175.1|  glutathione S-transferase                               212   3e-63   
gb|KDP37215.1|  hypothetical protein JCGZ_06271                         212   3e-63   
gb|ADB11323.1|  tau class glutathione transferase GSTU31                212   3e-63   
ref|XP_007149236.1|  hypothetical protein PHAVU_005G053100g             212   3e-63   
ref|NP_001238712.1|  uncharacterized protein LOC100500477               212   3e-63   
gb|ACD84881.1|  probable glutathione S-transferase                      212   3e-63   
ref|XP_004251827.1|  PREDICTED: probable glutathione S-transferase      212   3e-63   
ref|XP_006389996.1|  hypothetical protein EUTSA_v10019120mg             211   4e-63   
ref|XP_011013655.1|  PREDICTED: probable glutathione S-transferase      211   4e-63   
dbj|BAK22528.1|  tau glutathione S-transferase                          211   5e-63   
ref|XP_006366779.1|  PREDICTED: probable glutathione S-transferas...    211   5e-63   
gb|ACJ86071.1|  unknown                                                 210   5e-63   
gb|AIP98335.1|  putative glutathione S-transferase                      211   5e-63   
ref|NP_001240982.1|  uncharacterized protein LOC100776076               211   6e-63   
gb|KEH38387.1|  glutathione S-transferase, amino-terminal domain ...    211   6e-63   
ref|XP_007146897.1|  hypothetical protein PHAVU_006G079600g             211   7e-63   
ref|XP_009104574.1|  PREDICTED: glutathione S-transferase U22           211   7e-63   
ref|XP_009117716.1|  PREDICTED: glutathione S-transferase U25-like      211   7e-63   
ref|XP_009354821.1|  PREDICTED: probable glutathione S-transferase      211   7e-63   
ref|XP_010060806.1|  PREDICTED: glutathione S-transferase U19-lik...    211   8e-63   
ref|XP_008360297.1|  PREDICTED: probable glutathione S-transferase      211   8e-63   
ref|XP_008775488.1|  PREDICTED: probable glutathione S-transferas...    210   1e-62   
ref|XP_003550998.1|  PREDICTED: glutathione S-transferase U25-like      210   1e-62   
ref|XP_010416816.1|  PREDICTED: glutathione S-transferase U22-like      210   2e-62   
ref|NP_177956.1|  glutathione S-transferase TAU 22                      210   2e-62   
ref|XP_006303293.1|  hypothetical protein CARUB_v10010098mg             211   2e-62   
ref|XP_006301003.1|  hypothetical protein CARUB_v10021393mg             210   2e-62   
gb|ACH63238.1|  glutathione-S-transferase 2                             210   2e-62   
gb|KFK42219.1|  hypothetical protein AALP_AA2G226800                    210   2e-62   
ref|XP_009418987.1|  PREDICTED: probable glutathione S-transferas...    210   2e-62   
ref|XP_011036748.1|  PREDICTED: probable glutathione S-transferase      209   2e-62   
emb|CDX88438.1|  BnaC06g38820D                                          209   2e-62   
ref|XP_006416732.1|  hypothetical protein EUTSA_v10008735mg             209   3e-62   
ref|XP_006387538.1|  hypothetical protein POPTR_0878s00210g             209   3e-62   
ref|NP_001237686.1|  glutathione S-transferase GST 16                   209   3e-62   
ref|XP_010041120.1|  PREDICTED: glutathione S-transferase U25-like      209   4e-62   
ref|XP_002889188.1|  hypothetical protein ARALYDRAFT_477001             209   4e-62   
ref|XP_011041780.1|  PREDICTED: probable glutathione S-transferas...    209   5e-62   
gb|ACG33497.1|  glutathione S-transferase                               209   5e-62   
ref|XP_002515772.1|  glutathione s-transferase, putative                208   5e-62   
gb|KDP37219.1|  hypothetical protein JCGZ_06275                         209   5e-62   
ref|XP_010428955.1|  PREDICTED: glutathione S-transferase U23-like      209   5e-62   
gb|AAM63471.1|  glutathione transferase, putative                       208   5e-62   
ref|XP_008390703.1|  PREDICTED: probable glutathione S-transferase      208   6e-62   
ref|NP_173160.1|  glutathione S-transferase TAU 24                      208   6e-62   
emb|CDX81809.1|  BnaC08g37920D                                          208   6e-62   
ref|NP_001146786.1|  GST6 protein                                       208   7e-62   
emb|CDX81807.1|  BnaC08g37940D                                          208   7e-62   
ref|XP_002516073.1|  glutathione s-transferase, putative                214   8e-62   
ref|NP_001105112.1|  glutathione transferase6                           208   8e-62   
ref|XP_006302785.1|  hypothetical protein CARUB_v10020906mg             208   9e-62   
ref|XP_004500374.1|  PREDICTED: probable glutathione S-transferas...    208   9e-62   
ref|XP_010501496.1|  PREDICTED: glutathione S-transferase U26-like      207   9e-62   
ref|NP_177955.1|  glutathione S-transferase TAU 23                      208   1e-61   
gb|KFK43910.1|  hypothetical protein AALP_AA1G190000                    207   1e-61   
emb|CAN68934.1|  hypothetical protein VITISV_002763                     208   1e-61   
gb|KFK42221.1|  hypothetical protein AALP_AA2G227000                    208   1e-61   
gb|KFK42217.1|  hypothetical protein AALP_AA2G226600                    207   1e-61   
gb|KDP45710.1|  hypothetical protein JCGZ_17317                         207   1e-61   
emb|CDY21757.1|  BnaA09g45080D                                          207   1e-61   
emb|CDY21756.1|  BnaA09g45070D                                          207   1e-61   
ref|XP_010040784.1|  PREDICTED: probable glutathione S-transferase      207   2e-61   
emb|CDX68018.1|  BnaA07g20580D                                          207   2e-61   
ref|XP_009783954.1|  PREDICTED: probable glutathione S-transferase      207   2e-61   
ref|XP_011098136.1|  PREDICTED: probable glutathione S-transferase      207   2e-61   
emb|CDX79259.1|  BnaC06g20440D                                          207   2e-61   
ref|XP_009106542.1|  PREDICTED: glutathione S-transferase U22-like      207   2e-61   
ref|XP_002890207.1|  hypothetical protein ARALYDRAFT_471920             207   2e-61   
ref|XP_010060807.1|  PREDICTED: glutathione S-transferase U25-lik...    207   2e-61   
gb|KHN27768.1|  Putative glutathione S-transferase                      207   3e-61   
ref|XP_009614585.1|  PREDICTED: probable glutathione S-transferase      207   3e-61   
ref|XP_010060804.1|  PREDICTED: glutathione S-transferase U25-like      206   3e-61   
ref|XP_011029535.1|  PREDICTED: probable glutathione S-transferas...    207   3e-61   
ref|XP_009418998.1|  PREDICTED: probable glutathione S-transferase      206   3e-61   
ref|XP_010044072.1|  PREDICTED: probable glutathione S-transferase      206   4e-61   
ref|XP_010472049.1|  PREDICTED: glutathione S-transferase U23           206   4e-61   
ref|NP_177957.1|  glutathione S-transferase TAU 21                      206   4e-61   
ref|XP_010428961.1|  PREDICTED: glutathione S-transferase U21-like      206   4e-61   
ref|XP_010416815.1|  PREDICTED: glutathione S-transferase U23-like      206   4e-61   
gb|ADB11318.1|  tau class glutathione transferase GSTU16                206   5e-61   
gb|KEH38386.1|  glutathione S-transferase, amino-terminal domain ...    206   6e-61   
ref|XP_009418995.1|  PREDICTED: probable glutathione S-transferas...    206   6e-61   
ref|XP_010923804.1|  PREDICTED: probable glutathione S-transferas...    206   7e-61   
ref|XP_010694944.1|  PREDICTED: probable glutathione S-transferas...    205   1e-60   
gb|ADB11352.1|  tau class glutathione transferase GSTU15                205   1e-60   
ref|XP_010911024.1|  PREDICTED: probable glutathione S-transferas...    205   1e-60   
ref|XP_003609894.1|  Glutathione S-transferase                          205   1e-60   
ref|XP_010472051.1|  PREDICTED: glutathione S-transferase U21-like      205   1e-60   
gb|ADB11373.1|  tau class glutathione transferase GSTU49                205   1e-60   
ref|XP_009420693.1|  PREDICTED: probable glutathione S-transferas...    205   1e-60   
gb|AAF71799.1|AC013430_8  F3F9.13                                       211   1e-60   
gb|AFK35601.1|  unknown                                                 205   2e-60   
ref|XP_010044074.1|  PREDICTED: probable glutathione S-transferas...    205   2e-60   
ref|XP_010060803.1|  PREDICTED: glutathione S-transferase U25-like      204   2e-60   
ref|XP_009591607.1|  PREDICTED: probable glutathione S-transferase      204   2e-60   
gb|ABG77522.1|  glutathione S-transferase                               204   2e-60   
ref|XP_010416819.1|  PREDICTED: glutathione S-transferase U21-lik...    204   3e-60   
ref|XP_008356177.1|  PREDICTED: probable glutathione S-transferase      204   3e-60   
ref|XP_010094424.1|  putative glutathione S-transferase parA            204   3e-60   
ref|XP_010044071.1|  PREDICTED: glutathione S-transferase U19-like      204   3e-60   
ref|XP_002890208.1|  predicted protein                                  203   3e-60   
ref|XP_009615213.1|  PREDICTED: glutathione S-transferase U25-like      204   4e-60   
ref|XP_010534998.1|  PREDICTED: glutathione S-transferase U28           204   4e-60   
ref|XP_010060809.1|  PREDICTED: glutathione S-transferase U19-like      204   5e-60   
ref|XP_010476861.1|  PREDICTED: glutathione S-transferase U24-like      204   5e-60   
ref|XP_006360017.1|  PREDICTED: probable glutathione S-transferas...    203   5e-60   
ref|XP_010498063.1|  PREDICTED: glutathione S-transferase U24-like      203   5e-60   
emb|CDX88440.1|  BnaC06g38840D                                          203   6e-60   
ref|XP_006389993.1|  hypothetical protein EUTSA_v10019490mg             203   7e-60   
ref|NP_001236587.1|  uncharacterized protein LOC100527221               203   9e-60   
ref|XP_006357962.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    202   9e-60   
ref|XP_006349998.1|  PREDICTED: glutathione S-transferase U25-like      204   1e-59   
emb|CDX88441.1|  BnaC06g38850D                                          202   1e-59   
ref|XP_004500375.1|  PREDICTED: probable glutathione S-transferas...    202   1e-59   
ref|XP_009418994.1|  PREDICTED: probable glutathione S-transferas...    202   2e-59   
gb|KHN22772.1|  Putative glutathione S-transferase parA                 201   3e-59   
gb|ADB11353.1|  tau class glutathione transferase GSTU17                201   3e-59   
emb|CAN78389.1|  hypothetical protein VITISV_031129                     201   4e-59   
emb|CDX68019.1|  BnaA07g20590D                                          201   5e-59   
ref|XP_002326070.2|  hypothetical protein POPTR_0019s15100g             201   5e-59   
ref|XP_010459288.1|  PREDICTED: glutathione S-transferase U24 iso...    201   5e-59   
ref|XP_009418993.1|  PREDICTED: probable glutathione S-transferas...    201   5e-59   
ref|XP_009104575.1|  PREDICTED: glutathione S-transferase U23           201   6e-59   
ref|NP_001268177.1|  glutathione S-transferase                          201   7e-59   
ref|XP_009783953.1|  PREDICTED: probable glutathione S-transferase      200   8e-59   
gb|ADB11366.1|  tau class glutathione transferase GSTU39                200   8e-59   
gb|ADB11359.1|  tau class glutathione transferase GSTU27                200   1e-58   
ref|XP_009149164.1|  PREDICTED: glutathione S-transferase U26           200   1e-58   
gb|ACU16110.1|  unknown                                                 198   1e-58   
ref|XP_006829366.1|  hypothetical protein AMTR_s00384p00012000          199   1e-58   
ref|XP_006388265.1|  hypothetical protein POPTR_0256s00200g             201   2e-58   
gb|AAB38965.1|  auxin-induced protein                                   199   2e-58   
ref|XP_006388266.1|  hypothetical protein POPTR_0256s00210g             199   2e-58   
ref|XP_010040783.1|  PREDICTED: glutathione S-transferase U19-like      199   2e-58   
gb|AFK39936.1|  unknown                                                 199   2e-58   
gb|ADB11321.1|  tau class glutathione transferase GSTU29                199   2e-58   
ref|XP_010060805.1|  PREDICTED: probable glutathione S-transferase      199   2e-58   
ref|XP_004981530.1|  PREDICTED: probable glutathione S-transferas...    199   3e-58   
ref|XP_004488706.1|  PREDICTED: probable glutathione S-transferas...    199   3e-58   
ref|XP_009418991.1|  PREDICTED: glutathione S-transferase U19-like      198   4e-58   
ref|XP_010535759.1|  PREDICTED: glutathione S-transferase U27           199   4e-58   
ref|XP_009117715.1|  PREDICTED: glutathione S-transferase U25-like      199   4e-58   
ref|XP_009418992.1|  PREDICTED: probable glutathione S-transferase      198   4e-58   
ref|XP_004488708.1|  PREDICTED: probable glutathione S-transferas...    198   4e-58   
emb|CDP06109.1|  unnamed protein product                                199   6e-58   
ref|XP_009149162.1|  PREDICTED: glutathione S-transferase U24           198   6e-58   
ref|XP_004248223.1|  PREDICTED: probable glutathione S-transferase      198   7e-58   
ref|XP_010694580.1|  PREDICTED: probable glutathione S-transferas...    198   7e-58   
ref|XP_002316873.1|  hypothetical protein POPTR_0011s11420g             197   9e-58   
ref|XP_007022193.1|  Glutathione S-transferase TAU 25                   197   9e-58   
ref|XP_010416818.1|  PREDICTED: glutathione S-transferase U21-lik...    198   1e-57   
ref|XP_010044069.1|  PREDICTED: glutathione S-transferase U19-like      197   1e-57   
gb|ADB11378.1|  tau class glutathione transferase GSTU55                197   2e-57   
gb|EMT03167.1|  hypothetical protein F775_14055                         196   2e-57   
emb|CBI32905.3|  unnamed protein product                                194   3e-57   
gb|EMS47855.1|  putative glutathione S-transferase                      196   3e-57   
ref|XP_008222668.1|  PREDICTED: probable glutathione S-transferas...    196   3e-57   
emb|CBI32899.3|  unnamed protein product                                194   4e-57   
gb|KEH38380.1|  glutathione S-transferase, amino-terminal domain ...    196   5e-57   
gb|KCW44929.1|  hypothetical protein EUGRSUZ_L01482                     196   5e-57   
emb|CBI39919.3|  unnamed protein product                                194   6e-57   
ref|XP_004251829.1|  PREDICTED: glutathione S-transferase U25-like      195   6e-57   
emb|CDP06116.1|  unnamed protein product                                195   7e-57   
ref|XP_002326068.2|  hypothetical protein POPTR_0019s15100g             195   8e-57   
ref|XP_006377754.1|  hypothetical protein POPTR_0011s11440g             195   8e-57   
emb|CBI39927.3|  unnamed protein product                                194   9e-57   
ref|XP_006382635.1|  hypothetical protein POPTR_0005s04000g             194   9e-57   
emb|CBI39926.3|  unnamed protein product                                193   9e-57   
gb|ADB11326.1|  tau class glutathione transferase GSTU40                195   1e-56   
emb|CBI39920.3|  unnamed protein product                                193   1e-56   
ref|XP_002317471.2|  hypothetical protein POPTR_0011s11430g             194   2e-56   
ref|XP_011030764.1|  PREDICTED: probable glutathione S-transferase      194   2e-56   
ref|XP_011098133.1|  PREDICTED: probable glutathione S-transferase      194   2e-56   
emb|CBI39935.3|  unnamed protein product                                192   3e-56   



>ref|XP_010103479.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96021.1| putative glutathione S-transferase [Morus notabilis]
Length=218

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 163/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+ALA KGI YE KEEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  2    NEVILLDFWASMFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHNGK  61

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PI ESLIIV+Y+DEVWN+K PLLPSDPY+RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  62   PISESLIIVQYVDEVWNEKAPLLPSDPYQRAQARFWADFIDKKVYDAAGKVWTAKGEEKE  121

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + LKLLE ELG   YFGGD  GFLD+AL+ F+PW  A E   NFS+ E  CPK
Sbjct  122  AAKKEFIDILKLLETELGDKPYFGGDSFGFLDIALVGFYPWFYALETFGNFSV-EAECPK  180

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LIEW K C + E++SK  AD  K+ +   + RKT G+
Sbjct  181  LIEWAKSCKEKESVSKSLADEKKLYEFAAEKRKTMGI  217



>ref|XP_004294220.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 167/218 (77%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD Y SM+GMR R+ALA KGI YE  E+DL NKS LLLKMNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDLYVSMFGMRVRVALAEKGIKYEYSEQDLRNKSELLLKMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  63   PVCESLIIVQYIDEVWKDKAPLLPSDPYQRAQARFWADFIDKKLYDAGRKIWTTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + LK+LEGELG   YF G++ GFLD+ALI+F+ W  A+E   +FS+E   CPK
Sbjct  123  AAKKEFIDILKVLEGELGDKPYFMGERFGFLDIALITFYSWFHAYETLGSFSIEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            LI W KRC+Q E++SK  ADP K+ + +++M+K  GV 
Sbjct  182  LISWAKRCMQKESVSKSLADPKKVCEFLVEMKKRLGVE  219



>emb|CAN83043.1| hypothetical protein VITISV_027913 [Vitis vinifera]
Length=219

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 169/218 (78%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW+DK PLLPSDPY+RAQARFWA  +D K+Y+  R + W  K +++
Sbjct  63   PICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYELGRKI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFQAYESFGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   V+ MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGFVMGMRKKLGI  218



>ref|XP_011082829.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=219

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+ALA KGI YE +EE+L NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DELILLDVHVSMFGMRVRVALAEKGIEYEYREENLANKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PI ESLIIV+YIDEVW DK+PLLPSDPY+RAQARFWA  +D KI+D  R + W  K +++
Sbjct  63   PISESLIIVQYIDEVWKDKFPLLPSDPYQRAQARFWADFVDKKIFDAGRRI-WTRKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  + LKLLEGELG+  YFGGDK GF+D+ALI+F+ W   +E   NFS+EE  CP
Sbjct  122  EAAKKEFIDALKLLEGELGEKAYFGGDKFGFVDVALITFYSWFDTYETCGNFSVEEH-CP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KL+ W KRC++ E++SK  ADP  + + VL ++K  G+
Sbjct  181  KLVAWAKRCMEKESVSKSLADPKMVYEAVLMLKKKFGI  218



>ref|XP_010087165.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB27070.1| putative glutathione S-transferase [Morus notabilis]
Length=219

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+ALA KGI YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVILLDFWLSMFGMRVRVALAEKGIKYEYKEENLSNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PI ESL IV+YIDEVWNDK PLLPSDPY+RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  63   PISESLTIVQYIDEVWNDKAPLLPSDPYQRAQARFWADFIDKKVYDAWRKVWTTKGEEKE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + LKLLE ELG   YFGGD +GFLD+AL+ F+PW  A E   NFS+ E  CPK
Sbjct  123  AGKKEFLDALKLLETELGDKPYFGGDSLGFLDIALVGFYPWFYALETFGNFSV-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LIEW K C + E++SK  AD  K+ +   + RK  G+
Sbjct  182  LIEWAKSCKEKESVSKSLADEKKVYEFATERRKKIGI  218



>ref|XP_007149247.1| hypothetical protein PHAVU_005G054100g [Phaseolus vulgaris]
 gb|ESW21241.1| hypothetical protein PHAVU_005G054100g [Phaseolus vulgaris]
Length=222

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 166/223 (74%), Gaps = 3/223 (1%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M   +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLI
Sbjct  1    MSMADEVVLLDFWPSPFGMRVRIALAEKGINYEYKEEDLKNKSPLLLQMNPVHKKIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFK  574
            H GKPI ESLI+V+YIDEVW+D+ PLLPSDPY+RAQARFWA  +D KIYD  R + W  K
Sbjct  61   HKGKPISESLIVVQYIDEVWHDRTPLLPSDPYQRAQARFWADYVDKKIYDNGRKIVWTSK  120

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             +++   K+E  E LK+LE +LG  TYFGGD +GF+D+AL+ F+ W  A+E    F++E 
Sbjct  121  GEEKEVAKKEFIEGLKVLEEQLGDKTYFGGDNLGFVDVALVPFYTWFEAYETFGVFNLES  180

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
              CPK I W KRCLQ E+++K   D  KI ++V++MRK +G+ 
Sbjct  181  -ECPKFIAWAKRCLQKESVAKSLPDQHKIHEIVVEMRKKSGIQ  222



>ref|XP_002265110.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW+DK PLLPSDPY+RAQARFW   +D K+Y+  R + W  K +++
Sbjct  63   PICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWVDYVDKKLYELGRKI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFHAYESFGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   V+ MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGFVMGMRKKLGI  218



>ref|XP_002262767.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 169/218 (78%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+AL+ KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRLALSEKGLKYEYKEEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESL+IV+YIDEVW+DK PLLPSDPY+RAQARFWA  +D K+Y+  R + W  K +++
Sbjct  63   PICESLLIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYELGRKI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFHAYESFGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   V+ MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGFVMGMRKKLGI  218



>ref|XP_009757658.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             E+VLLD Y SM+GMR R+ALA KGI YE KE+DL NKS LLL++NPIHKKIPVLIHNGK
Sbjct  3    GEVVLLDAYVSMFGMRARIALAEKGIQYEYKEQDLSNKSSLLLQLNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLIIV+YIDEVW DK PL+P+DPYKRAQARFWA  ID K+YD     W  K +D+ 
Sbjct  63   PVCESLIIVQYIDEVWKDKSPLMPTDPYKRAQARFWADFIDKKVYDSGRRIWTTKGEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LKLLEGELG   YFGG+  GFLD+ALI ++ W   +EK  NFS+E   CPK
Sbjct  123  TAKKEFIECLKLLEGELGDKPYFGGEIFGFLDVALIPYYSWFPTYEKCGNFSIEA-KCPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+ WTK+C+Q E+++K  A+  K+    LQM++  G+
Sbjct  182  LVAWTKKCVQKESVAKSLAESDKVYDFALQMKQRLGI  218



>ref|XP_009616059.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=219

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD Y SM+G+R R+ALA KGI YE KE+DL NK+PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLDTYVSMFGVRVRIALAEKGIQYEYKEQDLLNKTPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIVEYIDEVW DK P +PSDPYKRAQARFWA  +D KIY+   + W  K +D+ 
Sbjct  63   PICESLIIVEYIDEVWKDKSPFMPSDPYKRAQARFWADYVDKKIYESGKKMWTSKVEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E LKLLEGELG   YFGG++ GF+D+AL+ ++ W  ++EK  NFS+ E  CPK
Sbjct  123  AANKEFIECLKLLEGELGDKPYFGGERFGFVDMALMPYYSWFPSYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++EW K+C+Q E++SK  ADP K+   ++  R+  G+
Sbjct  182  IVEWAKKCVQKESVSKSLADPDKVYDYIVMARQKWGI  218



>ref|XP_003634746.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRVALAEKGLKYEYREEDLWNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  ID K+Y+  R + W  K +++
Sbjct  63   PICESLIIVQYIDEVWCDKSPLLPSDPYQRAQARFWADYIDKKLYELGRKI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFSME   CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSMEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   ++ MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  218



>ref|XP_007212030.1| hypothetical protein PRUPE_ppa011202mg [Prunus persica]
 gb|EMJ13229.1| hypothetical protein PRUPE_ppa011202mg [Prunus persica]
Length=219

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 164/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+ALA KG+ YE +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWASMFGMRARVALAEKGVKYEYREEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLIIV+Y+DEVW DK PLLPSDPY RA++RFWA  ID K+YD  R++ W  K +++
Sbjct  63   PVCESLIIVQYVDEVWRDKAPLLPSDPYLRARSRFWADFIDKKLYDAGRII-WATKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LK LEGELG   YF G+  GFLD+ALI+F+ W  AFE   NFS E   CP
Sbjct  122  EAGKKEFIEVLKQLEGELGNKPYFEGESFGFLDIALITFYSWFYAFETCGNFSTEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRC+Q E++SK   D  KI + VL M+K  GV
Sbjct  181  KLIAWAKRCMQKESVSKTLPDNKKIYEFVLGMKKMFGV  218



>emb|CAN66702.1| hypothetical protein VITISV_005451 [Vitis vinifera]
Length=219

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 167/219 (76%), Gaps = 4/219 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +EI+LLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HK+IPVLIHNG
Sbjct  2    GDEIMLLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRNKSPLLLEMNPVHKQIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KPICESLIIV+YIDEVW+DK PLLPSDPY+RAQARFWA  +D K+Y   R V W  K ++
Sbjct  62   KPICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYGLGRKV-WSTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  C
Sbjct  121  QETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYESFGNFSI-EAEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI WTKRC + E++S    DP K+   V+ MRK  G+
Sbjct  180  PKLIAWTKRCKEKESVSSSLEDPHKVHGFVMGMRKRFGI  218



>ref|XP_002264437.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR ++ALA KG+ YE +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVKVALAEKGLEYEFREEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  ID KI++  R + W  K +D+
Sbjct  63   PICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYIDKKIFELGRKI-WTTKGEDQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLEGELG+  YFGG+  GF+D+AL++F  W  A+E   NFS+E   CP
Sbjct  122  EAAKKEFIECLKLLEGELGEKPYFGGENFGFVDVALVTFSCWFYAYETFGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S   ADP K+   V+ +RK  G+
Sbjct  181  KLIAWTKRCMERESVSSSLADPHKVHGFVVVLRKKFGI  218



>emb|CDP06112.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 167/221 (76%), Gaps = 8/221 (4%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++VLLD + S +GMR R+ALA KGI +E KEE+L +KSPLLL+MNP+HKKIPVLIHN
Sbjct  2    AGDKVVLLDTHVSAFGMRVRIALAEKGIEHEYKEENLADKSPLLLEMNPVHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKT  571
            GKP+CESLIIV+YIDEVW+DK PLLPSDP++RAQARFWA  +D K+YD   RL  W  K 
Sbjct  62   GKPVCESLIIVQYIDEVWHDKNPLLPSDPHQRAQARFWADFVDKKLYDAGWRL--WATKG  119

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            +++ A K+E+   +K LE ELG  TYFGG+  G++D+ALI F+ W   +E   NF +E  
Sbjct  120  EEQEAAKKELIGTVKTLEAELGDKTYFGGEDFGYVDVALIPFYNWFYTYETCGNFKIE--  177

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             CPKL+EW KRC+Q ET+SK  ADP KI + V+ ++K  G+
Sbjct  178  -CPKLVEWAKRCMQRETVSKSLADPHKIYEFVVSLKKKFGI  217



>ref|XP_007149246.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
 gb|ESW21240.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
Length=222

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 164/222 (74%), Gaps = 3/222 (1%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M   +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLI
Sbjct  1    MSMADEVVLLDFWPSPFGMRVRIALAEKGINYEYKEEDLKNKSPLLLQMNPVHKKIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFK  574
            H GKPI ESLI+V+YIDEVW+D+ PLLPSDPY+RAQARFWA  +D K+YD  R + W  K
Sbjct  61   HKGKPISESLIVVQYIDEVWHDRTPLLPSDPYQRAQARFWADFVDKKMYDLGRKILWTSK  120

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             ++    K+E  E LK+LE +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E 
Sbjct  121  GEENEVAKKEFIETLKVLEEQLGDRTYFGGDNLGFMDVALVPFYTWFEAYETFGGLNLES  180

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              CPK I W KRCLQ E+++K   D  KI ++V++MRK +G+
Sbjct  181  -ECPKFIAWAKRCLQKESVAKSLPDQHKIHEIVVEMRKKSGI  221



>ref|XP_002264825.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE ++EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRVALAEKGLKYEYRQEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+Y+   + W  K +++ 
Sbjct  63   PICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  CPK
Sbjct  123  TGKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI WTKRC++ E++S    DP K+   ++ MRK  G+
Sbjct  182  LIAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  218



>ref|XP_003634747.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE ++EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRLALAEKGLKYEYRQEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+Y+   + W  K +++ 
Sbjct  63   PICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+E   CPK
Sbjct  123  TGKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+ WTKRC++ E++S    DP K+   ++ MRK  G+
Sbjct  182  LVAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  218



>ref|XP_003634751.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRVALAEKGLKYEYREEDLWNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  ID K+Y+  R + W  K +++
Sbjct  63   PICESLIIVQYIDEVWCDKSPLLPSDPYQRAQARFWADYIDKKLYELGRKI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+E   CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   ++ MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  218



>gb|AEI01103.1| glutathione transferase [Nicotiana benthamiana]
Length=221

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD Y SM+GMR R ALA KGI YE KE+DL NK PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLDTYVSMFGMRVRFALAEKGIQYEYKEQDLMNKDPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESL+IV+YIDEVW D  PL+PSDPY+RA ARFWA  +D KIYD   + W  K +D+ 
Sbjct  63   PICESLVIVQYIDEVWKDNSPLMPSDPYERAHARFWADYVDKKIYDTGRKIWTSKKEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E  KLLE ELG   YFGG+  GF+D+ALI ++ W  A+EK  NF++ E  CPK
Sbjct  123  AANKEFIECFKLLEEELGDKPYFGGESFGFVDMALIPYYTWFPAYEKFGNFNI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++EW K+C+Q E++SK  ADP K+   ++ +R+  G+
Sbjct  182  IVEWAKKCMQKESVSKSLADPDKVYNFIVMVRQKWGI  218



>emb|CDP20885.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 167/220 (76%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++V+L  Y SM+ MR ++ALA KGI YE+KEEDL NKSPLLL++NP+HKKIPVLIHN
Sbjct  2    AGDKVVVLGTYGSMFSMRVQVALAEKGIEYENKEEDLANKSPLLLEVNPVHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW+DK PLLPSDPY+RAQARFWA  +D K+YD  R + W  K +
Sbjct  62   GKPVCESLIIVQYIDEVWHDKNPLLPSDPYQRAQARFWADFVDKKVYDCGRRI-WATKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K+E    +K LEGELG   YFGG+  G++D+ALI F+ W  A+EK  NF   E  
Sbjct  121  EKEAAKKEFIGIMKTLEGELGNKPYFGGEDFGYVDVALIPFYCWFHAYEKFGNFKT-ETE  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKL+EW KRC+Q E++SK  ADP KI + V+ ++K  G+
Sbjct  180  CPKLVEWAKRCMQRESVSKSLADPHKIYEFVVSLKKKLGI  219



>emb|CDP11579.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 166/220 (75%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++V+L  Y SM+ MR ++ALA KGI YE+KEEDL NKSPLLL+MNP+HKKIPVLIHN
Sbjct  2    AGDKVVVLGTYVSMFSMRVQVALAEKGIEYENKEEDLANKSPLLLEMNPVHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW+DK PLLPSDPY+RAQARFWA  ID K+YD  R + W  K +
Sbjct  62   GKPVCESLIIVQYIDEVWHDKNPLLPSDPYQRAQARFWADFIDKKVYDCGRRI-WATKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K+E    +K LEGELG   YFGG+  G++D+ALI F+ W  A+E   NF   E  
Sbjct  121  EKEAAKKEFIGIMKTLEGELGNKPYFGGEDFGYVDVALIPFYCWFHAYENFGNFKT-ETE  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKL+EW KRC+Q E++SK  ADP KI + V+ ++K  G+
Sbjct  180  CPKLVEWAKRCMQRESVSKSLADPHKIYEFVVSLKKKLGI  219



>emb|CAA45741.1| C-7 [Nicotiana tabacum]
Length=219

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD Y SM+G+  R+ALA KGI YE KE+DL NK+PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLDTYVSMFGVSVRIALAEKGIQYEYKEQDLLNKTPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIVEYIDEVW DK P +PSDPYKRAQARFWA  +D KIY+   + W  K +D+ 
Sbjct  63   PICESLIIVEYIDEVWKDKSPFMPSDPYKRAQARFWADYVDKKIYESGKKMWTSKVEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E LKLLEGELG   YFGG++ GF+D+AL+ ++ W  ++EK  NFS+ E  CPK
Sbjct  123  AANKEFIECLKLLEGELGDKPYFGGERFGFVDMALMPYYSWFPSYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++EW K+C+Q E++SK  ADP K+   ++  R+  G+
Sbjct  182  IVEWAKKCVQKESVSKSLADPDKVYDYIVMARQKWGI  218



>gb|ABL84692.1| glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE +EEDL NKSPLLL+MNP+HKKIP LIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRLALAEKGLKYEYREEDLWNKSPLLLEMNPVHKKIPALIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  ID K+Y+  R + W  K +++
Sbjct  63   PICESLIIVQYIDEVWCDKSPLLPSDPYQRAQARFWADYIDKKLYELGRKI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+E   CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   ++ MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  218



>ref|XP_010537670.1| PREDICTED: glutathione S-transferase U19-like [Tarenaya hassleriana]
Length=219

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 163/213 (77%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+ALA KGI YE +EEDL NKS LLL+MNP+H+KIPVLIHNGK
Sbjct  3    DEVILLDFWPSMFGMRTRIALAEKGIKYEYREEDLRNKSQLLLQMNPVHRKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLI V+YIDEVW+DK P+LPSDPY+RAQARFWA  +D K+YD     W  K +++ 
Sbjct  63   PVCESLIQVQYIDEVWSDKAPILPSDPYQRAQARFWADYVDKKMYDPARRIWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LE ELG+  YFGGD+ G++D++LI F+ W  A+EK  NFS+ E  CPK
Sbjct  123  AAKKEFLEILKTLESELGEKPYFGGDEFGYVDISLIGFYTWFQAYEKFGNFSI-EAGCPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            LI W KRCLQ E+++K   +P K++  V ++RK
Sbjct  182  LIGWAKRCLQRESVAKSLPEPEKVTGFVAELRK  214



>ref|XP_002263638.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 166/219 (76%), Gaps = 4/219 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +EI+LLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HK+IPVLIHNG
Sbjct  2    GDEIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRNKSPLLLEMNPVHKQIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KPICESLIIV+YIDEVW+DK PLL SDPY+RAQARFWA  +D K+Y   R V W  K ++
Sbjct  62   KPICESLIIVQYIDEVWHDKSPLLRSDPYQRAQARFWADYVDKKLYGLGRKV-WSTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K+E  E L+LLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  C
Sbjct  121  QETAKKEFIECLQLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYESFGNFSI-EAEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI WTKRC + E++S    DP K+   V+ MRK  G+
Sbjct  180  PKLIAWTKRCKEKESVSSSLEDPHKVHGFVMGMRKRFGI  218



>ref|XP_009781253.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   244 bits (623),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD   SM+GMR R ALA KGI YE KE+DL NK+PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLDTNVSMFGMRVRFALAEKGIQYEYKEQDLLNKTPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESL+IV+YIDEVW D  PL+PSDPY+RA ARFWA  +D KIYD   + W  K +D+ 
Sbjct  63   PICESLVIVQYIDEVWKDNSPLMPSDPYERAHARFWADYVDKKIYDTGRKIWTSKKEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E LKLLEGELG   YFGG+  GF+D+ALI ++ W   +EK  NFS+E   CPK
Sbjct  123  AANKEFIECLKLLEGELGDKPYFGGESFGFVDVALIPYYTWFPTYEKFGNFSIEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++ W KRC+Q E++SK  ADP K+   ++ +RK  G+
Sbjct  182  IVAWAKRCMQKESVSKSLADPDKVYDFIVMLRKRLGI  218



>ref|XP_003634749.1| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=219

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 166/218 (76%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + S +GMR R+ALA KG+ YE +EED  NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSSFGMRVRVALAEKGLKYEYREEDTSNKSPLLLEMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICES+IIV+YIDEVWN+K PLLPSDPY+RAQARFWA  ID K+Y+  R + W  K +++
Sbjct  63   PICESMIIVQYIDEVWNEKSPLLPSDPYQRAQARFWADYIDKKLYELGRRI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K E  E+LK+LEGELG+  YFGG+K GF+D+AL++F     A+E   NFS+ E+ CP
Sbjct  122  ETAKNEFIEYLKILEGELGEKPYFGGEKFGFVDVALVTFSTLFYAYESFGNFSI-EVECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC + E++S    DP K+   V++MRK  G+
Sbjct  181  KLIAWTKRCKEKESVSSSLKDPQKVHGFVMEMRKKLGI  218



>ref|XP_003634752.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE ++EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRVALAEKGLKYEYRQEDLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+Y+   + W  K +++ 
Sbjct  63   PICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LKLLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   NFS+ E  CPK
Sbjct  123  TGKKEFTECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYETFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+ WTKRC++ E++S    DP K+   V+  RK  G+
Sbjct  182  LVAWTKRCMEKESVSSSLEDPHKVHGYVVGRRKKLGI  218



>ref|XP_010103480.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96022.1| putative glutathione S-transferase [Morus notabilis]
Length=219

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 160/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+ALA KGI YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFGMRVRVALAEKGIKYEYKEENLSNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PI ESL IV+YIDEVWNDK PLLPSDPY+RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  63   PISESLTIVQYIDEVWNDKAPLLPSDPYQRAQARFWADFIDKKVYDAAGKVWTTKGEEKE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E    LKLLE ELG   YFGGD  GF+D+ALI F  W  A+E   NFS+ +  CPK
Sbjct  123  AAKKEFLNILKLLETELGNKPYFGGDSFGFVDIALIGFSCWFHAYETFGNFSI-KAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC + E++SK  AD  K+ + V + RK  G+
Sbjct  182  LIAWAKRCNEKESVSKSLADEKKVYEFVAEWRKKIGI  218



>emb|CAI48072.1| glutathione S-transferase/peroxidase [Capsicum chinense]
Length=220

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N+E++LLD + SM+GMR R+ALA K + YESKEEDL NKSPLLL+MNP+HKKIPVLIHN
Sbjct  2    ANDEVILLDFWPSMFGMRLRIALAEKEVKYESKEEDLRNKSPLLLQMNPVHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICES+I VEYIDEVW DK PLLP+DPY+RAQARFWA  ID K +D   + W  K ++
Sbjct  62   GKPICESIIAVEYIDEVWKDKAPLLPTDPYERAQARFWADYIDKKFFDSSRKIWTTKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  E LK+LEG LG+  +FGGD  GF+D+ALI F+ W  A+E   NFS  E  C
Sbjct  122  QEAAKKDFIECLKVLEGALGEKPFFGGDNFGFVDVALIGFYSWFFAYETCGNFST-EAEC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK + W KRC+Q ++++K   D  K+ + V  +RK  G+
Sbjct  181  PKFVTWAKRCMQRDSVAKSLPDQHKVLEFVQTLRKKYGI  219



>ref|XP_004251828.1| PREDICTED: probable glutathione S-transferase parC [Solanum lycopersicum]
Length=219

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
            +NE+VLL  Y SM+GMR R+AL  KGI YE KEEDL NKS LLL+MNPIHKKIPVLIHNG
Sbjct  2    SNEVVLLSAYVSMFGMRVRIALHEKGIQYEYKEEDLSNKSELLLQMNPIHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPICESLIIVEYIDEVW DK PL+P +PYKRAQARFWA  ID K+YD     W  K +D+
Sbjct  62   KPICESLIIVEYIDEVWKDKSPLMPFNPYKRAQARFWADFIDKKVYDSGKRIWATKGEDQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E+LKLLEGELG  TYF G+  GF+DLALI F+ W   FEK  NF++E+  CP
Sbjct  122  EAAKKEFIEYLKLLEGELGDKTYFNGENFGFVDLALIPFYSWFPTFEKFGNFNIEK-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K + W  +C+  +++SK  A+  K+ + VL+M++  G+
Sbjct  181  KFVAWANKCIYKDSVSKSLAESNKVYEYVLKMKQHLGL  218



>gb|KDP24710.1| hypothetical protein JCGZ_25701 [Jatropha curcas]
Length=219

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
              E++LLD + S +GMR R+ALA KG+ YE +EEDL NKSPLLL+MNPIHKKIPVLIH+G
Sbjct  2    GEEVILLDFWPSPFGMRVRIALAEKGVKYEYREEDLRNKSPLLLQMNPIHKKIPVLIHDG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKD  565
            KPICESLI V+Y+DEVW+DK PLLPSDPY+RAQARFWA  +D KIYD  R + W  K ++
Sbjct  62   KPICESLIAVQYVDEVWSDKSPLLPSDPYQRAQARFWADFVDKKIYDIGRKI-WTTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  E LKLLE EL    YFGG++IG++D++L+ F+ W  A+E+  NFS  E+ C
Sbjct  121  QEAAKKDFIECLKLLEAELEDKPYFGGERIGYVDVSLVPFYSWFYAYEQFGNFST-EVEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            PKLI W KRCL+ E++SK   D  K+   VL +RK  G
Sbjct  180  PKLIAWVKRCLEKESVSKSLPDQQKVYDFVLHLRKVYG  217



>ref|XP_010062724.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW69857.1| hypothetical protein EUGRSUZ_F03196 [Eucalyptus grandis]
Length=278

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 165/227 (73%), Gaps = 4/227 (2%)
 Frame = -3

Query  942  NSITKMESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKK  763
             S+ K +   E++LLD + S +GMR R+ALA KGI Y+ KEEDL NKSPLLL MNP+HKK
Sbjct  53   TSLLKKQMAEEVILLDFWPSPFGMRVRIALAEKGIAYDYKEEDLKNKSPLLLAMNPVHKK  112

Query  762  IPVLIHNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLV  589
            IPVLIHNGKP+CESLI V+YIDEVW+DK PLLPSDPY+RAQARFWA  +D KIYD  R +
Sbjct  113  IPVLIHNGKPVCESLIAVQYIDEVWHDKSPLLPSDPYERAQARFWADYVDKKIYDLGRKI  172

Query  588  EWVFKTKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVN  409
             W  K +++ A K+E  E LKLLEGELG   +FGG   GF+D+AL+ F+ W  A+E    
Sbjct  173  -WSTKGEEQEAAKKEFVESLKLLEGELGDKPFFGGQAFGFVDVALVPFYSWFYAYETCGG  231

Query  408  FSMEELVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            FS+E   CPKL+ W KRCL  E++SK   DP K+   VL+++K  GV
Sbjct  232  FSIEA-ECPKLVAWAKRCLLRESVSKSLPDPEKVHGFVLELKKKYGV  277



>ref|XP_008382602.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+ALA KGI YE +EEDL NKS LLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWASMFGMRARVALAEKGIEYEYREEDLRNKSQLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLIIV+YIDEVW+DK PLLPS+PY+RA +RFWA  ID K+YD   + W  K +++ 
Sbjct  63   PVCESLIIVQYIDEVWSDKAPLLPSEPYQRACSRFWADFIDKKLYDAGRKIWSTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K++  E LK LEG+LG   YF G+K GFLD+ALI+F+ W  A+E   NFS+ E  CPK
Sbjct  123  AAKKDFIEILKQLEGQLGGKPYFEGEKFGFLDIALITFYSWFHAYETCGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC Q E++SK  AD  K+ + VL ++K  GV
Sbjct  182  LIAWAKRCKQRESVSKSLADEKKVYEFVLSIKKMLGV  218



>ref|XP_010103478.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96020.1| putative glutathione S-transferase [Morus notabilis]
Length=241

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -3

Query  930  KMESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVL  751
            K+   +E++LLD + SM+GMR R+ALA KGI YE KEEDL NKS LLL+MNPIHKKIPVL
Sbjct  20   KIARMDEVILLDFWVSMFGMRVRIALAEKGIKYEYKEEDLRNKSVLLLQMNPIHKKIPVL  79

Query  750  IHNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVF  577
            IHNGKPI ESLIIV+Y+DEVWN+K PLLPSDPY+RAQARFWA  ID K+YD  R V W  
Sbjct  80   IHNGKPISESLIIVQYVDEVWNEKAPLLPSDPYQRAQARFWADFIDKKMYDAGRNV-WTT  138

Query  576  KTKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSME  397
            K +++ A K+E    LKLLE ELG   YFGGD  GF+D+ALI F  W  A+E   NFS+ 
Sbjct  139  KGEEQEAAKKEFLGNLKLLETELGNKPYFGGDSFGFVDIALIGFSCWFHAYETFGNFSI-  197

Query  396  ELVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            E  CPKLI W KRC++ E++SK  AD  K+ + V +MR   G+
Sbjct  198  EAECPKLIAWAKRCMEKESVSKSLADEKKVYEFVSRMRNKLGI  240



>ref|XP_007149248.1| hypothetical protein PHAVU_005G054200g [Phaseolus vulgaris]
 gb|ESW21242.1| hypothetical protein PHAVU_005G054200g [Phaseolus vulgaris]
Length=222

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 162/223 (73%), Gaps = 3/223 (1%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M   +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL MNP+HKKIPVLI
Sbjct  1    MSMADEVVLLDFWPSPFGMRVRIALAEKGINYEYKEEDLKNKSPLLLHMNPVHKKIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFK  574
            H GKPI ESLI V+YIDEVW+D+ PLLPSDPY+RAQARFW   +D K+YD  R + W  K
Sbjct  61   HKGKPISESLIAVQYIDEVWHDRTPLLPSDPYQRAQARFWVDYVDKKMYDLGRKIVWTSK  120

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             +++   K+E  E LK+LE +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E 
Sbjct  121  GEEKEVAKKEFIEVLKVLEEQLGDKTYFGGDNLGFVDVALVPFYTWFEAYETFGGLNLES  180

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
              CPK I W KRCLQ E+++K   D  KI +++++MRK +G+ 
Sbjct  181  -ECPKFIAWAKRCLQKESVAKSLPDQHKIHEIIVEMRKKSGLQ  222



>ref|XP_009776045.1| PREDICTED: probable glutathione S-transferase parA [Nicotiana 
sylvestris]
Length=220

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 164/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            MESNN +VLLD + S +GMR R+ALALKGI YE+KEE+L +KSPLLL+MNP+HKKIP+LI
Sbjct  1    MESNN-VVLLDFWPSSFGMRIRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILI  59

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFK  574
            HN KPICESL I+EYIDEVW+D  PLLPSDPY R+QARFWA  ID KIY   R V W  K
Sbjct  60   HNSKPICESLNILEYIDEVWHDNCPLLPSDPYGRSQARFWADYIDKKIYSTGRRV-WSGK  118

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             +D+   K+E  E  K LEGELG  TYFGGD +GF+D+AL+ F  W  ++E   NFS+E 
Sbjct  119  GQDQEEAKKEFIEIFKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEA  178

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              CPKL+ W KRC++NE++SK    P KI   VL+++   G+
Sbjct  179  -ECPKLVVWAKRCMENESVSKSLPHPHKIYDFVLELKHKLGL  219



>ref|XP_010644726.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=219

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 166/218 (76%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GMR R+ALA KG+ YE +EEDL  KSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMRVRLALAEKGLKYEYREEDLWKKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  ID K+Y+  R + W  K +++
Sbjct  63   PICESLIIVQYIDEVWCDKSPLLPSDPYQRAQARFWADYIDKKLYELGRRI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K E  E+LK+LEGELG+  YFGG+K GF+D+AL++F     A+E   NFS+ E+ CP
Sbjct  122  ETAKNEFIEYLKILEGELGEKPYFGGEKFGFVDVALVTFSTLFYAYESFGNFSI-EVECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC + E++S    DP K+   V++MRK  G+
Sbjct  181  KLIAWTKRCKEKESVSSSLKDPQKVHGFVMEMRKKLGI  218



>ref|NP_001237713.1| 2,4-D inducible glutathione S-transferase [Glycine max]
 pdb|4TOP|A Chain A, Glycine Max Glutathione Transferase
 pdb|4TOP|B Chain B, Glycine Max Glutathione Transferase
 gb|AAC18566.1| 2,4-D inducible glutathione S-transferase [Glycine max]
Length=219

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 163/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
            ++E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  2    SDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKD  565
            KPICESLI V+YI+EVWND+ PLLPSDPY+RAQ RFWA  +D KIYD  R + W  K ++
Sbjct  62   KPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKI-WTSKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LKLLE +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E   C
Sbjct  121  KEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIES-EC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK I W KRCLQ E+++K   D  K+ + ++ +RK  G+
Sbjct  180  PKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGI  218



>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max
 pdb|2VO4|B Chain B, Glutathione Transferase From Glycine Max
Length=219

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 162/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  2    QDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKD  565
            KPICESLI V+YI+EVWND+ PLLPSDPY+RAQ RFWA  +D KIYD  R + W  K ++
Sbjct  62   KPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKI-WTSKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LKLLE +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E   C
Sbjct  121  KEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIES-EC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK I W KRCLQ E+++K   D  K+ + ++ +RK  G+
Sbjct  180  PKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGI  218



>gb|KFK42224.1| hypothetical protein AALP_AA2G227300 [Arabis alpina]
Length=219

 Score =   241 bits (616),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+AL  KG+ +E +EEDL NKSPLLL+ NPIHKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQTNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES I V+YIDEVW+ K P+LPSDPY+RAQARFW+  ID K+Y+   + W  K ++  
Sbjct  63   PVCESSIQVQYIDEVWSHKNPILPSDPYQRAQARFWSDFIDKKVYEASRKTWTTKGEELE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LE ELG  TYFGGD  GF+D+A+I F+ W  AFEK  N S+EE  CPK
Sbjct  123  AAKKEFIEILKTLETELGDKTYFGGDGFGFVDIAMIGFYTWFPAFEKFGNLSIEE-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+ W K+CL+ ET++K   DP K+++ V ++RK  G+
Sbjct  182  LMVWVKKCLERETVAKSLPDPHKVTEFVAEVRKRFGL  218



>ref|XP_011098135.1| PREDICTED: LOW QUALITY PROTEIN: probable glutathione S-transferase 
[Sesamum indicum]
Length=218

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 163/217 (75%), Gaps = 3/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD Y SM+GMR R+ALA KG+ YE +EE+L  KSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    NEVVLLDVYVSMFGMRARVALAEKGVEYEYREENLAEKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLIIV  IDEVW D+ PLLPSDPY+RAQARFWA  ID K+Y+   + W  K ++  
Sbjct  63   PVCESLIIVX-IDEVWKDRSPLLPSDPYQRAQARFWADFIDKKVYEAGRKLWTTKGEELE  121

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            + K++  E LK+LEGELG   YFGG+  GF+D+ALI F+ W  A+E   NFS+EE  CPK
Sbjct  122  SGKKDFIEILKVLEGELGDKPYFGGEDFGFVDVALIPFYSWFNAYETCANFSIEEH-CPK  180

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC++ E++SK  ADP KI   VL M+K  G+
Sbjct  181  LIAWAKRCMERESVSKSLADPNKIYDFVLAMKKKFGI  217



>ref|XP_010060812.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW67684.1| hypothetical protein EUGRSUZ_F01428 [Eucalyptus grandis]
Length=219

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 166/218 (76%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+ALA KG+ YE KEEDL NKS LLL+MNP+HKKIPVL+HNGK
Sbjct  3    DEVILLDFWPSMFGMRCRLALAEKGVKYEYKEEDLRNKSDLLLRMNPVHKKIPVLVHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLII++YI+E W D+ PLLPSDPY+RAQARFWA  +D K YD  R V W  K +++
Sbjct  63   PVCESLIILQYIEETWPDRCPLLPSDPYQRAQARFWADYVDKKFYDLGRKV-WTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ E +K+LEGELG   +FGG+K+GF+D+A++ F  W  A+E   NFS+E   CP
Sbjct  122  EVAKKELIESMKVLEGELGDKPFFGGEKLGFVDVAIVPFSTWFYAYEMCGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRCL+ ET+SK   DP K+   +LQ++K  G+
Sbjct  181  KLIAWTKRCLEIETVSKSLVDPHKVYDFILQLKKALGI  218



>ref|XP_006364366.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=219

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLL  Y SM+ +R ++ALA KGI YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLGTYVSMFAVRVKIALADKGIQYEYKEENLVNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIVEYIDEVW DK PLLPSDPYK+AQARFWA  +D KIYD   + W  K +D+ 
Sbjct  63   PICESLIIVEYIDEVWKDKSPLLPSDPYKKAQARFWADYVDKKIYDGGKKIWTTKVEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E LK+LE ELG   YF G+  GF+DLALI ++ W  A+EK   FS+E   CPK
Sbjct  123  AANKEFIESLKVLEEELGDKPYFDGESFGFVDLALIPYYSWFPAYEKFGKFSIEP-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             + W KRC+Q E +SK  +DP KI   V+ +R+  G+
Sbjct  182  FVAWAKRCMQKENVSKYLSDPDKIYDFVVMLRQRMGI  218



>ref|XP_008226272.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=220

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 165/217 (76%), Gaps = 3/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLLD + SM+GMR R+ALA KG+ YE +EEDL +NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  3    DEVVLLDFWSSMFGMRVRVALAEKGVKYEYREEDLPNNKSPLLLQMNPVHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KP+CES  IV+YIDE W DK PLLPSDPY+RAQARFW   ID  +Y+     W  K +++
Sbjct  63   KPVCESANIVQYIDEAWKDKAPLLPSDPYQRAQARFWVDYIDKNLYEAGKNIWATKGEEQ  122

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+++ E LKLLEG+LG DTYFGG+  GFLD+AL++F+ W  ++E   NFS+E   CP
Sbjct  123  EAAKKKLIEILKLLEGQLGDDTYFGGEIFGFLDVALVTFYCWFFSYETCGNFSIEA-ECP  181

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            KLIEW KRCLQ ++++K  ADP K+ +  L ++K  G
Sbjct  182  KLIEWAKRCLQKDSVAKSLADPKKVYEFTLLLKKMFG  218



>ref|XP_009759836.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD Y SM+G+R R+ALA K I YE KE+DL NK+PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLDTYVSMFGVRARIALAEKDIQYEYKEQDLLNKTPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIVEYIDEVW +K P +PSDPY RAQARFWA  ID KIY+   + W  K +D+ 
Sbjct  63   PICESLIIVEYIDEVWKNKTPFMPSDPYMRAQARFWADYIDKKIYESGKKMWTSKVEDQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E LKLLEGELG  TY GG+  GF+D+AL+ ++ W  A+EK  NFS+E   CPK
Sbjct  123  AANKEFIECLKLLEGELGDKTYLGGESFGFVDIALMPYYSWFPAYEKFGNFSIEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++EW K+C+Q E++SK  AD  K+   ++  R+  G+
Sbjct  182  IVEWAKKCMQKESVSKSLADSDKVYDFIVMARQKWGI  218



>ref|XP_004243192.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=219

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLL  Y SM+ +R ++ALA KGI YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLGTYVSMFAVRVKIALAEKGIQYEYKEENLVNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIVEYIDEVWNDK PLLPSDPYKRAQARFWA  +D KIYD   + W  K +++ 
Sbjct  63   PICESLIIVEYIDEVWNDKSPLLPSDPYKRAQARFWADYVDKKIYDGGKKIWTTKVEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E LK+LEGELG   YF G+  GF+DLALI ++ W  A+EK   FS+E   CPK
Sbjct  123  AANKEFIECLKVLEGELGDKPYFDGESFGFVDLALIPYYSWFPAYEKFGKFSIEP-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             + W  RC+Q E +SK  +DP KI   V+ +R+  G+
Sbjct  182  FVAWANRCMQKENVSKYLSDPDKIYDFVVMLRQRIGI  218



>ref|XP_007213483.1| hypothetical protein PRUPE_ppa023395mg [Prunus persica]
 gb|EMJ14682.1| hypothetical protein PRUPE_ppa023395mg [Prunus persica]
Length=220

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLLD + SM+GMR R+ALA KG+ YES+EEDL  NKSPLLL+MNP HKKIPVLIHNG
Sbjct  3    DEVVLLDFWPSMFGMRVRVALAEKGVKYESREEDLLYNKSPLLLQMNPFHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KP+CES  IV+YIDE W DK PLLPSDPY+RAQARFW   ID  +Y+     W  K K++
Sbjct  63   KPVCESANIVQYIDEAWKDKAPLLPSDPYQRAQARFWVSYIDKNLYEAGKNIWATKGKEQ  122

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+++ E LKLLEG+LG +TYFGG+  GFLD+AL++F+ W  ++E   NFS+E   CP
Sbjct  123  EAAKKKLIEILKLLEGQLGDNTYFGGEIFGFLDVALVTFYSWFFSYETCGNFSIEA-ECP  181

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            KLIEW KRC+Q E+++K  A+P K+ +  L ++K  G
Sbjct  182  KLIEWAKRCMQKESVAKSVAEPKKVYEFTLLLKKMFG  218



>ref|XP_009344316.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 166/219 (76%), Gaps = 4/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNK--SPLLLKMNPIHKKIPVLIHN  742
            +E+VLLD + SM+GMR R+ALA KG+ YE++EEDL NK  S LLL+MNP+HKKIPVLIHN
Sbjct  3    DEVVLLDYWASMFGMRARVALAEKGVKYENREEDLRNKIKSQLLLQMNPVHKKIPVLIHN  62

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKP+CESLIIV+YIDEVW DK PLLPS+PY++A +RFWA  ID K+YD   + W  K ++
Sbjct  63   GKPVCESLIIVQYIDEVWRDKAPLLPSEPYQKAHSRFWADFIDKKLYDACSKIWSTKGEE  122

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
              A K++  E LK LEG+LG + YF G+K GFLD+ALI+F+ W  AFE   NFS+E   C
Sbjct  123  REAAKKDFIEILKQLEGQLGDEPYFEGEKFGFLDIALITFYCWFHAFETCGNFSIEA-EC  181

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC+Q E++S+  AD  K+ ++VL ++K  GV
Sbjct  182  PKLIAWAKRCMQRESVSRSLADEKKVYELVLGVQKMLGV  220



>ref|XP_009778021.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 160/215 (74%), Gaps = 4/215 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD Y S++GMR R ALA KGI YE KE+DL NK+PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLDTYVSVFGMRVRFALAEKGIQYEYKEQDLLNKTPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICE+LIIV+YIDEVW DK PL+PSDPY+RA ARFWA  ID K+YD  R + W  K +D+
Sbjct  63   PICETLIIVQYIDEVWTDKSPLMPSDPYERAHARFWADYIDKKLYDIGRKI-WTTKKEDQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A+ +E  E LKLLEGELG   YFGG   GF+D+ LI ++ W   +EK  NFS+E   CP
Sbjct  122  EAVNKEFIECLKLLEGELGDKPYFGGGSFGFVDMTLIPYYCWFPTYEKFGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
            K++ W KRC+Q E++SK   DP K+   V+ +R+ 
Sbjct  181  KIVAWAKRCMQKESVSKSLVDPDKVYDFVVMLRQA  215



>ref|XP_002263395.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 166/218 (76%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + S +GMR R+ALA KG+ YE +EED  NK+PLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSPFGMRVRVALAEKGLKYEYREEDPRNKNPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICES+IIV+YIDEVWN K PLLPSDPY+RAQARFWA  ID K+Y+  R + W  K +++
Sbjct  63   PICESMIIVQYIDEVWNKKSPLLPSDPYQRAQARFWADYIDKKLYELGRRI-WSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K E  E+LK+LEGELG+  YFGG+K GF+D+AL++F     A+E   NFS+ E+ CP
Sbjct  122  ETAKNEFIEYLKILEGELGEKPYFGGEKFGFVDVALVTFSTLFYAYESFGNFSI-EVECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   V++MRK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLKDPQKVHGFVMEMRKKLGI  218



>gb|ABG90381.2| glutathione S-transferase [Caragana korshinskii]
Length=219

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 166/218 (76%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    NEVVLLDFWPSPFGMRLRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLI V+YIDEVW+D+ PLLPSDPY+RAQARFWA  +D KIY+  R V W  K +++
Sbjct  63   PVCESLIAVQYIDEVWSDRSPLLPSDPYQRAQARFWADYVDKKIYEVGRNV-WTKKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  + LKLLE +LG  TYFGG+K+G++D+ALI F+ W  A+E   N ++E+  CP
Sbjct  122  EAAKKEFIDALKLLEEQLGDKTYFGGEKLGYVDIALIPFYTWFKAYEVFGNLNIEK-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K I W KRC+Q E +S+   D  K+ + ++++RK  G+
Sbjct  181  KFIAWAKRCMQIENVSRSLPDQHKVYEFIVEIRKRFGI  218



>gb|AEF79856.1| glutathione-S-transferase tau 1 [Hevea brasiliensis]
Length=219

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKP  733
            E++LLD + S +GMR R+ALA KG+ YE +EEDL NKSPLLL+MNP+HKKIPVLIHNGKP
Sbjct  4    EVILLDFWPSPFGMRVRIALAEKGVKYEYREEDLRNKSPLLLQMNPVHKKIPVLIHNGKP  63

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDEN  559
            ICESLI V+Y+DEVW DK P LPSDPY+RAQARFWA  ID KIYD  R + W  K  ++ 
Sbjct  64   ICESLIAVQYVDEVWKDKSPFLPSDPYQRAQARFWADFIDKKIYDIGRKI-WTTKGDEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LKLLEGELG   YFGG+ +G++D+ALI F+ W  A+E   NFS+E   CP 
Sbjct  123  AAKKEFIEALKLLEGELGNKPYFGGESMGYVDVALIPFYSWFYAYETCGNFSIEP-ECPV  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRCLQ E++S+   DP K+ + VL ++K  G+
Sbjct  182  LIAWAKRCLQKESVSESVPDPEKVYEFVLVLKKKFGI  218



>ref|XP_008451810.1| PREDICTED: probable glutathione S-transferase parC [Cucumis melo]
Length=219

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 156/216 (72%), Gaps = 2/216 (1%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKP  733
            E+ LLD + SM+GMR R+ALA KG+ YE  EEDL NKSPLLL+MNPIHKKIPVLIHNGKP
Sbjct  4    EVKLLDFWPSMFGMRVRIALAQKGVAYEYIEEDLRNKSPLLLQMNPIHKKIPVLIHNGKP  63

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDENA  556
            ICES IIV+YIDEVWNDK PLLPS PY RAQARFW   ID K+YD   + W  K ++  A
Sbjct  64   ICESSIIVQYIDEVWNDKAPLLPSHPYDRAQARFWVDFIDKKLYDPTRKIWATKGEEHEA  123

Query  555  IKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKL  376
             K+E+ E LK LE  LG+  YFGG+ +G +D+ALI F+ W   +E    FS+E   CPK+
Sbjct  124  GKKEMIEILKQLEQVLGEKDYFGGESMGIIDIALIGFYSWFYTYETIGKFSIEA-ECPKI  182

Query  375  IEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            I W KRCLQNE+++K   D  KI   V+Q++K  G+
Sbjct  183  ISWGKRCLQNESVAKSLPDSRKIYDFVVQVQKAMGI  218



>ref|XP_004147764.1| PREDICTED: probable glutathione S-transferase parC-like [Cucumis 
sativus]
 ref|XP_004166600.1| PREDICTED: probable glutathione S-transferase parC-like [Cucumis 
sativus]
 gb|KGN53533.1| Glutathione S-transferase [Cucumis sativus]
Length=220

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 156/219 (71%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            ++ E+ LLD + SM+GMR R+ALA KG+ YE  EEDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ADQEVKLLDFWPSMFGMRVRIALAQKGVAYEYVEEDLRNKSPLLLEMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICES IIVEYIDE WNDK PLLPS PY RAQARFW   ID K+Y    + W  K ++
Sbjct  62   GKPICESSIIVEYIDEFWNDKAPLLPSHPYDRAQARFWVDFIDKKLYGPTRKIWATKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
              A K+E  E LK LE  LG+  YFGG+ +GF+D+ALI F+ W   +E    FS+E   C
Sbjct  122  HEAGKKEFIEILKQLEQVLGEKEYFGGESLGFIDIALIGFYSWFYTYETVGKFSIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK+I W KRCLQNE+++K   D  KI   V+Q++K  G+
Sbjct  181  PKIISWGKRCLQNESVAKSLPDSKKIYDFVVQVQKALGI  219



>gb|AFK35485.1| unknown [Lotus japonicus]
Length=219

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWASPFGMRVRIALAEKGINYEYKEEDLRNKSPLLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PI ESLI V+YIDEVWND  PLLPSDPY+RAQARFWA  +D KIY+  R + W  K ++ 
Sbjct  63   PIAESLIAVQYIDEVWNDASPLLPSDPYQRAQARFWADYVDKKIYEIGRNIIWK-KNEER  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  + LKLLE +LG  TYFGGDK+G++D+AL+ F+ W   +E   NF++E   CP
Sbjct  122  EAAKKEFIDCLKLLEEQLGDKTYFGGDKLGYVDIALVPFYTWFKGYETLGNFNIES-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRCLQ E++SK   D  KI + ++++RK  G+
Sbjct  181  KLIAWAKRCLQKESVSKSLHDQDKIYESIVEIRKKLGI  218



>gb|AFK42157.1| unknown [Lotus japonicus]
Length=219

 Score =   239 bits (610),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWASPFGMRVRIALAEKGINYEYKEEDLRNKSPLLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PI ESLI V+YIDEVWND  PLLPSDPY+RAQARFWA  +D KIY+  R + W  K ++ 
Sbjct  63   PIAESLIAVQYIDEVWNDASPLLPSDPYQRAQARFWADYVDKKIYEIGRNIIWK-KNEER  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  + LKLLE +LG  TYFGGDK+G++D+AL+ F+ W   +E   NF++E   CP
Sbjct  122  EAAKKEFIDCLKLLEEQLGDKTYFGGDKLGYVDIALVPFYTWFKGYETLGNFNIES-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRCLQ E++SK   D  +I + ++++RK  G+
Sbjct  181  KLIAWAKRCLQKESVSKSLHDQGQIYEFIVEIRKKLGI  218



>ref|XP_006584638.1| PREDICTED: glutathione S-transferase GST 9 isoform X1 [Glycine 
max]
 gb|ACU18934.1| unknown [Glycine max]
 gb|KHN26786.1| Glutathione S-transferase 3 [Glycine soja]
Length=219

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 148/212 (70%), Gaps = 2/212 (1%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            +VLLD + SM+GMR R+ALA KG+ YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGKPI
Sbjct  5    VVLLDTWASMFGMRVRIALAEKGVEYEYKEENLRNKSPLLLQMNPIHKKIPVLIHNGKPI  64

Query  729  CESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDENAI  553
            CES IIV+YIDEVWNDK P+LPSDPY+RAQARFW   ID K+YD   + W+ K ++  A 
Sbjct  65   CESAIIVQYIDEVWNDKAPILPSDPYERAQARFWVDYIDKKVYDTWRKMWLSKGEEHEAG  124

Query  552  KEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLI  373
            K+E     K LE  L    Y+G D  GFLD+ LI F+ W   FE   NF MEE  CPKL+
Sbjct  125  KKEFISIFKQLEETLSDKAYYGSDTFGFLDIGLIPFYSWFYTFETYGNFKMEE-ECPKLV  183

Query  372  EWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
             W KRC+Q E +SK   D  K+   V+ + K 
Sbjct  184  AWAKRCMQREAVSKSLPDEKKVYDYVVAVTKV  215



>ref|XP_004488707.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=219

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            ++++LLD + S +GMR R+ALA KGI +E +EEDL NKSPLLL+MNPIHKKIPVL+HNGK
Sbjct  3    DQVILLDFWPSPFGMRLRIALAEKGIEFEYREEDLRNKSPLLLQMNPIHKKIPVLVHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLI V+YIDEVWN K PLLPSDPY+R+QARFWA  +D KIYD     W  K +++ 
Sbjct  63   PICESLIAVQYIDEVWNHKSPLLPSDPYQRSQARFWADYVDKKIYDAGRNIWTKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + LKLLE ELG  TYFGGDK+GF+D+ALI F+ W   +E   NF +E+  CPK
Sbjct  123  AAKKEFIDALKLLEQELGDKTYFGGDKLGFVDVALIPFYTWFKGYETFGNFIVEK-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC+Q E++SK   D  K+ + ++ +RK  G+
Sbjct  182  FIAWAKRCMQIESVSKSLPDQEKVYEFIVDIRKKIGI  218



>ref|XP_009347994.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 163/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNK--SPLLLKMNPIHKKIPVLIHN  742
            +E+VLLD + SM+GMR R+AL  KG+ YE +EEDL NK  S LLL+MNP+HKKIPVLIHN
Sbjct  3    DEVVLLDYWASMFGMRARVALVEKGVKYEYREEDLRNKIKSQLLLQMNPVHKKIPVLIHN  62

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKP+CESLIIV+YIDEVW DK PLLPS+PY++A +RFWA  ID K+YD   + W  K ++
Sbjct  63   GKPVCESLIIVQYIDEVWRDKAPLLPSEPYQKAHSRFWADFIDKKLYDACSKIWSTKGEE  122

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
              A K++  E LK LEG+LG   YF G+K GFLD+ALI+F+ W  AFE   NFS+E   C
Sbjct  123  REAAKKDFIEILKQLEGQLGDKQYFEGEKFGFLDIALITFYCWFHAFETCGNFSIEA-EC  181

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC+Q E++S+  AD  K+ ++VL ++K  GV
Sbjct  182  PKLIAWAKRCMQRESVSRSLADEKKVYELVLGVQKMLGV  220



>ref|XP_010245130.1| PREDICTED: probable glutathione S-transferase parC [Nelumbo nucifera]
Length=219

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 161/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KG+ YE ++EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWPSPFGMRARIALAEKGVKYEYRDEDLQNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLII++YIDEVW DK PL+PSDP+KRAQARFWA   D KIYD  R + W  K +D+
Sbjct  63   PICESLIILQYIDEVWKDKLPLMPSDPHKRAQARFWADFTDKKIYDCGRRI-WATKGEDQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLEGELG   YFGGD + F+D+ L+ F+ W  A+E   NFS+E   CP
Sbjct  122  EAAKKEFIECLKLLEGELGDKPYFGGDALDFVDVTLVPFYSWFYAYETCGNFSIEAH-CP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K + W KRC+Q E++SK   D  K+   VL ++K  G+
Sbjct  181  KFVAWAKRCMQKESVSKSLPDQNKVYDFVLVLKKKFGI  218



>ref|XP_006389991.1| hypothetical protein EUTSA_v10019118mg [Eutrema salsugineum]
 gb|ESQ27277.1| hypothetical protein EUTSA_v10019118mg [Eutrema salsugineum]
Length=219

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+AL  KG+ +E +EEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES I V+YIDEVW+ K P+LPSDPY+RAQARFW   ID K+YD   + W  K +++ 
Sbjct  63   PVCESSIQVQYIDEVWSHKNPILPSDPYQRAQARFWVDFIDKKMYDAQRKVWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LE ELG   YFGGD  G++D+ LI F+ W  A+EK  NFS+E   CPK
Sbjct  123  ASKKEFIELLKTLESELGDKPYFGGDDFGYVDIGLIGFYTWFGAYEKFGNFSIES-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            LI W KRCLQ E+++K   +  K+++ V ++RK
Sbjct  182  LIGWAKRCLQRESVAKSLPESEKVTEFVSELRK  214



>ref|XP_006478015.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 157/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + SM+G+R R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG+
Sbjct  3    NEVVLLDFWPSMFGIRVRIALAEKGVKYEYKEEDLKNKSPLLLQMNPVHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P CES IIV+YIDEVW DK PLLPSDPY+RAQARFW   ID K+YD L + W  K +++ 
Sbjct  63   PFCESPIIVQYIDEVWKDKAPLLPSDPYQRAQARFWVDFIDKKMYDSLRKTWTTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LEG+LG   +FGGD  G++DL+LI F+ W   +E    F++E   CPK
Sbjct  123  AAKKEFFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCWFYTYETCGKFNVEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRCLQ ET++K   D  K+ + V  MR   G+
Sbjct  182  FIAWVKRCLQRETVAKALPDGKKVFEFVSAMRTNLGL  218



>emb|CDP06113.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = -3

Query  882  MYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPICESLIIVEY  703
            M+ MR ++AL  KGI YE KEEDL NKSPLLL++NP+HKKIPV+IHNGKP+CESLIIV+Y
Sbjct  1    MFSMRVQVALGEKGIEYEYKEEDLGNKSPLLLQLNPVHKKIPVMIHNGKPVCESLIIVQY  60

Query  702  IDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDENAIKEEIAEWlk  526
            IDEVW+DK PLLPSDPY+RAQARFWA  +D K+YD     W  K +++ A K+E  E LK
Sbjct  61   IDEVWHDKNPLLPSDPYQRAQARFWADFVDKKVYDSTRRIWTTKGEEKEAAKKEFIEILK  120

Query  525  llegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLIEWTKRCLQN  346
             LEGELG   YFGG+  G++D+ALI F+ W  A+E   NF +E   CPKL+EW KRC+Q 
Sbjct  121  TLEGELGNKPYFGGENFGYVDVALIPFYCWFYAYETFGNFKIE---CPKLVEWAKRCMQR  177

Query  345  ETISKCFADPLKISQMVLQMRKTNGV  268
            E++SK  ADP K+ + V+ ++K  G+
Sbjct  178  ESVSKSLADPHKVYEFVVSLKKKLGI  203



>ref|XP_009612277.1| PREDICTED: probable glutathione S-transferase parA [Nicotiana 
tomentosiformis]
 sp|P25317.1|GSTXA_TOBAC RecName: Full=Probable glutathione S-transferase parA; AltName: 
Full=Auxin-regulated protein parA; AltName: Full=STR246C 
protein [Nicotiana tabacum]
 gb|AAA67894.1| par peptide [Nicotiana tabacum]
 emb|CAA56790.1| STR246C [Nicotiana tabacum]
Length=220

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            MESNN +VLLD + S +GMR R+ALALKGI YE+KEE+L +KSPLLL+MNP+HKKIP+LI
Sbjct  1    MESNN-VVLLDFWPSSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILI  59

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFK  574
            HN K ICESL I+EYIDEVW+DK PLLPSDPY+R+QARFWA  ID KIY   R V W  K
Sbjct  60   HNSKAICESLNILEYIDEVWHDKCPLLPSDPYERSQARFWADYIDKKIYSTGRRV-WSGK  118

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             +D+   K+E  E LK LEGELG  TYFGGD +GF+D+AL+ F  W  ++E   NFS+E 
Sbjct  119  GEDQEEAKKEFIEILKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEA  178

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              CPKL+ W K C+++E++SK    P KI   VL+++   G+
Sbjct  179  -ECPKLVVWAKTCMESESVSKSLPHPHKIYGFVLELKHKLGL  219



>gb|AFK34240.1| unknown [Lotus japonicus]
Length=221

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+ALA KG+ YE KEE+L NKS LLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDVWASMFGMRVRIALAEKGVEYEYKEENLRNKSDLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICES IIV+YIDEVW DK P+LPSDPY+RAQARFW   ID K+YD   + W+ + ++  
Sbjct  63   PICESAIIVQYIDEVWKDKAPILPSDPYERAQARFWVDYIDKKVYDTWRKMWLSEGEEHE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E+    KLLE  LG  +++GGD  GFLDL LI F+ W   FE   NF M E  CPK
Sbjct  123  AGKKELISIFKLLEETLGDKSFYGGDTFGFLDLGLIPFYTWFYTFETFGNFKM-ETECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
            L++W KRC+Q ET+SK   D  K+ + VL M K 
Sbjct  182  LMDWVKRCMQKETVSKTLPDEKKVYEHVLGMLKA  215



>ref|XP_002262644.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 164/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + S++GMR R+ALA KG+ YE +EEDL NKSPLLL++NP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFWASIFGMRVRVALAEKGLKYEKREEDLWNKSPLLLEVNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE--  562
            PICES+I+V+YIDEVWN K PLLP+DPY+RAQARFWA  ID K+YD L + +  TK E  
Sbjct  63   PICESMILVQYIDEVWNHKSPLLPTDPYQRAQARFWADYIDKKLYD-LGKKILLTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+  G +D+AL++F     A+E   NFS+E   CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGENFGLVDVALVTFSSRFYAYESIGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC+Q E++S   ADP K+   V+ +RK  G+
Sbjct  181  KLIAWTKRCMQKESVSSSLADPHKVHAFVMGLRKKTGI  218



>ref|XP_003634776.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 163/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD   SM+GMR R+ALA KG+ YE K EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEIILLDFSSSMFGMRVRVALAEKGLKYEYKGEDLWNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE--  562
            PICESLIIV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+ + L + +  TK E  
Sbjct  63   PICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKLAE-LGKKICSTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG+  YFGG+KIGF+D+AL+ F  W  A+E   NFS+ E  CP
Sbjct  122  ETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVPFSCWFYAYESFGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI WTKRC++ E++S    DP K+   V+ +RK  G+
Sbjct  181  KLIAWTKRCMEKESVSSSLEDPHKVHGYVVGIRKKYGI  218



>ref|XP_008226266.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=215

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD   SM+ MR R+ALA KG+ YE+KEEDL NKS LLL+MNP+HKKIPVLIHNG
Sbjct  2    GDEVVLLDFCASMFAMRARVALAEKGVKYENKEEDLRNKSSLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KP+CESLIIV+Y+DEVW DK PLLPSDPY+RA++RFWA  ID K+Y   R + W  K ++
Sbjct  62   KPVCESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKI-WGTKEEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK LEGELG + YF G+  GFLD+ALI F+ W  A+E   NFS  E  C
Sbjct  121  QEAGKKEFIEALKQLEGELGDEPYFEGESFGFLDIALIPFYSWFYAYETCGNFST-EAEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKI  307
            PKLIEW KRC+Q E++SK  ADP K+
Sbjct  180  PKLIEWAKRCMQRESVSKSLADPKKV  205



>gb|AFK49533.1| unknown [Medicago truncatula]
Length=219

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KGI +E +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDYWVSPFGMRVRIALAEKGIKHEYREEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICESLI V+YIDEVWN+K PLLPSDPY+R+QARFWA  +D KIY+     W  K +++ 
Sbjct  63   SICESLIAVQYIDEVWNEKSPLLPSDPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LKLLE ELG  TYFGGDKIGF+D+ALI F+ W   +E   N ++E+  CPK
Sbjct  123  AAKKEFIEALKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEK-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC+Q E+ISK   D  K+   ++++RK  G+
Sbjct  182  FIAWAKRCMQVESISKSLPDQDKVYGFIVEIRKKFGL  218



>ref|XP_008226264.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=215

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 158/210 (75%), Gaps = 4/210 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD + SM+  R R+ALA KG+ YE++EEDL NKS LLL+MNP+HKKIPVLIHNG
Sbjct  2    GDEVVLLDFWASMFATRVRVALAEKGVKYENREEDLWNKSSLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KPICESLIIV+Y+DEVW DK PLLPSDPY+RA++RFWA  ID K+Y   R + W  K ++
Sbjct  62   KPICESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKI-WGTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK LEGELG   YF G+  GFLD+ALISF+ W  A+E   NFS  E  C
Sbjct  121  QEAGKKEFIEALKQLEGELGDKPYFEGESFGFLDIALISFYSWFYAYETFGNFST-EAEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMV  295
            PKLIEW KRC+Q E++SK  ADP K+ + V
Sbjct  180  PKLIEWAKRCMQRESVSKSLADPKKVYESV  209



>ref|XP_006364367.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N+E++LLD + SM+GMR R+ALA K I YE K+EDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANDEVILLDFWPSMFGMRLRIALAEKEIKYEYKDEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICES+I VEYIDEVW DK P LPSDPY+RAQARFWA  +D K++D   + W  K ++
Sbjct  62   GKPICESIIGVEYIDEVWKDKAPFLPSDPYERAQARFWADYVDKKLFDSGRKLWTTKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  E LK+LEG LG+  YFGGD  GF+D+ALI F+ W  ++E   NFS  E  C
Sbjct  122  QEAAKKDFIECLKVLEGALGEKPYFGGDNFGFVDIALIGFYSWFHSYETYGNFST-EAEC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK + W KRC+Q ++++K   D  K+   V  +R   G+
Sbjct  181  PKFVAWAKRCMQRDSVAKSLPDQHKVLDFVKTLRHKFGI  219



>ref|XP_004243193.1| PREDICTED: probable glutathione S-transferase parA [Solanum lycopersicum]
Length=219

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 157/215 (73%), Gaps = 4/215 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD + S +GMR R+AL  KGI YESKEE+L NKS LLLKMNPIHK+IPVLIHNG
Sbjct  2    GDEVVLLDLWVSPFGMRVRIALKEKGINYESKEENLSNKSSLLLKMNPIHKQIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKD  565
            KPICESLIIV+YIDEVW DK PLLPSDPY+RA A+FWA  +D KIY   RLV W  K + 
Sbjct  62   KPICESLIIVQYIDEVWKDKAPLLPSDPYERAHAKFWADYVDKKIYSTGRLV-WTTKGEA  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E+    KLLE ELG  T+FGGD+ G +D+ALI F+ W  A E   NFSM    C
Sbjct  121  QEAAKKELIHHFKLLEKELGDKTFFGGDQFGLVDIALIPFYSWFYALETCGNFSMIH-EC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            PKL+EW KRC++ E++S    D  K+   +L+++K
Sbjct  180  PKLVEWAKRCMERESVSTSLPDQYKVYDFILELKK  214



>ref|XP_006442220.1| hypothetical protein CICLE_v10022164mg [Citrus clementina]
 gb|ESR55460.1| hypothetical protein CICLE_v10022164mg [Citrus clementina]
Length=219

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 157/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+G+R R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG+
Sbjct  3    DEVVLLDFWPSMFGIRVRIALAEKGVKYEYKEEDLKNKSPLLLQMNPVHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES IIV+YIDEVW DK PLLPSDPY+RAQARFW   ID K+YD   + W  K +++ 
Sbjct  63   PVCESPIIVQYIDEVWKDKAPLLPSDPYQRAQARFWVDFIDKKMYDSSRKTWTTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LEG+LG   +FGGD  G++DL+LI F+ W   +E    FS+E   CPK
Sbjct  123  AAKKEFFEVLKTLEGQLGDKPFFGGDNFGYVDLSLIPFYCWFYTYETCGKFSVEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRCLQ ET++K   D  K+ + V  MR   G+
Sbjct  182  FIAWVKRCLQRETVAKALPDGKKVFEFVSVMRTNLGL  218



>emb|CDP06114.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
            + E++LLD Y SM+GMR R+ALA KG+ YE +EE+L  KSP L +MNPIHKK+PVLIHNG
Sbjct  2    DGEVILLDAYASMFGMRLRIALAEKGVKYEYREENLPKKSPFLFQMNPIHKKVPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KPICESLI ++YIDEVW+DK PLLPSDPYKRAQAR WA  +D K++   R + W  K ++
Sbjct  62   KPICESLIALQYIDEVWHDKNPLLPSDPYKRAQARLWADFVDQKVHILGRKI-WSAKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK+LEGELG+  YFGG++ G++D+ALI F+ W  A+E   NF +    C
Sbjct  121  QEAAKKEFIEALKVLEGELGEKPYFGGEEFGYVDVALIPFYSWFHAYETCGNFKI-GTQC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK + W KRC+Q E++SK  ADP K+   VL ++K  GV
Sbjct  180  PKFVAWAKRCMQRESVSKSLADPEKVYDFVLILKKHFGV  218



>gb|EYU26251.1| hypothetical protein MIMGU_mgv1a013400mg [Erythranthe guttata]
Length=221

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 163/219 (74%), Gaps = 8/219 (4%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            +VLLD Y SM+GMR R+ALA KGI YE KEE+L +KSP+LL+MNP+HKKIPVLIHNGKP+
Sbjct  5    VVLLDTYFSMFGMRARLALAEKGIEYEYKEENLGDKSPILLEMNPVHKKIPVLIHNGKPV  64

Query  729  CESLIIVEYIDEVW--NDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKD  565
            CESLIIV+YIDEVW  N+   LLPSDPY++AQARFWA  +D K+YD   RL  W  K  +
Sbjct  65   CESLIIVQYIDEVWKDNNSPSLLPSDPYQKAQARFWADFVDKKVYDAGRRL--WTTKGDE  122

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                K++  E LKLLE ELGK  YFGG+  GF+D+AL+++  W  A+E   NFS+ E  C
Sbjct  123  LETAKKDFIEALKLLEAELGKKPYFGGENFGFVDVALVTYSSWFYAYETCGNFSVAEH-C  181

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKL+EW KRC++ E++SK  ADP K+   VL +RK +G+
Sbjct  182  PKLMEWVKRCMEKESVSKSLADPKKVYDFVLFLRKKHGL  220



>ref|XP_010087160.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB27065.1| putative glutathione S-transferase [Morus notabilis]
Length=220

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            ++ E++LLD + SM+GMR R+ALA KGI YE KEEDL NKS LL++MNPIHK+IPVLIHN
Sbjct  2    ADEEVILLDFWGSMFGMRVRIALAEKGIKYEYKEEDLWNKSTLLVEMNPIHKRIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GK ICESLIIV+Y+DEVW+ K PLLPSDPY+RA ARFWA V+D K+YD     W  K +D
Sbjct  62   GKSICESLIIVQYVDEVWHGKAPLLPSDPYQRAHARFWADVVDDKMYDAGKNVWATKGED  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A  +   + LKLLE ELG   YFGGD  GF+D+ALI ++ W  A+E   NFS+ E  C
Sbjct  122  QEAANKVFFDTLKLLEAELGDKPYFGGDSFGFVDVALIPYYSWFHAYETFGNFSI-EAEC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC + E++SK  AD  KI + V Q+R   G+
Sbjct  181  PKLIAWAKRCTEKESVSKSLADENKICEFVSQLRNKFGI  219



>gb|ACL80571.1| glutathione S-transferase [Glycine max]
Length=216

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YESKEEDL NKSPLLLKMNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQNKSPLLLKMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESL+ V+YI+EVWND+ PLLPSDPY+RAQARFWA  +D KI+D  R + W  K +++
Sbjct  63   PICESLVAVQYIEEVWNDRNPLLPSDPYQRAQARFWADFVDNKIFDLGRKI-WTSKGEEK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLE +LG  TYFGGD +GF+D+ALI F  W   F   +N   E   CP
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWFKTF-GSLNIESE---CP  177

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            K + W KRCLQ ++++K   D  K+ + ++ +RK
Sbjct  178  KFVAWAKRCLQKDSVAKSLPDQHKVYEFIMDIRK  211



>gb|ACA83740.1| auxin-induced glutathione S transferase [Prosopis juliflora]
 gb|ACA83741.1| auxin-induced glutathione S transferase [Prosopis juliflora]
Length=221

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 156/220 (71%), Gaps = 3/220 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            ++ E+VLLD   SM+ MR R+ALA KGI YE KE++L +K P LL+MNPIHKK+PVL+HN
Sbjct  2    ASQEVVLLDATCSMFSMRARLALAEKGIAYEKKEQNLADKGPELLQMNPIHKKVPVLVHN  61

Query  741  GKPICESLIIVEYIDEVWNDK-YPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTK  568
            GKPICESLIIV+YIDEVW D+  PLLPSDPY RAQARFWA  +D K+ D     W  K +
Sbjct  62   GKPICESLIIVQYIDEVWKDQGSPLLPSDPYDRAQARFWADFVDKKVADAASGVWTKKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            +    K++    LK L+  LG+  YFGGD  G++DLALI F+ W  A+E   NF  EE  
Sbjct  122  ELETAKKDFIAVLKQLQEVLGEKPYFGGDNFGYVDLALIPFYSWFHAYETCGNFKTEEH-  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPK IEW KRC+Q ET++K  ADP ++ ++VL +RK  G+
Sbjct  181  CPKFIEWAKRCMQRETVAKSLADPKEVHELVLILRKRFGL  220



>ref|XP_007149245.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
 gb|ESW21239.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
Length=204

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 152/204 (75%), Gaps = 3/204 (1%)
 Frame = -3

Query  873  MRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPICESLIIVEYIDE  694
            MR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIH GKPI ESLI+V+YIDE
Sbjct  1    MRVRIALAEKGINYEYKEEDLKNKSPLLLQMNPVHKKIPVLIHKGKPISESLIVVQYIDE  60

Query  693  VWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDENAIKEEIAEWlkll  520
            VW+D+ PLLPSDPY+RAQARFWA  +D K+YD  R + W  K ++    K+E  E LK+L
Sbjct  61   VWHDRTPLLPSDPYQRAQARFWADFVDKKMYDLGRKILWTSKGEENEVAKKEFIETLKVL  120

Query  519  egelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLIEWTKRCLQNET  340
            E +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E   CPK I W KRCLQ E+
Sbjct  121  EEQLGDRTYFGGDNLGFMDVALVPFYTWFEAYETFGGLNLES-ECPKFIAWAKRCLQKES  179

Query  339  ISKCFADPLKISQMVLQMRKTNGV  268
            ++K   D  KI ++V++MRK +G+
Sbjct  180  VAKSLPDQHKIHEIVVEMRKKSGI  203



>ref|NP_565178.1| glutathione S-transferase TAU 19 [Arabidopsis thaliana]
 sp|Q9ZRW8.1|GSTUJ_ARATH RecName: Full=Glutathione S-transferase U19; Short=AtGSTU19; 
AltName: Full=GST class-tau member 19; AltName: Full=Glutathione 
S-transferase 8 [Arabidopsis thaliana]
 gb|AAK60284.1|AF385691_1 At1g78380/F3F9_11 [Arabidopsis thaliana]
 emb|CAA10060.1| glutathione transferase [Arabidopsis thaliana]
 gb|AAL77713.1| At1g78380/F3F9_11 [Arabidopsis thaliana]
 gb|AEE36099.1| glutathione S-transferase TAU 19 [Arabidopsis thaliana]
Length=219

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 159/213 (75%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+AL  KG+ +E +EEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+ ES+I V+YIDEVW+ K P+LPSDPY RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  63   PVNESIIQVQYIDEVWSHKNPILPSDPYLRAQARFWADFIDKKLYDAQRKVWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K++  E LK LE ELG   YF GD  G++D+ALI F+ W  A+EK  NFS+E  V PK
Sbjct  123  AGKKDFIEILKTLESELGDKPYFSGDDFGYVDIALIGFYTWFPAYEKFANFSIESEV-PK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            LI W K+CLQ E+++K   DP K+++ V ++RK
Sbjct  182  LIAWVKKCLQRESVAKSLPDPEKVTEFVSELRK  214



>ref|NP_001238691.1| glutathione S-transferase [Glycine max]
 pdb|4CHS|A Chain A, Crystal Structure Of A Tau Class Glutathione Transferase 
10 From Glycine Max
 pdb|4CHS|B Chain B, Crystal Structure Of A Tau Class Glutathione Transferase 
10 From Glycine Max
 gb|AAG34800.1|AF243365_1 glutathione S-transferase GST 10 [Glycine max]
 gb|AAR26528.1| glutathione S-transferase [Glycine max]
 gb|KHN26781.1| Putative glutathione S-transferase [Glycine soja]
Length=219

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  2    TDEVVLLDFWPSPFGMRVRIALAEKGIEYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPI ESLI V+YI+EVWND+ PLLPSDPY+RAQARFWA  +D KI+D   + W  K +++
Sbjct  62   KPISESLIAVQYIEEVWNDRNPLLPSDPYQRAQARFWADYVDIKIHDLGKKIWTSKGEEK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLE +LG  TYFGGD IGF+D+AL+ F+ W   +E   + ++E   CP
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDNIGFVDIALVPFYTWFKVYETFGSLNIEN-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            + + W KRCLQ E+++K   D  K+ + V+++RK
Sbjct  181  RFVAWAKRCLQKESVAKSLPDQHKVYEFVVEIRK  214



>gb|AAR26529.1| glutathione S-transferase 2 [Glycine max]
Length=216

 Score =   234 bits (596),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YESKEEDL NKSPLLLKMNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQNKSPLLLKMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESL+ V+YI+EVWND+ PLLPSDPY+RAQARFWA  +D KI+D  R + W  K +++
Sbjct  63   PICESLVAVQYIEEVWNDRNPLLPSDPYQRAQARFWADFVDNKIFDLGRKI-WTSKGEEK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLE +LG  TYFGGD +GF+D+ALI F  W   F   +N   E   CP
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWFKTF-GSLNIESE---CP  177

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            K + W KRCLQ +++++   D  K+ + ++ +RK
Sbjct  178  KFVAWAKRCLQKDSVARSLPDQHKVYEFIMDIRK  211



>gb|KHN27773.1| Putative glutathione S-transferase [Glycine soja]
Length=216

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 160/214 (75%), Gaps = 7/214 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YESKEEDL NKSPLLLKMNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQNKSPLLLKMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESL+ V+YI+EVWND+ PLLPSDPY+RAQARFWA  +D KI+D  R + W  K +++
Sbjct  63   PICESLVAVQYIEEVWNDRNPLLPSDPYQRAQARFWADFVDNKIFDLGRKI-WTSKGEEK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLE +LG  TYFGGD +GF+D+ALI F  W   F    N ++E   CP
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWFKTFG---NLNIES-ECP  177

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            K + W KRCLQ +++++   D  K+ + ++ +RK
Sbjct  178  KFVAWAKRCLQKDSVARSLPDQHKVYEFIMDIRK  211



>gb|ACJ85907.1| unknown [Medicago truncatula]
Length=219

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KGI +E +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDYWVSPFGMRVRIALAEKGIKHEYREEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICESLI V+YIDEVWN+K PLLPSDPY+R+QARFWA  +D KIY+     W  K +++ 
Sbjct  63   SICESLIAVQYIDEVWNEKSPLLPSDPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LKLLE ELG  TYFGGDKIGF+D+ALI F+ W   +E   N ++E+  CPK
Sbjct  123  AAKKEFIEALKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEK-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC+Q E+ISK   D  K+   ++++ K  G+
Sbjct  182  FIAWAKRCMQVESISKSLPDQDKVYGFIVEITKKFGL  218



>ref|XP_002300487.1| hypothetical protein POPTR_0001s42820g [Populus trichocarpa]
 gb|EEE85292.1| hypothetical protein POPTR_0001s42820g [Populus trichocarpa]
Length=220

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGDQVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRNKSALLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICESLIIV+YID+VW DK PLLPSDPY+RAQ+RFWA  +D K+YD   + W  K +D
Sbjct  62   GKPICESLIIVQYIDDVWKDKAPLLPSDPYQRAQSRFWADFVDKKLYDLGRKIWTTKGED  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  + LKLLEGELG   YFGG+ +G++D+AL+ F+ W  A+E   NF++E  VC
Sbjct  122  QEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETVGNFNIEA-VC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI + KRCL+ E++SK   DP K+S  V+  RK  G+
Sbjct  181  PKLIAYCKRCLEKESVSKSLEDPQKVSDFVVMRRKMLGL  219



>gb|ADB11314.1| tau class glutathione transferase GSTU9 [Populus trichocarpa]
Length=220

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGDQVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRNKSALLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICESLIIV+YID+VW DK PLLPSDPY+RAQ+RFWA  +D K+YD   + W  K +D
Sbjct  62   GKPICESLIIVQYIDDVWKDKAPLLPSDPYQRAQSRFWADFVDKKLYDLGRKIWTTKGED  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  + LKLLEGELG   YFGG+ +G++D+AL+ F+ W  A+E   NF++E  VC
Sbjct  122  QEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETVGNFNIEA-VC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI + KRCL+ E++SK   DP K+S  V+  RK  G+
Sbjct  181  PKLIAYCKRCLEKESVSKSLEDPQKVSDFVVMRRKKLGL  219



>emb|CAN81905.1| hypothetical protein VITISV_006049 [Vitis vinifera]
Length=220

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + S +GMR R+ALA KG+ YE +EE+L NKSPLLL+MNP+HKK+PVLIHNGK
Sbjct  3    DEIILLDFWASHFGMRVRIALAEKGLMYEYREENLWNKSPLLLEMNPVHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE--WVFKTKDE  562
            PICESL+IV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+Y  L +  W  K ++ 
Sbjct  63   PICESLMIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKLYHELGKKIWYTKGEEH  122

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LK  EGELG+  YFGG+  GF D+AL+    W   +E   NFS+E+  CP
Sbjct  123  EAGKKEFIECLKFFEGELGEKPYFGGENFGFEDVALVPLSCWFYTYESFGNFSVED-ECP  181

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
             L+ W KRC Q E++S   ADP K+   V++MRK  G++
Sbjct  182  NLMAWAKRCGQKESVSSSLADPHKVHGFVMEMRKRLGID  220



>gb|EYU26248.1| hypothetical protein MIMGU_mgv1a023011mg [Erythranthe guttata]
Length=222

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 164/219 (75%), Gaps = 4/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N++VLLD + SM+GMR R+ALA KG+ YE +E++L +KS LLL+MNP+HKKIPVL+HNGK
Sbjct  4    NKVVLLDCHFSMFGMRARIALAEKGVDYEYREQNLFDKSALLLEMNPVHKKIPVLVHNGK  63

Query  735  PICESLIIVEYIDEVW--NDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            P+CES+ IVEYIDEVW  N+   LLPSDPY+R+QARFWA  +D K+ D     W+ K ++
Sbjct  64   PVCESMNIVEYIDEVWKNNNSSSLLPSDPYQRSQARFWADFVDQKVADAGKRMWLKKGEE  123

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E+ + LKLLEGELG   YFGGD  GF D+AL+ F+ W  A+E   NFS+EE  C
Sbjct  124  QEAAKKELLDALKLLEGELGNKRYFGGDSFGFADVALVPFYTWFYAYENLGNFSIEEH-C  182

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLIEW KRC+Q E++SK  +DP K  + ++ +RK  G+
Sbjct  183  PKLIEWGKRCVQKESVSKSLSDPHKTYEFIVGLRKKFGI  221



>ref|XP_007212046.1| hypothetical protein PRUPE_ppa011371mg [Prunus persica]
 gb|EMJ13245.1| hypothetical protein PRUPE_ppa011371mg [Prunus persica]
Length=213

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 157/212 (74%), Gaps = 4/212 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD   SM+ MR R+ALA KG+ YE++EEDL NKS LLL+MNP+HK IPVLIHNG
Sbjct  2    GDEVVLLDFCASMFAMRARVALAEKGVKYENREEDLRNKSSLLLQMNPVHKMIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KPICESLIIV+Y+DEVW DK PLLPSDPY+RA++RFWA  ID K+Y   R + W  K ++
Sbjct  62   KPICESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKI-WGTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK LEGELG   YF G+  GFLD+ALI F+ W  A+E   NFS  E  C
Sbjct  121  QEAGKKEFIEALKQLEGELGDRPYFEGESFGFLDIALIPFYSWFYAYETFGNFST-EAEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQ  289
            PKLIEW KRC+Q E++SK  ADP K+ + ++ 
Sbjct  180  PKLIEWAKRCMQRESVSKSLADPKKVYESLVN  211



>ref|NP_001236486.1| glutathione S-transferase GST 9 [Glycine max]
 gb|AAG34799.1|AF243364_1 glutathione S-transferase GST 9 [Glycine max]
Length=200

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            +VLLD + SM+GMR R+ALA KG+ YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGKPI
Sbjct  5    VVLLDTWASMFGMRVRIALAEKGVEYEYKEENLRNKSPLLLQMNPIHKKIPVLIHNGKPI  64

Query  729  CESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDENAI  553
            CES IIV+YIDEVWNDK P+LPSDPY+RAQARFW   ID K+YD   + W+ K ++  A 
Sbjct  65   CESAIIVQYIDEVWNDKAPILPSDPYERAQARFWVDYIDKKVYDTWRKMWLSKGEEHEAG  124

Query  552  KEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLI  373
            K+E     K LE  L    Y+G D  GFLD+ LI F+ W   FE   NF MEE  CPKL+
Sbjct  125  KKEFISIFKQLEETLSDKAYYGSDTFGFLDIGLIPFYSWFYTFETYGNFKMEE-ECPKLV  183

Query  372  EWTKRCLQNETISKCFA  322
             W KRC+Q E +SK  +
Sbjct  184  AWAKRCMQREAVSKSLS  200



>ref|XP_008372264.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 160/217 (74%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE K+EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGIEYEYKDEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLI ++YIDEVWNDK PLLPSD Y RAQARFWA  +D KIYD   + W  K ++ +
Sbjct  63   PVCESLIALQYIDEVWNDKAPLLPSDSYLRAQARFWADFVDKKIYDIGRKLWTTKGEEYD  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K++  + + +LEGELG   +FGGD +GF+D+ALI F+ W L +EK  NFS+E  V PK
Sbjct  123  AAKKDFLDCIGVLEGELGDKPFFGGDTLGFVDVALIPFYSWFLVYEKFGNFSVEA-VHPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ E++SK   D  K+   V  MRK  G+
Sbjct  182  FIVWVKRCMEKESVSKSLPDQEKVYDFVALMRKKFGI  218



>gb|EYU26247.1| hypothetical protein MIMGU_mgv1a013356mg [Erythranthe guttata]
Length=223

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 163/222 (73%), Gaps = 4/222 (2%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M + +++VLLD   SMYGMR R+ALA KG+ YE K+E+L +KS LLL+MNPIHKKIPVLI
Sbjct  1    MVAADKVVLLDSMFSMYGMRVRVALAEKGVEYEFKDENLLDKSTLLLEMNPIHKKIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVW-NDKYP-LLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVF  577
            HNGKP+CES++IVEY+D VW ND  P LLP DPYKR QARFWA  ID K+ D   + W  
Sbjct  61   HNGKPVCESMMIVEYVDNVWKNDDSPLLLPCDPYKRFQARFWADFIDKKVNDSQKKVWTM  120

Query  576  KTKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSME  397
            K K++   KEE  E LKLLEGELG   YFGGD  GFLD+AL+ F+ W  A+E   NFS+E
Sbjct  121  KGKEQEKGKEEFIEALKLLEGELGDKPYFGGDNFGFLDIALVPFYSWFYAYETLGNFSIE  180

Query  396  ELVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            E  CPKLIEW +RC+Q E++SK   DP K+ + +L ++KT G
Sbjct  181  EH-CPKLIEWIERCMQKESVSKSLPDPKKVYEYILYLKKTFG  221



>ref|XP_009759844.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=221

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N E++LLD + SM+GMR R+ALA K I YE KEEDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANEEVILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYP-LLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTK  568
            GKPICES+I VEYI+EVW DK P LLPSDPY RAQARFWA  ID K+YD   + W  K +
Sbjct  62   GKPICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K++  E LK+LEG LG   YFGG+  GF+D+ALI F+ W  A+E   NFS  E  
Sbjct  122  EQEAAKKDFIECLKVLEGALGDRPYFGGESFGFVDIALIGFYSWFYAYETFGNFSA-EAE  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPK + W KRC+Q E+++K   D  K+ + V  +R+  G+
Sbjct  181  CPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVLRQKFGL  220



>ref|XP_007022199.1| Glutathione S-transferase TAU 19 [Theobroma cacao]
 gb|EOY13724.1| Glutathione S-transferase TAU 19 [Theobroma cacao]
Length=219

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI +E +EEDL NKS LLL+MNP+HKKIPVLIHNGK
Sbjct  3    DELVLLDFWPSPFGMRVRIALAEKGIKHEYREEDLRNKSALLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLI V+YIDEVW+D+ PLLPSDPY+RA ARFWA  +D KIY+  R + W  K +++
Sbjct  63   PVCESLIQVQYIDEVWHDQAPLLPSDPYQRAIARFWADFVDKKIYELGRKI-WTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG   YFGG+ +G++D+ L+ F+ W LA+EK  NFS+E   CP
Sbjct  122  ETGKKEFIECLKLLEGELGDKPYFGGENLGYVDVVLVPFYSWFLAYEKCGNFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W +RCLQ E++SK   D  K+   VLQ++K  G+
Sbjct  181  KLIAWAQRCLQKESVSKSLPDQEKVYGFVLQLKKIFGI  218



>ref|NP_001236312.1| glutathione transferase [Glycine max]
 emb|CAA71784.1| glutathione transferase [Glycine max]
Length=216

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YESKEEDL NKSPLLLKMNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQNKSPLLLKMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESL+ V+YI+EVWND+ PLLPSDPY+RAQARFWA  +D KI+D  R + W  K +++
Sbjct  63   PICESLVAVQYIEEVWNDRNPLLPSDPYQRAQARFWADFVDNKIFDLGRKI-WTSKGEEK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LKLLE +LG  TYFGGD +GF+D+ALI F  W   F   +N   E   CP
Sbjct  122  EAAKKEFIEALKLLEEQLGDKTYFGGDDLGFVDIALIPFDTWFKTF-GSLNIESE---CP  177

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            K + W KRC+Q +++++   D  K+ + ++ +RK
Sbjct  178  KFVAWAKRCMQKDSVARSLPDQHKVYEFIMGIRK  211



>gb|KHG29593.1| putative glutathione S-transferase [Gossypium arboreum]
Length=219

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             E+VLLD + S +GMR R+ALA KGI YE +EEDL NKS LLL+MNP+HKKIPVLIHNGK
Sbjct  3    GELVLLDFWPSPFGMRSRIALAEKGIPYEYREEDLRNKSDLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDENA  556
            P+CES+I V+YIDEVW+DK PL+PSDPY+RA ARFW   +D KIYD L   ++KTK E  
Sbjct  63   PVCESVIQVQYIDEVWHDKAPLIPSDPYQRAVARFWVDFVDKKIYD-LGSKIWKTKGEEQ  121

Query  555  --IKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG  TYFGG+ +G++D+AL+ F+ W  A+EK  +FS+E   CP
Sbjct  122  ANAKKEFIECLKLLEGELGDKTYFGGESLGYVDVALVPFYTWFYAYEKCGDFSIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K+I W KRC+Q E+++K   D  K+ + VLQ++K  G+
Sbjct  181  KMIAWVKRCMQKESVAKSLPDQEKVYEFVLQLKKLFGI  218



>ref|XP_010428964.1| PREDICTED: glutathione S-transferase U19-like [Camelina sativa]
Length=219

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 158/212 (75%), Gaps = 2/212 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + SM+GMR R+AL  KG+ +E +EEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVVLLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+ ES+I V+YIDEVW+ K P+LPSDPY+RAQARFWA  ID K+Y+   + W  K +++ 
Sbjct  63   PVNESIIQVQYIDEVWSHKNPILPSDPYQRAQARFWADFIDKKMYEAQRKVWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K++  E LK LE ELG   YFGGD+ G +D+ALI F  W  ++EK  NFS+E+  CPK
Sbjct  123  TGKKDFIEILKTLESELGDKPYFGGDEFGLVDIALIGFSTWFPSYEKFGNFSIEQ-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMR  283
            LI W K+CLQ ET++K   DP K+++ V  +R
Sbjct  182  LIAWVKKCLQRETVAKSLPDPEKVTEFVSMLR  213



>sp|P50471.1|GSTX1_NICPL RecName: Full=Probable glutathione S-transferase MSR-1; AltName: 
Full=Auxin-regulated protein MSR-1 [Nicotiana plumbaginifolia]
 gb|AAB47712.2| multiple stimulus response gene [Nicotiana plumbaginifolia]
Length=219

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 163/222 (73%), Gaps = 6/222 (3%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            MESNN +VLLD   S +GMR R+ALALKGI YE+KEE+L +KSPLLL+MNP+HKKIP+LI
Sbjct  1    MESNN-VVLLDFSGSSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILI  59

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFK  574
            HNGKPICESL I+EYIDEVW++K PLLPSDPY+R+QARFWA  ID KIY   R V W  K
Sbjct  60   HNGKPICESLNILEYIDEVWHEKCPLLPSDPYQRSQARFWANYIDNKIYSTGRRV-WSGK  118

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             +D+   K+E  E  K LEGELG  TYFGGD +GF+D+AL+ F  W  ++E   NFS+E 
Sbjct  119  GEDQEEAKKEFIEIFKTLEGELGNKTYFGGDNLGFVDVALVPFTSWFYSYETCANFSIEA  178

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              C KL+ W + C++NE +SK    P KI   VL+++   G+
Sbjct  179  -ECRKLVVW-QNCMENERVSKSLPHPHKIYDFVLELKHKLGL  218



>ref|XP_002532823.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29553.1| glutathione s-transferase, putative [Ricinus communis]
Length=219

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KG+ YE +EE+L NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWASPFGMRVRIALAEKGVKYEYREENLRNKSPLLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLI V+YIDEVW+D+ PLLPSD Y RA ARFWA  +D KIY+  R + W  K +D+
Sbjct  63   PICESLIAVQYIDEVWHDESPLLPSDSYPRAHARFWADFVDKKIYELGRKI-WTTKGEDQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  + +KLLEGELG   YFGG+  G++D+ALI F+ W  A+E   NFS+ E  CP
Sbjct  122  EAGKKEFIDAIKLLEGELGDKPYFGGESFGYVDVALIPFYSWFYAYETCGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K + W KRCLQ E++SK   D  K+ + VL+++K  G+
Sbjct  181  KFMAWIKRCLQKESVSKALPDQQKVYEFVLELKKVFGI  218



>ref|XP_010472053.1| PREDICTED: glutathione S-transferase U19-like [Camelina sativa]
Length=219

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 157/212 (74%), Gaps = 2/212 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + SM+GMR R+AL  KG+ +E +EEDL NKSPLL++MNPIHKKIPVLIHNGK
Sbjct  3    NEVVLLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLIQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+ ES I V+YIDEVW+ K P+LPSDPY RAQARFWA  ID K+Y+   + W  K +++ 
Sbjct  63   PVVESSIQVQYIDEVWSHKNPILPSDPYHRAQARFWADFIDKKMYEAQRKVWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K++  E LK LE ELG   YFGGD  GF+D+ALI F+ W  A+EK  NFS+E+  CPK
Sbjct  123  TGKKDFIEILKTLESELGDKPYFGGDDFGFVDIALIGFYTWFPAYEKFGNFSIEQ-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMR  283
            LI W K+CLQ ++++K   DP K+++ V  +R
Sbjct  182  LIAWVKKCLQRDSVAKSLPDPEKVTEFVSMLR  213



>gb|KFK42223.1| hypothetical protein AALP_AA2G227200 [Arabis alpina]
Length=219

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 158/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM GMR R+AL  KG+ +E +EEDL NKSPLLL+MNPIHKK+PVLIHNGK
Sbjct  3    NEVILLDFWASMLGMRIRIALREKGVEFEYREEDLRNKSPLLLEMNPIHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+CES I V+YIDEVW+ K  ++PSDPY+RAQARFW+  ID K+YD     W  K ++  
Sbjct  63   PVCESSIEVQYIDEVWSHKNRIIPSDPYQRAQARFWSDFIDKKLYDVSKKTWTSKGEELE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E+ E LK LE ELG   YF GD+ G++D+ALI F+ W  AFEK  NFS E   CPK
Sbjct  123  AATKELIEILKTLETELGDKLYFAGDEFGYVDIALIGFYTWFPAFEKLGNFSFES-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+ W K+CL+ ET+ K   DP K++++V ++RK  GV
Sbjct  182  LMVWVKKCLERETVVKSLPDPHKVTELVTELRKKFGV  218



>gb|ACJ84159.1| unknown [Medicago truncatula]
Length=219

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E +LLD + S +GMR R+ALA KGI +E KEEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEAILLDYWASPFGMRVRIALAEKGIKHEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICESLI V+YIDEVWN+K PLL SDPY+R+QARFWA  +D KIY+     W  K +++ 
Sbjct  63   SICESLIAVQYIDEVWNEKSPLLLSDPYQRSQARFWADYVDKKIYEVGKNLWTKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E  KLLE ELG  TYFGGDKIGF+D+ALI F+ W   +E   N ++E+  CPK
Sbjct  123  AAKKEFVEAHKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEK-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC+Q E+ISK   D  K+   ++++RK  G+
Sbjct  182  FIAWAKRCMQVESISKSVPDQDKVYGFMVEIRKRFGL  218



>sp|P49332.1|GSTXC_TOBAC RecName: Full=Probable glutathione S-transferase parC; AltName: 
Full=Auxin-regulated protein parC [Nicotiana tabacum]
 emb|CAA45740.1| parC [Nicotiana tabacum]
Length=221

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N E++LLD + SM+GMR R+ALA K I YE K+EDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANEEVILLDFWPSMFGMRLRIALAEKEIKYEYKQEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYP-LLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTK  568
            GKPICES+I VEYI+EVW DK P LLPSDPY RAQARFWA  ID K+YD   + W  K +
Sbjct  62   GKPICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K++  E LK+LEG LG   YFGG+  GF+D+ALI F+ W  A+E   NFS E   
Sbjct  122  EQEAAKKDFIECLKVLEGALGDRPYFGGESFGFVDIALIGFYSWFYAYETFGNFSTEA-E  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPK + W KRC+Q E+++K   D  K+ + V  +R+  G+
Sbjct  181  CPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVLRQKFGL  220



>ref|XP_004243196.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=241

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 168/238 (71%), Gaps = 6/238 (3%)
 Frame = -3

Query  972  IGSFNFVE*-FNSITKMESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSP  796
            I + NF+   F  I+KM +NNE++LLD + SM+G+R R+ALA K + YE +EEDL NKSP
Sbjct  6    ISTSNFISFLFIHISKM-ANNEVILLDFWPSMFGLRLRIALAEKEVKYEYREEDLPNKSP  64

Query  795  LLLKMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVI  616
            LLL+MNPIHKKIPVLIHNGKPICES+I VEYIDEVW DK PLLPSDPY+RAQARFWA  I
Sbjct  65   LLLQMNPIHKKIPVLIHNGKPICESIIGVEYIDEVWKDKAPLLPSDPYERAQARFWADYI  124

Query  615  DAKIY--DRLVEWVFKTKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFF  442
            D K Y   R + W  K ++ +A KEE    LK+LEG LG   YFGGD  GF+D+ALI F+
Sbjct  125  DKKFYWASRKL-WTTKGEELDAAKEEFIVCLKVLEGALGDKPYFGGDNFGFVDIALIGFY  183

Query  441  PWLLAFEKEVNFSMEELVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             W  A+E   NFS E    PK + W KRC+Q ++++K   D  K+ + V  +R+  G+
Sbjct  184  CWFSAYETYGNFSTEA-ESPKFVAWAKRCMQRDSVAKSSPDQHKVLEFVKVVRQRLGI  240



>gb|ABG73419.1| glutathione S-transferase isoform 1 [Castanea crenata]
Length=219

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 160/214 (75%), Gaps = 4/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             ++VLLD + S++GMR R+ALA KGI YE+KEEDL  KSPLLL+MNP+ K+IPVLIHNGK
Sbjct  3    GKVVLLDFWPSLFGMRVRIALAEKGIKYENKEEDLSKKSPLLLEMNPVIKQIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKDE  562
            P+CESLIIV+YIDEVWNDK PLLPSDPY+RAQARFWA  +D K+Y   R + W  K +++
Sbjct  63   PVCESLIIVQYIDEVWNDKCPLLPSDPYQRAQARFWADFVDKKVYVASRKI-WRPKKEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LK +EGELG   YFGG+  G++DL+LI F+ W  A++   N ++E   CP
Sbjct  122  EAGKKEFLETLKTMEGELGGKPYFGGETFGYVDLSLIPFYSWFHAYKVLDNLNIEA-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            K+I W KRC+Q E ++K F DP K+ + V Q RK
Sbjct  181  KIIAWAKRCMQKEAVAKTFHDPKKVLEFVAQTRK  214



>gb|KEH38385.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=217

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            ++++LLD + S +GMR R+ALA KGI YE +EEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DKVILLDYWVSPFGMRVRIALAEKGIKYEYREEDLSNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICESL+ V+YIDEVWN+K  LLPSDPY+R+QARFWA  +D KI+D     W  K +++ 
Sbjct  63   SICESLMAVQYIDEVWNEKSSLLPSDPYQRSQARFWADYVDKKIFDVGRNLWAKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E  KLLE ELG  TYFGGDK+GF+D+ALI ++ W  ++E   N S+E+  CPK
Sbjct  123  AAKKEFIEVHKLLELELGDKTYFGGDKLGFVDVALIPYYTWFKSYETFGNISLEK-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
             I W K+C+Q E++SK   D  K+  +++++RK +
Sbjct  182  FIAWAKKCMQIESVSKSLPDQDKVHDLIVELRKMS  216



>gb|ACJ84004.1| unknown [Medicago truncatula]
 gb|AFK47909.1| unknown [Medicago truncatula]
 gb|KEH38378.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=219

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 158/218 (72%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + SM+GMR R+ALA KG+ YE KEE+L +KSP+LL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVVLLDTWVSMFGMRVRIALAEKGVQYEYKEENLRDKSPILLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES IIV+YIDEVWNDK P +PSDPY+RAQARFW   ID K+YD   + W+ K ++  
Sbjct  63   PVCESAIIVQYIDEVWNDKAPFMPSDPYERAQARFWVDYIDKKVYDTWRKMWLSKGEEHE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E+    K LE  LG   ++GG   GFLD+ LI F+ W  A+E   NF M E+ CPK
Sbjct  123  EGKKELISIFKTLEETLGDKPFYGGATFGFLDIGLIPFYSWFYAYETYGNFKM-EVECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            L+ W KRCL+ E++SK   D +K+   V+ M+K+ G++
Sbjct  182  LMAWAKRCLEKESVSKTLPDQMKVYDFVVSMKKSLGLD  219



>ref|XP_007213037.1| hypothetical protein PRUPE_ppa020220mg [Prunus persica]
 gb|EMJ14236.1| hypothetical protein PRUPE_ppa020220mg [Prunus persica]
Length=220

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLLD + SM+GMR R+ALA KG+ YE +EEDL +NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  3    DEVVLLDFWPSMFGMRVRVALAEKGVKYEYREEDLLNNKSPLLLQMNPVHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKD  565
            KP+CES  IV+YIDE W DK PLLPSDPY+RAQARFW   ID  +Y+  R + W  K ++
Sbjct  63   KPVCESANIVQYIDEAWKDKAPLLPSDPYQRAQARFWVDYIDKNLYEVGRNI-WATKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            ++  K+++ E LKLLEG+LG +++FGG+  GFLD+AL++ + W  ++E   NFS+E   C
Sbjct  122  QDEAKKKLIEILKLLEGQLGDNSFFGGEIFGFLDVALVTVYCWFFSYETCGNFSIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            PKLIEW KRC+Q E+++K  ADP K+ +  L ++K  G
Sbjct  181  PKLIEWAKRCMQKESVAKSLADPKKVYEFTLLLKKRFG  218



>gb|KDP43662.1| hypothetical protein JCGZ_24120 [Jatropha curcas]
Length=221

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 160/222 (72%), Gaps = 2/222 (1%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M  ++E+VLLD + S +GMR R+ALA KGI +E +EE+L NKS LLL+MNP+HKKIPVLI
Sbjct  1    MAIDDEVVLLDFWPSPFGMRVRIALAEKGIKHEYREENLRNKSALLLQMNPVHKKIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKT  571
            HNGKP+ ES I VEYIDEVW DK PLLPSDPY+RAQA+FWA  +D KIYD     W  K 
Sbjct  61   HNGKPVVESRIAVEYIDEVWKDKTPLLPSDPYQRAQAKFWADFVDKKIYDLGRKTWATKG  120

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            +++ A K+E  E LK+LEGELG   YFGG+  G++D+A I F+ W  A+E   NFS+ E 
Sbjct  121  EEQEAAKKEFMESLKILEGELGDKPYFGGECFGYVDVAFIPFYSWFYAYEVSGNFSI-EA  179

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
             CPKLI W KRCL+ ET+S    D  KI   VL+++K  G++
Sbjct  180  ECPKLIAWVKRCLEKETVSNSLPDQKKIYGFVLELKKAYGID  221



>ref|XP_009616058.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
 sp|Q03666.1|GSTX4_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PCNT107 [Nicotiana tabacum]
 emb|CAA39707.1| auxin-induced protein [Nicotiana tabacum]
Length=221

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N E++LLD + SM+GMR R+ALA K I YE KEEDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANEEVILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYP-LLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTK  568
            GKPICES+I VEYI+EVW DK P LLPSDPY RAQARFWA  ID K+YD   + W  K +
Sbjct  62   GKPICESIIAVEYIEEVWKDKAPNLLPSDPYDRAQARFWADYIDKKLYDFGRKLWTTKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K++  E LK+LEG LG   YFGG+  GF+D+ALI ++ W  A+E   NFS  E  
Sbjct  122  EQEAAKKDFIECLKVLEGALGDKPYFGGESFGFVDIALIGYYSWFYAYETFGNFST-EAE  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPK + W KRC+Q E+++K   D  K+ + V  +R+  G+
Sbjct  181  CPKFVAWAKRCMQRESVAKSLPDQPKVLEFVKVLRQKFGL  220



>ref|XP_007212042.1| hypothetical protein PRUPE_ppa011334mg [Prunus persica]
 gb|EMJ13241.1| hypothetical protein PRUPE_ppa011334mg [Prunus persica]
Length=215

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 159/210 (76%), Gaps = 4/210 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD + SM+ MR R+ALA KG+ YE++EEDL NKS LLL+MNP+HKKIPVLIHNG
Sbjct  2    GDEVVLLDFWASMFAMRVRVALAEKGVKYENREEDLWNKSSLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            KP+CESLIIV+Y+DEVW DK PLLPSDPY+RA++RFWA  ID K+Y   R + W  K ++
Sbjct  62   KPVCESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKI-WGTKEEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK LEGELG + YF G+  GFLD+ALI F+ W  A+E   NFS  E  C
Sbjct  121  QEAGKKEFIEALKQLEGELGDEPYFEGESFGFLDIALIPFYSWFNAYETCGNFST-EAEC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMV  295
            PKLIEW KRC++ E++SK  ADP K+ + +
Sbjct  180  PKLIEWAKRCMRRESVSKSLADPKKVYEFL  209



>gb|ACU13552.1| unknown [Glycine max]
Length=207

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = -3

Query  873  MRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPICESLIIVEYIDE  694
            MR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNGKPICESLI V+YI+E
Sbjct  1    MRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEE  60

Query  693  VWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDENAIKEEIAEWlkll  520
            VWND+ PLLPSDPY+RAQARFWA  +D KIYD  R + W  K +++ A K+E  E LKLL
Sbjct  61   VWNDRNPLLPSDPYQRAQARFWADYVDKKIYDLGRKI-WTSKGEEKEAAKKEFIEALKLL  119

Query  519  egelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLIEWTKRCLQNET  340
            E +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E   CPK I W KRCLQ E+
Sbjct  120  EEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIES-ECPKFIAWAKRCLQKES  178

Query  339  ISKCFADPLKISQMVLQMRKTNGV  268
            ++K   D  KI + ++ +RK  G+
Sbjct  179  VAKSLPDQQKIYEFIMDLRKKLGI  202



>ref|XP_007214172.1| hypothetical protein PRUPE_ppa019045mg [Prunus persica]
 gb|EMJ15371.1| hypothetical protein PRUPE_ppa019045mg [Prunus persica]
Length=220

 Score =   231 bits (590),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 163/217 (75%), Gaps = 3/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLLD + SM+GMR R+ALA KG+ YE KEEDL +NKSPLLL+MNP+HKK+PVLIHNG
Sbjct  3    DEVVLLDFWPSMFGMRVRVALAEKGVKYEYKEEDLLNNKSPLLLQMNPVHKKLPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KP+CES  IV+YIDE W DK PLLPSDPY+RA ARFW   ID  +Y+     W  K +++
Sbjct  63   KPVCESANIVQYIDEAWKDKAPLLPSDPYQRALARFWVDYIDKNLYEAGKNIWATKGEEQ  122

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+++ E LKLLEG+LG ++YFGG+  GFLD+AL++F+ W  ++E   NFS+E   CP
Sbjct  123  EEAKKKLIEILKLLEGQLGDNSYFGGEIFGFLDVALVTFYCWFFSYETCGNFSIEA-ECP  181

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            KLIEW KRC+Q E++++  ADP K+ +  L ++K  G
Sbjct  182  KLIEWAKRCMQKESVAQSLADPKKVYEFTLLLKKRFG  218



>ref|XP_008226269.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=213

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD   SM+ MR R+ALA KG+ YE++EEDL NKS LLL+MNP+HK IPVLIHNGK
Sbjct  3    DEVVLLDFCASMFAMRARVALAEKGVKYENREEDLRNKSSLLLQMNPVHKMIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKDE  562
            PICESLIIV+Y+DEVW DK PLLPSDPY+RA++RFWA  ID K+Y   R + W  K +++
Sbjct  63   PICESLIIVQYVDEVWRDKAPLLPSDPYQRARSRFWADFIDKKLYVASRKI-WGTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LK LEGELG   YF G+  GFLD+ALI F+ W  A+E   NFS  E  CP
Sbjct  122  EAGKKEFIEALKQLEGELGDRPYFEGESFGFLDIALIPFYSWFYAYETFGNFST-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQ  289
            KLIEW KRC+  E++SK  ADP K+ + ++ 
Sbjct  181  KLIEWAKRCMHRESVSKSLADPKKVYESLVN  211



>ref|XP_010245128.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=219

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 163/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            ++++LLD + S +GMR R+ALA K I YE ++E+L +KSP+LL+MNP+HKKIPVLIHNG+
Sbjct  3    DQVILLDFWPSSFGMRVRIALAEKEIQYEYRDENLQDKSPMLLEMNPVHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESL+IV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+Y  +   W  K +++ 
Sbjct  63   PICESLLIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKMYYCMSRIWRNKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A KEE+ E LK+L+GELG+  YFGG+  GF+DL+ +SF+ W  + E   NFS+E   CPK
Sbjct  123  AAKEELIESLKVLQGELGEKPYFGGETFGFVDLSFVSFYSWFYSTETCGNFSIES-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++ W KRC++ E++SK      KI + VLQ+RK  G+
Sbjct  182  IVAWAKRCMERESVSKTLPHHHKIYEFVLQLRKRLGI  218



>gb|AAO61854.1| glutathione S-transferase U1 [Malva pusilla]
Length=219

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 161/218 (74%), Gaps = 2/218 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
              E+VLLD + S +GMR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  2    TGEVVLLDFWPSPFGMRSRIALAEKGINYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPICESLI V+YIDEVW+DK PLLPSDP++RA ARFWA  +D K+Y++    W  K +++
Sbjct  62   KPICESLIQVQYIDEVWHDKSPLLPSDPHQRAVARFWADFVDKKMYEQGSRVWKTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LKLLEGELG    FGG+ +G++D  L+ F+ W+ A+EK  NF++E   CP
Sbjct  122  ATAKKEFIESLKLLEGELGASLTFGGENLGYVDGVLVPFYSWVYAYEKCGNFNIEP-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRC++ E+++K   D  K+   VLQ++K  G+
Sbjct  181  KLIAWAKRCMEKESVAKSLPDQEKVYDFVLQLKKIYGI  218



>ref|NP_001236181.1| glutathione S-transferase 3 [Glycine max]
 sp|P46417.1|GSTX3_SOYBN RecName: Full=Glutathione S-transferase 3 [Glycine max]
 emb|CAA48717.1| lactoylglutathione lyase [Glycine max]
 gb|KHN27764.1| Glutathione S-transferase 3 [Glycine soja]
Length=219

 Score =   231 bits (589),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 155/215 (72%), Gaps = 2/215 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
            ++E+VLLD + SMYGMR R+ALA KG+ YE KEE+L N+SPLLL+MNPIHKKIPVLIHNG
Sbjct  2    SDEVVLLDTWASMYGMRARIALAEKGVRYEYKEENLMNRSPLLLQMNPIHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPICES IIV+YIDEVWNDK PL+PSDPYKR+QARFW   ID KIYD   + W+ K ++ 
Sbjct  62   KPICESAIIVQYIDEVWNDKSPLMPSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEH  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+    K LE  L    ++G D  GF+DL LI+F  W   +E   NF MEE  CP
Sbjct  122  EEGKKELISIFKQLEETLTDKPFYGDDTFGFVDLCLITFSSWFYTYETYGNFKMEE-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
            KL+ W KRC++ ET+S    D  K+  ++++++KT
Sbjct  181  KLMAWVKRCMERETVSNTLPDAKKVYGLIVELQKT  215



>gb|EYU26250.1| hypothetical protein MIMGU_mgv1a022085mg [Erythranthe guttata]
Length=221

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 161/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+ALA KGI YE KEE+L +KSP+LL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDTFFSMFGMRARLALAEKGIEYEYKEENLGDKSPVLLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVW--NDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE  562
            P+CESLIIV+YIDEVW  N+   LLPSDPY++AQARFWA  +D K+YD          DE
Sbjct  63   PVCESLIIVQYIDEVWKDNNSPSLLPSDPYQKAQARFWADFVDKKLYDAGRRLCTTKGDE  122

Query  561  -NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                K++  E LKLLE ELG+ +YFGG+  GF D+ALI++  W  ++E   NFS+EE  C
Sbjct  123  LETAKKDFIEVLKLLEAELGEKSYFGGENFGFGDVALITYSNWFYSYETCGNFSVEEH-C  181

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            PKL+EW KRC++ E++SK  ADP KI   +L  +K +G
Sbjct  182  PKLMEWVKRCMEKESVSKSLADPKKIYDSILVFKKKHG  219



>gb|KHN27770.1| Putative glutathione S-transferase [Glycine soja]
Length=203

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = -3

Query  873  MRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPICESLIIVEYIDE  694
            MR R+ALA KGI YE KEEDL NKSPLLL+MNP+HKKIPVLIHNGKPICESLI V+YI+E
Sbjct  1    MRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEE  60

Query  693  VWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDENAIKEEIAEWlkll  520
            VWND+ PLLPSDPY+RAQARFWA  +D KIYD  R + W  K +++ A K+E  E LKLL
Sbjct  61   VWNDRNPLLPSDPYQRAQARFWADYVDKKIYDLGRKI-WTSKGEEKEAAKKEFIEALKLL  119

Query  519  egelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLIEWTKRCLQNET  340
            E +LG  TYFGGD +GF+D+AL+ F+ W  A+E     ++E   CPK I W KRCLQ E+
Sbjct  120  EEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIES-ECPKFIAWAKRCLQKES  178

Query  339  ISKCFADPLKISQMVLQMRKTNGV  268
            ++K   D  K+ + ++ +RK  G+
Sbjct  179  VAKSLPDQQKVYEFIMDLRKKLGI  202



>gb|KEH38377.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=219

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+ALA K + YE KEEDL NKSPLLL+MNPIH KIPVLIHNGK
Sbjct  3    NEVILLDTWASMFGMRARIALAEKSVKYEYKEEDLRNKSPLLLQMNPIHNKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICES IIV+YIDEVWNDK   +PSDPY+RAQARFW    D K+YD   + W+ K ++  
Sbjct  63   SICESAIIVQYIDEVWNDKASFMPSDPYERAQARFWVDYSDKKVYDTWKKMWLSKGEEYE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K E+    K LEG L    ++GGD  GFLD+ LI F+ W  AFE   NF M E  CPK
Sbjct  123  EGKMELISIFKTLEGALSDKLFYGGDTFGFLDIGLIPFYSWFYAFETYGNFKM-ETECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            L+ WTKRC++ +++SK   D  K+   V+ ++K  G++
Sbjct  182  LMAWTKRCMEKDSVSKSLPDQKKVYDFVVSIKKALGLD  219



>gb|ACU15945.1| unknown [Glycine max]
Length=216

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 157/214 (73%), Gaps = 7/214 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YESKEEDL NKSPLLLKMNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIKYESKEEDLQNKSPLLLKMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESL+ V+YI+EVWND+ PLLPSDPY+RAQARFWA  +D KI+D  R + W  K +++
Sbjct  63   PICESLVAVQYIEEVWNDRNPLLPSDPYQRAQARFWADFVDNKIFDLGRKI-WTSKGEEK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A  +E  E LKLLE +LG  TYF GD +GF+D+ALI F  W   F   +N   E   CP
Sbjct  122  EAANKEFIEALKLLEEQLGDKTYFAGDDLGFVDIALIPFDTWFKTF-GSLNIESE---CP  177

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            K + W KRCLQ ++++K   D  K+ + ++ +RK
Sbjct  178  KFVAWAKRCLQKDSVAKSLPDQHKVYEFIMDIRK  211



>gb|AAM64593.1| glutathione transferase, putative [Arabidopsis thaliana]
Length=219

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+ MR R+AL  KG+ +E +EEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFRMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+ ES+I V+YIDEVW+ K P+LPSDPY RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  63   PVNESIIQVQYIDEVWSHKNPILPSDPYLRAQARFWADFIDKKLYDAQRKVWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K++  E LK LE ELG   YF GD  G++D+ALI F+ W  A+EK  NFS+E  V PK
Sbjct  123  AGKKDFIEILKTLESELGDKPYFSGDDFGYVDIALIGFYTWFPAYEKFANFSIESEV-PK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            LI W K+CLQ E+++K   DP K+++ V ++RK
Sbjct  182  LIAWVKKCLQRESVAKSLPDPEKVTEFVSELRK  214



>gb|AEB77867.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=219

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 156/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ L  KG+ +E +E+DL NKSPLLL+MNP+HKKIPVL+HNGK
Sbjct  3    DEVILLDFWASPFGMRVRITLEEKGVKFEYREQDLMNKSPLLLQMNPVHKKIPVLVHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+CESLI V+Y+DE W DK PLLPSDPY+RAQARFWA  +D KIYD     W  K +++ 
Sbjct  63   PVCESLIAVQYVDETWKDKAPLLPSDPYRRAQARFWADFVDKKIYDLGRKTWQTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E+ E  KLLE ELG   YFGG+  G++D+ L+ F+ W   +E+  NFS+ E  CPK
Sbjct  123  GAKKELIECFKLLEKELGDKPYFGGETFGYVDVTLVPFYSWFDVYERSGNFSV-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+EW  RCLQ E++SK   D  K+   VL+++K  G+
Sbjct  182  LMEWANRCLQKESVSKSLVDREKVYGFVLELKKKFGI  218



>emb|CAA04391.1| glutathione transferase [Carica papaya]
Length=218

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 158/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE KEE+L NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRIRIALAEKGIHYEYKEENLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLI ++YIDEVW+DK PLLPSDPY+RAQARFWA  +D K+Y+  R V W  K +++
Sbjct  63   PICESLIQIQYIDEVWSDKAPLLPSDPYQRAQARFWADYVDKKMYEAGRRV-WTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LK LEGELG+  YFGG+  G++DL  I F+ W   +E     S+ E  CP
Sbjct  122  EGAKKEFIEILKTLEGELGEKPYFGGESFGYVDLTFIPFYTWFSVYESFGKMSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KL  W KRCL+ E++SK   D  K+   VL++RK  G+
Sbjct  181  KLFSWVKRCLEKESVSKSLPDQDKVYGFVLELRKALGI  218



>ref|XP_002300483.2| hypothetical protein POPTR_0001s42760g [Populus trichocarpa]
 gb|ADB11311.1| tau class glutathione transferase GSTU2 [Populus trichocarpa]
 gb|EEE85288.2| hypothetical protein POPTR_0001s42760g [Populus trichocarpa]
Length=220

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 164/220 (75%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGDQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRNKSDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW DK PLLPSDP++RAQ+RFWA  +D K+YD  R + W  K +
Sbjct  62   GKPVCESLIIVQYIDEVWKDKAPLLPSDPHERAQSRFWADFVDKKMYDFGRKI-WTTKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+ A K++  + LKLLEGELG   YFGG+ +GF+D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEAAKKDFIDSLKLLEGELGDKPYFGGETLGFVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI + KRCLQ E++SK   DP K+   V+ +RK  G+
Sbjct  180  CPKLIAYCKRCLQKESVSKSLKDPQKVYDFVVMLRKMFGL  219



>ref|XP_008383009.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KG+ YE K+ED+ NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGVEYEYKDEDVRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLI ++YIDEVWNDK PLLPSD Y RAQARFWA  +D KIY+   + W  K ++++
Sbjct  63   PVCESLIALQYIDEVWNDKAPLLPSDCYLRAQARFWADYVDKKIYEFGRKLWTTKGEEQD  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + + +LEGELG   +FGG+ IGF+D+ALI F+ W L +EK  NFS+E L  PK
Sbjct  123  AAKKEFLDCMGVLEGELGDKPFFGGETIGFMDVALIPFYSWFLLYEKFGNFSVEAL-HPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ E++SK   +  K+   V+ MRK  G+
Sbjct  182  FIAWVKRCMEKESVSKSLPEQEKVYDFVMLMRKKLGM  218



>gb|ADC95628.1| glutathione S-transferase [Bruguiera gymnorhiza]
Length=219

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 156/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ L  KG+ +E +E+DL NKSPLLL+MNP+HKKIPVL+HNGK
Sbjct  3    DEVILLDFWASPFGMRVRITLEEKGVKFEYREQDLMNKSPLLLQMNPVHKKIPVLVHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+CESLI V+Y+DE W DK PLLPSDPY+RAQARFWA  +D KIYD     W  K +++ 
Sbjct  63   PVCESLIAVQYVDETWKDKAPLLPSDPYQRAQARFWADFVDKKIYDLGRKTWQTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E+ E  KLLE ELG   YFGG+  G++D+ L+ F+ W   +E+  NFS+ E  CPK
Sbjct  123  GAKKELIECFKLLEKELGDKPYFGGETFGYVDVTLVPFYSWFDVYERSGNFSV-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+EW  RCLQ E++SK   D  K+   VL+++K  G+
Sbjct  182  LMEWANRCLQKESVSKSLVDREKVYGFVLELKKKFGI  218



>ref|XP_009354819.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 157/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + S +GMR R+ALA KGI YE K+EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    NEVVLLDFWPSPFGMRLRIALAEKGIEYEYKDEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESL+ ++YIDEVWNDK PLLPSD Y RAQARFWA  +D KIYD   + W  K ++ +
Sbjct  63   PVCESLVALQYIDEVWNDKAPLLPSDSYLRAQARFWADFVDKKIYDIGRKLWTTKGEEHD  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  + + +LEGEL    +FGG+ +GF+D+ALI F+ W L +EK  NFS+E    PK
Sbjct  123  AASKEFLDCIGVLEGELEDKPFFGGETLGFVDVALIPFYSWFLVYEKFGNFSVEA-EHPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ E++SK   +  K+   V  MRK  G+
Sbjct  182  FIAWVKRCMEKESVSKSLPEQEKVYDFVALMRKKFGI  218



>ref|XP_008451814.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=217

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 153/214 (71%), Gaps = 2/214 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
              E+ LLD + SM+GMR ++ALA KG+ YE  E+DL NKSPLLL+MNPIHK+IPVLIHNG
Sbjct  2    GEEVKLLDFWPSMFGMRVKIALAEKGVAYEYVEQDLRNKSPLLLQMNPIHKQIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPICES IIVEYIDE W DK PLLPSDPY+RAQARFW   ID KIY+   + +  K +++
Sbjct  62   KPICESSIIVEYIDEFWKDKAPLLPSDPYERAQARFWVDFIDKKIYESAKKIYTKKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ E LK LE  LG+  YFGG+  G+LD+ LI F  W  A+E   NFS+ E  CP
Sbjct  122  EGGKKEVIEILKQLEQVLGEKAYFGGECFGYLDIGLIGFSSWFYAYETIGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            KLI W KRCL+ E++S    DP K+ + +LQ +K
Sbjct  181  KLISWVKRCLEKESVSNSLPDPKKVCESLLQFKK  214



>ref|XP_006366776.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N+E++LLD + SM+GMR R+ALA K + YE KEEDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANDEVILLDFWPSMFGMRLRIALAEKEVKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE  562
            GKPICESLI VEYIDEVW DK PLLPSDPY RAQARFW   ID K+YD   +    T DE
Sbjct  62   GKPICESLIGVEYIDEVWKDKSPLLPSDPYVRAQARFWGDYIDKKLYDTARKIYSATGDE  121

Query  561  N-AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  E LK+LEG LG+  Y+GGD  GF D+ALI F+ W  A+E   NFS+E   C
Sbjct  122  HEAGKKDFIEILKVLEGALGEKPYYGGDNFGFGDIALIGFYCWFPAYEIYGNFSIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKL+ W KRC++ ++++K   D  KI +    +R+  G+
Sbjct  181  PKLVAWAKRCMKRDSVAKTLPDQHKILEFAKILREKLGL  219



>ref|XP_002317608.1| glutathione transferase family protein [Populus trichocarpa]
 gb|EEE98220.1| glutathione transferase family protein [Populus trichocarpa]
 gb|ADB11322.1| tau class glutathione transferase GSTU30 [Populus trichocarpa]
Length=220

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 163/220 (74%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +++++ LLD + S +GMR R+ALA KG+ YE  EEDL NKS LLL+MNP++K+IPVL+HN
Sbjct  2    ASDQVTLLDFWPSPFGMRVRLALAEKGVKYEYSEEDLRNKSALLLQMNPVNKQIPVLVHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW D  PLLPSDPY+RAQ+RFWA  +D KIYD  R + W  K +
Sbjct  62   GKPVCESLIIVQYIDEVWKDSAPLLPSDPYQRAQSRFWADFVDKKIYDLGRKI-WTKKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K++  + LKL+EGELG   YFGG+ IG++D+AL+ F+ W  A+E   NF++E   
Sbjct  121  EQEAAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEA-E  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPK+I + KRCLQ ET+SK   DP K+   VL + K  G+
Sbjct  180  CPKMIAYCKRCLQKETVSKALEDPQKVYDFVLMLMKKFGI  219



>ref|XP_002266007.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 160/219 (73%), Gaps = 6/219 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GM+ R+ALA KG+ YE ++EDL NK PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMKVRIALAEKGLKYEYRDEDLFNKGPLLLEMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY---DRLVEWVFKTKD  565
            PICES IIV+YIDEVW DK PLLPSDPY RAQARFWA  ID K++    RL  W  K ++
Sbjct  63   PICESQIIVQYIDEVWKDKSPLLPSDPYHRAQARFWADYIDKKLHLLGARL--WRTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LKLLEGELG   YFGG+  GF+D+ L+ +F WL  FE   NFS+E   C
Sbjct  121  QEANKKEYIECLKLLEGELGDKPYFGGENFGFVDVNLMPYFSWLYVFEIAANFSIEA-EC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC++ E++S    D  K+    LQ++K +G+
Sbjct  180  PKLITWAKRCMEKESVSTSLPDHQKLYDFFLQLKKWHGI  218



>ref|XP_010644811.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 160/219 (73%), Gaps = 6/219 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GM+ R+ALA KG+ YE ++EDL NK PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMKVRIALAEKGLKYEYRDEDLFNKGPLLLEMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY---DRLVEWVFKTKD  565
            PICES IIV+YIDEVW DK PLLPSDPY RAQARFWA  ID K++    RL  W  K ++
Sbjct  63   PICESQIIVQYIDEVWKDKSPLLPSDPYHRAQARFWADYIDKKLHLLGKRL--WRTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LKLLEGELG   YFGG+  GF+D+ L+ +F WL  FE   NFS+E   C
Sbjct  121  QEANKKEYIECLKLLEGELGDKPYFGGENFGFVDVNLMPYFSWLYVFEIAANFSIEA-EC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC++ E++S    D  K+    LQ++K +G+
Sbjct  180  PKLITWAKRCMEKESVSTSLPDRQKLYDFFLQLKKWHGI  218



>ref|XP_011082832.1| PREDICTED: glutathione S-transferase U25-like [Sesamum indicum]
Length=222

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 162/222 (73%), Gaps = 7/222 (3%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E++LL    SM+ MR  +AL  KGI YE +EE LDNKSPLLL+MNP+HKK+PVLIHNG
Sbjct  2    GDELILLGYDISMFAMRVSIALDEKGIEYEYREESLDNKSPLLLEMNPVHKKVPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY---DRLVEWVFKTK  568
            KP+ ESLII+EYIDEVWNDK PLLPSDPY+RAQARFWA +ID KIY    R+V W  K +
Sbjct  62   KPVSESLIILEYIDEVWNDKPPLLPSDPYQRAQARFWADLIDKKIYINGGRVV-WFSKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K+E+ + LKLLE ELG+  YFGGDK GFLD+ALI F+     FE+     +EE  
Sbjct  121  EQEAGKKELMDGLKLLEAELGEKVYFGGDKFGFLDVALIPFYNCFDTFERCGKLRIEEH-  179

Query  387  CPKLIEWTKRCLQNETISKCF--ADPLKISQMVLQMRKTNGV  268
            CPKLI W KRC++ E++SK F  A P KI + VL  RK  G+
Sbjct  180  CPKLIAWAKRCMEKESVSKSFAMAHPSKIDEYVLMTRKKYGI  221



>ref|XP_006302801.1| hypothetical protein CARUB_v10020928mg [Capsella rubella]
 gb|EOA35699.1| hypothetical protein CARUB_v10020928mg [Capsella rubella]
Length=219

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 156/213 (73%), Gaps = 2/213 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             NE++LLD + SM+GMR R+AL  KG+ +E +EEDL NKSPLLL+MNPIHKKIPVLIHNG
Sbjct  2    TNEVILLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KP+ ES+I V+YIDEVW+ K P+LPSDPY+RAQARFWA  ID K+YD   + W  K +++
Sbjct  62   KPVNESIIQVQYIDEVWSHKSPILPSDPYQRAQARFWADFIDKKMYDAQRKVWATKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K++  E LK LE ELG   YF GD  G++D+ALI F  W  A+EK  NFS+E+  CP
Sbjct  122  ETGKKDFIEILKTLESELGDKPYFAGDDFGYVDIALIGFSTWFPAYEKFGNFSVEQ-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMR  283
            KL  W K+CLQ E+++K   +P K+++ V  +R
Sbjct  181  KLTAWVKKCLQRESVAKSLPEPEKVTEFVSMLR  213



>ref|XP_004147761.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004161559.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN53529.1| Glutathione S-transferase [Cucumis sativus]
Length=218

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 156/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +++ LLD + SM+GMR R+ALALK + YE  +EDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DQVKLLDFWPSMFGMRVRVALALKCVPYEYVDEDLTNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICES IIV+YIDE W DK PL P+ PY RAQARFW   ID K++D  R + W  K +++
Sbjct  63   PICESSIIVQYIDEFWKDKAPLFPTHPYDRAQARFWVDFIDKKLFDCGRKI-WASKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K E+   LK LE  +G+  YFGG+ +GF+D+ LI ++ W  A+E   NFS+E   CP
Sbjct  122  EEGKTEVIGILKQLEEVIGEKAYFGGECLGFVDIVLIGYYTWFYAYETIGNFSIES-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K++ W KRCLQNE++S+   DP K+   VLQM+K  G+
Sbjct  181  KIMSWAKRCLQNESVSESLPDPKKVCDFVLQMKKKYGL  218



>gb|KHG06513.1| putative glutathione S-transferase [Gossypium arboreum]
Length=232

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 160/220 (73%), Gaps = 2/220 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
             + ++VLLD + S +GMR R ALA+KGI YE KEEDL NKS LLLKMNPIHKKIPVLIHN
Sbjct  2    GDEKVVLLDFWPSPFGMRVRTALAVKGIKYEYKEEDLSNKSDLLLKMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICESLI V+YIDE+W  K PLLP+DPY+RA A+FWA  ++ KIYD   + W  K ++
Sbjct  62   GKPICESLIQVQYIDEIWPHKSPLLPTDPYQRAIAKFWADFVEKKIYDLGKKVWTTKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E    LKLLEGELG   YFGG+ +G++D+ L+ F+ W  A+EK  NFS+E   C
Sbjct  122  QEAAKKEFIACLKLLEGELGNKDYFGGENLGYVDVVLVPFYSWFYAYEKCGNFSIER-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            PKLI W KRC++ +++SK   D  KI   VL +RK  G++
Sbjct  181  PKLIAWAKRCMEKDSVSKSLPDQQKIYGFVLHLRKVVGLS  220



>gb|ACI42271.1| glutathione S-transferase Tau2 [Citrus sinensis]
 gb|ACO05907.1| glutathione transferase Tau2 [Citrus sinensis]
Length=216

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 151/214 (71%), Gaps = 5/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG+
Sbjct  3    DEVVLLDFWPSMFGMRVRIALAEKGVKYEYKEEDLKNKSPLLLQMNPVHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES IIV+YIDEVW DK PLLPSDPY+RAQARFW   ID K+YD   + W  K +++ 
Sbjct  63   PVCESSIIVQYIDEVWKDKAPLLPSDPYQRAQARFWVDFIDKKMYDASTKTWTTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LEG+LG   +FGGD  G+LDL+LI F+     F K    S  E  CPK
Sbjct  123  AAKKEFFEALKTLEGQLGDKPFFGGDNFGYLDLSLIPFYYTYETFGK----SSVEAECPK  178

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
               W KRCLQ ETI+K   D  K+ +    MRK 
Sbjct  179  FKAWVKRCLQRETIAKALPDEKKVLEHASGMRKN  212



>gb|KHN27766.1| Glutathione S-transferase 3 [Glycine soja]
Length=217

 Score =   229 bits (583),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 145/208 (70%), Gaps = 2/208 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLL  + SM+GMR R+ALA KG+ YE KEE+L NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVVLLGTWASMFGMRVRIALAEKGVKYEYKEENLRNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICES IIV+YIDEVWNDK P+LPSDPY+RAQARFW   ID K+ D   + W+   ++  
Sbjct  63   PICESAIIVQYIDEVWNDKAPILPSDPYERAQARFWVDYIDKKVNDTWRKMWLSTGEEHE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E     K LE  LG   ++GGD  GF+DL LI F+ W   FE   NF M E  CPK
Sbjct  123  TWKKEFISVFKQLEEALGDKPFYGGDTFGFVDLGLIPFYSWFYTFETYGNFKM-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMV  295
            L+ W KRCLQ ET+SK   D  K+   V
Sbjct  182  LVAWAKRCLQRETVSKTLPDEKKVYDHV  209



>ref|XP_009354827.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=220

 Score =   229 bits (583),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 158/219 (72%), Gaps = 4/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KG+ YES+EEDL NKSPLLLKMNP+HK+IPVLIH G+
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGVEYESREEDLSNKSPLLLKMNPVHKQIPVLIHKGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW++K PLLPSDPY RA ARFWA  +D KIY   +LV WV   + +
Sbjct  63   PICESLIIVQYIDEVWSNKAPLLPSDPYPRAHARFWADYVDKKIYSTGKLV-WVTTGEVQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E+ E  KLLE ELG  TYFGG+  G +D+AL  F+ W  A E   N  M +  CP
Sbjct  122  EAAKKELIECFKLLENELGDKTYFGGESFGLVDVALSPFYSWFYALETCGNLCMVK-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            +L+ W KRC+Q E++SK   D  K+   +L++RK   V+
Sbjct  181  RLVGWAKRCMQRESVSKSLPDQYKMYDFLLELRKKFDVH  219



>ref|XP_010060817.1| PREDICTED: glutathione S-transferase U19-like [Eucalyptus grandis]
 gb|KCW67688.1| hypothetical protein EUGRSUZ_F01433 [Eucalyptus grandis]
Length=227

 Score =   229 bits (583),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 160/215 (74%), Gaps = 5/215 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+ALA KGI YE K EDL NKS LLL+MN +HKKIPVL+HNG 
Sbjct  13   DEVILLDSWPSMFGMRCRIALAEKGIEYEYKGEDLRNKSDLLLRMNRVHKKIPVLVHNGT  72

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLII++YIDE W+D + LLPSDP +RAQARFWA  +D K YD  R V W  + K+E
Sbjct  73   PICESLIILQYIDETWSDGWSLLPSDPKQRAQARFWADYVDKKFYDLERKV-WTIEGKEE  131

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A KEE+ E LKLLEGELG   +FGG ++GF+D+A I F+ WL A+EK  NFS+ E  CP
Sbjct  132  VA-KEELIESLKLLEGELGDKPFFGGKRLGFVDVAAIPFYTWLYAYEKFGNFSI-EAECP  189

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
            KLI WTKRCL  E++SK   DP K+ +  L ++K 
Sbjct  190  KLIAWTKRCLNKESVSKSVPDPQKVYEFTLHVKKA  224



>gb|KDP37218.1| hypothetical protein JCGZ_06274 [Jatropha curcas]
Length=222

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (72%), Gaps = 4/222 (2%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M   ++++LLD + S +  R R+ALA K + YESK+EDL NKSPLLL+MNP+HK+IPVLI
Sbjct  1    MSEGDQLILLDLFPSPFAARVRIALAEKELQYESKQEDLSNKSPLLLQMNPVHKQIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFK  574
            HN KPICES+IIV+YIDEVW  K PLLPS PY+RA ARFWA  ID KIY   R++ W  K
Sbjct  61   HNDKPICESMIIVQYIDEVWTHKSPLLPSHPYQRAHARFWADYIDKKIYPIGRML-WASK  119

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
             + + A K+E+ +  K+LEGEL    YFGG+  G++DLALI F  +  +FE     SM E
Sbjct  120  GEVKEASKKELVQCFKILEGELADKPYFGGESFGYIDLALIPFSNFFYSFETLGKLSM-E  178

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            + CPKL+EW+KRCLQ ET+SK  ADP  + + VL +RK  G+
Sbjct  179  VECPKLLEWSKRCLQKETVSKSIADPKTVYETVLGIRKQLGM  220



>ref|XP_010694823.1| PREDICTED: probable glutathione S-transferase [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 159/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE+VLLD + S +GMR R+ALA K + YE ++E+L +KS LLLKMNP+HKKIPVL+HN K
Sbjct  3    NEVVLLDFWPSPFGMRVRIALAEKEVKYEYRDENLRDKSELLLKMNPVHKKIPVLVHNNK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLIIVEYIDEVW+DKYPLLPSDPY+RAQARFWA  ++ K+Y   R V W  K  ++
Sbjct  63   PVCESLIIVEYIDEVWSDKYPLLPSDPYQRAQARFWADFVEKKMYTTGRSV-WSTKGAEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A   +  + LKLLE ELG   YFGGD  G++DL  I ++ W  A+E   NF +EE  CP
Sbjct  122  EAAIRDFIDHLKLLEQELGNKPYFGGDNFGYVDLTFIPYYSWFHAYETLGNFKIEE-SCP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K+IEW KRC++ ET++K   D  K+ + VL+++K  G+
Sbjct  181  KIIEWAKRCMERETVAKALPDQKKVYEFVLELKKMYGL  218



>ref|XP_002269705.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=223

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + S +GMR R+ALA KG+ YE +EE+L NKSPLLL+MNP+HKK+PVLIHNGK
Sbjct  3    DEIILLDFWASHFGMRVRIALAEKGLMYEYREENLWNKSPLLLEMNPVHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKI---YDRLVE--WVFKT  571
            PICESL+IV+YIDEVW DK PLLPSDPY+RAQARFWA  +D K+   Y  L +  W  K 
Sbjct  63   PICESLMIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKVPQLYHELGKKIWYTKG  122

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            ++  A K+E  E LK  EGELG+  YFGG+  GF D+AL+    W   +E   NFS+E+ 
Sbjct  123  EEHEAGKKEFIECLKFFEGELGEKPYFGGENFGFEDVALVPLSCWFYTYESFGNFSVED-  181

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
             CP L+ W KRC Q E++S   ADP K+   V++MRK  G++
Sbjct  182  ECPNLMAWAKRCGQKESVSSSLADPHKVHGFVMEMRKRLGID  223



>gb|KEH38383.1| glutathione S-transferase, amino-terminal domain protein, partial 
[Medicago truncatula]
Length=204

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 152/200 (76%), Gaps = 2/200 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KGI +E +EEDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDYWVSPFGMRVRIALAEKGIKHEYREEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICESLI V+YIDEVWN+K PLLPSDPY+R+QARFWA  +D KIY+     W  K +++ 
Sbjct  63   SICESLIAVQYIDEVWNEKSPLLPSDPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LKLLE ELG  TYFGGDKIGF+D+ALI F+ W   +E   N ++E+  CPK
Sbjct  123  AAKKEFIEALKLLEQELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEK-ECPK  181

Query  378  LIEWTKRCLQNETISKCFAD  319
             I W KRC+Q E+ISK   D
Sbjct  182  FIAWAKRCMQVESISKSLPD  201



>ref|XP_002298938.2| hypothetical protein POPTR_0001s42790g [Populus trichocarpa]
 gb|EEE83743.2| hypothetical protein POPTR_0001s42790g [Populus trichocarpa]
Length=220

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 163/220 (74%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA K + YE  E+DL NK  LLL+MNP+HKKIPVL+H+
Sbjct  2    AGDQVTLLDLWASPFGMRVRIALAEKAVKYEYSEQDLWNKGDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKPICESLIIV+YIDEVWNDK PLL SDPY+RAQ+RFWA  +D KI+D  R + W  K +
Sbjct  62   GKPICESLIIVQYIDEVWNDKAPLLFSDPYERAQSRFWADFVDKKIHDVGRKI-WTTKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+ A K++  + LKLLEGELG   YFGGD +G++D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEAAKKDFIDSLKLLEGELGDKPYFGGDTLGYVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI + KRCLQ E++SK   DP K+S  V+ MRK  G+
Sbjct  180  CPKLIAYCKRCLQKESVSKSLEDPQKVSDFVVMMRKKLGL  219



>gb|AHI54570.1| glutathione S-transferase [Camellia japonica]
Length=220

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 160/219 (73%), Gaps = 5/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N++VLLD + SM+GMR R+ALA KGI YE +EEDL NKSPLLLKMNP+HKKIPVLIHN K
Sbjct  3    NQLVLLDFWPSMFGMRLRIALAEKGIDYEYREEDLRNKSPLLLKMNPVHKKIPVLIHNDK  62

Query  735  PICESLIIVEYIDEVWNDKY-PLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKD  565
            P+CESLI ++YIDEVW DK  PLLPSDPY+RA ARFWA  +D K+YD  R V W  K ++
Sbjct  63   PVCESLIALQYIDEVWKDKSPPLLPSDPYQRAHARFWADYVDKKVYDGGRKV-WTSKKEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK+LEGELG   YF G+  G++D+AL+ F+ W  A+E   NFS+E   C
Sbjct  122  QEAAKKEFIECLKVLEGELGDKPYFAGETFGYIDIALVPFYSWFYAYETCGNFSVEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC+  E+++K   D  K+ + V  +R+  G+
Sbjct  181  PKLIAWVKRCMNKESVAKTLPDQHKVYEFVKIVRQKYGL  219



>gb|EYU26253.1| hypothetical protein MIMGU_mgv1a013454mg [Erythranthe guttata]
Length=220

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 155/215 (72%), Gaps = 5/215 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VL+D Y SMYGMR R+ALA KG+ YE K E+L +KS LLL+MNP HKK+PVLIHNGK
Sbjct  3    DEVVLVDAYISMYGMRVRIALAEKGVEYEFKNENLFDKSALLLEMNPAHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKY-PLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKD  565
            PICESLIIVEYIDEVW D   PLLP  PY+RAQARFWA  +D K+    R + W  K  +
Sbjct  63   PICESLIIVEYIDEVWKDNSPPLLPRHPYQRAQARFWADFVDKKVSVPGRRI-WFTKGDE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K+E  E L  LE ELG+ TYFGG+  GF+DLALI F+ W  A+E   NFS+EE  C
Sbjct  122  QEKAKKEFIEALNSLEEELGEKTYFGGESFGFVDLALIPFYSWFYAYETCGNFSIEEH-C  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            P+LI W KRC++ E++SK  ADP K+   VL ++K
Sbjct  181  PRLIVWAKRCMEKESVSKSLADPKKVYDFVLLLKK  215



>ref|NP_001234157.1| glutathione S-transferase-like protein [Solanum lycopersicum]
 gb|AAL92873.1| glutathione S-transferase-like protein [Solanum lycopersicum]
Length=220

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N++++ LD + SMYGMR R+ALA K I YE ++EDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANDQVIQLDFWPSMYGMRLRIALAEKEIKYEYRDEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE  562
            GKPICES+I VEYIDEVW DK PLLPSDPY+RAQARFWA  ID K+Y    +    T DE
Sbjct  62   GKPICESIIGVEYIDEVWKDKAPLLPSDPYERAQARFWADYIDKKLYATGSKIYTATGDE  121

Query  561  N-AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
              A K++  E LK+LEG LG+  Y+GGD  GF D+ALI F+ W  A+E   NFS+E   C
Sbjct  122  QEAGKKDFVEILKVLEGALGEKPYYGGDNFGFGDIALIGFYCWFHAYEVYGNFSIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            P L+ W KRC+Q ++++K   D  KI + V  +R+  G+
Sbjct  181  PNLVAWAKRCMQRDSVAKTLPDQHKIIEFVKILREKLGL  219



>ref|XP_009344314.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
 ref|XP_009347997.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=219

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI Y  K+ED+ NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGIEYVYKDEDVRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLI ++YIDEVWNDK PLLPSD Y RAQARFWA  +D KIY+  R + W  K +++
Sbjct  63   PVCESLIALQYIDEVWNDKAPLLPSDSYLRAQARFWADFVDKKIYEFGRKI-WTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
            +A K+E  + + +LEGELG   +FGG+ +GF+D+ALI F+ W L +EK  NFS+E L  P
Sbjct  122  DAAKKEFLDCMGVLEGELGDKPFFGGETLGFVDVALIPFYSWFLLYEKFGNFSVEAL-HP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K I W KRC++ E++SK   +  K+   V+ MRK  G+
Sbjct  181  KFIAWVKRCMEKESVSKSLPEQEKVYDFVMFMRKKLGM  218



>ref|XP_004243195.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=222

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEED--LDNKSPLLLKMNPIHKKIPVLI  748
            +N+E++LLD + SM+GMR R+ALA KGI YE KEE+  + NKS LLL+MNPIHKK+PVLI
Sbjct  2    ANDELILLDFWASMFGMRLRIALAEKGIKYEYKEEEGLISNKSALLLEMNPIHKKVPVLI  61

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKT  571
            HNGKPICES+I VEYI+EVW DK PLLPSDPY+RAQARFW   ID K+Y    + W  K 
Sbjct  62   HNGKPICESIIGVEYIEEVWKDKAPLLPSDPYERAQARFWVDYIDKKLYVSARKIWGTKG  121

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            +++ A K++  E LK+LEGELG+  YFGGD  GF+D+ALI F+ W  A+E   NFS  E 
Sbjct  122  EEQEAGKKDFIEVLKVLEGELGEKPYFGGDNFGFVDIALIGFYSWFYAYETYGNFSA-EA  180

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             CPK + W KRC+Q ++++K   D  K+ + +  +R+  G+
Sbjct  181  ECPKFVAWAKRCMQRDSVAKSLPDQHKVLEFIQMLRRKFGI  221



>ref|XP_008226256.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=220

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE +EEDL NKSPLLLKMNP+HK+IPVLIH G+
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIDYEPREEDLSNKSPLLLKMNPVHKQIPVLIHKGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLIIV+YIDEVW+ K PLLPSDPY RA ARFWA  +D KIY   +LV W  + + +
Sbjct  63   PVCESLIIVQYIDEVWSHKAPLLPSDPYHRAHARFWADYVDKKIYSTGKLV-WGTRGEIQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E+ E  +LLE ELG  TYFGG+  G +D+ALI F+ W  A E   N  M +  CP
Sbjct  122  EAAKKELIECFRLLENELGDKTYFGGETFGIVDVALIPFYSWFYALETCGNLCMVK-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            +L+ W KRC+Q E++SK   D  K+   +L++RK
Sbjct  181  RLVAWAKRCMQRESVSKSLPDQYKMYDFLLELRK  214



>gb|EYU26249.1| hypothetical protein MIMGU_mgv1a013392mg [Erythranthe guttata]
Length=221

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 160/218 (73%), Gaps = 8/218 (4%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            +VLLD   SM+GMR R+ALA KGI YE KEE+L++KS LLL+MNP+HKKIPVLIHNGKP+
Sbjct  5    VVLLDSLCSMFGMRARIALAEKGIEYEYKEENLEDKSALLLEMNPVHKKIPVLIHNGKPV  64

Query  729  CESLIIVEYIDEVW--NDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKD  565
            CESLIIV+YIDEVW  N+   LLPSDPY++AQARFWA  +D K+YD   RL  W  K  +
Sbjct  65   CESLIIVQYIDEVWKDNNSPSLLPSDPYQKAQARFWADFVDKKVYDAGKRL--WTTKGDE  122

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                K++  + LKL+E ELG+  YFGG+  GF+D+ALI+F  W   +E   NFS+EE  C
Sbjct  123  IETAKKDFIKALKLMEAELGEKPYFGGENFGFVDVALITFSSWFYTYETCGNFSVEEH-C  181

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            PKL+EW KRC++ E++SK  ADP K+   +L  +K +G
Sbjct  182  PKLMEWVKRCMEKESVSKSLADPKKLYDSILFFKKKHG  219



>emb|CDY14615.1| BnaC02g24980D [Brassica napus]
Length=219

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 156/213 (73%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+AL  KGI +E ++EDL NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFGMRTRIALREKGIEFEYRDEDLWNKSPLLLETNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES I V+YIDEVW+DK  +LPSDPY+RAQARFW   ID K+YD   + W  K +++ 
Sbjct  63   PVCESTIQVQYIDEVWSDKNRILPSDPYQRAQARFWVDFIDKKMYDAQRKVWGTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LK LE ELG++TYFGGD  G++D+ LI F+ W  A+EK  N ++E   CPK
Sbjct  123  TGKKEFIELLKTLESELGENTYFGGDDFGYVDIGLIGFYSWFHAYEKYGNLNIES-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            LI W K C+Q E+++K   D  K+ + V ++RK
Sbjct  182  LIAWAKTCMQRESVAKSLPDSEKVIEFVTEIRK  214



>ref|XP_008226270.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=225

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 164/218 (75%), Gaps = 5/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLLD + SM+GMR R+ALA KG+ YE +EEDL +NKSPLLL+MNP+HKKIPVLIHNG
Sbjct  3    DEVVLLDFWPSMFGMRVRVALAEKGVKYEYREEDLLNNKSPLLLQMNPVHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE-  562
            KP+CES  IV+YIDE W DK PLLPSDPY+RAQARFW   ID  +Y+ + + +  T+ E 
Sbjct  63   KPVCESANIVQYIDEAWKDKAPLLPSDPYQRAQARFWVDYIDKNLYE-VGKNICATEGEE  121

Query  561  -NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
              A K+++ E LKLLEG+LG + YFGG+  GFLD+AL++F+    ++E   NFS+E   C
Sbjct  122  QEAAKKKLIEILKLLEGQLGDNAYFGGEIFGFLDVALVTFYCRFFSYETCGNFSIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            PKLIEW KRC+Q E+++K  ADP K+ +  L ++K  G
Sbjct  181  PKLIEWAKRCMQKESVAKSLADPKKVYEFTLLLKKRFG  218



>emb|CDY26861.1| BnaA02g18860D [Brassica napus]
Length=219

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 154/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+AL  KGI +E ++EDL NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    NEVILLDFWPSMFGMRTRIALREKGIEFEYRDEDLWNKSPLLLETNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CES I V+YIDEVW+DK P+LPSDPY+RAQARFW   ID K+YD  R V W  K +++
Sbjct  63   PVCESTIQVQYIDEVWSDKNPILPSDPYQRAQARFWVDFIDKKMYDAQRKVWWT-KGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E  E LK LE EL   TYFGGD  G++D+ LI F+ W  A EK  N ++E   CP
Sbjct  122  ETGKKEFIELLKTLESELRDKTYFGGDDFGYVDIGLIGFYSWFHACEKYGNLNIES-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            KLI W K C+Q E+++K   D  K+ + V ++RK
Sbjct  181  KLIAWAKTCMQRESVAKSLPDSEKVIKFVTEIRK  214



>ref|XP_002270159.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 159/219 (73%), Gaps = 6/219 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +EI+LLD + SM+GM+ R+ALA KG+ YE ++EDL NK PLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEIILLDFWPSMFGMKVRIALAEKGLKYEYRDEDLFNKGPLLLEMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY---DRLVEWVFKTKD  565
            PICES IIV+YIDEVW DK PLLPSD Y RAQARFWA  ID K++    RL  W  K ++
Sbjct  63   PICESQIIVQYIDEVWKDKSPLLPSDQYHRAQARFWADYIDKKLHLLGARL--WRTKGEE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LKLLEGELG   YFGG+  GF+D+ L+ +F WL  FE   NFS+E   C
Sbjct  121  QEANKKEYIECLKLLEGELGDKPYFGGENFGFVDVNLMPYFSWLYVFEIAANFSIEA-EC  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC++ E++S    D  K+    LQ++K +G+
Sbjct  180  PKLITWAKRCMEKESVSTSLPDRQKLYDFFLQLKKWHGI  218



>ref|XP_006366777.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 157/219 (72%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N+E++LLD + SM+GMR R+ALA K I YE KEEDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANDELILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLWNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICES+I VEYI+EVW DK PLLPSDPY RAQARFWA  ID K+Y    + W    ++
Sbjct  62   GKPICESIIGVEYIEEVWKDKSPLLPSDPYDRAQARFWADYIDKKLYYSARKIWGANGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LK+LEG LG+  YFGGD  GF+D+ALI F+ W+ + E   NFS E   C
Sbjct  122  QEAGKKEFIECLKVLEGALGEKPYFGGDNFGFVDIALIGFYSWIHSCETYGNFSTEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK + W KRC+Q ++++K   D  K+ +    +R   G+
Sbjct  181  PKFVVWAKRCMQRDSVAKSLPDQHKVLEFAKTLRHKLGL  219



>ref|XP_007212347.1| hypothetical protein PRUPE_ppa014555mg [Prunus persica]
 gb|EMJ13546.1| hypothetical protein PRUPE_ppa014555mg [Prunus persica]
Length=220

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 161/217 (74%), Gaps = 3/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLLD + SM+GMR R+ALA KG+ YE +EEDL +NKSPLLL+ NP+HKKIPVLIHNG
Sbjct  3    DEVVLLDFWPSMFGMRVRVALAEKGVKYEYREEDLLNNKSPLLLQTNPVHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KP+CES  IV+YIDE W DK PLLPSDPY+RA ARFW   ID  +Y+     W  K +++
Sbjct  63   KPVCESANIVQYIDEAWKDKAPLLPSDPYQRALARFWVDYIDKNLYEAGKNIWATKGEEQ  122

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K ++ E LKLLEG+LG +++FGG+  GFLD+AL++F+ W  ++E   NFS+E   CP
Sbjct  123  EAAKNKLIEILKLLEGQLGDNSFFGGEIFGFLDVALVTFYCWFFSYETCGNFSIEA-ECP  181

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            KLIEW KRC++ E+++K  AD  K+ +  L ++K  G
Sbjct  182  KLIEWAKRCMEKESVAKSLADSKKVYEFTLLLKKRFG  218



>gb|KEH38382.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=203

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 151/203 (74%), Gaps = 2/203 (1%)
 Frame = -3

Query  873  MRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPICESLIIVEYIDE  694
            MR R+ALA KGI +E KEEDL NKSPLLL+MNP+HKKIPVLIHNGK ICESLI V+YIDE
Sbjct  1    MRVRIALAEKGIKHEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKSICESLIAVQYIDE  60

Query  693  VWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDENAIKEEIAEWlklle  517
            VWN+K PLLPSDPY+R+QARFWA  +D KIY+     W  K +++ A K+E  E LKLLE
Sbjct  61   VWNEKSPLLPSDPYQRSQARFWADYVDKKIYEVGKNLWTKKGEEQEAAKKEFVEALKLLE  120

Query  516  gelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLIEWTKRCLQNETI  337
             ELG  TYFGGDKIGF+D+ALI F+ W   +E   N ++E+  CPK I W KRC+Q E+I
Sbjct  121  QELGDKTYFGGDKIGFVDVALIPFYTWFKGYETFGNINVEK-ECPKFIAWAKRCMQVESI  179

Query  336  SKCFADPLKISQMVLQMRKTNGV  268
            SK   D  K+   ++++RK  G+
Sbjct  180  SKSLPDQDKVYGFIVEIRKKFGL  202



>ref|XP_009783951.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
 ref|XP_009783952.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=220

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 160/219 (73%), Gaps = 5/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNG  739
            NE++LL+ + SM+GMR ++ALA K I YE KEEDL   KSPLLLK+NPIHKK+PVLIHNG
Sbjct  3    NEVILLNFWPSMFGMRVKVALAEKEIKYEYKEEDLFTAKSPLLLKINPIHKKVPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            K +CESLI+VEYIDEVWNDK PLLPSDPY+RAQARFWA   D K+YD   + W  K ++ 
Sbjct  63   KIVCESLIVVEYIDEVWNDKAPLLPSDPYERAQARFWADYTD-KLYDYGRKIWATKREEL  121

Query  561  NAIKEEIAEWlkllegelgKDT-YFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
               K+E+ + LKLLE E+  D  YFGG+  GF+D+ALI F+ W   +E   NFS+E   C
Sbjct  122  KEAKKELIDPLKLLELEVLGDKPYFGGENFGFVDIALIGFYCWFYTYENFANFSIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKL  W KRC+Q E++SK   DP KI +++L+ RK  GV
Sbjct  181  PKLAAWGKRCMQRESVSKSLPDPYKIYEVLLEFRKNYGV  219



>ref|XP_007214499.1| hypothetical protein PRUPE_ppa018063mg [Prunus persica]
 gb|EMJ15698.1| hypothetical protein PRUPE_ppa018063mg [Prunus persica]
Length=220

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE +EEDL NKSPLLLKMNP+HK+IPVLIH G+
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIDYEPREEDLSNKSPLLLKMNPVHKQIPVLIHKGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLIIV+YIDEVW+ + PLLPSDPY RA ARFWA  +D KIY   +LV W  + + +
Sbjct  63   PVCESLIIVQYIDEVWSHQAPLLPSDPYHRAHARFWADYVDKKIYSTGKLV-WGTRGEIQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E+ E  KLLE ELG  TYFGG+  G +D+ALI F+ W  A E   N  M +  CP
Sbjct  122  EAAKKELIECFKLLENELGDKTYFGGESFGIVDVALIPFYSWFYALETCGNLCMVK-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            +L+ W KRC+Q E++SK   D  K+   +L++RK
Sbjct  181  RLVTWAKRCMQRESVSKSLPDQYKMYDFLLELRK  214



>ref|XP_004248222.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=221

 Score =   226 bits (576),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 158/221 (71%), Gaps = 7/221 (3%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHN  742
            N+E++LLD + SM+GMR R+ALA K I YE KEEDL  +KSPLL+KMNPIHKKIPVLIHN
Sbjct  3    NDEVILLDFWPSMFGMRVRVALAEKAIEYEYKEEDLFTSKSPLLVKMNPIHKKIPVLIHN  62

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CES ++VEYIDEVW DK PLLPS PY R+QARFWA   D K+YD  R + W  K +
Sbjct  63   GKPVCESFVVVEYIDEVWKDKAPLLPSHPYDRSQARFWASYTD-KLYDFGRRI-WTVKRE  120

Query  567  DENAIKEEIAEWlkllegelgKDT-YFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            +    K++  + LKLLE     D  YFGG+  GF+D+ALI F+ W   +E   NFS+ E 
Sbjct  121  EFAEGKKDFIDPLKLLEEAALGDKPYFGGESFGFVDIALIGFYSWFYTYETICNFSI-EA  179

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             CPK+  W KRC++ E++SK  AD  KI ++V++ RK NG+
Sbjct  180  ECPKIAAWGKRCMKRESVSKSLADSRKIYEVVIEFRKKNGL  220



>ref|XP_009354818.1| PREDICTED: probable glutathione S-transferase isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 160/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE K+EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGIEYEYKDEDLWNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE--  562
            P+CESLI ++YIDEVWNDK PLLPSD Y RAQARFWA  +D KIYD +   +  TK E  
Sbjct  63   PVCESLIALQYIDEVWNDKAPLLPSDSYLRAQARFWADFVDKKIYD-IGRKLGTTKGEEY  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
            +A K++  + + +LEGELG  T+FGG+ +GF+D+ALI F+ W L +EK  NFS+E    P
Sbjct  122  DAAKKDFLDCIGVLEGELGDKTFFGGETLGFVDVALIPFYSWFLVYEKSGNFSVEA-EHP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K I W KRC++ E++SK   +  ++   V  MRK  G+
Sbjct  181  KFIAWVKRCMEKESVSKSLPEQERVYDFVALMRKKFGI  218



>ref|XP_011030768.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=219

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +  ++ LLD + S +GMR R+ALA KG+ YE +EEDL NKS LLL+MNP++K+IPVL+H+
Sbjct  2    AGGQVTLLDFWPSPFGMRVRLALAEKGVKYEYREEDLWNKSALLLQMNPVNKQIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKP+CESLIIV+YIDEVW D  PLLPSDPY+RAQARFWA  +D KIYD   + W  K ++
Sbjct  62   GKPVCESLIIVQYIDEVWKDSAPLLPSDPYQRAQARFWADFVDKKIYDLGRKIWTKKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K++  + LKL+EGELG   YFGG+ IG++D+AL+ F+ W  A+E   NF++E   C
Sbjct  122  QETAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI + KRCLQ ET+SK   DP K+   VL + K  G+
Sbjct  181  PKLIAYCKRCLQKETVSKALEDPQKVYDFVLILMKKFGI  219



>gb|AAO61855.1| glutathione S-transferase U2 [Malva pusilla]
Length=219

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 152/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S + MR ++AL LKGI YE K++DL NK PLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFAMRAKLALELKGINYECKQQDLLNKDPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDEN-  559
            P+CESL+IV YIDEVWN   PLLPSDPY+R+QA FW   I+  +Y         T +E  
Sbjct  63   PVCESLVIVRYIDEVWNHVSPLLPSDPYRRSQALFWTDYIEKTVYGVGRRIFIATGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              KEE+ ++LK +E ELG+  YFGGD IGF+D+AL+ F  W   +E   NFS+EE  CPK
Sbjct  123  KAKEELIQFLKTIETELGEKLYFGGDSIGFVDVALLPFTAWFYTYETCGNFSIEE-SCPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            LIEW KRC Q E++SK  A P KI    L+ ++  G N
Sbjct  182  LIEWVKRCTQKESVSKAIAHPHKIYDFFLEYKEKLGGN  219



>gb|AFK44154.1| unknown [Lotus japonicus]
Length=221

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 154/218 (71%), Gaps = 6/218 (3%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +++E++LLDE+ SM+GMR R+ALA K I YE KEEDL NKS LLL+MNPIHKKIPVLIH+
Sbjct  2    ADHELILLDEWLSMFGMRARIALAEKEIRYEYKEEDLTNKSQLLLEMNPIHKKIPVLIHH  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKT  571
            GKPICES+IIVEYIDEVW +K PLLPS+PY+RAQARFWA  ++ K+ D   R+  W  K 
Sbjct  62   GKPICESIIIVEYIDEVWKEKAPLLPSEPYQRAQARFWADFVNKKVGDVGGRI--WAGKR  119

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
                  K+E+ E LK LE  LG   YFGGD  GF+D+ALI F+ W   +E    F + E 
Sbjct  120  DGIEEAKKELIEGLKELEKVLGVKPYFGGDTFGFVDIALIPFYTWFYTYEALCKFKV-EA  178

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
             CPKLI W KRC Q E++SK  AD  ++   V+  RK+
Sbjct  179  ECPKLIAWAKRCKQRESVSKSVADEKEVYDFVVNYRKS  216



>emb|CDX68016.1| BnaA07g20560D [Brassica napus]
Length=219

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             E++LLD + SMYGMR R+AL  KG+ +E ++E+L  KSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    KEVILLDFWPSMYGMRTRIALREKGVDFEYRDENLREKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES I V+YIDEVW  K P+LPSDPY+RAQARFW   ID K+Y+   + +  K +++ 
Sbjct  63   PVCESAIQVQYIDEVWPHKNPILPSDPYQRAQARFWVDFIDKKMYEAQRKVYATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LK LE ELG   YFGGD  G++D+ LI F+ W   +EK  NFS+ E  CPK
Sbjct  123  TGKKEFIEILKTLETELGDKPYFGGDDFGYVDIGLIGFYTWFPGYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC+Q E+++K   DP K+ + +  +RK  GV
Sbjct  182  LIAWAKRCMQRESVAKSLPDPEKVVEFMAMLRKKFGV  218



>emb|CDX79261.1| BnaC06g20420D [Brassica napus]
Length=219

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             E++LLD + SMYGMR R+AL  KG+ +E ++E+L  KSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    KEVILLDFWPSMYGMRTRIALREKGVDFEYRDENLREKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES I V+YIDEVW  K P+LPSDPY+RAQARFW   ID K+Y+   + +  K +++ 
Sbjct  63   PVCESAIQVQYIDEVWPHKNPILPSDPYQRAQARFWVDFIDKKMYEAQRKVYATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LK LE ELG   YFGGD  G++D+ LI F+ W   +EK  NFS+ E  CPK
Sbjct  123  TGKKEFIEILKTLETELGDKPYFGGDDFGYVDIGLIGFYTWFPGYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC+Q E+++K   DP K+ + +  +RK  GV
Sbjct  182  LIAWAKRCMQRESVAKSLPDPEKVVEFMAMLRKRFGV  218



>ref|XP_011013656.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 162/220 (74%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +  ++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGEQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRNKSDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW +K PLLPSDPY+RA++RFWA  +D K+YD  R + W  K +
Sbjct  62   GKPVCESLIIVQYIDEVWKEKAPLLPSDPYERARSRFWADFVDKKMYDFGRKI-WTTKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+   K++  + LKLLEGELG   YFGG+ +GF+D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEVAKKDFIDSLKLLEGELGDKPYFGGETLGFVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI + KRCLQ E++SK   DP K+   V+ +RK  G+
Sbjct  180  CPKLITYCKRCLQKESVSKSLKDPHKVYDFVVMLRKMLGL  219



>ref|XP_009104572.1| PREDICTED: glutathione S-transferase U19 [Brassica rapa]
Length=219

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             E++LLD + SMYGMR R+AL  KG+ +E ++E+L  KSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    KEVILLDFWPSMYGMRTRIALREKGVDFEYRDENLREKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES I V+YIDEVW  K P+LPSDPY+RAQARFW   ID K+Y+   + +  K +++ 
Sbjct  63   PVCESAIQVQYIDEVWPHKNPILPSDPYQRAQARFWVDFIDKKMYEAQRKVYATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E  E LK LE ELG   YFGGD  G++D+ LI F+ W   +EK  NFS+ E  CPK
Sbjct  123  TGKKEFIEILKTLESELGDKPYFGGDDFGYVDIGLIGFYTWFPGYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC+Q E+++K   DP K+ + +  +RK  GV
Sbjct  182  LIAWAKRCMQRESVAKSLPDPEKVVEFMAMLRKKFGV  218



>ref|XP_011036235.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 161/219 (74%), Gaps = 4/219 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +  ++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGEQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRNKSDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW +K PLLPSDPY+RA++RFWA  +D K+YD  R + W  K +
Sbjct  62   GKPVCESLIIVQYIDEVWKEKAPLLPSDPYERARSRFWADFVDKKMYDFGRKI-WTTKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+   K++  + LKLLEGELG   YFGG+ +GF+D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEVAKKDFIDSLKLLEGELGDKPYFGGETLGFVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            CPKLI + KRCLQ E++SK   DP K+   V+ +RK  G
Sbjct  180  CPKLIAYCKRCLQKESVSKSLKDPRKVYDFVVMLRKMLG  218



>gb|ABZ80407.1| tau glutathione S-transferase [Casuarina glauca]
Length=219

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+AL  KGI YE KEEDL NKS LLLKMNP++KKIPV IHNGK
Sbjct  3    DEVVLLDMWMSMFGMRVRLALIEKGIQYEYKEEDLMNKSELLLKMNPVYKKIPVFIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLIIV+YIDEVW D+ PLLPSDPY+RAQARFWA  ID K ++     W  K ++  
Sbjct  63   PICESLIIVQYIDEVWGDRSPLLPSDPYERAQARFWADFIDKKFHEASKGLWFNKGEELE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K++  E LK LEGEL    YFGG+  GF+DLALI+F+ W   ++    FS+ E+ CPK
Sbjct  123  AAKKDFFEALKTLEGELDHKPYFGGENFGFVDLALITFYNWFYFYDTIGKFSI-EVECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            +++W +RCL+ E+++K   D  K+ +  L++RK  G+
Sbjct  182  IMQWGRRCLERESVAKTLPDTKKLCEAALELRKKIGM  218



>ref|XP_006442222.1| hypothetical protein CICLE_v10022154mg [Citrus clementina]
 gb|ESR55462.1| hypothetical protein CICLE_v10022154mg [Citrus clementina]
Length=219

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+G+R R+ALA KG+ YE KE+DL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWASMFGIRVRIALAEKGVKYEYKEQDLFNKSPLLLRMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             +CES IIV+YIDEVW DK PLLP DPY+RAQARFW   ID K+YD   + W  K +++ 
Sbjct  63   SVCESSIIVQYIDEVWKDKAPLLPYDPYQRAQARFWVDFIDKKMYDTSRKTWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LEGELG   +FGGD  G++DL LI ++ W  ++E    FS+E   CPK
Sbjct  123  AAKKEFIEVLKTLEGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
             I W KRCLQ ET++K   D  K+ + V  +R+
Sbjct  182  FIAWVKRCLQRETVAKALPDEKKVFEFVSVLRE  214



>ref|XP_006477979.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 153/213 (72%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+G+R R+ALA KGI YE KE+DL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWASMFGIRVRIALAEKGIKYEYKEQDLFNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             +CES IIV+YIDEVW DK PLLP DPY+RAQARFWA  ID K+YD   + W  K +++ 
Sbjct  63   SVCESSIIVQYIDEVWKDKAPLLPYDPYQRAQARFWADFIDKKMYDTSRKTWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK L GELG   +FGGD  G++DL LI ++ W  ++E    FS+E   CPK
Sbjct  123  AAKKEFIEVLKTLGGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
             I W  RCLQ ET++K   D  K+ + V  +R+
Sbjct  182  FIAWVTRCLQRETVAKALPDEKKVFEFVSVLRE  214



>ref|XP_003628404.1| Glutathione S-transferase [Medicago truncatula]
 gb|AET02880.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
 gb|AFK46926.1| unknown [Medicago truncatula]
Length=219

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 151/214 (71%), Gaps = 6/214 (3%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKP  733
            E++LLDE+ SM+GMR R+ALA KGI YE KEEDL+NKS +LLKMNPIHKKIPVLIH GKP
Sbjct  4    ELILLDEWLSMFGMRARIALAEKGIKYEYKEEDLENKSQMLLKMNPIHKKIPVLIHKGKP  63

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKDE  562
            I ES+IIVEYIDEVW DK P LPSDPY++AQARFWA  ++ K+ D   R+  W  K  + 
Sbjct  64   ISESIIIVEYIDEVWKDKVPFLPSDPYQKAQARFWADFVNKKVGDVGGRI--WAGKRDEI  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ E LK LE  LG   YFGGD  GF+D+ALI F+ W   +EK  NF +EE  C 
Sbjct  122  ELAKKELIEGLKELENVLGDQPYFGGDTFGFVDIALIPFYSWFYTYEKLCNFKVEE-ECE  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            KLI W K C Q E++SK  AD  ++   V+  RK
Sbjct  181  KLIVWAKNCKQKESVSKSIADEKEVYDFVVNYRK  214



>ref|XP_009591608.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
tomentosiformis]
 ref|XP_009591609.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
tomentosiformis]
 ref|XP_009591611.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
tomentosiformis]
Length=221

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 160/220 (73%), Gaps = 5/220 (2%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHN  742
            N+E++LL+ + SM+GMR R+ALA K I YE KEEDL   KSPLLLKMNPIHKKIPVLIHN
Sbjct  3    NDEVILLNFWPSMFGMRVRVALAEKEIKYEYKEEDLFTAKSPLLLKMNPIHKKIPVLIHN  62

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GK +CESLI VEYIDEVWNDK PLLPSDPY+RAQARFWA   D K+YD   + W  K ++
Sbjct  63   GKTVCESLIAVEYIDEVWNDKAPLLPSDPYERAQARFWADYTD-KLYDYGRKIWATKREE  121

Query  564  ENAIKEEIAEWlkllegelgKDT-YFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
               I +++ + LKLLE E+ +D  YFGG+  GF+D+ALI F+ W   +E   NFS+    
Sbjct  122  FEGITKDLIDPLKLLELEVLRDKPYFGGESFGFVDIALIGFYCWFYTYENVGNFSIVA-E  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKL  W KRC+Q E++SK   DP KI +++L+ RK  GV
Sbjct  181  CPKLAAWGKRCMQRESVSKSVPDPHKIYEVLLEFRKNYGV  220



>ref|XP_008226260.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=219

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 157/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +++VLLD + S +GMR R+ALA KG+ YE KEEDL NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    DQVVLLDFWPSPFGMRLRIALAEKGVQYEYKEEDLRNKSPLLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
             + ESLI V+Y+DEVW DK PLLPSDP+ RAQARFWA  +D K+Y+  R V W  K +++
Sbjct  63   AVSESLIAVQYVDEVWKDKAPLLPSDPHLRAQARFWADYVDKKMYEIGRKV-WTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
            +A K+E  E + +LEGELG   YFGG   GF+D+ALI F+ WL  +EK  NFS+E    P
Sbjct  122  DAAKKEFLECISVLEGELGDKPYFGGKTFGFVDVALIPFYSWLSVYEKFGNFSVES-EHP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K I W KR L+ E++SK   D  K+   VL+MRK  GV
Sbjct  181  KFIAWAKRSLEKESVSKSVPDQQKVYDFVLEMRKKLGV  218



>ref|XP_010060810.1| PREDICTED: probable glutathione S-transferase isoform X1 [Eucalyptus 
grandis]
 gb|KCW67683.1| hypothetical protein EUGRSUZ_F01427 [Eucalyptus grandis]
Length=219

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 159/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++L D + SM+GMR R+ALA KG+ YE KEEDL  KS LLL+MNPIHKKIPVL+HNGK
Sbjct  3    DEVILQDFWSSMFGMRCRIALAEKGVKYEYKEEDLRKKSDLLLQMNPIHKKIPVLVHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE--  562
            P+CESLII++YIDE W DK  LLPSDPY+RAQARFWA     K  D L   +  TK E  
Sbjct  63   PVCESLIILQYIDETWPDKCSLLPSDPYQRAQARFWADYFYKKFSD-LGRKICTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ + LKLLEGELG   +FGG+K+G +DLA++ F+ + LA+E   NFS+ E+ CP
Sbjct  122  EVAKKELIDSLKLLEGELGDKPFFGGEKLGLVDLAIVPFYTYFLAYETCGNFSI-EVECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              I WTKRCL+ E++SK  ADP K+   VL ++K NG+
Sbjct  181  NFIAWTKRCLEIESVSKSLADPQKVYGFVLHLKKANGI  218



>ref|XP_008226263.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=216

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 153/211 (73%), Gaps = 2/211 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +++E+V+L  + SMYG R  +AL  KG+ YE +EEDL NKS LLL+MNP+HKKIPVLIHN
Sbjct  2    ADDEVVVLGFWPSMYGTRATIALDEKGVKYEYREEDLRNKSSLLLEMNPVHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKD  565
            GKP+CESLIIV+YIDEVW  K PLLPSDPY+RA+AR WA  ID K+ D R   W  K ++
Sbjct  62   GKPVCESLIIVQYIDEVWEGKAPLLPSDPYQRARARVWADFIDKKVPDARKKLWSTKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                K+E  + LK LEGELG   YFGG+  GFLD+ALI+ + W  AFE   NFS  E  C
Sbjct  122  LEEAKKEFIDILKQLEGELGDKPYFGGESFGFLDIALITSYNWFYAFETLGNFST-EAEC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVL  292
            PKLIEW KRC+Q E++SK  ADP K+ + +L
Sbjct  181  PKLIEWAKRCMQRESVSKSLADPKKVYEFLL  211



>gb|ADB11350.1| putative tau class glutathione transferase GSTU10 [Populus trichocarpa]
Length=220

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 159/220 (72%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA KG+ YE  E+DL NK+ LLL+MNP+HKKIPVL+HN
Sbjct  2    AGDQVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRNKTALLLQMNPVHKKIPVLVHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTK  568
            GKP+CESLIIV+ IDE W DK PLLPSDPY+  Q+RFWA  +D KIY   R + W  K +
Sbjct  62   GKPVCESLIIVQNIDEAWKDKAPLLPSDPYQGVQSRFWADFVDKKIYALGRKI-WTTKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+ + K++  + LKLLE ELG+  YFGG+ +G++D+AL+ F  W  A+E   NFS+E   
Sbjct  121  DQESAKKDFIDSLKLLERELGEKPYFGGETLGYVDVALLPFLCWFYAYETIGNFSIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI + KRCLQ E++SK   DP K+S  V+ MRK  G+
Sbjct  180  CPKLIAYCKRCLQKESVSKSLEDPQKVSDFVVMMRKKLGL  219



>gb|KDP43660.1| hypothetical protein JCGZ_24118 [Jatropha curcas]
Length=224

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 159/225 (71%), Gaps = 5/225 (2%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLI  748
            M  ++E+VLLD + S +GMR R+ALA KGI +E +EE+L NKS LLL+MNP+HKKIPVLI
Sbjct  1    MAIDDEVVLLDFWPSPFGMRVRIALAEKGIKHEYREENLRNKSALLLQMNPVHKKIPVLI  60

Query  747  HNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKT  571
            HNGKP+ ES I VEYIDEVW DK PLLPSDPY+RAQA+FWA  +D KIYD     W  K 
Sbjct  61   HNGKPVVESRIAVEYIDEVWKDKTPLLPSDPYQRAQAKFWADFVDKKIYDLGRKTWATKG  120

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAF---EKEVNFSM  400
            +++ A K+E  E LK+LEGELG   YFGG+  G++D+A I F+ W   F   E   NFS+
Sbjct  121  EEQEAAKKEFMESLKILEGELGDKPYFGGECFGYVDVAFIPFYSWFYWFYANEVSGNFSV  180

Query  399  EELVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
             E  CPKLI W KRCL+ ET+S    D  KI   VL+++K  G++
Sbjct  181  -EAECPKLIAWVKRCLEKETVSNSLPDQKKIYGFVLELKKAYGID  224



>ref|NP_001234379.1| glutathione S-transferase/peroxidase [Solanum lycopersicum]
 gb|AAF22647.1|AF193439_1 glutathione S-transferase/peroxidase [Solanum lycopersicum]
Length=220

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 155/219 (71%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +N+E++LLD + SM+GMR R+ALA K I YE ++EDL NKSPLLL+MNPIHKKIPVLIHN
Sbjct  2    ANDEVILLDFWPSMFGMRLRIALAEKEIKYEYRDEDLRNKSPLLLQMNPIHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPICES+I VEYIDEVW DK P LPSDPY+RAQARFWA  ID K+YD   + W  K  +
Sbjct  62   GKPICESIIGVEYIDEVWKDKAPFLPSDPYERAQARFWADYIDKKLYDSGRKLWTTKGGE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K++  E LK+LEG LG+  YFGG   G +D+ALI ++ W  A+E   N S+E   C
Sbjct  122  QETAKKDFIECLKVLEGALGEKPYFGGGNFGCVDIALIGYYSWFYAYESYANISVEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK + W K C+  ++++K   D  K+ + V  +R+  G+
Sbjct  181  PKFVAWAKNCMLRDSVAKSLPDQHKVCEFVKVLRQKFGI  219



>ref|XP_011098134.1| PREDICTED: probable glutathione S-transferase parC [Sesamum indicum]
Length=221

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 160/219 (73%), Gaps = 6/219 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLD-NKSPLLLKMNPIHKKIPVLIHNG  739
            +++VLLD+Y SM+GMR R+ALA KG+ YE +EE L   KSPLLL+MNP+HK++PVLIHNG
Sbjct  3    DKVVLLDDYVSMFGMRARVALAEKGVEYEYREESLQAGKSPLLLQMNPVHKQVPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYP-LLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
             PI ESLIIVEYIDEVW DK P LLP+ PY+RA ARFWA  +D K+YD  R +    K +
Sbjct  63   NPISESLIIVEYIDEVWKDKCPDLLPAHPYQRAHARFWADFVDRKVYDAGRRLSGT-KVE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ + K++    LKLLEGELG + YFGG+  GFLD+ALI F+ W  AFE   NFS EE  
Sbjct  122  EQESGKKDFIAALKLLEGELGDNPYFGGENFGFLDVALIPFYTWFPAFETCGNFSTEEH-  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            CPKLI W +RC++ E++SK  ADP K+   VL ++K  G
Sbjct  181  CPKLISWARRCMERESVSKSLADPKKVYDFVLFLKKKYG  219



>gb|ACU15760.1| unknown [Glycine max]
Length=226

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 150/214 (70%), Gaps = 2/214 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
            ++E+VLLD + SMYGMR R+ALA KG+ YE KEE+L N+SPLLL+MNPIHKKIPVLIHNG
Sbjct  2    SDEVVLLDTWASMYGMRARIALAEKGVRYEYKEENLMNRSPLLLQMNPIHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPICES IIV+YIDEVWNDK PL+PSDPYKR+QARFW   ID KIYD   + W+ K ++ 
Sbjct  62   KPICESAIIVQYIDEVWNDKSPLMPSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEH  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+    K LE  L    ++G D  GF+DL LI+F  W   +E   NF MEE  CP
Sbjct  122  EEGKKELISIFKQLEETLTDKPFYGDDTFGFVDLCLITFSSWFYTYETYGNFKMEE-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            KL+ W KRC++ ET+S    D  K   ++   R+
Sbjct  181  KLMAWVKRCMERETVSNTLPDAKKCMALLWNCRR  214



>ref|XP_007212678.1| hypothetical protein PRUPE_ppa018428mg [Prunus persica]
 gb|EMJ13877.1| hypothetical protein PRUPE_ppa018428mg [Prunus persica]
Length=216

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 153/211 (73%), Gaps = 2/211 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +++E+V+L  + SMYG R  +AL  KG+ YE +E+DL NKS LLL+MNP+HKKIPVLIHN
Sbjct  2    ADDEVVVLGFWPSMYGTRATIALDEKGVKYEYREQDLRNKSSLLLQMNPVHKKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKD  565
            GKP+CESLIIV+YIDEVW  K PLLPSDPY+RA+AR WA  ID K+ D R   W  K ++
Sbjct  62   GKPVCESLIIVQYIDEVWEGKAPLLPSDPYQRARARVWADFIDKKVPDARKKLWSTKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                K+E  + LK LEGELG   YFGG+  GFLD+ALI+ + W  AFE   NFS  E  C
Sbjct  122  LEEAKKEFIDILKQLEGELGDKPYFGGESFGFLDIALITSYNWFYAFETLGNFST-EAEC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVL  292
            PKLIEW KRC+Q E++SK  ADP K+ + +L
Sbjct  181  PKLIEWAKRCMQRESVSKSLADPKKVYEFLL  211



>ref|XP_007214387.1| hypothetical protein PRUPE_ppb009345mg [Prunus persica]
 gb|EMJ15586.1| hypothetical protein PRUPE_ppb009345mg [Prunus persica]
Length=220

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 153/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KGI YE KEEDL NKS LLL+ NP+HKKIPVLIHNGK
Sbjct  3    DEVLLLDFWPSPFGMRVRVALAEKGIQYEYKEEDLSNKSALLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+ ESL+ +EYIDEVW DK PLLPSDPY RAQARFWA  +D K+Y+   V    K +++ 
Sbjct  63   PVSESLVALEYIDEVWKDKTPLLPSDPYLRAQARFWADFVDKKVYEIGKVLRSTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E + LLE +LG   YFGG+ +GF+D+ALI F+ W  A+EK  NFS+E    PK
Sbjct  123  AAKKEFLECIGLLEEKLGDKPYFGGETLGFVDVALIPFYSWFYAYEKLGNFSIEA-EQPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
               W KRC+Q E++SK  AD   I    LQ  K  G++
Sbjct  182  FYAWAKRCMQKESVSKSLADQKAIYDFFLQRMKARGID  219



>gb|ADB11346.1| tau class glutathione transferase GSTU4 [Populus trichocarpa]
Length=220

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 161/219 (74%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA K + YE  E+DL NK  LLL+MNP+HK+IPVL+H+
Sbjct  2    AGDQVTLLDLWASPFGMRVRIALAEKAVKYEYSEQDLWNKGALLLQMNPVHKRIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKPI ESLIIV+YIDEVW DK PLLPSDPY+RAQ+RFWA  +D K+YD   + W  K +D
Sbjct  62   GKPIFESLIIVQYIDEVWKDKAPLLPSDPYERAQSRFWADFVDKKVYDLGRKIWTTKGED  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K++  + LKLLEGELG   YFGG+ +G++D+AL+ F+ W  A+E   NF++E  VC
Sbjct  122  QEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETVGNFNIEA-VC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI + KRCL+ E++SK   DP K+S  V+  RK  G+
Sbjct  181  PKLIAYCKRCLEKESVSKSLEDPQKVSDFVVMRRKMLGL  219



>ref|XP_010060811.1| PREDICTED: probable glutathione S-transferase isoform X2 [Eucalyptus 
grandis]
Length=219

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 160/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++L D + SM+GMR R+ALA KG+ YE KEEDL  KS LLL+MNPIHKKIPVL+HNGK
Sbjct  3    DEVILQDFWSSMFGMRCRIALAEKGVKYEYKEEDLRKKSDLLLQMNPIHKKIPVLVHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE--  562
            P+CESLII++YIDE W DK  LLPSDPY+RAQARFWA     K+ + L   +  TK E  
Sbjct  63   PVCESLIILQYIDETWPDKCSLLPSDPYQRAQARFWADYFYKKV-NYLGRKICTTKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ + LKLLEGELG   +FGG+K+G +DLA++ F+ + LA+E   NFS+ E+ CP
Sbjct  122  EVAKKELIDSLKLLEGELGDKPFFGGEKLGLVDLAIVPFYTYFLAYETCGNFSI-EVECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              I WTKRCL+ E++SK  ADP K+   VL ++K NG+
Sbjct  181  NFIAWTKRCLEIESVSKSLADPQKVYGFVLHLKKANGI  218



>gb|KHF99304.1| putative glutathione S-transferase [Gossypium arboreum]
Length=220

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
             + ++VLLD + S +GMR R+ALA K I YE KEEDL NKS LLLKMNP+HKKIPVLI+N
Sbjct  2    GDEDVVLLDFWPSPFGMRVRIALAEKEIKYEYKEEDLRNKSDLLLKMNPVHKKIPVLIYN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKP+CESLI V+YIDE+W  K PLLP+DPY+RA ARFW   +D KIYD   + W  K ++
Sbjct  62   GKPVCESLIQVQYIDEIWPHKSPLLPTDPYQRAIARFWGDFVDNKIYDLGRKLWTTKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + A K+E  E LKLLEGELG   YFGG+ +G++D+ L+ F+ W  A+EK  NFS+ E  C
Sbjct  122  QEAAKKEFIECLKLLEGELGNKAYFGGENLGYVDVVLVPFYSWFYAYEKCGNFSI-ETEC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC++ +T+SK   D  KI   VL ++K  G+
Sbjct  181  PKLIAWAKRCMEKDTVSKSLPDQDKIYDFVLHLKKVFGI  219



>ref|XP_003596129.1| Glutathione S-transferase [Medicago truncatula]
 gb|ACJ84005.1| unknown [Medicago truncatula]
Length=219

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 152/213 (71%), Gaps = 6/213 (3%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKP  733
            E++LLDE+ SM+GMR R+ALA KGI YE KEEDL+NKS +LLKMNPIHKKIPVLIH GKP
Sbjct  4    ELILLDEWLSMFGMRARIALAEKGIKYEYKEEDLENKSQMLLKMNPIHKKIPVLIHKGKP  63

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKDE  562
            I ES+IIVEYIDEVW DK P LPSDPY++AQA+FWA  ++ K+ D   R+  W  K  + 
Sbjct  64   ISESIIIVEYIDEVWKDKVPFLPSDPYQKAQAKFWADFVNKKVGDVGGRI--WAGKRDEI  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ E LK LE  LG   YFGGD  GF+D+ALI F+ W   +EK  NF +EE  C 
Sbjct  122  ELAKKELIEGLKELENVLGDKPYFGGDTFGFVDIALIPFYSWFYTYEKLCNFKVEE-ECE  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMR  283
            KLI W KRC Q +++SK  AD  ++ + V+  R
Sbjct  181  KLIVWAKRCKQRDSVSKSVADEKEVYEFVVNYR  213



>ref|XP_006360016.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=221

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 160/221 (72%), Gaps = 7/221 (3%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHN  742
            N+E++LLD + SM+GMR R+ALA K I YE KEEDL  +KSPLLLKMNPIHKKIPVLIHN
Sbjct  3    NDEVILLDFWPSMFGMRVRVALAEKAIEYEYKEEDLFCSKSPLLLKMNPIHKKIPVLIHN  62

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CES ++VEYIDEVW DK PLLPSDPY+R+QARFWA   D K+YD  R V W  K +
Sbjct  63   GKPVCESFVVVEYIDEVWKDKAPLLPSDPYERSQARFWASYTD-KLYDFGRRV-WTHKRE  120

Query  567  DENAIKEEIAEWlkllegelgKDT-YFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            +    K+++ + LKLLE     D  YFGG+  GF+D+ALI F+ W   +E   NFS+ E 
Sbjct  121  EFAEGKKDLIDPLKLLEEAALGDQPYFGGESFGFVDIALIGFYIWFYTYETICNFSI-EA  179

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             CPK+  W KRC++ E++SK   D  KI ++V++ RK +G+
Sbjct  180  ECPKIAAWGKRCMKRESVSKSLPDSHKIYEVVIENRKKSGL  220



>ref|XP_008451812.1| PREDICTED: glutathione S-transferase U25-like [Cucumis melo]
Length=218

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 154/213 (72%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+ +LD + SM+GMR R+ALA KG+GYE  EEDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  3    DEVKILDFWPSMFGMRVRVALAEKGVGYECIEEDLSNKSPLLLQMNPIHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICES IIVEYIDE WND+ PLLPSDPY+RAQARFW   ID K+Y  + + +  K +++ 
Sbjct  63   PICESAIIVEYIDEFWNDRAPLLPSDPYERAQARFWVDFIDKKLYGSVRKIYGGKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E+ E LK LE  LG+  YFGG+  G LD++L+ F  W    E   NFS+ E  CPK
Sbjct  123  EGKKEMMEILKELEKVLGEKDYFGGECFGVLDVSLVGFSTWFGGLESVGNFSI-ETECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            L+ W KRC Q E++SK   D  KIS+ ++Q RK
Sbjct  182  LVSWAKRCSQKESVSKSLPDSNKISEFIVQFRK  214



>gb|KDO38596.1| hypothetical protein CISIN_1g027727mg [Citrus sinensis]
Length=219

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 152/213 (71%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+G+R R+ALA KG+ YE KE+DL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWASMFGIRVRIALAEKGVKYEYKEQDLFNKSPLLLRMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             +CES IIV+YIDEVW DK PLLP DPY+RAQARFW   ID K+YD   + W  K +++ 
Sbjct  63   SVCESSIIVQYIDEVWKDKAPLLPYDPYQRAQARFWVDFIDKKMYDTSRKTWATKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK L GELG   +FGGD  G++DL LI ++ W  ++E    FS+E   CPK
Sbjct  123  AAKKEFIEVLKTLGGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
             I W  RCLQ ET++K   D  K+ + V  +R+
Sbjct  182  FIAWVTRCLQRETVAKALPDEKKVFEFVSVLRE  214



>ref|XP_002300482.1| hypothetical protein POPTR_0001s42750g [Populus trichocarpa]
 gb|EEE85287.1| hypothetical protein POPTR_0001s42750g [Populus trichocarpa]
 gb|ADB11310.1| tau class glutathione transferase GSTU1 [Populus trichocarpa]
Length=217

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            + LLD   S +GMR R+AL  KG+ YE  E+DL NK P+LL+MNP++KK+PVLIHNGKPI
Sbjct  3    VTLLDTRVSPFGMRVRIALEEKGVKYEYSEQDLRNKGPMLLQMNPVYKKVPVLIHNGKPI  62

Query  729  CESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY-DRLVEWVFKTKDENAI  553
            CESLI V+YIDEVWN+K PLLPSDPY+RAQ+R WA  +D K+Y      W  K ++  A 
Sbjct  63   CESLIAVQYIDEVWNNKPPLLPSDPYQRAQSRLWADFVDNKVYFPGRKTWTKKGQELEAG  122

Query  552  KEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLI  373
            K ++ E LKLLEGELG   YF GDK+G++D+ALI F+ W   +E   NFS+E   CPKLI
Sbjct  123  KNDLIESLKLLEGELGDKAYFEGDKLGYVDIALIPFYSWFHGYETFGNFSIEA-ECPKLI  181

Query  372  EWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             W KRCLQNE++S+  ADP ++   ++++RK  G+
Sbjct  182  AWCKRCLQNESVSRSVADPQEVYGFLVELRKKLGL  216



>ref|NP_173161.1| glutathione S-transferase TAU 25 [Arabidopsis thaliana]
 sp|Q9SHH7.1|GSTUP_ARATH RecName: Full=Glutathione S-transferase U25; Short=AtGSTU25; 
AltName: Full=GST class-tau member 25 [Arabidopsis thaliana]
 gb|AAD50015.1|AC007651_10 Putative glutathione transferase [Arabidopsis thaliana]
 dbj|BAC43490.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AAO64063.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AEE29555.1| glutathione S-transferase TAU 25 [Arabidopsis thaliana]
Length=221

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 159/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+AL  K + ++ +E+DL NKSP+LL+MNP+HKKIPVLIHNG 
Sbjct  3    DEVILLDFWPSMFGMRTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHKKIPVLIHNGN  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKDE  562
            P+CESLI +EYIDEVW  K PLLPSDPY+RAQA+FW   ID K+Y   RL+ W  K ++ 
Sbjct  63   PVCESLIQIEYIDEVWPSKTPLLPSDPYQRAQAKFWGDFIDKKVYASARLI-WGAKGEEH  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LK LE ELG  TYFGG+  G++D+ALI F+ W  A+EK  +FS+ E  CP
Sbjct  122  EAGKKEFIEILKTLESELGDKTYFGGETFGYVDIALIGFYSWFEAYEKFGSFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRC++ E+++K   D  KI + V ++RK  G+
Sbjct  181  KLIAWGKRCVERESVAKSLPDSEKIIKFVPELRKKLGI  218



>ref|NP_001275790.1| glutathione S-transferase [Citrus sinensis]
 gb|ABQ95990.2| glutathione S-transferase [Citrus sinensis]
 gb|ACO05906.1| glutathione transferase Tau1 [Citrus sinensis]
Length=216

 Score =   223 bits (569),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 150/214 (70%), Gaps = 5/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG+
Sbjct  3    DEVVLLDFWPSMFGMRVRIALAEKGVKYEYKEEDLKNKSPLLLQMNPVHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES IIV+YIDEVW DK PLLPSD Y+RAQARFW   ID K+YD   + W  + +++ 
Sbjct  63   PVCESSIIVQYIDEVWKDKAPLLPSDRYQRAQARFWVDFIDKKMYDASTKTWTTEGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LEG+LG   +FGGD  G+LDL+LI F+     F K    S  E  CPK
Sbjct  123  AAKKEFFEALKTLEGQLGDKPFFGGDNFGYLDLSLIPFYYTYETFGK----SSIEAECPK  178

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
               W KRCLQ ETI+K   D  K+ +    MRK 
Sbjct  179  FKAWVKRCLQRETIAKALPDEKKVLEHASGMRKN  212



>gb|ABG73420.1| glutathione S-transferase isoform 2 [Castanea crenata]
Length=219

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 155/213 (73%), Gaps = 2/213 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
             E+VLLD + SM+ MR R+ALA KGI YESKEEDL NKSPLLL+MNPI+K+IPVLIH GK
Sbjct  3    GEVVLLDFWPSMFAMRVRIALAEKGIRYESKEEDLSNKSPLLLEMNPINKQIPVLIHKGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLIIV+YIDEVWNDK PLLPSDPY++  ++ WA  +D K+     + W  K +++ 
Sbjct  63   PVCESLIIVQYIDEVWNDKSPLLPSDPYQKRSSQVWADFVDKKVSGAAKKVWSTKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK +EGELG   YFGG+  G++DL+ I+F+ W  A+E   NF++ E  CPK
Sbjct  123  AGKKEFLEALKTMEGELGDKPYFGGETFGYVDLSFITFYSWFHAYEVLGNFNI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            +I W KRC+Q E ++    D  K+ + V+Q+RK
Sbjct  182  IITWAKRCMQKEAVANTLPDQKKVYEFVVQLRK  214



>dbj|BAB32446.2| glutathione S-transferase [Matricaria chamomilla]
Length=220

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 156/219 (71%), Gaps = 3/219 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
            N  +VLL  + S +GMR ++ALA KGI YE KEEDL NKS LLL+MNP+HKKIPVLIHNG
Sbjct  3    NTNVVLLTTWASGFGMRVQIALAEKGIEYEYKEEDLSNKSSLLLEMNPVHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYP-LLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            KPICES IIV+YID+ W++K P LLPSDPY +AQARFWA  +D KIYD   + W  K ++
Sbjct  63   KPICESNIIVQYIDDAWSNKSPSLLPSDPYLKAQARFWADFVDKKIYDAARKIWTTKGEE  122

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K+E  +WLK++EG+LG   Y  GD  G+ D+ALI F  W    E   N S+E+  C
Sbjct  123  QETAKKEFIDWLKVMEGQLGDKPYLIGDSFGYADIALIPFSCWFYTLETIGNMSIEK-EC  181

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKL+ W KRC++ E++SK  ADP K+ + VLQ++K  G+
Sbjct  182  PKLVAWVKRCMERESVSKSLADPHKMYEFVLQLKKKLGL  220



>ref|XP_006389992.1| hypothetical protein EUTSA_v10019114mg [Eutrema salsugineum]
 dbj|BAJ34081.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27278.1| hypothetical protein EUTSA_v10019114mg [Eutrema salsugineum]
Length=220

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 151/215 (70%), Gaps = 2/215 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N+ +LLD + SM+ MR R+AL  KG+ +ES+EEDL NKSPLLL+ NPIHKK+PVLIHNGK
Sbjct  3    NQTILLDYWPSMFAMRARVALREKGVEFESREEDLTNKSPLLLQSNPIHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESL +V+Y+DE W+DK P  P+DPY RAQARFWA  +D K+ +   + W  K +++ 
Sbjct  63   PVCESLNVVQYVDEAWSDKNPFFPADPYGRAQARFWADFVDKKVSEAQFKIWGKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E +K LE ELG   YFGGD  G++D++LI+F+ W  A+EK  NFS+ E   PK
Sbjct  123  AGKKEFIEAIKTLESELGDKPYFGGDSFGYVDISLITFYSWFGAYEKFGNFSI-EAESPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
            LI W KRC++ E++SK   +  KI       RK N
Sbjct  182  LIAWCKRCMEKESVSKSLPESQKIVAYAAAFRKNN  216



>ref|NP_001234094.1| uncharacterized protein LOC543817 [Solanum lycopersicum]
 gb|AAG16760.1| putative glutathione S-transferase T5 [Solanum lycopersicum]
Length=220

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 154/219 (70%), Gaps = 3/219 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+VLLD + S++GMR R+ALA KGI YE KEEDL NKS LLL+MNPIHKKIPVLIHNG
Sbjct  2    GDEVVLLDTFVSVFGMRVRIALAEKGIQYEYKEEDLMNKSQLLLQMNPIHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDK-YPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            KPICESLIIVEYIDEVW DK  PL+PSDPYKRA ARFWA  I  KIYD  ++ W  K ++
Sbjct  62   KPICESLIIVEYIDEVWKDKSTPLMPSDPYKRAHARFWADYIGKKIYDGGMKIWSSKVEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                 ++  E LK+LEGELG   YF G   G +D+A I ++ W   ++K  N ++E   C
Sbjct  122  HKTANKDFIECLKVLEGELGDKPYFDGKNFGLVDMAFIPYYSWFPVYKKLSNLNIEA-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PK + W KRC+Q E++SK   DP KI + ++  R+  GV
Sbjct  181  PKFVAWAKRCMQKESVSKTLVDPDKIYEFIVLFRQKIGV  219



>ref|XP_006442221.1| hypothetical protein CICLE_v10022193mg [Citrus clementina]
 gb|ESR55461.1| hypothetical protein CICLE_v10022193mg [Citrus clementina]
Length=216

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 150/214 (70%), Gaps = 5/214 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HKKIPVLIHNG+
Sbjct  3    DEVILLDFWPSMFGMRVRIALAEKGVKYEYKEEDLKNKSPLLLQMNPVHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CES IIV+YIDEVW DK PLLPSD Y+RAQARFW   ID K+YD   + W  + +++ 
Sbjct  63   PVCESSIIVQYIDEVWKDKAPLLPSDRYQRAQARFWVDFIDKKMYDASTKTWTTEGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LEG+LG   +FGGD  G+LDL+LI F+     F K    S  E  CPK
Sbjct  123  AAKKEFFEALKTLEGQLGDKPFFGGDNFGYLDLSLIPFYYTYETFGK----SSIEAECPK  178

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
               W KRCLQ ETI+K   D  K+ +    MRK 
Sbjct  179  FKAWVKRCLQRETIAKALPDEKKVLEHASGMRKN  212



>ref|XP_007133435.1| hypothetical protein PHAVU_011G178400g [Phaseolus vulgaris]
 gb|ESW05429.1| hypothetical protein PHAVU_011G178400g [Phaseolus vulgaris]
Length=219

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 158/219 (72%), Gaps = 6/219 (3%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKP  733
            E++LLD++ SM+GMR R+ALA K I YE +EEDL+NKS LLL+MNP+HKKIPVLIHNGKP
Sbjct  4    ELILLDDWLSMFGMRARIALAEKEIEYEYREEDLNNKSQLLLQMNPVHKKIPVLIHNGKP  63

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKDE  562
            I ES+IIVEYIDEVW +K   LPS+PY+RAQARFWA  ++ KI D   R+  W  K ++ 
Sbjct  64   ISESIIIVEYIDEVWKNKASFLPSEPYQRAQARFWADFVNKKIGDVGGRI--WAGKREEI  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E+ E LK LE  LG+  YFGGD  GF+D+ALI F  W  ++E   NF + E  CP
Sbjct  122  EAAKKELVEGLKELEKNLGEKPYFGGDTFGFVDIALIPFSTWFYSYEALGNFKV-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            K+I W KRC + E++SK  AD  K+ + V+  RK++ ++
Sbjct  181  KIIAWAKRCNERESVSKSVADEKKVYEFVVDFRKSHQLD  219



>ref|XP_007149244.1| hypothetical protein PHAVU_005G053900g [Phaseolus vulgaris]
 gb|ESW21238.1| hypothetical protein PHAVU_005G053900g [Phaseolus vulgaris]
Length=219

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 149/214 (70%), Gaps = 2/214 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + SM+GMR R+ALA K + YE KEE+L +KSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDTWASMFGMRVRIALAEKSVKYELKEENLRDKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICES IIV+YIDEVWN   PL+PSDPY+RAQARFW   ID K+YD   + W+   ++  
Sbjct  63   PICESAIIVQYIDEVWNHNPPLMPSDPYERAQARFWVDYIDKKVYDTWRKMWLSSGEEHE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E+    K LE  LG   ++GG+  GF D+ LI F+ W   FE   NF M E  CPK
Sbjct  123  TWKKELISIFKQLEETLGDKPFYGGETFGFADVGLIPFYSWFYTFETYGNFKM-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKT  277
            L+ W KRC++ ET+SK   D  K+   +++++K 
Sbjct  182  LMVWAKRCMERETVSKTLPDEKKVYAYIVEIKKA  215



>gb|ADB11349.1| tau class glutathione transferase GSTU8 [Populus trichocarpa]
Length=220

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 160/220 (73%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGDQVTLLDFWSSPFGMRVRIALAEKGVKYEYSEQDLRNKSDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW DK PLLPSDP+KRAQ+RFWA  +D KIYD  R + W    +
Sbjct  62   GKPVCESLIIVQYIDEVWKDKAPLLPSDPHKRAQSRFWADFVDKKIYDFGRKI-WTTNGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+ A K++  + LKLLEGELG   YFGG+ +G++D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI   KRCLQ E++SK   DP  +    + +RK  G+
Sbjct  180  CPKLIACCKRCLQKESVSKSLKDPQILYDFAVMVRKKLGL  219



>ref|XP_008451813.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=303

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 155/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +++ LLD + SM+GMR R+ALALK + YE  +EDL NKSPLLL+MNPIHKKIPVLIHNGK
Sbjct  88   DQVKLLDFWPSMFGMRVRVALALKCVPYEYVDEDLTNKSPLLLQMNPIHKKIPVLIHNGK  147

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICES IIV+YIDE W DK PL P+ PY RAQARFW   ID K++D   + W  K +++ 
Sbjct  148  PICESSIIVQYIDEFWKDKAPLFPTHPYDRAQARFWVDFIDKKLFDSGRKVWACKGEEQE  207

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K+E+   LK LE  + +  YFGG+ +GF+D+ LI ++ W  A+E   NFS+E   CPK
Sbjct  208  EGKKEVIRILKQLEEVIEEKAYFGGECLGFVDIVLIGYYTWFYAYETIGNFSIES-ECPK  266

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            ++ W KRCLQNE++SK   DP K+   VLQM+K  G+
Sbjct  267  IMSWVKRCLQNESVSKSLPDPKKVCDFVLQMKKKYGL  303



>ref|XP_004510706.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=219

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 149/212 (70%), Gaps = 2/212 (1%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKP  733
            E++LLDE+ SM+GMR R+ALA K I YE KEEDL NKS +LL+MNPIHKKIPVLIH GKP
Sbjct  4    ELILLDEWLSMFGMRARIALAEKEINYEYKEEDLMNKSQMLLQMNPIHKKIPVLIHKGKP  63

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVEWVFKTKDE-NA  556
            ICES+IIVEYIDEVW D+ PLLPSDPY++AQARFWA  ++ K+ D       K +DE   
Sbjct  64   ICESIIIVEYIDEVWKDRVPLLPSDPYQKAQARFWADFVNKKVGDVGGRIWSKKRDEIEG  123

Query  555  IKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKL  376
             K E+ E LK LE  LG   YFGGD  GF+D+ALI F+ W   +EK  NF + E  C KL
Sbjct  124  AKNELIEGLKELENVLGDKPYFGGDTFGFVDIALIPFYNWFYTYEKLGNFKV-EAECAKL  182

Query  375  IEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            I W KRC+  E++SK  AD   I + V+  RK
Sbjct  183  IVWAKRCIHRESVSKSVADEKDIYEWVVNYRK  214



>ref|XP_006305593.1| hypothetical protein CARUB_v10010257mg [Capsella rubella]
 gb|EOA38491.1| hypothetical protein CARUB_v10010257mg [Capsella rubella]
Length=219

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 159/218 (73%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+AL  K + ++ +E+DL NKSP+LL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDFWPSMFGMRTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRLVEWVFKTKDE  562
            P+CESLI VEYIDEVW  K PLLPSDPY+RAQA+FW   ID K+Y   RL+ W  K +++
Sbjct  63   PVCESLIQVEYIDEVWPSKNPLLPSDPYQRAQAKFWGDFIDKKVYASARLI-WGAKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K+E  E LK LE ELG   YFGG+  G++D+ALI F+ W  A++K  NFS+ E  CP
Sbjct  122  EAGKKEFIEILKTLESELGDKIYFGGETFGYVDIALIGFYSWFEAYDKFGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRC++ E+++K   D  KI + V  ++K  G+
Sbjct  181  KLIAWAKRCVERESVAKSLPDSNKIVEFVPVLKKHIGI  218



>gb|AFK35203.1| unknown [Medicago truncatula]
Length=209

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 142/203 (70%), Gaps = 2/203 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            NE++LLD + SM+GMR R+ALA K + YE KEEDL NKSPLLL+MNPIH KIPVLIHNGK
Sbjct  3    NEVILLDTWASMFGMRARIALAEKSVKYEYKEEDLRNKSPLLLQMNPIHNKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             ICES IIV+YIDEVWNDK   +PSDPY+RAQARFW    D K+YD   + W+ K ++  
Sbjct  63   SICESAIIVQYIDEVWNDKASFMPSDPYERAQARFWVDYSDKKVYDTWKKMWLSKGEEYE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K E+    K LEG L    ++GGD  GFLD+ LI F+ W  AFE   NF ME   CPK
Sbjct  123  EGKMELISIFKTLEGALSDKLFYGGDTFGFLDIGLIPFYSWFYAFETYGNFKMET-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLK  310
            L+ WTKRC++ +++SK   D  K
Sbjct  182  LMAWTKRCMEKDSVSKSLPDQKK  204



>emb|CBI32903.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 154/203 (76%), Gaps = 4/203 (2%)
 Frame = -3

Query  945  FNSITKMESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHK  766
            F  I  + S   I+LLD + SM+GMR R+ALA KG+ YE KEEDL NKSPLLL+MNP+HK
Sbjct  133  FKLIWSLLSKESIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLRNKSPLLLEMNPVHK  192

Query  765  KIPVLIHNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY--DRL  592
            +IPVLIHNGKPICESLIIV+YIDEVW+DK PLL SDPY+RAQARFWA  +D K+Y   R 
Sbjct  193  QIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLRSDPYQRAQARFWADYVDKKLYGLGRK  252

Query  591  VEWVFKTKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEV  412
            V W  K +++   K+E  E L+LLEGELG+  YFGG+KIGF+D+AL++F  W  A+E   
Sbjct  253  V-WSTKGEEQETAKKEFIECLQLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYAYESFG  311

Query  411  NFSMEELVCPKLIEWTKRCLQNE  343
            NFS+E   CPKLI WTKRC + E
Sbjct  312  NFSIEA-ECPKLIAWTKRCKEKE  333



>ref|XP_008360299.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE KE+DL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGIEYEYKEDDLWNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLI ++YIDEVWNDK PLLPSD Y RAQARFWA  +D KI++   + W  K ++ +
Sbjct  63   PVCESLIALQYIDEVWNDKAPLLPSDSYLRAQARFWADFVDKKIHENGRKLWTTKGEEYD  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K++  + + +LEGELG   +FGG+ +GF+D+AL+ F+ W L +EK  NFS+E    PK
Sbjct  123  AAKKDFLDCIGVLEGELGNKPFFGGETLGFVDVALVPFYSWFLVYEKFGNFSVEA-EHPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ E++SK   +  K+    + +RK  G+
Sbjct  182  FIAWVKRCMEKESVSKSLPEQEKVYDFFMLIRKKRGI  218



>gb|KHN26783.1| Glutathione S-transferase 3 [Glycine soja]
Length=221

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 154/216 (71%), Gaps = 3/216 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            S++E+VLLD + SM+GMR  +AL  KG+ YE K EDL+NKS LL++MNPI+K+IPVLIHN
Sbjct  2    SHDEVVLLDAWGSMFGMRAWIALEEKGVKYEHKMEDLNNKSSLLMQMNPIYKQIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWND-KYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTK  568
            GKPI ES IIV+YI EVWND K P+LPSDPY+RAQARFW   ID K+Y    + W+ K +
Sbjct  62   GKPISESAIIVQYIYEVWNDNKAPILPSDPYERAQARFWVDYIDKKVYPAWNKMWLSKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            +  A K+E+    K LE  LG  T++GGD  GF+D+ALI+F+ W   FE   NF ME   
Sbjct  122  EHEAGKKELISVFKQLEETLGDKTFYGGDTFGFVDIALITFYSWFYTFETYGNFEMEG-E  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            CPKL+ W KRC+Q ET+SK   D  ++   V++M+K
Sbjct  181  CPKLVAWAKRCIQRETVSKVLPDEKELYDAVVEMKK  216



>ref|XP_008360298.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE K+EDL NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGIEYEYKDEDLWNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLI ++YIDEVWNDK PLLP D Y RAQARFWA  +D KIY+   + W  K +++ 
Sbjct  63   PICESLIALQYIDEVWNDKAPLLPXDSYLRAQARFWADFVDKKIYEIGRKLWTTKGEEQX  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + + +LE ELG   +FGG+ +GF+D+ALI ++ W L +EK  NFS+E    P+
Sbjct  123  AXKKEFLDCIGVLERELGDKPFFGGNTLGFVDVALIPYYSWFLVYEKFGNFSVEA-EHPE  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ +++SK   +  K+   V+ +RK +G+
Sbjct  182  FIAWVKRCMEKKSVSKSLPEQEKVYDFVMLVRKKHGI  218



>ref|XP_002300485.1| hypothetical protein POPTR_0001s42800g [Populus trichocarpa]
 gb|EEE85290.1| hypothetical protein POPTR_0001s42800g [Populus trichocarpa]
Length=220

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 160/220 (73%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LLD + S +GMR R+ALA KG+ YE  E+DL NKS LLL+MNP+HKKIPVL+H+
Sbjct  2    AGDQVTLLDFWSSPFGMRVRIALAEKGVKYEYCEQDLRNKSDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            GKP+CESLIIV+YIDEVW DK PLLPSDP+KRAQ+RFWA  +D KIYD  R + W    +
Sbjct  62   GKPVCESLIIVQYIDEVWKDKAPLLPSDPHKRAQSRFWADFVDKKIYDFGRKI-WTTNGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+ A K++  + LKLLEGELG   YFGG+ +G++D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEAAKKDFIDSLKLLEGELGDKPYFGGETLGYVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI   KRCLQ E++SK   DP  +    + +RK  G+
Sbjct  180  CPKLIACCKRCLQKESVSKSLKDPQILYDFAVMVRKKLGL  219



>ref|XP_011036234.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011013657.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=217

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 154/214 (72%), Gaps = 2/214 (1%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            + LLD   S +GMR R+AL  KG+ YE  E+DL NK P+LL+MNP++KK+PVLIHNGKPI
Sbjct  3    VTLLDTRVSPFGMRVRIALEEKGVKYEYSEQDLRNKGPMLLQMNPVYKKVPVLIHNGKPI  62

Query  729  CESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY-DRLVEWVFKTKDENAI  553
            CESLI V+YIDEVWN+K PLLPSDPY+RAQ+R WA  +D K+Y      W  K ++  A 
Sbjct  63   CESLIAVQYIDEVWNNKSPLLPSDPYQRAQSRLWADFVDNKVYFPGRKTWTKKGQELEAG  122

Query  552  KEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKLI  373
            K ++ E LKLLEGELG   YF GD +G++D+AL+ F+ W   +E   NFS+E   CPKLI
Sbjct  123  KNDLIESLKLLEGELGDKPYFEGDNLGYVDIALVPFYSWFHGYETFGNFSIEA-ECPKLI  181

Query  372  EWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
             W KRCLQNE++S+  ADP ++   ++++RK  G
Sbjct  182  AWCKRCLQNESVSRSLADPQEVYGFLVELRKKLG  215



>ref|XP_010923803.1| PREDICTED: probable glutathione S-transferase parA [Elaeis guineensis]
Length=222

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 162/218 (74%), Gaps = 8/218 (4%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVLIHNGKP  733
            +VLLD + SM+G R R+ALA KG+ YE +EE++ ++KSPLLLKMNPIHKKIPVLIH+GKP
Sbjct  8    VVLLDLWVSMFGQRCRIALAEKGVEYEFREENIPEHKSPLLLKMNPIHKKIPVLIHDGKP  67

Query  732  ICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKDE  562
            +CESLIIV+YIDEVW +  PLLPSDPY+RA+ARFWA ++D KIYD   RL  W  K + +
Sbjct  68   VCESLIIVQYIDEVWTNN-PLLPSDPYERAEARFWADLVDKKIYDCGSRL--WKLKGEAQ  124

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ E LKLLE ELG   YFGG+  GF+D+AL+ F  W  ++E   NFS+EE  CP
Sbjct  125  QEAKKEMIEVLKLLEDELGDKKYFGGEIFGFVDVALVPFTAWFYSYETCANFSIEE-ECP  183

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KL+ W KRC++ E+++K   DP K+ + V  ++K  GV
Sbjct  184  KLVAWGKRCMERESVAKSLHDPHKVYEFVCFLKKKFGV  221



>ref|XP_008226262.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=220

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 152/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KGI YE KEEDL NKS LLL+ NP+HKKIPVLIHNGK
Sbjct  3    DEVLLLDFWPSPFGMRLRVALAEKGIQYEYKEEDLSNKSALLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+ ESL+ +EYIDEVW DK PLLPSDPY RAQARFWA  +D K+Y+   V    K +++ 
Sbjct  63   PVSESLVALEYIDEVWKDKTPLLPSDPYLRAQARFWADFVDKKVYEIGKVLRSAKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E + LLE +LG   YFGG+ +GF+D+ALI F+ W   +EK  NFS+E    PK
Sbjct  123  AAKKEFLECIGLLEEKLGDKPYFGGETLGFVDVALIPFYSWFYVYEKFGNFSIEA-EQPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
               W KRC+Q E++SK  AD   I    LQ  K  G++
Sbjct  182  FYGWAKRCMQKESVSKSLADQKAIYDFFLQRMKARGID  219



>ref|XP_004147762.1| PREDICTED: glutathione S-transferase U19-like [Cucumis sativus]
 ref|XP_004161560.1| PREDICTED: glutathione S-transferase U19-like [Cucumis sativus]
 gb|KGN53531.1| Glutathione S-transferase [Cucumis sativus]
Length=218

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 153/214 (71%), Gaps = 2/214 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E+ +LD + SM+GMR R+ALA KG+GYE  EEDL NKSPLLL+MNPIHKKIPVLIHNG
Sbjct  2    GDEVKILDFWPSMFGMRVRVALAEKGVGYECIEEDLRNKSPLLLEMNPIHKKIPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KPICES IIVEYIDE WND+ PL PSDPY+RAQARFW   ID K+Y  + + +  K +++
Sbjct  62   KPICESSIIVEYIDEFWNDRAPLFPSDPYERAQARFWIDFIDKKLYGSVRKIYGGKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
               K+E+ E LK LE  LG+  YFGG+  G LD+ALI F  W    E   NFS+E   CP
Sbjct  122  EEGKKEMMEILKELEKVLGEKDYFGGECFGVLDIALIGFSTWFSGLESIGNFSIES-ECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRK  280
            KLI W KRCLQ E++SK   D  K ++ + ++RK
Sbjct  181  KLISWAKRCLQRESVSKSLPDSKKTTEFIAELRK  214



>ref|XP_009418988.1| PREDICTED: probable glutathione S-transferase parA [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 155/218 (71%), Gaps = 6/218 (3%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            +VLLD + S +G R R+ALA KG+ YE +EE+L +KSPLLLK NP+HKKIPVLIH+GKP+
Sbjct  9    VVLLDFWVSPFGQRCRIALAEKGVEYEFREENLGDKSPLLLKSNPVHKKIPVLIHDGKPV  68

Query  729  CESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKTKDEN  559
            CESLIIV+YIDE W D  PLLP+DPY RAQARFWA  ID KIY+   RL  W  K + + 
Sbjct  69   CESLIIVQYIDEAWPDCAPLLPADPYARAQARFWADFIDKKIYECGTRL--WKLKGEGQA  126

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A KEE+   LKLLEGELG   YFGGD  GF+D+AL+ F  W   +E    FS+EE   PK
Sbjct  127  AAKEELIGILKLLEGELGDKKYFGGDAFGFVDIALVPFVSWFYTYETCAGFSIEE-AAPK  185

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            L+ W KRC++ E+++K  +DP K+ + V  ++K  GV 
Sbjct  186  LVAWGKRCMERESVAKTLSDPHKVYEFVGLLKKRFGVE  223



>ref|XP_004294221.1| PREDICTED: probable glutathione S-transferase-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   221 bits (563),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 155/217 (71%), Gaps = 3/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KG+ YE K+EDL NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGVKYEYKDEDLRNKSPLLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+CES+I ++YIDEVW +K PLLPSDPY R+QARFWA  +D KIYD     W  K  ++ 
Sbjct  63   PVCESVIALQYIDEVWTNK-PLLPSDPYLRSQARFWADFVDKKIYDIGRKTWTTKGDEQE  121

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + +KLLE ELG   +FGG+ +GF+D+ L+ F+ W   +EK  NFS+    CPK
Sbjct  122  AAKKEFIDCIKLLEVELGDKPFFGGETLGFVDVTLVPFYSWFSVYEKYGNFSIAP-ECPK  180

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             + W KRC++ E++SK   D  K+   V +MRK  GV
Sbjct  181  FMAWVKRCMEKESVSKSLPDQDKVCGFVAEMRKKLGV  217



>ref|XP_009104573.1| PREDICTED: glutathione S-transferase U20 [Brassica rapa]
Length=217

 Score =   221 bits (563),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 150/215 (70%), Gaps = 2/215 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N  +LLD + SM+ MR R+AL  KG+ +E++EEDL NKSPLLL+ NPIHKK+PVLIHNGK
Sbjct  3    NSTILLDYWPSMFCMRARVALREKGVVFEAREEDLTNKSPLLLRSNPIHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESL +V+Y+DE W+DK P  PSDPY +AQARFWA  +D K  D   + W  K +++ 
Sbjct  63   PICESLNVVQYVDEAWSDKNPFFPSDPYGKAQARFWADFVDKKFSDAQFKIWGKKGEEQA  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E +K+LE ELG   YFGGD  G++D+ALI+F+ W  A+EK  NFS+ E   PK
Sbjct  123  AGVKEFIEAVKILEAELGDKPYFGGDSFGYVDIALITFYSWFGAYEKFGNFSI-EAESPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
            LI W KRC++ E++SK   D  KI     + RK N
Sbjct  182  LIAWAKRCMEKESVSKSLPDQEKIVAYAAEFRKNN  216



>ref|XP_011082830.1| PREDICTED: glutathione S-transferase U25-like [Sesamum indicum]
Length=222

 Score =   221 bits (563),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 158/222 (71%), Gaps = 7/222 (3%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
             +E++LL    S + MR R+AL  KGI YE +EE + NKSPLLL+MNP+H K+PVLIHNG
Sbjct  2    GDELILLGYDISAFAMRVRIALDEKGIEYEYREESMANKSPLLLEMNPVHMKVPVLIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY---DRLVEWVFKTK  568
            KPI ESLII+EYIDEVWNDK PLLPSDPY+RAQ RFWA +ID KIY    RLV W  K +
Sbjct  62   KPISESLIILEYIDEVWNDKSPLLPSDPYQRAQGRFWADLIDKKIYINGGRLV-WFSKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
             + A K+E+ + LKLLE ELG+  YFGGDK GFLD+ALI F+    +FE+     +EE  
Sbjct  121  KQEAGKKELMDGLKLLEEELGEKVYFGGDKFGFLDVALIPFYNCFDSFERCGKLRIEEH-  179

Query  387  CPKLIEWTKRCLQNETISKCF--ADPLKISQMVLQMRKTNGV  268
            CPKLI W KRC++ E++ K F  A P KI + +L  RK  G+
Sbjct  180  CPKLIAWAKRCMEKESVFKSFTMAHPSKIDEYILMTRKKYGI  221



>ref|XP_011030763.1| PREDICTED: probable glutathione S-transferase isoform X2 [Populus 
euphratica]
Length=219

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 159/218 (73%), Gaps = 2/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+ LLD + S +GMR R+ALA KG+ YE  E+DL +KS LLL+MNP++KKIPVL+H GK
Sbjct  3    DEVTLLDFWASPFGMRVRIALAEKGVKYEYSEQDLRDKSALLLQMNPVYKKIPVLVHRGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESLIIV+YID+VW DK PLLPSDPY+RAQ+ FWA  ID K+++   + W  K ++  
Sbjct  63   PVCESLIIVQYIDDVWRDKAPLLPSDPYERAQSMFWADFIDKKVFEITKKIWTTKGEELE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
              K++  E LKLLEGELG   YFGG+ +G++D+A + F+ W  A+E   NFS+E   CPK
Sbjct  123  GAKKDFIECLKLLEGELGDRPYFGGENLGYVDVAFVPFYCWFYAYETCGNFSIEA-ECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            +I W KRC+Q E++SK    P K+ + VL++RK  GV+
Sbjct  182  IIAWAKRCMQKESVSKSLEQPKKVYEFVLELRKRFGVD  219



>emb|CAC24549.1| glutathione S-transferase [Cichorium intybus x Cichorium endivia]
Length=219

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +E+VLLD + S++GMR R+ALA K + YE +EEDL NKS LLL+MNP+HKK+PVLIH+
Sbjct  2    AGSEVVLLDTWVSLFGMRVRIALAEKDVHYERREEDLTNKSSLLLQMNPVHKKVPVLIHD  61

Query  741  GKPICESLIIVEYIDEVW-NDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTK  568
            GKPICES IIV+YIDE W N+  PLLPSDPY +AQARFWA  ID KIYD     W  K +
Sbjct  62   GKPICESNIIVQYIDEAWQNNSPPLLPSDPYLKAQARFWADFIDKKIYDAGTRIWRRKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++   K+E  +W+K+LEG+LG+++Y  G   G++D+A++ F+ W  A EK  N S+E+  
Sbjct  122  EQEIAKKEFIDWMKVLEGQLGENSYLMGKSFGYVDIAMVPFYCWFYALEKIGNISIEK-E  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            CPKL+ W KRC++ E++SK   DP K+ +  L++ K  G
Sbjct  181  CPKLVAWAKRCMERESVSKTLPDPHKVYEYALELMKKLG  219



>ref|XP_010087162.1| putative glutathione S-transferase parC [Morus notabilis]
 gb|EXB27067.1| putative glutathione S-transferase parC [Morus notabilis]
Length=221

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 159/220 (72%), Gaps = 6/220 (3%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+ LLD + SM G+R R+ALA KGI YE +EEDL NKSPLLL+MNPIHKKIPVLIHNG+
Sbjct  3    SEVTLLDFWPSMLGIRVRVALAEKGIKYEHREEDLRNKSPLLLQMNPIHKKIPVLIHNGR  62

Query  735  PICESLIIVEYIDEVWN-DKYP-LLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTK  568
            PI ESL IV YID+VWN D+ P LLPSDP +R+QARFWA  +D  ++   R V W  K +
Sbjct  63   PISESLNIVHYIDDVWNHDRAPLLLPSDPDQRSQARFWAHFVDQNVFSSGRRV-WATKGE  121

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            ++ A K+E  E L+L E ELG   YFGG+  G++D++L++F+ W  A+E   NFS+EE  
Sbjct  122  EQEAAKKEFMETLRLFEVELGDKPYFGGESFGYVDVSLVAFYSWFYAYETFGNFSIEE-E  180

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CP+LI W KRC++ E++ K   D  KI + V+Q+RK  G+
Sbjct  181  CPRLIAWAKRCMEKESVYKSLPDEKKIFEFVIQLRKKFGI  220



>gb|ADB11313.1| tau class glutathione transferase GSTU6 [Populus trichocarpa]
Length=220

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 162/220 (74%), Gaps = 4/220 (2%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +++++ LLD + S +GMR R+ALA K + YE  E+DL NK  LLL+MNP+HKKIPVL+H+
Sbjct  2    ADDQVTLLDLWASPFGMRVRIALAEKAVKYEYSEQDLWNKGDLLLQMNPVHKKIPVLVHD  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKI--YDRLVEWVFKTK  568
            GKPICESLIIV+YIDEVWNDK PLL SDPY+RAQ+RFWA  +D K+  + R + W  K +
Sbjct  62   GKPICESLIIVQYIDEVWNDKAPLLSSDPYERAQSRFWADFVDKKVNYFGRKI-WTPKGE  120

Query  567  DENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELV  388
            D+ A K++  + LKLLEGELG   YFGGD +G++D+AL+ F+ W  A+E   NF++E   
Sbjct  121  DQEAAKKDFIDSLKLLEGELGDKPYFGGDTLGYVDVALLPFYCWFYAYETIGNFNIEA-D  179

Query  387  CPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            CPKLI + KRCL+ E++SK   DP K+   V+ +RK  G+
Sbjct  180  CPKLIAYCKRCLEKESVSKSVKDPQKVYDFVVMLRKKFGL  219



>emb|CDX68017.1| BnaA07g20570D [Brassica napus]
Length=217

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 150/215 (70%), Gaps = 2/215 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N  +LLD + SM+ MR R+AL  KG+ +E++EEDL NKSPLLL+ NPIHKK+PVLIHNGK
Sbjct  3    NSTILLDYWPSMFCMRARVALREKGVVFEAREEDLTNKSPLLLQSNPIHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESL +V+Y+DE W+DK P  PSDPY +AQARFWA  +D K  D   + W  K +++ 
Sbjct  63   PICESLNVVQYVDEAWSDKNPFFPSDPYGKAQARFWADFVDKKFSDAQFKIWGKKGEEQA  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E +K+LE ELG   YFGGD  G++D+ALI+F+ W  A+EK  NFS+ E   PK
Sbjct  123  AGVKEFIEAVKILEAELGDKPYFGGDSFGYVDIALITFYSWFGAYEKFGNFSI-EAESPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
            LI W KRC++ E++SK   D  KI     + RK N
Sbjct  182  LIAWAKRCMEKESVSKSLPDQEKIVAYAAEFRKNN  216



>ref|XP_009117717.1| PREDICTED: glutathione S-transferase U25-like [Brassica rapa]
Length=219

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 157/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+AL  K I ++ +E+DL NKSP+LL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDYWPSMFGMRTRVALEEKNIKFDYREQDLFNKSPILLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLI VEYIDE W    P LPSDPY+RAQA+FW   ID K+Y   RL+ W  K K++
Sbjct  63   PVCESLIQVEYIDETWPGGNPFLPSDPYQRAQAKFWGDFIDKKVYGPTRLI-WGAKGKEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A  +E  E LK+LE ELG  TYFGG+  G++D+A+I F+ W    EK  NFS+ E  CP
Sbjct  122  EAGTKEFIEMLKMLESELGDKTYFGGETFGYVDIAMIGFYCWFDVLEKCGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRC++ E+++K   D  KI++ V +++K  G+
Sbjct  181  KLIAWAKRCMKRESVAKSLPDSDKITKFVPELKKKIGI  218



>gb|KFK25183.1| hypothetical protein AALP_AA8G077600 [Arabis alpina]
Length=219

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 153/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N++ LLD + SM+GMR ++ALA KG+ YE KE D   K+PLL++MNP+HKKIPVLIHNGK
Sbjct  3    NQVTLLDFWPSMFGMRTKIALAEKGVEYEYKETDPWVKTPLLIEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLI +EYIDEVW+D YP+LPSDPY+++QARFW   ID K YD   + W    ++  
Sbjct  63   PICESLIQIEYIDEVWSDTYPILPSDPYEKSQARFWGEFIDRKFYDPSWKVWATMGEEHV  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A ++E+ E  K LE ELG   YFGG+  GF+D+ALI ++ W  A EK   F +E+ V PK
Sbjct  123  AARKELIEHFKTLETELGDKPYFGGEVFGFVDIALIGYYSWFKAMEKFGEFRLEKEV-PK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            L+EWTKRC+  E++ K  ADP  I Q    +RK  GV
Sbjct  182  LVEWTKRCIVRESVVKSMADPDNIIQYACVLRKNLGV  218



>gb|ABD36807.1| glutathione S-transferase [Brassica napus]
 emb|CDX79260.1| BnaC06g20430D [Brassica napus]
Length=217

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 150/215 (70%), Gaps = 2/215 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N  +LLD + SM+ MR R+AL  KG+ +E++EEDL NKSPLLL+ NPIHKK+PVLIHNGK
Sbjct  3    NSTILLDYWPSMFCMRARVALREKGVVFEAREEDLTNKSPLLLQSNPIHKKVPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESL +V+Y+DE W+DK P  PSDPY +AQARFWA  +D K  D   + W  K +++ 
Sbjct  63   PVCESLNVVQYVDEAWSDKNPFFPSDPYGKAQARFWADFVDKKFSDAQFKIWGKKGEEQA  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A  +E  E +K+LE ELG   YFGGD  G++D+ALI+F+ W  A+EK  NFS+ E   PK
Sbjct  123  AGVKEFIEAVKILEAELGDKPYFGGDSFGYVDIALITFYSWFGAYEKFGNFSI-EAESPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
            LI W KRC++ E++SK   D  KI     + RK N
Sbjct  182  LIAWAKRCMEKESVSKSLPDQEKIVAYAAEFRKNN  216



>ref|XP_006370194.1| hypothetical protein POPTR_0001s40510g [Populus trichocarpa]
 gb|ADB11379.1| tau class glutathione transferase GSTU56 [Populus trichocarpa]
 gb|ERP66763.1| hypothetical protein POPTR_0001s40510g [Populus trichocarpa]
Length=219

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 154/216 (71%), Gaps = 3/216 (1%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            I LLD + S   M+ R+ALA KGI YES EEDL +KSPLLL+MNP+HK+IPVLIHNGKPI
Sbjct  4    IKLLDSWASPAAMKVRIALAEKGIEYESMEEDLPHKSPLLLEMNPVHKRIPVLIHNGKPI  63

Query  729  CESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDENA  556
            CES+IIVEYIDEVWND+ PLLPSD  +R +ARFW  +ID KIY   R + W   + ++ A
Sbjct  64   CESMIIVEYIDEVWNDRSPLLPSDVQERTRARFWVHLIDKKIYSLIRRLVWSSSSDNKKA  123

Query  555  IKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPKL  376
              +++ E+ K++EGELG   YFGG+  GF+D+AL+ F+ +   +E   NF    + CPKL
Sbjct  124  AAKDLIEFFKVIEGELGDKPYFGGEGFGFVDVALVPFYGYFYTYETFGNFRF-AIECPKL  182

Query  375  IEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            +EW KRCLQ E++SK   DP K  + V++ RK  G+
Sbjct  183  VEWGKRCLQKESVSKNLPDPYKAYEFVMEHRKKLGI  218



>ref|XP_008226267.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=220

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 152/218 (70%), Gaps = 3/218 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEED-LDNKSPLLLKMNPIHKKIPVLIHNG  739
            +E+VLL  + S YGMR R+ALA KGI YES+EED L NKS LLL+MNP+HKKIPVLIHNG
Sbjct  3    DEVVLLHYWASPYGMRVRIALAEKGIQYESREEDYLTNKSSLLLQMNPVHKKIPVLIHNG  62

Query  738  KPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDE  562
            KP+ ESLI V+YIDEVW DK PLLPSDPY RAQA FWA  +D K+YD     W  K +++
Sbjct  63   KPVSESLIAVQYIDEVWKDKAPLLPSDPYLRAQAMFWADFVDKKVYDSAKRTWRTKGEEQ  122

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A K E  E ++LLE ELG   YFGG+ +GF+D+ALI  + W    EK  NFS+ E   P
Sbjct  123  EAAKREFLECIRLLEEELGDKPYFGGENLGFVDVALIPTYSWFYVREKFGNFSV-EAKHP  181

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            K I W KRC+Q E++SK   D  ++ +  L++R   G+
Sbjct  182  KFIAWAKRCMQKESVSKSLPDQERVYEFALRLRSKLGL  219



>ref|XP_010498064.1| PREDICTED: glutathione S-transferase U25-like [Camelina sativa]
Length=219

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 157/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+AL  K + ++ +E+DL NKSP+LL+MNP+H KIPVLIHNGK
Sbjct  3    DEVILLDFWPSMFGMRTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHSKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY-DRLVEWVFKTKDEN  559
            P+CESLI VEYIDEVW    PLLPSDPY+RAQA+FW   ID K+Y    + W  K +++ 
Sbjct  63   PVCESLIQVEYIDEVWPGINPLLPSDPYQRAQAKFWGDYIDKKVYASARLTWGAKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E+ E LK LE ELG   YFGG+  G++D+ALI F+ W  A+EK  NFS+ E  CPK
Sbjct  123  AGKKELIEILKTLESELGDKIYFGGETFGYVDIALIGFYSWFGAYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC++ E+++K   D  KI + V +++K  G+
Sbjct  182  LIAWGKRCVERESVAKSLPDSEKIIKFVPELKKHFGI  218



>ref|XP_004147763.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004161561.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN53532.1| hypothetical protein Csa_4G064640 [Cucumis sativus]
Length=220

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 154/220 (70%), Gaps = 3/220 (1%)
 Frame = -3

Query  918  NNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNG  739
              E+ LLD + SM+GMR R+ALA KG+ YE  E+DL NKS LLL+MNPIHKK+PV IHNG
Sbjct  2    GEEVKLLDFWGSMFGMRIRIALAEKGVSYEYVEQDLRNKSHLLLQMNPIHKKVPVFIHNG  61

Query  738  KPICESLIIVEYIDEVWNDKYP-LLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            KPICES II++YIDEVW DK P LLP  PY RAQA+FW   ID K+YD   + W  K ++
Sbjct  62   KPICESYIILQYIDEVWKDKAPNLLPLHPYDRAQAKFWVDFIDKKLYDGAKKIWAGKGEE  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
                K+E+ E LK LE  LG  TYFGG+ +GF+D+ LI ++ W   +E   NFS+E   C
Sbjct  122  REKGKKEVIEILKQLEQVLGDKTYFGGESLGFVDIGLIGYYTWFYTYETIGNFSIES-EC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            PK++ W KRC+QNE+++K   +P  + + V+Q +K+ G++
Sbjct  181  PKIMCWVKRCMQNESVAKSLPEPKNVYEFVVQWKKSFGLD  220



>ref|XP_008390702.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 158/217 (73%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLLD + S +GMR R+ALA KGI YE K+EDL NKSP LL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLDFWPSPFGMRLRIALAEKGIEYEYKDEDLWNKSPXLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            PICESLI ++YIDEVWNDK PLLP D Y RAQARFWA  +D KIY+   + W  K +++ 
Sbjct  63   PICESLIALQYIDEVWNDKAPLLPXDSYLRAQARFWADFVDKKIYEIGRKLWTTKGEEQX  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  + + +LE ELG   +FGG+ +GF+D+ALI ++ W L +EK  NFS+E    P+
Sbjct  123  AXKKEFLDCIGVLERELGDKPFFGGNTLGFVDVALIPYYSWFLVYEKFGNFSVEA-EHPE  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ +++SK   +  K+   V+ +RK +G+
Sbjct  182  FIAWVKRCMEKKSVSKSLPEQEKVYDFVMLVRKKHGI  218



>gb|ACA83743.1| auxin-induced glutathione S transferase [Prosopis juliflora]
 gb|ACD74942.1| auxin-induced glutathione S-transferase [Prosopis juliflora]
Length=220

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 153/219 (70%), Gaps = 6/219 (3%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +  E+VLLDE+ SM+G R R+ALA KGI YE +EEDL +KSPLLL+MNPIHKKIPVLIH 
Sbjct  2    AEQEVVLLDEWLSMFGSRARIALAEKGIKYEYREEDLSSKSPLLLQMNPIHKKIPVLIHK  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD---RLVEWVFKT  571
            G+PICESLIIVEYIDEVW +  P LPSDPY RAQARFWA  ++ K+ D   R+  W  K 
Sbjct  62   GEPICESLIIVEYIDEVWKETAPFLPSDPYLRAQARFWADFVNKKVGDVGGRI--WAGKK  119

Query  570  KDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEEL  391
            ++    K+EI E LK LE  LG  T+FGG+  GF+D+AL+ F+PW   +E   NF +E  
Sbjct  120  EEHEEAKKEIIENLKQLEETLGDKTFFGGETFGFVDIALVPFYPWFYTYEALCNFKVETR  179

Query  390  VCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
             CPKLI W  RC+Q +++SK  A   +I   V+  RK +
Sbjct  180  -CPKLISWAHRCVQRQSVSKSLAAEKEIYDFVIDFRKKS  217



>gb|EYU38214.1| hypothetical protein MIMGU_mgv1a013218mg [Erythranthe guttata]
Length=227

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 161/224 (72%), Gaps = 11/224 (5%)
 Frame = -3

Query  909  IVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGKPI  730
            I+LLD + SM+GMR R+ALA KG+ YE +EE+L  KSPLL +MNP+H KIPVLIHNGKPI
Sbjct  6    IILLDVHVSMFGMRARVALAEKGVQYEYREENLAAKSPLLRQMNPVHTKIPVLIHNGKPI  65

Query  729  CESLIIVEYIDEVWNDKY-------PLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVF  577
            CESLIIV+YID+VW +         PLL SDPY+RAQARFWA  ID KI+D  R + W  
Sbjct  66   CESLIIVQYIDDVWRNDNNCNNNNPPLLSSDPYQRAQARFWADFIDKKIFDAGRRI-WTK  124

Query  576  KTKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSME  397
            K +++ A K+E+ + L LLEGELG   YFGGD  GFLD+ALI+++ W   +E   +F +E
Sbjct  125  KGEEQEAAKKEVIDALVLLEGELGDKPYFGGDSFGFLDVALITYYCWFDTWETCGDFKIE  184

Query  396  ELVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            +  CPKLI W K+C++ E++SK  ADP ++ + VL ++K  G+ 
Sbjct  185  QH-CPKLIVWAKKCMERESVSKSLADPKEVYEFVLMLKKKYGIE  227



>ref|XP_002264813.1| PREDICTED: probable glutathione S-transferase parA [Vitis vinifera]
 emb|CAN82751.1| hypothetical protein VITISV_009609 [Vitis vinifera]
Length=221

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 158/222 (71%), Gaps = 3/222 (1%)
 Frame = -3

Query  927  MESNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDL-DNKSPLLLKMNPIHKKIPVL  751
            M ++++IVLLD + S++G+R R+ALA KG+ YE KEEDL  +KS LLLKMNP+HKKIPVL
Sbjct  1    MANSDQIVLLDFFPSVFGIRVRLALAAKGVEYEGKEEDLTGDKSSLLLKMNPVHKKIPVL  60

Query  750  IHNGKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFK  574
            IHNGKPICESLIIVEYIDEVW D+ PLLPSDPY++AQA+FWA  ID  +Y    + W  K
Sbjct  61   IHNGKPICESLIIVEYIDEVWKDRCPLLPSDPYQKAQAKFWADFIDKMVYPCSKKLWTAK  120

Query  573  TKDENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEE  394
              ++ A K+E  + +KLLEGEL    YFGG+ +GFLD+A + F+     FE   NFS+E 
Sbjct  121  GAEQEASKKEFLDRIKLLEGELKSYPYFGGESLGFLDIAFLPFYSRFYTFEAFGNFSIEA  180

Query  393  LVCPKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
              CPKL+ W KRC++ E +S+      K+  +V++  K  G+
Sbjct  181  -ECPKLVAWGKRCMEEEFVSRSLPHQHKMYDLVVEFTKKVGI  221



>ref|XP_010472052.1| PREDICTED: glutathione S-transferase U20 [Camelina sativa]
Length=220

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 151/215 (70%), Gaps = 2/215 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            N+ +LLD + SM+GMR R+AL  KG+ +E +EED  NKSPLLL+ NP+HKKIPVLIHNGK
Sbjct  3    NKPILLDYWPSMFGMRARVALREKGVDFEYREEDFSNKSPLLLQSNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+CESL +V Y+DE W DK P  PSDPY R+QARFWA  +D K  +  V+ W+ K +++ 
Sbjct  63   PVCESLNVVHYVDEAWPDKNPFFPSDPYGRSQARFWADFVDKKFTEAQVKIWMKKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK+LE ELG   YFGGD  G++D++LI+F+ W  A+EK  N ++E    PK
Sbjct  123  AGKKEFIEALKILETELGDKPYFGGDSFGYVDISLITFYSWFQAYEKFGNINIES-ESPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTN  274
            L+ W KRC++ E++SK   D  KI   V + RK N
Sbjct  182  LVAWGKRCMEKESVSKSLPDSEKIVGYVAEFRKNN  216



>gb|ADB11348.1| tau class glutathione transferase GSTU7 [Populus trichocarpa]
Length=220

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            + +++ LL+ + S +GMR R+ALA KG+ YE  E+DL NK+ LLL+MNP+H KI VL+HN
Sbjct  2    AGDQVTLLNFWASPFGMRVRIALAEKGVKYEYGEQDLRNKTALLLQMNPVHSKILVLVHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKP CESLIIV+YI+E W DK PLLPSDPY+ A +RFWA  +D KIYD   + W  K +D
Sbjct  62   GKPACESLIIVQYINEAWKDKAPLLPSDPYQGALSRFWADFVDKKIYDLGRKIWTTKRED  121

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            + + K++  + LKLLEGELG   YFGGD +G++D+AL+ F+ W  A+E   NF++E   C
Sbjct  122  QESAKKDFIDSLKLLEGELGDKPYFGGDTLGYVDVALLPFYCWFYAYETIGNFNIEA-DC  180

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI + KRCLQ E++SK   DP K+S  V+ MRK  G+
Sbjct  181  PKLIAYCKRCLQKESVSKSLEDPQKVSDFVVMMRKKLGL  219



>ref|XP_010459291.1| PREDICTED: glutathione S-transferase U25-like [Camelina sativa]
Length=219

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 156/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+AL  K + ++ +E+DL NKSP+LL+MNP+H KIPVLIHNGK
Sbjct  3    DEVILLDFWPSMFGMRTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHNKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIY-DRLVEWVFKTKDEN  559
            P+CESLI VEYIDEVW    PLLPSDPY+RAQA+FW   ID K+Y    + W  K +++ 
Sbjct  63   PVCESLIQVEYIDEVWPGINPLLPSDPYQRAQAKFWGDYIDKKVYASARLTWGAKGEEQE  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E LK LE ELG   YFGG+  G++D+ALI F+ W  A+EK  NFS+ E  CPK
Sbjct  123  AGKKEFIEILKTLESELGDKIYFGGETFGYVDIALIGFYSWFGAYEKFGNFSI-EAECPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            LI W KRC++ E+++K   D  KI + V +++K  G+
Sbjct  182  LIAWGKRCVERESVAKSLPDSEKIIKFVPELKKHFGI  218



>ref|XP_010245129.1| PREDICTED: probable glutathione S-transferase parA [Nelumbo nucifera]
Length=219

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 4/217 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + S +GMR R+ALA KGI YE ++EDL+NKS  LL++NP+HKKIPVLI NGK
Sbjct  3    DEVILLDFWPSPFGMRARIALAEKGIKYEYRDEDLENKSRFLLQVNPVHKKIPVLIDNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICESLIIV+YIDEVW DK  L+PSDPYKRAQARFWA  +D K+Y   R V W  K +D+
Sbjct  63   PICESLIIVQYIDEVWKDKCLLMPSDPYKRAQARFWADFVDNKLYHCGRRV-WFSKAEDK  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
                +E+ E LKLLEGELG   YFGG+ +GF+D+AL+ F  W  ++E   NFS+E   CP
Sbjct  122  EEACKELIECLKLLEGELGNKPYFGGETLGFIDVALVPFNSWFCSYETCENFSIEPH-CP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNG  271
            K++ W KRC++ E++SK F D   +  + LQ +K  G
Sbjct  181  KIVAWAKRCMEKESVSKSFPDHQMVCDLALQWKKKLG  217



>ref|XP_009117719.1| PREDICTED: glutathione S-transferase U25 [Brassica rapa]
 emb|CDY21758.1| BnaA09g45090D [Brassica napus]
Length=219

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 157/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E++LLD + SM+GMR R+AL  K I ++ +E+DL NKSP+LL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVILLDYWPSMFGMRTRVALEEKNIKFDYREQDLFNKSPILLEMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            P+CESLI VEYIDE W    P LPSDPY+RAQA+FW   ID K+Y   RL+ W  K +++
Sbjct  63   PVCESLIQVEYIDETWPGGNPFLPSDPYQRAQAKFWGDFIDKKVYGPTRLI-WGAKGEEQ  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A  +E  E LK+LE ELG  TYFGG+  G++D+A+I F+ W    EK  NFS+ E  CP
Sbjct  122  EAGTKEFIEMLKMLESELGDKTYFGGETFGYVDIAMIGFYCWFDVLEKCGNFSI-EAECP  180

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            KLI W KRC++ E+++K   D  KI++ V +++K  G+
Sbjct  181  KLIAWAKRCMKRESVAKSLPDSNKITKFVPELKKKIGI  218



>ref|XP_008390704.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 156/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+VLL  + S +G+R R+ALA KGI YE KEED+ NKSPLLL+MNP+HKKIPVLIHNGK
Sbjct  3    DEVVLLGFWSSPFGIRLRIALAEKGIVYEYKEEDIWNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD-RLVEWVFKTKDEN  559
            P+ ESLI ++YIDEVWN K PLLPSD Y RAQARFWA  +D KI++     W  K +++N
Sbjct  63   PVSESLIALQYIDEVWNHKAPLLPSDSYLRAQARFWADFVDKKIFEFGRALWATKGEEQN  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  +++ +L+ ELG   +FGGD +GF+D+ LIS++ W L +EK  NFS+E    P+
Sbjct  123  AAKKEFLDYIGVLQRELGDKPFFGGDTLGFVDVTLISYYSWFLEYEKFGNFSVEA-EHPE  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC++ E++SK   +  K+    + +RK  G+
Sbjct  182  FIAWVKRCMEKESVSKSLPEQEKVYDYAMFLRKKFGI  218



>ref|XP_008226265.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=219

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +++VLLD + S +GMR R+ALA KG+ YE K+EDL NKSPLLL+ NP+HK+IPVLIHNGK
Sbjct  3    DQVVLLDFWPSPFGMRLRIALAEKGVQYEYKDEDLSNKSPLLLQSNPVHKQIPVLIHNGK  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
             + ESLI V+YIDEVW DK PLLPSDP+ RA ARFWA  +D K+Y+   + W  K ++++
Sbjct  63   AVSESLIAVQYIDEVWKDKAPLLPSDPHLRAHARFWADYVDKKMYEIGKKVWTTKGEEQD  122

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K+E  E + +LEGELG   YFGG   GF+D+ALI F+ W   +EK  NFS+ E   PK
Sbjct  123  AAKKEFLECISVLEGELGDKPYFGGKTFGFVDVALIPFYTWFSVYEKFGNFSV-EAEHPK  181

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRCL+ E++SK   D  K+  +VL+M K  G 
Sbjct  182  FIAWAKRCLEKESVSKSIPDQQKVYDLVLEMSKKLGT  218



>ref|XP_007212649.1| hypothetical protein PRUPE_ppa018201mg [Prunus persica]
 gb|EMJ13848.1| hypothetical protein PRUPE_ppa018201mg [Prunus persica]
Length=220

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 153/217 (71%), Gaps = 3/217 (1%)
 Frame = -3

Query  912  EIVLLDEYESMYGMRPRMALALKGIGYESKEED-LDNKSPLLLKMNPIHKKIPVLIHNGK  736
            ++VLL+ + S YGMR R+ALA KGI YES+EED L NKS LLL+MNP+HKKIPVLIHNGK
Sbjct  4    KVVLLNYWASPYGMRVRIALAEKGIQYESREEDYLTNKSSLLLQMNPVHKKIPVLIHNGK  63

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKDEN  559
            P+ ESLI V+YIDEVW DK PLLPSDPY RAQA FWA  +D K+Y+     W  K +++ 
Sbjct  64   PVSESLIAVQYIDEVWKDKAPLLPSDPYLRAQAMFWADFVDKKVYESAKRTWRTKGEEQE  123

Query  558  AIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCPK  379
            A K E  E ++LLE ELG   YFGG+ +GF+D+ALI  + W  A EK  NFS+ E   PK
Sbjct  124  AAKREFLECIRLLEEELGDKPYFGGENLGFVDVALIPTYSWFYAREKIGNFSV-EAKHPK  182

Query  378  LIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
             I W KRC+Q E++SK   D  ++ +  L++R   G+
Sbjct  183  FIAWAKRCMQKESVSKSLPDQKRVYEFALRLRSKLGL  219



>dbj|BAC21261.1| glutathione S-transferase [Cucurbita maxima]
Length=218

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 154/219 (70%), Gaps = 5/219 (2%)
 Frame = -3

Query  915  NEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHNGK  736
            +E+ LLD + SM+G+R R+ALA KG+  E  E+DL NKSPLLL+MNP+HKKIPVL+HNG+
Sbjct  3    DEVKLLDFWPSMFGIRVRIALAEKGVRIEYMEQDLRNKSPLLLQMNPVHKKIPVLVHNGR  62

Query  735  PICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYD--RLVEWVFKTKDE  562
            PICES IIV+YIDEVW DK PLLPSDPY+RAQARFW   ID K+YD  R V W  K ++ 
Sbjct  63   PICESSIIVQYIDEVWKDKAPLLPSDPYQRAQARFWVDFIDKKLYDAGRKV-WTGKGEEV  121

Query  561  NAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVCP  382
             A KE I   LK LE  LG+  +FGG+++GF+D+ALI F  W   +E     S+E   CP
Sbjct  122  EAGKELIGV-LKQLEEVLGEKGFFGGERLGFVDIALIGFHSWFYTYEAFGKLSIEA-ECP  179

Query  381  KLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGVN  265
            K++ W KRCL+ E++SK   D  K+    +QM+K  G+ 
Sbjct  180  KIMGWAKRCLEKESVSKSLPDSKKVYDFAVQMKKALGLE  218



>ref|XP_009591606.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=219

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 160/219 (73%), Gaps = 3/219 (1%)
 Frame = -3

Query  921  SNNEIVLLDEYESMYGMRPRMALALKGIGYESKEEDLDNKSPLLLKMNPIHKKIPVLIHN  742
            +++E++LL+ + SMYGMR R+ALA KG+ YE KEE+L  KS LLL+MNP+++KIPVLIHN
Sbjct  2    ADDEVILLNFWPSMYGMRVRVALAEKGVKYEYKEENLGEKSSLLLEMNPVYQKIPVLIHN  61

Query  741  GKPICESLIIVEYIDEVWNDKYPLLPSDPYKRAQARFWAGVIDAKIYDRLVE-WVFKTKD  565
            GKP+CESLI+V+YIDEVW DK PLLPSDPY++ +A FWA  ++ K++D   + W+ +  +
Sbjct  62   GKPVCESLIVVQYIDEVWKDKAPLLPSDPYEKYEAIFWADYVE-KVFDLGRKIWMTRGGE  120

Query  564  ENAIKEEIAEWlkllegelgKDTYFGGDKIGFLDLALISFFPWLLAFEKEVNFSMEELVC  385
            +   K+   + L++LEG LG   YFGG+ IGFLD+ALI F  W   +EK  NF+ E    
Sbjct  121  QQTRKKNYIDSLRMLEGILGDKPYFGGENIGFLDIALIGFCSWFYTYEKFGNFNTEA-ET  179

Query  384  PKLIEWTKRCLQNETISKCFADPLKISQMVLQMRKTNGV  268
            PKLI W KRC+Q E++SK  A+PLK+    LQ+RK  G+
Sbjct  180  PKLIAWMKRCMQRESVSKSVAEPLKVYDFALQIRKHYGI  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2327078598528