BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21012_g1_i3 len=1818 path=[2208:0-700 2908:701-726 @46@!:727-1017
178:1018-1105 266:1106-1195 362:1196-1349 3464:1350-1817]

Length=1818
                                                                      Score     E

ref|XP_006351760.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    308   4e-129   
ref|XP_009602277.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    269   1e-123   
ref|XP_004230559.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    284   3e-121   
emb|CDO97421.1|  unnamed protein product                                271   7e-118   
ref|XP_009774982.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    266   3e-116   
ref|XP_006423810.1|  hypothetical protein CICLE_v10028615mg             265   5e-116   
ref|XP_002323971.1|  hypothetical protein POPTR_0017s07770g             248   6e-115   Populus trichocarpa [western balsam poplar]
gb|KHG28696.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase,...    263   1e-114   
gb|AES90637.2|  1,4-dihydroxy-2-naphthoate octaprenyltransferase        248   1e-113   
ref|XP_003608440.1|  hypothetical protein MTR_4g094100                  248   1e-113   
ref|XP_007042907.1|  UbiA prenyltransferase family protein              259   2e-113   
ref|XP_004504820.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    248   3e-113   
gb|EYU18456.1|  hypothetical protein MIMGU_mgv1a007846mg                230   1e-111   
gb|EYU18457.1|  hypothetical protein MIMGU_mgv1a007846mg                229   2e-111   
ref|XP_008382042.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-dihydrox...    248   2e-111   
ref|XP_008455170.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    246   3e-111   
ref|XP_008237282.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    248   8e-111   
ref|XP_004136884.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    243   1e-110   
ref|XP_006492626.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    244   1e-110   
ref|XP_007200196.1|  hypothetical protein PRUPE_ppa016004mg             243   2e-110   
ref|XP_003543928.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    247   3e-110   
ref|XP_006492625.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    243   3e-110   
ref|XP_009349445.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    246   7e-110   
ref|XP_010690535.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    238   5e-108   
ref|XP_010417994.1|  PREDICTED: LOW QUALITY PROTEIN: 1,4-dihydrox...    243   5e-108   
ref|XP_004297559.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    241   5e-107   
ref|XP_010473237.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    240   5e-107   
ref|XP_010473238.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    239   7e-107   
ref|XP_010520880.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    253   5e-106   
ref|XP_003532605.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    229   6e-106   
ref|XP_010917309.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    233   6e-106   
ref|XP_010267186.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    258   3e-105   
ref|NP_001117518.1|  1,4-dihydroxy-2-naphthoate polyprenyltransfe...    246   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584972.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    218   1e-102   
ref|XP_011087913.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    206   2e-101   
ref|XP_010648174.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    247   3e-101   
ref|XP_002886606.1|  hypothetical protein ARALYDRAFT_475272             217   3e-101   
ref|XP_010648175.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    246   3e-101   
gb|EYU18455.1|  hypothetical protein MIMGU_mgv1a007846mg                202   4e-101   
ref|XP_004985400.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    216   8e-100   
emb|CDY34126.1|  BnaC01g28660D                                          234   1e-99    
ref|XP_010315115.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    283   3e-99    
ref|XP_006423809.1|  hypothetical protein CICLE_v10028615mg             207   1e-98    
ref|XP_011087912.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    207   1e-98    
ref|XP_010917310.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    233   8e-98    
ref|XP_010267194.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    258   8e-97    
gb|ABR16600.1|  unknown                                                 218   2e-94    Picea sitchensis
ref|NP_176259.2|  1,4-dihydroxy-2-naphthoate polyprenyltransferase      216   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAS76683.1|  At1g60600                                               213   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520871.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    253   2e-93    
ref|XP_006300524.1|  hypothetical protein CARUB_v10020546mg             242   3e-93    
ref|XP_010648176.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    246   9e-93    
ref|XP_006492627.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    186   1e-92    
ref|XP_004985401.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    187   5e-91    
gb|KHN26511.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase,...    229   7e-91    
ref|XP_007138251.1|  hypothetical protein PHAVU_009G192700g             239   3e-88    
gb|EYU26901.1|  hypothetical protein MIMGU_mgv1a022266mg                184   4e-87    
ref|XP_002980796.1|  hypothetical protein SELMODRAFT_57400              166   1e-74    
gb|KDP40919.1|  hypothetical protein JCGZ_24918                         254   4e-74    
ref|XP_002961856.1|  hypothetical protein SELMODRAFT_67325              165   4e-74    
ref|XP_006392143.1|  hypothetical protein EUTSA_v10023528mg             252   1e-73    
gb|KDO45007.1|  hypothetical protein CISIN_1g023777mg                   182   8e-71    
gb|KCW63305.1|  hypothetical protein EUGRSUZ_G00932                     241   1e-70    
gb|KCW63304.1|  hypothetical protein EUGRSUZ_G00932                     241   6e-70    
gb|KCW63299.1|  hypothetical protein EUGRSUZ_G00932                     241   1e-69    
gb|KCW63298.1|  hypothetical protein EUGRSUZ_G00932                     242   2e-69    
ref|XP_010065687.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    242   2e-69    
ref|XP_010065685.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    241   2e-69    
gb|KDO45006.1|  hypothetical protein CISIN_1g023777mg                   177   2e-69    
ref|XP_011043106.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    241   5e-69    
emb|CDY24540.1|  BnaA01g22440D                                          233   1e-66    
ref|XP_009103842.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    233   1e-66    
ref|XP_009383578.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    232   6e-66    
ref|XP_008804769.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    228   1e-64    
ref|XP_008804768.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    227   3e-64    
ref|NP_001152170.1|  LOC100285808                                       216   2e-60    Zea mays [maize]
gb|AFK47288.1|  unknown                                                 190   5e-60    
gb|ACN26005.1|  unknown                                                 214   2e-59    Zea mays [maize]
ref|XP_003558621.2|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    213   4e-59    
ref|XP_002465728.1|  hypothetical protein SORBIDRAFT_01g044560          213   4e-59    Sorghum bicolor [broomcorn]
ref|XP_006593110.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    186   8e-59    
gb|EMS49790.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase,...    215   2e-58    
gb|AAN64152.1|  Hypothetical protein                                    209   5e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88854.1|  hypothetical protein OsI_10327                          209   5e-58    Oryza sativa Indica Group [Indian rice]
ref|NP_001049226.1|  Os03g0190100                                       209   7e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001764177.1|  predicted protein                                  206   1e-57    
ref|XP_006649533.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    208   3e-57    
gb|KDO45009.1|  hypothetical protein CISIN_1g023777mg                   182   7e-57    
ref|XP_011087910.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    206   2e-56    
ref|XP_010065683.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    197   4e-56    
gb|KCW63303.1|  hypothetical protein EUGRSUZ_G00932                     198   5e-55    
dbj|BAJ91549.1|  predicted protein                                      195   1e-52    
ref|XP_011043107.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    192   3e-51    
gb|EPS57604.1|  hypothetical protein M569_17213                         184   2e-50    
gb|EYU26903.1|  hypothetical protein MIMGU_mgv1a021810mg                182   6e-50    
ref|XP_008804771.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    183   7e-50    
gb|KDO45011.1|  hypothetical protein CISIN_1g023777mg                   181   1e-49    
ref|XP_008804770.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    183   2e-49    
ref|XP_010229059.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    186   3e-49    
ref|WP_015218328.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       117   2e-48    
gb|ACN29030.1|  unknown                                                 176   3e-47    Zea mays [maize]
ref|WP_010872655.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       117   6e-47    
ref|WP_015141929.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       117   1e-46    
ref|WP_015216392.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       117   2e-46    
ref|XP_008680598.1|  PREDICTED: LOC100285808 isoform X1                 176   7e-46    
ref|WP_016874824.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       120   7e-46    
ref|WP_028090904.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    121   1e-45    
ref|WP_015178934.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       119   1e-45    
ref|WP_015170623.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       117   2e-45    
gb|EPS59958.1|  hypothetical protein M569_14848                         169   2e-45    
ref|XP_008358355.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    172   3e-45    
gb|EMT04177.1|  Putative 1,4-dihydroxy-2-naphthoate octaprenyltra...    171   3e-45    
ref|WP_015111493.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       121   4e-45    
ref|WP_006633954.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       119   1e-44    
ref|WP_016950297.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       117   1e-44    
ref|XP_006607039.1|  PREDICTED: uncharacterized protein LOC100813101    134   8e-44    
ref|WP_011319395.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   1e-43    
ref|WP_002782974.1|  putative 1,4-dihydroxy-2-naphthoate octapren...    120   2e-43    
ref|XP_010068285.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    168   2e-43    
ref|XP_010096941.1|  1,4-dihydroxy-2-naphthoate polyprenyltransfe...    168   3e-43    
ref|WP_008199406.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       119   5e-43    
ref|XP_006590098.1|  PREDICTED: uncharacterized protein LOC100788238    134   1e-42    
ref|WP_015126781.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       110   2e-42    
ref|XP_011087911.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    164   2e-42    
ref|WP_028084271.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    108   3e-42    
ref|WP_027402297.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    107   4e-42    
ref|WP_015137035.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       110   8e-42    
ref|WP_039203153.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    104   2e-41    
ref|WP_026103115.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    118   3e-41    
ref|WP_017655474.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       107   5e-41    
emb|CEG02143.1|  1,4-dihydroxy-2-naphthoate phytyltransferase           114   6e-41    
gb|KFM27531.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase,...    108   7e-41    
ref|WP_013190658.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       112   8e-41    
ref|WP_027840956.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    105   9e-41    
ref|WP_012412664.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       100   1e-40    
ref|WP_015211008.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       103   1e-40    
ref|WP_015080747.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       103   2e-40    
ref|XP_003083066.1|  Predicted membrane protein (ISS)                   112   2e-40    
ref|WP_006619924.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       109   4e-40    
ref|WP_014274528.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    108   1e-39    
gb|ABB51237.1|  UbiA                                                    108   1e-39    Arthrospira platensis
ref|XP_009337905.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    153   1e-39    
ref|WP_010477786.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       104   4e-39    
ref|WP_006625485.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       110   5e-39    
ref|WP_035759563.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    110   5e-39    
gb|KHN41270.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase,...    139   4e-38    
gb|KHN15691.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase,...    139   4e-38    
ref|WP_036008931.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    103   1e-37    
ref|WP_008050963.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       105   2e-37    
ref|XP_010068283.1|  PREDICTED: 1,4-dihydroxy-2-naphthoate polypr...    139   2e-35    
ref|XP_002525833.1|  hypothetical protein RCOM_0822650                  123   7e-29    Ricinus communis
ref|WP_012594849.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...    125   1e-28    
ref|XP_006853281.1|  hypothetical protein AMTR_s00038p00239380          120   2e-28    
ref|WP_017286479.1|  hypothetical protein                               124   5e-28    
ref|WP_002768157.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       124   7e-28    
ref|WP_021834695.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    123   1e-27    
ref|WP_011433869.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       123   1e-27    
ref|WP_002763692.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       123   1e-27    
ref|WP_004161629.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       123   2e-27    
ref|WP_002798226.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       122   2e-27    
ref|WP_007309766.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       122   3e-27    
ref|WP_007304368.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       121   4e-27    
ref|WP_015193571.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       121   5e-27    
ref|XP_005644911.1|  hypothetical protein COCSUDRAFT_57519              122   8e-27    
gb|AAL85697.1|AF474982_1  hypothetical protein T17F15.140-like pr...    122   8e-27    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_012266417.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       120   9e-27    
gb|EKV00712.1|  1,4-dihydroxy-2-naphthoate phytyltransferase            120   1e-26    
ref|WP_023076946.1|  hypothetical protein                               120   1e-26    
ref|XP_006833567.1|  hypothetical protein AMTR_s00216p00022320          120   1e-26    
ref|WP_015160112.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       120   2e-26    
ref|WP_012953917.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       120   2e-26    
ref|WP_036487910.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    120   2e-26    
ref|WP_022609084.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       120   2e-26    
ref|WP_024970270.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    119   3e-26    
ref|WP_002750368.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       119   4e-26    
ref|WP_002776353.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       119   4e-26    
ref|WP_016516794.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    119   4e-26    
ref|WP_002744108.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       118   5e-26    
ref|WP_002800653.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       118   6e-26    
ref|WP_015200003.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       118   6e-26    
ref|WP_002736788.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       118   6e-26    
ref|WP_006528398.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       118   7e-26    
ref|WP_036020136.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    118   7e-26    
ref|WP_002790797.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       117   9e-26    
ref|WP_015223527.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       117   1e-25    
ref|WP_007353321.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...    117   1e-25    
ref|WP_026072455.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    117   1e-25    
gb|AIE73921.1|  1,4-dihydroxy-2-naphthoate octaprenyltransferase        117   2e-25    
ref|WP_015204775.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       116   3e-25    
ref|WP_026097960.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    115   6e-25    
ref|WP_009543466.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...    115   6e-25    
ref|WP_016871474.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       115   6e-25    
ref|WP_009459023.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       115   7e-25    
ref|XP_005849506.1|  hypothetical protein CHLNCDRAFT_48633              115   7e-25    
ref|WP_008314998.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       114   1e-24    
ref|WP_011431251.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       115   1e-24    
ref|WP_016867896.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       114   1e-24    
ref|WP_026082454.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    114   2e-24    
ref|WP_024125203.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    114   2e-24    
ref|WP_017311241.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       114   2e-24    
gb|EDX86986.1|  1,4-dihydroxy-2-naphthoate phytyltransferase            114   2e-24    Synechococcus sp. PCC 7335
ref|WP_037221988.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    110   3e-24    
dbj|GAL92312.1|  1,4-dihydroxy-2-naphthoate polyprenyltransferase       113   3e-24    
ref|WP_009633114.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       113   3e-24    
ref|WP_009628241.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       113   4e-24    
ref|WP_026079671.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    113   4e-24    
ref|XP_005714922.1|  unnamed protein product                            113   4e-24    
ref|WP_011058030.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       113   4e-24    
ref|WP_030007854.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    113   4e-24    
ref|WP_009555890.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       112   6e-24    
ref|WP_012307593.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       112   6e-24    
ref|WP_008277770.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       112   6e-24    
ref|WP_019505811.1|  hypothetical protein                               112   7e-24    
ref|WP_015182113.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       112   1e-23    
ref|WP_026732594.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    112   1e-23    
ref|WP_015134406.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       112   1e-23    
ref|WP_026222139.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    111   1e-23    
ref|WP_015225671.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       111   1e-23    
ref|WP_026087108.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    111   1e-23    
ref|WP_026723187.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    111   2e-23    
ref|WP_011613412.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       111   2e-23    
ref|WP_035154130.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    110   2e-23    
ref|WP_013320592.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       110   3e-23    
ref|WP_017293894.1|  hypothetical protein                               110   3e-23    
ref|WP_038019139.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    110   3e-23    
ref|WP_015227911.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       110   4e-23    
ref|XP_002505417.1|  predicted protein                                  113   5e-23    Micromonas commoda
ref|WP_015124706.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       110   6e-23    
ref|WP_006196062.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       109   8e-23    
gb|KFF42133.1|  1,4-dihydroxy-2-naphthoate phytyltransferase            109   8e-23    
ref|WP_017320202.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   1e-22    
ref|WP_026093445.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    108   1e-22    
ref|WP_006511269.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       108   1e-22    
ref|WP_039729444.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    108   1e-22    
ref|WP_015116250.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       108   1e-22    
ref|WP_038654964.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   1e-22    
gb|AIQ96357.1|  1,4-dihydroxy-2-naphthoate octaprenyltransferase        108   2e-22    
ref|WP_035991238.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    108   2e-22    
ref|WP_036904880.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   2e-22    
ref|WP_011823035.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   2e-22    
gb|KGG21670.1|  1,4-dihydroxy-2-naphthoate octaprenyltransferase        108   2e-22    
ref|XP_007509891.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    110   2e-22    
ref|WP_015165002.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       108   2e-22    
ref|WP_015956695.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   2e-22    
ref|WP_015148203.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       108   2e-22    
ref|WP_011294177.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       108   2e-22    
ref|WP_012630441.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       107   3e-22    
ref|WP_015168429.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       107   3e-22    
ref|WP_019475506.1|  hypothetical protein                               107   4e-22    
ref|WP_008187028.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       107   5e-22    
ref|WP_006098029.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       107   6e-22    
ref|WP_039716432.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    106   6e-22    
ref|WP_026032806.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       106   1e-21    
ref|WP_010994210.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       105   1e-21    
ref|WP_039742617.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    105   1e-21    
ref|WP_011141577.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    105   2e-21    
ref|WP_006278173.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       105   2e-21    
ref|WP_032522899.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       105   3e-21    
ref|WP_026098425.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    104   4e-21    
ref|XP_001422744.1|  predicted protein                                  103   6e-21    Ostreococcus lucimarinus CCE9901
ref|WP_009344364.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       103   6e-21    
ref|WP_011131815.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       103   7e-21    
ref|WP_012161703.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       103   7e-21    
ref|WP_015189658.1|  1,4-dihydroxy-2-naphthoate phytyltransferase       103   8e-21    
ref|WP_009783199.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       103   8e-21    
ref|WP_029637834.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    103   1e-20    
ref|WP_026032390.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       101   3e-20    
ref|WP_036902048.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       102   3e-20    
ref|WP_026101100.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    101   4e-20    
ref|WP_038075214.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    101   4e-20    
ref|WP_017746976.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       101   4e-20    
ref|WP_026797590.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...    100   6e-20    
ref|WP_025893906.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...    100   9e-20    
ref|WP_036922039.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       100   9e-20    
ref|WP_011819528.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       100   1e-19    
ref|WP_025967796.1|  1,4-dihydroxy-2-naphthoate prenyltransferase       100   1e-19    
ref|WP_025921351.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...    100   1e-19    
ref|WP_025971634.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     99.4    2e-19    
ref|WP_017710802.1|  hypothetical protein                             99.4    2e-19    
emb|CDN12546.1|  1,4-dihydroxy-2-naphthoate octaprenyltransferase     96.3    2e-19    
ref|WP_036916462.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  99.4    2e-19    
ref|XP_003059690.1|  predicted protein                                99.4    2e-19    
ref|WP_037218913.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  95.5    3e-19    
ref|WP_025957537.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     98.2    4e-19    
ref|WP_023068118.1|  1,4-dihydroxy-2-naphthoate phytyltransferase     98.2    5e-19    
ref|WP_011242503.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     97.8    6e-19    
ref|WP_036530610.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  97.8    7e-19    
ref|WP_011365366.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     97.8    7e-19    
ref|WP_002805905.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     97.8    7e-19    
gb|AHF64855.1|  1,4-dihydroxy-2-naphthoate phytyltransferase          97.4    9e-19    
ref|WP_025941226.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     97.4    1e-18    
ref|WP_038552625.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     96.7    2e-18    
ref|WP_036898748.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     96.3    2e-18    
ref|WP_012006983.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     95.9    3e-18    
ref|WP_025922787.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     95.9    3e-18    
ref|WP_024545894.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  95.9    3e-18    
ref|WP_025959620.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     95.5    3e-18    
ref|WP_025925861.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     95.5    4e-18    
ref|WP_011375744.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     95.1    4e-18    
ref|WP_015156032.1|  1,4-dihydroxy-2-naphthoate phytyltransferase     95.1    5e-18    
ref|YP_002048988.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  95.1    5e-18    
ref|WP_025952277.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.7    7e-18    
ref|WP_025958707.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.4    7e-18    
ref|WP_025944361.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.4    9e-18    
ref|WP_025939842.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  94.4    9e-18    
ref|WP_025973677.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.4    9e-18    
ref|WP_025960222.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.4    1e-17    
ref|XP_006387246.1|  UbiA prenyltransferase family protein            90.5    1e-17    
ref|WP_025980167.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.4    1e-17    
ref|WP_025943263.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.4    1e-17    
ref|WP_032526525.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.0    1e-17    
ref|WP_025960803.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     94.0    1e-17    
ref|WP_025932301.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  94.0    1e-17    
ref|WP_025892494.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  94.0    1e-17    
ref|WP_025914037.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     93.6    2e-17    
ref|WP_025962138.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     93.2    2e-17    
ref|WP_025932998.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     93.2    2e-17    
ref|WP_023173797.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  92.8    3e-17    
ref|WP_032515822.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     93.2    3e-17    
ref|WP_025945617.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     92.8    3e-17    
gb|AIQ94245.1|  1,4-dihydroxy-2-naphthoate octaprenyltransferase      92.8    3e-17    
ref|WP_011124356.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  92.8    3e-17    
ref|WP_032517283.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     92.4    4e-17    
ref|WP_025948149.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     92.4    4e-17    
ref|WP_011129160.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     92.0    6e-17    
tpg|DAA43809.1|  TPA: hypothetical protein ZEAMMB73_964455            87.8    7e-17    
ref|WP_011360861.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     91.3    9e-17    
ref|WP_012194750.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     91.3    1e-16    
ref|WP_026032671.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     90.9    1e-16    
ref|WP_025929662.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     90.9    1e-16    
ref|WP_026787017.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate oct...  90.9    1e-16    
ref|WP_025951781.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     90.9    1e-16    
gb|KEI65513.1|  MenA                                                  90.5    2e-16    
ref|WP_027249383.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  90.5    2e-16    
ref|WP_032523948.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     90.1    2e-16    
ref|WP_032514642.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     90.1    3e-16    
ref|WP_011936665.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     90.1    3e-16    
ref|WP_025937941.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     89.0    6e-16    
ref|WP_011862221.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.6    7e-16    
ref|WP_015110369.1|  1,4-dihydroxy-2-naphthoate phytyltransferase     88.6    8e-16    
ref|WP_032519713.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.6    8e-16    
ref|WP_025927892.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.6    8e-16    
ref|WP_025905983.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.2    9e-16    
ref|WP_006909483.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.6    9e-16    
ref|WP_025954314.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.2    9e-16    
ref|WP_011817669.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.2    9e-16    
ref|WP_025963494.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.2    1e-15    
ref|WP_006173295.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     88.2    1e-15    
ref|WP_025900229.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  88.2    1e-15    
ref|WP_025965211.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     87.4    2e-15    
ref|WP_007099159.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     87.8    2e-15    
ref|WP_008233337.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  85.5    2e-15    
ref|WP_025782181.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     87.8    2e-15    
ref|WP_035830556.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     87.4    2e-15    
ref|WP_025937283.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     87.0    2e-15    
ref|WP_025975696.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     85.1    9e-15    
ref|WP_029552805.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     85.5    1e-14    
ref|WP_006173511.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  83.6    3e-14    
ref|WP_006854034.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     82.0    9e-14    
ref|WP_011620547.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     81.6    1e-13    
ref|WP_021327508.1|  1,4-dihydroxy-2-naphtoic acid prenyltransferase  80.1    4e-13    
ref|WP_028953009.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     79.3    9e-13    
ref|WP_025980853.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     77.4    1e-12    
gb|AII46346.1|  1,4-dihydroxy-2-naphthoate prenyltransferase          78.6    1e-12    
ref|WP_038547192.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     78.2    2e-12    
gb|EAQ70542.1|  1,4-dihydroxy-2-naphthoate (DHNA) octaprenyltrans...  77.8    2e-12    
ref|WP_038001034.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     78.2    3e-12    
ref|WP_029626021.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     75.5    2e-11    
ref|WP_036913055.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  74.3    4e-11    
ref|WP_008514766.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     50.8    6e-11    
ref|WP_029952329.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     71.6    8e-11    
ref|WP_011827307.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     73.2    1e-10    
ref|WP_029979261.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     70.5    1e-10    
ref|WP_025958198.1|  hypothetical protein                             70.1    2e-10    
ref|WP_011131424.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     70.5    8e-10    
ref|WP_006042969.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     70.1    1e-09    
ref|WP_011934205.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     69.3    2e-09    
ref|WP_025958199.1|  hypothetical protein                             63.2    3e-08    
ref|WP_013780868.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  44.7    6e-08    
ref|WP_025970094.1|  hypothetical protein                             62.0    8e-08    
ref|WP_029985691.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     60.1    2e-07    
ref|WP_020864800.1|  hypothetical protein                             62.4    5e-07    
ref|WP_025931330.1|  hypothetical protein                             59.3    6e-07    
ref|WP_028831381.1|  hypothetical protein                             56.6    4e-05    
ref|WP_006447944.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     55.5    5e-05    
gb|KCW63308.1|  hypothetical protein EUGRSUZ_G00935                   52.8    7e-05    
dbj|GAF23247.1|  1,4-dihydroxy-2-naphthoate octaprenyltransferase     54.3    8e-05    
gb|AIQ38336.1|  ubiquinone biosynthesis protein UbiA                  54.7    1e-04    
ref|WP_008479353.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     54.3    1e-04    
ref|WP_036682043.1|  ubiquinone biosynthesis protein UbiA             54.3    2e-04    
ref|WP_008895347.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  54.3    2e-04    
dbj|BAP55788.1|  1,4-dihydroxy-2-naphthoateoctaprenyltransferase      41.2    2e-04    
ref|WP_014809003.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     53.9    2e-04    
ref|WP_026681514.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  53.5    3e-04    
ref|WP_021288889.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  53.5    3e-04    
ref|WP_029269892.1|  1,4-dihydroxy-2-naphthoate octaprenyltransfe...  53.5    3e-04    
ref|WP_028459442.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     53.1    3e-04    
ref|WP_012984173.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     52.8    4e-04    
ref|WP_012256005.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  52.8    5e-04    
ref|WP_036642613.1|  ubiquinone biosynthesis protein UbiA             52.8    5e-04    
ref|WP_006523760.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     52.4    5e-04    
ref|WP_026569614.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate oct...  52.4    6e-04    
ref|WP_003184647.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate pre...  52.0    7e-04    
ref|WP_036728337.1|  ubiquinone biosynthesis protein UbiA             52.0    7e-04    
ref|WP_007132369.1|  ubiquinone biosynthesis protein UbiA             52.0    8e-04    
ref|WP_015737266.1|  MULTISPECIES: ubiquinone biosynthesis protei...  52.0    8e-04    
gb|AIQ55269.1|  ubiquinone biosynthesis protein UbiA                  52.0    8e-04    
ref|WP_012901176.1|  1,4-dihydroxy-2-naphthoate prenyltransferase     52.0    9e-04    
gb|ETT64416.1|  UbiA prenyltransferase                                52.0    9e-04    
ref|WP_020452697.1|  MULTISPECIES: 1,4-dihydroxy-2-naphthoate oct...  51.6    0.001    
ref|WP_035401969.1|  hypothetical protein                             52.0    0.001    



>ref|XP_006351760.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Solanum tuberosum]
Length=403

 Score =   308 bits (790),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 189/242 (78%), Gaps = 0/242 (0%)
 Frame = +3

Query  294   FHNQGHSFSRLTKFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRRQCQHPRHF  473
             F+   H+ +    F F   S+  H   RS CC   T R +S   LRW+E R+     R F
Sbjct  16    FNKSSHAPTSSRNFIFRTCSLPSHVTQRSICCFQSTGRSSSVINLRWKEVRQWQLSLRGF  75

Query  474   YSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRY  653
             + C+ +  DA +EE EENIS+ TLIWRA+KLPIYSVALVPLTVGSAAAYLQ GLFS  RY
Sbjct  76    FMCKVQQHDATSEENEENISQATLIWRAIKLPIYSVALVPLTVGSAAAYLQTGLFSARRY  135

Query  654   LALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL  833
               LLASSV IITWLNLSNDVYDFDTGADK+KKESVVNIVGSRTGT IAA + L LGF G+
Sbjct  136   FMLLASSVFIITWLNLSNDVYDFDTGADKDKKESVVNIVGSRTGTFIAACLLLALGFLGI  195

Query  834   VWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQS  1013
              + S+++ANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS
Sbjct  196   TYTSVEAANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS  255

Query  1014  ST  1019
             ST
Sbjct  256   ST  257


 Score =   182 bits (463),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             S LPI+ T LSAS LVG TTSLILFCSHFHQ++ DKAVGK+SPLVRLGT   + VVK  V
Sbjct  258   SELPITYTTLSASALVGFTTSLILFCSHFHQVEGDKAVGKFSPLVRLGTGAASRVVKVGV  317

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
               LYS  ++LGFT+TLP   IIL  LTIPMG++V+SYVEKNH+DK KIFMAKYYCV+LHA
Sbjct  318   ATLYSGMLLLGFTQTLPFTCIILGALTIPMGKLVVSYVEKNHKDKAKIFMAKYYCVKLHA  377

Query  1468  LFGATLAAGLVVARFFARNYNMRPV  1542
             LFG  LAAGLV A+  AR    +P+
Sbjct  378   LFGVALAAGLVAAKMVARYPVPKPI  402



>ref|XP_009602277.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Nicotiana tomentosiformis]
Length=411

 Score =   269 bits (688),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 178/230 (77%), Gaps = 8/230 (3%)
 Frame = +3

Query  330   KFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRRQCQHPRHFYSCRARHSDAIN  509
             KF F   S+  H   RS        R  +    RW+E +++    R F++CR  +    +
Sbjct  44    KFIFKTCSLASHVTQRSI------GRSGNEINFRWKEVKQRHSSQRRFFTCR--YDATTS  95

Query  510   EEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIIT  689
              E EENIS+ TLIWRA+KLPIYSVALVPLTVGSAAAYLQ G+FS  RY  L  SSVLIIT
Sbjct  96    MENEENISQATLIWRAIKLPIYSVALVPLTVGSAAAYLQTGIFSAKRYFMLFVSSVLIIT  155

Query  690   WLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRA  869
             WLNLSNDVYDFDTGADK+KKESVVNIVGSRTGT IAAY+ L LGF GL + S+++AN+RA
Sbjct  156   WLNLSNDVYDFDTGADKDKKESVVNIVGSRTGTFIAAYLLLALGFFGLTYTSVEAANMRA  215

Query  870   ILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ILLLASAI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAF+LLQSST
Sbjct  216   ILLLASAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFFLLQSST  265


 Score =   204 bits (518),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             S LPI+ TILSASVLVG TTSLILFCSHFHQ++ DKAVGK+SPLVRLGT+ G+ VVK  V
Sbjct  266   SELPITCTILSASVLVGFTTSLILFCSHFHQVEGDKAVGKFSPLVRLGTQAGSRVVKVGV  325

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYS  ++LG T+TLP   IIL  LTIP+G++V+SYVE N+EDK KIFMAKYYCVRLHA
Sbjct  326   AALYSGMLLLGLTQTLPFTCIILCALTIPVGKLVVSYVENNYEDKAKIFMAKYYCVRLHA  385

Query  1468  LFGATLAAGLVVARFFARNYNMRPV  1542
             LFG  LAAG V A+  AR +  +P+
Sbjct  386   LFGVALAAGFVAAKMVARYHVPKPI  410



>ref|XP_004230559.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=402

 Score =   284 bits (726),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 186/242 (77%), Gaps = 0/242 (0%)
 Frame = +3

Query  294   FHNQGHSFSRLTKFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRRQCQHPRHF  473
             F+   H+      F     S+  H   RS CC  CT R  S   L W+E ++     R F
Sbjct  16    FNKTSHAPISSRNFILRTCSLPSHVRQRSICCFQCTGRSGSVIDLGWKEVKQWHSSLRGF  75

Query  474   YSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRY  653
             + C+ +  DA +EE EENIS+ TLIWRA+KLPIYSVAL+PLTVGSAAAYLQ GLFS  RY
Sbjct  76    FMCKVQQHDATSEENEENISQATLIWRAIKLPIYSVALIPLTVGSAAAYLQTGLFSARRY  135

Query  654   LALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL  833
               LLASSV IITWLNLSNDVYDFDTGADK+KKESVVNIVGSRTGT +AA + L LGF GL
Sbjct  136   FMLLASSVFIITWLNLSNDVYDFDTGADKDKKESVVNIVGSRTGTFVAACLLLALGFLGL  195

Query  834   VWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQS  1013
              + S+++ANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS
Sbjct  196   TYTSVEAANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS  255

Query  1014  ST  1019
             +T
Sbjct  256   NT  257


 Score =   181 bits (460),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             S LPI+ T LSAS LVG TTSLILFCSHFHQ++ DKAV K+SPLVRLGT+ G+ VVK  V
Sbjct  258   SELPITYTTLSASALVGFTTSLILFCSHFHQVEGDKAVRKFSPLVRLGTEAGSRVVKVGV  317

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
               LYS  ++LGFT+TLP   IIL  LTIP+G++V+SYVEKNH+DK KIFMAKYYCVRLHA
Sbjct  318   ATLYSGMLLLGFTQTLPLTCIILCALTIPVGKLVVSYVEKNHKDKAKIFMAKYYCVRLHA  377

Query  1468  LFGATLAAGLVVARFFARNYNMRPV  1542
             LFG  LAAGLV A+  AR    +P+
Sbjct  378   LFGVALAAGLVAAKMVARYPVPKPI  402



>emb|CDO97421.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   271 bits (692),  Expect(2) = 7e-118, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 184/245 (75%), Gaps = 14/245 (6%)
 Frame = +3

Query  312   SFSRLTKFDFAINSVLPH---------SVYRSFCCIGCTNRCNSWSALRWQESRRQCQHP  464
             SFS L K D  + S+L           ++ R + C  C   C+  S ++    +++ Q  
Sbjct  31    SFSNLLKSDSGLLSLLKRFCPVPSLSGNIRRPWFC-KCPKTCHQPSIMQLAVKQQRQQWK  89

Query  465   RHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSV  644
               F S     SD I EE++++  R T+IWRA+KLPIYSVAL+PL V SAAAYLQ GLFS 
Sbjct  90    TFFQST----SDTIIEEEKDDTPRATIIWRAIKLPIYSVALIPLAVASAAAYLQTGLFSS  145

Query  645   TRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGF  824
              R++ LLASS LIITWLNLSNDVYDFDTGADKNKKESVVNI+GSRTGTL+AA +SL LGF
Sbjct  146   GRFVVLLASSALIITWLNLSNDVYDFDTGADKNKKESVVNILGSRTGTLVAAVLSLILGF  205

Query  825   CGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYL  1004
              GL+WASL++ N+R+ILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYL
Sbjct  206   MGLIWASLEAGNVRSILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATAAFYL  265

Query  1005  LQSST  1019
             LQS T
Sbjct  266   LQSRT  270


 Score =   183 bits (464),  Expect(2) = 7e-118, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LPI+GT+LSAS+LVGLTTSLILFCSHFHQ+ DD AVGK SPLVRLGT+ G++VVK +V+ 
Sbjct  273   LPITGTVLSASILVGLTTSLILFCSHFHQVKDDMAVGKMSPLVRLGTRAGSDVVKIAVVV  332

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS  ++LG    LP   IIL  LT+P+GR+VI YV +NH+D TKIFMAKYYCVRLH +F
Sbjct  333   LYSSLLVLGLFGGLPITCIILCGLTVPIGRLVIRYVAENHQDNTKIFMAKYYCVRLHTVF  392

Query  1474  GATLAAGLVVARFFA  1518
             G  LAAGLV AR  A
Sbjct  393   GTALAAGLVAARIVA  407



>ref|XP_009774982.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Nicotiana sylvestris]
 ref|XP_009774983.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Nicotiana sylvestris]
Length=397

 Score =   266 bits (680),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 181/237 (76%), Gaps = 12/237 (5%)
 Frame = +3

Query  339   FAINSVLPHSVYRSFCCIGCT----------NRCNSWSALRWQESRRQCQHPRHFYSCRA  488
             F +NS +  +  R+F    C+           R  +    R +E + +    R F++CR 
Sbjct  17    FNLNSFIGRTSSRNFIFKTCSLASHVTQRSIGRSGNEINFRQKEVKHRHSSQRGFFTCR-  75

Query  489   RHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLA  668
              +    ++E EENIS+ TLIWRA+KLPIYSVALVPLTVGSAAAYLQ G+FS  RY  LL 
Sbjct  76    -YDATTSKENEENISQATLIWRAIKLPIYSVALVPLTVGSAAAYLQTGIFSANRYFMLLV  134

Query  669   SSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL  848
             SSVLIITWLNLSNDVYDFDTGADK+KKESVVNIVGSRTGT IAAY+ L LGF GL + S+
Sbjct  135   SSVLIITWLNLSNDVYDFDTGADKDKKESVVNIVGSRTGTFIAAYLLLALGFFGLTYTSV  194

Query  849   QSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++AN+RAILLLASAI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQSST
Sbjct  195   EAANMRAILLLASAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQSST  251


 Score =   182 bits (462),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             S LPI+ TILSAS LVGLTTSLILF SHFHQ++ DKAVGK+SPLVRLGT+ G+ VVK  V
Sbjct  252   SELPITCTILSASALVGLTTSLILFSSHFHQVEGDKAVGKFSPLVRLGTQAGSRVVKVGV  311

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYS T++LG T+ LP   IIL  LTIP+G++V+SYVE N+EDK KIFMAKYYCVRLHA
Sbjct  312   AALYSGTLLLGLTQALPFTCIILCALTIPVGKLVVSYVENNYEDKGKIFMAKYYCVRLHA  371

Query  1468  LFGATLAAGLVVARFFARNYNMRPV  1542
             LFG  LAAGLV A+  AR +  +P+
Sbjct  372   LFGVALAAGLVAAKMVARYHVPKPL  396



>ref|XP_006423810.1| hypothetical protein CICLE_v10028615mg [Citrus clementina]
 gb|ESR37050.1| hypothetical protein CICLE_v10028615mg [Citrus clementina]
Length=392

 Score =   265 bits (677),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = +3

Query  429   RWQESRRQCQHPRHFYSCRARHSDAINEE-KEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             R  E ++QC H       +A  S +++ +  EE++SR TLIWRA+KLPIYSVALVPLTVG
Sbjct  45    RELEFKQQCHHALFRSKDKADFSSSMHHQANEEDVSRATLIWRAIKLPIYSVALVPLTVG  104

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
             SA AYLQ G+FS  RY  LL SSVLIITWLNLSNDVYDFDTGADKNK ESVVN+VGSRTG
Sbjct  105   SATAYLQTGMFSTRRYFVLLISSVLIITWLNLSNDVYDFDTGADKNKTESVVNLVGSRTG  164

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
             TL+ AY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQGLGEPLCF
Sbjct  165   TLVTAYLLLVLGFIGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQGLGEPLCF  224

Query  966   aafgpfattafYLLQSSTR  1022
             AAFGPFATTAFYLL  STR
Sbjct  225   AAFGPFATTAFYLLLGSTR  243


 Score =   182 bits (463),  Expect(2) = 5e-116, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  238   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  297

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  298   SVVVKWAVMILYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  357

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVR HALFGA L AGL+ AR
Sbjct  358   YYCVRFHALFGAALVAGLITAR  379



>ref|XP_002323971.1| hypothetical protein POPTR_0017s07770g [Populus trichocarpa]
 gb|ABK94797.1| unknown [Populus trichocarpa]
 gb|EEF04104.1| hypothetical protein POPTR_0017s07770g [Populus trichocarpa]
Length=401

 Score =   248 bits (633),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 159/213 (75%), Gaps = 3/213 (1%)
 Frame = +3

Query  384   CCIGCTNRCNSWSALRWQESRRQCQHPRHFYSCRARHSDAINE-EKEENISRTTLIWRAV  560
             CC      C S   +   E ++  Q  R F    A ++D  +E E  E++ + TLIWRAV
Sbjct  47    CCTAQNFVCGS--RISRLEFKKGIQCWRAFSGSIANYADKSHEGETGEDVPKATLIWRAV  104

Query  561   KLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADK  740
             KLPIYSVALVPLTVG AAAYLQ G+FS  RY +LL SS+LIITWLNLSNDVYDFDTGADK
Sbjct  105   KLPIYSVALVPLTVGGAAAYLQTGMFSARRYFSLLVSSILIITWLNLSNDVYDFDTGADK  164

Query  741   NKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCP  920
             NKKESVVN+VGSR+   IAAY SL LGF GL W S+   N+ AIL LA AI CGY+YQCP
Sbjct  165   NKKESVVNLVGSRSVAFIAAYSSLLLGFAGLAWTSMGEGNIHAILFLACAILCGYVYQCP  224

Query  921   PFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             PFRLSYQGLGEPLCFAAFGPFAT+AFYLL  ST
Sbjct  225   PFRLSYQGLGEPLCFAAFGPFATSAFYLLLGST  257


 Score =   196 bits (497),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S    SILP++GTILSAS+LVG TT+LILFCSHFHQ+++DKAVGK+SPLVRLGT+ G
Sbjct  253   LLGSTSEMSILPLTGTILSASLLVGFTTTLILFCSHFHQVEEDKAVGKFSPLVRLGTERG  312

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +V  LYSL    G ++TLP A I+L  LT+PMG++V+ +VE+N++DK KIFMAK
Sbjct  313   SGVVKVAVAMLYSLLFASGLSRTLPLACILLCSLTLPMGKLVVGFVEENYKDKGKIFMAK  372

Query  1444  YYCVRLHALFGATLAAGLVVARFF  1515
             Y+CVRLHALFGA LA+GLV AR F
Sbjct  373   YFCVRLHALFGAALASGLVAARVF  396



>gb|KHG28696.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic 
-like protein [Gossypium arboreum]
Length=396

 Score =   263 bits (672),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = +3

Query  429   RWQESRRQCQHPRHFYSCRARHSDAINEEKEEN-ISRTTLIWRAVKLPIYSVALVPLTVG  605
             R    + +CQH +H +     H  A    +++N +S+ TLIWRA+KLPIYSVALVPLTVG
Sbjct  58    RIGRLKTRCQHQQHVFPNNIAHISADGTHQDQNDVSKATLIWRAIKLPIYSVALVPLTVG  117

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
              A AYLQ GLFS  RY+ LLASSVLIITWLNLSNDVYDFDTGADKNKKESVVN+V SR+G
Sbjct  118   GAVAYLQTGLFSARRYMTLLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNLVSSRSG  177

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
              LIAAY SL LGF GL WAS  + N+R++LLL  AI CGY+YQCPPFRLSYQGLGEPLCF
Sbjct  178   PLIAAYSSLALGFIGLTWASADARNMRSLLLLGCAIFCGYVYQCPPFRLSYQGLGEPLCF  237

Query  966   aafgpfattafYLLQSSTRLFVFL  1037
             AAFGPFATTAFYLL  STR  +F+
Sbjct  238   AAFGPFATTAFYLLLGSTREIIFV  261


 Score =   179 bits (455),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             +P++ T+LSASVLVGLTT+LILFCSHFHQ+++D AVGK SPLV++GT+ G+ VVK +V+ 
Sbjct  261   VPLTHTVLSASVLVGLTTTLILFCSHFHQVEEDIAVGKMSPLVKMGTERGSMVVKGAVLT  320

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYSL   LG  K LP   I+L  LT+P+G++V+++VE+NH+DK  IFMAKYYCVRLHALF
Sbjct  321   LYSLLFGLGLCKALPLTCIVLCALTLPIGKLVVNFVEENHKDKGMIFMAKYYCVRLHALF  380

Query  1474  GATLAAGLVVARFFAR  1521
             GA + AGLV AR   +
Sbjct  381   GAAMTAGLVSARILVK  396



>gb|AES90637.2| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Medicago truncatula]
Length=396

 Score =   248 bits (633),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +3

Query  504   INEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLI  683
             + EE +E+IS  TLIWRA+KLPIYSVALVPLTVGSAAAYLQ G+FS   Y  LLASS+L+
Sbjct  78    VGEEIQEDISMETLIWRAIKLPIYSVALVPLTVGSAAAYLQTGIFSAKCYFVLLASSILV  137

Query  684   ITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANL  863
             ITWLNLSNDVYDFDTG DKNKKESVVN+VGSRTG  I AY+ L LGF GL WA++++ N+
Sbjct  138   ITWLNLSNDVYDFDTGVDKNKKESVVNLVGSRTGIFIVAYLCLALGFVGLTWAAVEAGNI  197

Query  864   RAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSS  1016
             R++L L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYL+Q S
Sbjct  198   RSVLFLTCAIFCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATAAFYLVQGS  248


 Score =   192 bits (487),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSASVLVG TTSLILFCSHFHQ+D D+ VGK SPLVRLGT+ GAEVVKA+V++
Sbjct  256   FPLSGTVLSASVLVGFTTSLILFCSHFHQVDGDEEVGKLSPLVRLGTERGAEVVKAAVLS  315

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G +K LP   I L  LT+P+G +VI +V+ NH+DK KIFMAKY+CVRLHALF
Sbjct  316   LYALLVAFGLSKALPLTCIFLCALTLPIGNLVIKFVQDNHKDKDKIFMAKYFCVRLHALF  375

Query  1474  GATLAAGLVVAR  1509
             GA LA GLV+AR
Sbjct  376   GAALAFGLVLAR  387



>ref|XP_003608440.1| hypothetical protein MTR_4g094100 [Medicago truncatula]
Length=359

 Score =   248 bits (632),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +3

Query  504   INEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLI  683
             + EE +E+IS  TLIWRA+KLPIYSVALVPLTVGSAAAYLQ G+FS   Y  LLASS+L+
Sbjct  41    VGEEIQEDISMETLIWRAIKLPIYSVALVPLTVGSAAAYLQTGIFSAKCYFVLLASSILV  100

Query  684   ITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANL  863
             ITWLNLSNDVYDFDTG DKNKKESVVN+VGSRTG  I AY+ L LGF GL WA++++ N+
Sbjct  101   ITWLNLSNDVYDFDTGVDKNKKESVVNLVGSRTGIFIVAYLCLALGFVGLTWAAVEAGNI  160

Query  864   RAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSS  1016
             R++L L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYL+Q S
Sbjct  161   RSVLFLTCAIFCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATAAFYLVQGS  211


 Score =   192 bits (487),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSASVLVG TTSLILFCSHFHQ+D D+ VGK SPLVRLGT+ GAEVVKA+V++
Sbjct  219   FPLSGTVLSASVLVGFTTSLILFCSHFHQVDGDEEVGKLSPLVRLGTERGAEVVKAAVLS  278

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G +K LP   I L  LT+P+G +VI +V+ NH+DK KIFMAKY+CVRLHALF
Sbjct  279   LYALLVAFGLSKALPLTCIFLCALTLPIGNLVIKFVQDNHKDKDKIFMAKYFCVRLHALF  338

Query  1474  GATLAAGLVVAR  1509
             GA LA GLV+AR
Sbjct  339   GAALAFGLVLAR  350



>ref|XP_007042907.1| UbiA prenyltransferase family protein [Theobroma cacao]
 gb|EOX98738.1| UbiA prenyltransferase family protein [Theobroma cacao]
Length=417

 Score =   259 bits (663),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 171/217 (79%), Gaps = 8/217 (4%)
 Frame = +3

Query  396   CTNRCNSWSALRWQ---ESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKL  566
             C+N  N +   R +    +RRQ   P+    C A  SD+  +E E+++S+ TLIWRA+KL
Sbjct  71    CSNDQNFFQIRRIRIRCPTRRQHIFPK----CTADISDSPCQE-EKDVSKATLIWRAIKL  125

Query  567   PIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNK  746
             PIYSVALVPLTVG + AYLQ GLFSV RYL LLASSVLIITW+NLSNDVYDFD GADKNK
Sbjct  126   PIYSVALVPLTVGGSVAYLQTGLFSVRRYLMLLASSVLIITWINLSNDVYDFDIGADKNK  185

Query  747   KESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPF  926
             KESVVN+VGSR+G  IAAY+SL LGF GL W S  + ++R++LLLA AITCGYIYQCPPF
Sbjct  186   KESVVNLVGSRSGPFIAAYLSLALGFMGLTWVSADAGSMRSLLLLACAITCGYIYQCPPF  245

Query  927   RLSYQGLGEPLCfaafgpfattafYLLQSSTRLFVFL  1037
             RLSYQGLGEPLCFAAFGPFATTAFYLL  ST   +FL
Sbjct  246   RLSYQGLGEPLCFAAFGPFATTAFYLLLGSTSEIIFL  282


 Score =   179 bits (455),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP++ T LSAS+LVG+TT+LILFCSHFHQI++D AVGK SPLVR+GT+  + VVK +++ 
Sbjct  282   LPLTRTALSASLLVGVTTTLILFCSHFHQIEEDMAVGKMSPLVRMGTERASVVVKGAILT  341

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY++   LGF + LP   ++   LT+P+G++V+SYVE+NH+DK KIF+AKYYCVRLHALF
Sbjct  342   LYAVLFALGFCRALPLTCVVFCALTLPIGKLVVSYVEENHKDKGKIFIAKYYCVRLHALF  401

Query  1474  GATLAAGLVVARFFAR  1521
             GA + AGLV AR  A+
Sbjct  402   GAAMTAGLVYARMLAK  417



>ref|XP_004504820.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Cicer arietinum]
Length=393

 Score =   248 bits (634),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 171/246 (70%), Gaps = 15/246 (6%)
 Frame = +3

Query  282   NYCYFHNQGHSFSRLTKFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRRQCQH  461
             N+ ++  + H  S+ +K    +  VL               RC     ++ +  R  C  
Sbjct  17    NHLFYFKRCHFISKSSKCTINVEKVLHR-------------RCRGKLQVQRRHQRVCCNG  63

Query  462   PRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFS  641
                  S  +R  D + EE EE+IS  TLIWRA+KLPIYSVALVPLTVGSAAAYLQ G+FS
Sbjct  64    IVELTS-SSRFED-VGEEIEEDISMETLIWRAIKLPIYSVALVPLTVGSAAAYLQTGMFS  121

Query  642   VTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELG  821
                Y  LLASSVL+ITWLNLSNDVYDFDTG DKNKKESVVN+VGSRTG  + +Y+ L LG
Sbjct  122   AKCYFVLLASSVLVITWLNLSNDVYDFDTGVDKNKKESVVNLVGSRTGIFVVSYLCLALG  181

Query  822   FCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafY  1001
             F GL WA++++ N R++L L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFY
Sbjct  182   FAGLSWAAVEARNTRSVLFLTCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFY  241

Query  1002  LLQSST  1019
             L+Q S+
Sbjct  242   LVQGSS  247


 Score =   189 bits (481),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ+D DK VGK SPLVRLGT+ GAEVVK +V+ 
Sbjct  253   FPLSGTVLSASILVGFTTSLILFCSHFHQVDGDKEVGKLSPLVRLGTEKGAEVVKVAVLM  312

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G +K LP   I L  LT+P+G +V+ +V+ NH+DK KIFMAKY+CVRLHALF
Sbjct  313   LYALLVAFGLSKILPLTCIFLCALTLPVGNLVVRFVQDNHKDKNKIFMAKYFCVRLHALF  372

Query  1474  GATLAAGLVVAR  1509
             GA LA GLV+AR
Sbjct  373   GAALAFGLVLAR  384



>gb|EYU18456.1| hypothetical protein MIMGU_mgv1a007846mg [Erythranthe guttata]
Length=393

 Score =   230 bits (586),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +3

Query  420   SALRWQESRRQCQHPRHFYSCRARHS---DAINEEKE-ENISRTTLIWRAVKLPIYSVAL  587
             +  R    +      R+    + R S   D I  EKE  NIS+ TLIWRAVKLP+Y+VA 
Sbjct  43    NVFRLDARKLHSIQRRYIIPLKPRASSNEDHIQHEKEVNNISKATLIWRAVKLPMYTVAF  102

Query  588   VPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNI  767
             +P++VGSAAAYLQ G +   RY  LL SSVL+I WLNLSNDVYDFDTGADKNKKESVVN+
Sbjct  103   IPISVGSAAAYLQTGKYFAKRYFVLLVSSVLVIAWLNLSNDVYDFDTGADKNKKESVVNL  162

Query  768   VGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGL  947
             +GSRTG  + A++ L +GF GL   S+++ ++R+ILLLA A+ CGYIYQCPPFRLSY GL
Sbjct  163   LGSRTGAHVIAWLLLGIGFTGLTLVSIEAKSIRSILLLACAVVCGYIYQCPPFRLSYMGL  222

Query  948   GEPLCfaafgpfattafYLLQS  1013
             GEPLCFAAFGP ATTAFYLLQS
Sbjct  223   GEPLCFAAFGPLATTAFYLLQS  244


 Score =   202 bits (515),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP+SGTI+S+S+LVGLTTSLIL CSHFHQI+DDKAVGK SPLVRLGT+ GA+VV  
Sbjct  245   GRSELPVSGTIVSSSILVGLTTSLILLCSHFHQIEDDKAVGKISPLVRLGTERGAKVVNV  304

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             +V  LYSL  +LG  +TLP  S++L  LT+P+GR+V S+VEKNH+D+TKIFMAKYYCVRL
Sbjct  305   AVGLLYSLVFLLGLNQTLPFFSLVLCALTLPVGRLVSSFVEKNHKDETKIFMAKYYCVRL  364

Query  1462  HALFGATLAAGLVVARFFARN  1524
             H +FG  LAAG+V AR FAR 
Sbjct  365   HTVFGGALAAGMVAARMFARR  385



>gb|EYU18457.1| hypothetical protein MIMGU_mgv1a007846mg [Erythranthe guttata]
Length=385

 Score =   229 bits (585),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +3

Query  420   SALRWQESRRQCQHPRHFYSCRARHS---DAINEEKE-ENISRTTLIWRAVKLPIYSVAL  587
             +  R    +      R+    + R S   D I  EKE  NIS+ TLIWRAVKLP+Y+VA 
Sbjct  35    NVFRLDARKLHSIQRRYIIPLKPRASSNEDHIQHEKEVNNISKATLIWRAVKLPMYTVAF  94

Query  588   VPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNI  767
             +P++VGSAAAYLQ G +   RY  LL SSVL+I WLNLSNDVYDFDTGADKNKKESVVN+
Sbjct  95    IPISVGSAAAYLQTGKYFAKRYFVLLVSSVLVIAWLNLSNDVYDFDTGADKNKKESVVNL  154

Query  768   VGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGL  947
             +GSRTG  + A++ L +GF GL   S+++ ++R+ILLLA A+ CGYIYQCPPFRLSY GL
Sbjct  155   LGSRTGAHVIAWLLLGIGFTGLTLVSIEAKSIRSILLLACAVVCGYIYQCPPFRLSYMGL  214

Query  948   GEPLCfaafgpfattafYLLQS  1013
             GEPLCFAAFGP ATTAFYLLQS
Sbjct  215   GEPLCFAAFGPLATTAFYLLQS  236


 Score =   202 bits (515),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP+SGTI+S+S+LVGLTTSLIL CSHFHQI+DDKAVGK SPLVRLGT+ GA+VV  
Sbjct  237   GRSELPVSGTIVSSSILVGLTTSLILLCSHFHQIEDDKAVGKISPLVRLGTERGAKVVNV  296

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             +V  LYSL  +LG  +TLP  S++L  LT+P+GR+V S+VEKNH+D+TKIFMAKYYCVRL
Sbjct  297   AVGLLYSLVFLLGLNQTLPFFSLVLCALTLPVGRLVSSFVEKNHKDETKIFMAKYYCVRL  356

Query  1462  HALFGATLAAGLVVARFFAR  1521
             H +FG  LAAG+V AR FAR
Sbjct  357   HTVFGGALAAGMVAARMFAR  376



>ref|XP_008382042.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Malus domestica]
Length=403

 Score =   248 bits (632),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 181/264 (69%), Gaps = 17/264 (6%)
 Frame = +3

Query  270   FSKVNYCYFHNQGHSFSRLTKFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRR  449
             F    +CY        S LTK +    S  P+  + +  C  C  +       R  E RR
Sbjct  4     FMATTFCYLPTG----SGLTKLNDYRVSKRPYRRFETLSCFSCNPQ--KVFPRREVEVRR  57

Query  450   QCQH--------PRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             Q QH           +YS    H +   E+KE +IS+ TL WRA+ LPIYSVAL+PLTVG
Sbjct  58    QWQHCGQAFVNNKSDYYSNTTIHQE---EDKEADISKATLTWRAIXLPIYSVALIPLTVG  114

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
             SAAAYLQ G+FS  RY  LL SSVLIITWLNLSNDVYDFDTGAD NKKESVVN+VGSRTG
Sbjct  115   SAAAYLQTGMFSAQRYSILLISSVLIITWLNLSNDVYDFDTGADINKKESVVNLVGSRTG  174

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
             TL++AY+ L LGF GL W S+++ ++RAILLL  A+TCGYIYQCPPFRLSY+GLGEPLCF
Sbjct  175   TLVSAYLLLALGFLGLAWVSVKAGSMRAILLLGCAVTCGYIYQCPPFRLSYKGLGEPLCF  234

Query  966   aafgpfattafYLLQSSTRLFVFL  1037
             AAFGPFATT FYLLQ STR  + L
Sbjct  235   AAFGPFATTGFYLLQGSTREXIHL  258


 Score =   185 bits (469),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP +G+ILS S+LVG+TT+LILFCSHFHQI+ D+AVGK SPLVRLGT+ G+ VVK +V  
Sbjct  258   LPFTGSILSLSLLVGITTALILFCSHFHQIEGDRAVGKISPLVRLGTERGSGVVKWAVTG  317

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY LT   G +  LP   I L  LT+P+ R+V+SYVE+NH DK KIFMAKYYCVRLH+LF
Sbjct  318   LYVLTFTFGLSSALPFTCIFLCCLTLPIARLVVSYVEENHXDKQKIFMAKYYCVRLHSLF  377

Query  1474  GATLAAGLVVARFFAR  1521
             G  LAAGLVV+R F +
Sbjct  378   GTALAAGLVVSRMFPK  393



>ref|XP_008455170.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Cucumis melo]
Length=404

 Score =   246 bits (629),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +3

Query  480   CRARHSDAINEEK-EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYL  656
             C+A   D++ +E  EE++   TLIWRA+KLPIYSVALVPL VGSAAAY Q+G FS   + 
Sbjct  74    CKAMEVDSMPQENGEEDVGMGTLIWRAIKLPIYSVALVPLMVGSAAAYFQSGNFSSRLFA  133

Query  657   ALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLV  836
              +LASSVLIITWLNLSND YDF TGADKNKKESVV +VGS TGTL+AAY  L LGF GL 
Sbjct  134   VILASSVLIITWLNLSNDAYDFSTGADKNKKESVVKLVGSPTGTLVAAYTFLALGFMGLT  193

Query  837   WASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSS  1016
             WASL++ NLR+IL LA +I CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS+
Sbjct  194   WASLEAGNLRSILFLAFSIVCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQSN  253

Query  1017  TRLFVFL  1037
              R   +L
Sbjct  254   ARAMRYL  260


 Score =   185 bits (470),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LPIS TILSAS+LVG TT+LILFCSHFHQ++ D+AVGK SPLVRLGT+ G++VVK +V+ 
Sbjct  260   LPISNTILSASILVGTTTTLILFCSHFHQVEGDRAVGKMSPLVRLGTERGSKVVKVAVIM  319

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY L   LG +K LP   I+   LT+P+G++V+S+VE+NH+DK KIFMAKY+CVRLHA+F
Sbjct  320   LYVLLFALGLSKNLPFTCILFCGLTVPVGKLVVSFVEENHKDKQKIFMAKYFCVRLHAIF  379

Query  1474  GATLAAGLVVAR  1509
             G  LAAG VVAR
Sbjct  380   GLALAAGFVVAR  391



>ref|XP_008237282.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Prunus mume]
Length=401

 Score =   248 bits (633),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 184/249 (74%), Gaps = 3/249 (1%)
 Frame = +3

Query  300   NQGHSFSRLTKFDFA-INSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRRQCQH-PRHF  473
             N G   ++L ++    I S   +  Y    C  C  +       R +   RQ Q+  + F
Sbjct  9     NTGSGLTKLNEYHLKQIVSKRSYGGYGRLSCFSCNAQRVFHRVCRKKLEARQWQYCGQAF  68

Query  474   YSCRARHSDAINEE-KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTR  650
              + +A +S+ I+EE KEE IS+ TLIWRAVKLPIYSVALVPLTVGSAAAYLQ G+FS   
Sbjct  69    VNNKAGYSNTIHEENKEEPISKATLIWRAVKLPIYSVALVPLTVGSAAAYLQTGMFSAWH  128

Query  651   YLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCG  830
             Y  LL SSVLIITWLNLSNDVYDFDTGADK+KKESVVN+VGSRTGTL+AAY+ L LGF G
Sbjct  129   YSVLLVSSVLIITWLNLSNDVYDFDTGADKDKKESVVNLVGSRTGTLVAAYLLLALGFLG  188

Query  831   LVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQ  1010
             L W S ++ N+RAILLLA AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQ
Sbjct  189   LAWVSFEAGNMRAILLLACAIMCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQ  248

Query  1011  SSTRLFVFL  1037
              STR  + L
Sbjct  249   GSTREMIHL  257


 Score =   182 bits (462),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP +G+ILSAS+L+G+TT+LILFCSHFHQI+ D+AVGK SPLVRLGTK G  VVK +V+ 
Sbjct  257   LPFTGSILSASLLIGITTALILFCSHFHQIEGDRAVGKMSPLVRLGTKRGLVVVKLAVIG  316

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY LT   G +  LP   + L  LT+P+ R+V+ YVE+NH DK KIFMAKYYCVRLH+LF
Sbjct  317   LYVLTFTFGLSSALPFTCVFLCALTLPIARLVVGYVEENHNDKHKIFMAKYYCVRLHSLF  376

Query  1474  GATLAAGLVVAR  1509
             GA LAAGLV+ R
Sbjct  377   GAALAAGLVLPR  388



>ref|XP_004136884.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004155434.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Cucumis sativus]
 gb|KGN43741.1| hypothetical protein Csa_7G064030 [Cucumis sativus]
Length=404

 Score =   243 bits (619),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +3

Query  480   CRARHSDAINEEK-EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYL  656
             C+A   D++ +E  EE++    LIWRA+KLPIYSVALVPL VGSAAAY Q+G FS   + 
Sbjct  74    CKAMEVDSMPQENGEEDVGMGILIWRAIKLPIYSVALVPLMVGSAAAYFQSGNFSSRLFA  133

Query  657   ALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLV  836
              +LASSVLII+WLNLSND YDF TGADKNKKESVV +VGS TGTL+AAY  L LGF GL 
Sbjct  134   VILASSVLIISWLNLSNDAYDFSTGADKNKKESVVKLVGSPTGTLVAAYTFLALGFMGLT  193

Query  837   WASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSS  1016
             WASL++ NLR+IL LA +I CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS+
Sbjct  194   WASLEAGNLRSILFLAFSIVCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQSN  253

Query  1017  TR  1022
              R
Sbjct  254   AR  255


 Score =   187 bits (475),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LPIS TILSAS+LVG TT+LILFCSHFHQ++ D+AVGK SPLVRLGT+ G++VVK +V+ 
Sbjct  260   LPISNTILSASILVGTTTTLILFCSHFHQVEGDRAVGKMSPLVRLGTERGSKVVKVAVIM  319

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY L   LG +K LP   I+   LTIP+G++V+S+VE+NH+DK KIFMAKY+CVRLHA+F
Sbjct  320   LYVLLFALGLSKNLPFTCILFCGLTIPVGKLVVSFVEENHKDKQKIFMAKYFCVRLHAIF  379

Query  1474  GATLAAGLVVAR  1509
             G  LAAGLVVAR
Sbjct  380   GLALAAGLVVAR  391



>ref|XP_006492626.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=365

 Score =   244 bits (624),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +3

Query  411   NSWSALRWQESRRQCQHPRHFYSCRARHSDAINEE-KEENISRTTLIWRAVKLPIYSVAL  587
              S+   R  E ++QC H       +A  S +++ +  EE++SR TLIWRA+KLPIYSVAL
Sbjct  12    QSYVTRRELEFKQQCHHALFRSKDKADFSSSMHHQANEEDVSRATLIWRAIKLPIYSVAL  71

Query  588   VPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNI  767
             VPLTVGSAAAYLQ G+FS  RY  LL SSVLIITWLNLSNDVYDFDTGADKNK ESVVN+
Sbjct  72    VPLTVGSAAAYLQTGMFSARRYFVLLISSVLIITWLNLSNDVYDFDTGADKNKTESVVNL  131

Query  768   VGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGL  947
             VGSRTGTL+AAY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQGL
Sbjct  132   VGSRTGTLVAAYLLLVLGFVGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQGL  191

Query  948   GEPLCfaafgpfattafYLLQSSTR  1022
             GEPLCFAAFGPFATTAFYLL  STR
Sbjct  192   GEPLCFAAFGPFATTAFYLLLGSTR  216


 Score =   185 bits (469),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  211   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  270

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  271   SVVVKWAVMTLYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  330

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVRLHALFGA L AGL+ AR
Sbjct  331   YYCVRLHALFGAALVAGLITAR  352



>ref|XP_007200196.1| hypothetical protein PRUPE_ppa016004mg [Prunus persica]
 gb|EMJ01395.1| hypothetical protein PRUPE_ppa016004mg [Prunus persica]
Length=401

 Score =   243 bits (620),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 173/219 (79%), Gaps = 2/219 (1%)
 Frame = +3

Query  387   CIGCTNRCNSWSALRWQESRRQCQH-PRHFYSCRARHSDAINEE-KEENISRTTLIWRAV  560
             C  C  +       R +   +Q Q+  + F + +A +S+ I EE KE +IS+TTLIWRA+
Sbjct  39    CFSCNAQRVFHRVCRRELEAKQWQYCGQAFVNNKADYSNTIREENKEVDISKTTLIWRAI  98

Query  561   KLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADK  740
             KLPIYSVALVPLTVGSAAAYLQ G+FS   Y  LL SSVLIITWLNLSNDVYDFDTGADK
Sbjct  99    KLPIYSVALVPLTVGSAAAYLQTGMFSAWHYSVLLVSSVLIITWLNLSNDVYDFDTGADK  158

Query  741   NKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCP  920
             +KKESVVN+VGSRTGTL+AAY+ L LGF GL W S ++ N+RAILLLA AI CGYIYQCP
Sbjct  159   DKKESVVNLVGSRTGTLVAAYLLLALGFLGLAWVSFEAGNMRAILLLACAIMCGYIYQCP  218

Query  921   PFRLSYQGLGEPLCfaafgpfattafYLLQSSTRLFVFL  1037
             PFRLSYQGLGEPLCFAAFGPFATTAFYLLQ STR  V L
Sbjct  219   PFRLSYQGLGEPLCFAAFGPFATTAFYLLQGSTREMVHL  257


 Score =   185 bits (470),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LPI+G+ILS+S+L+G+TT+LILFCSHFHQI+ DKAVGK SPLVRLGTK G  VVK +++ 
Sbjct  257   LPITGSILSSSLLIGITTALILFCSHFHQIEGDKAVGKMSPLVRLGTKRGLVVVKLAIIG  316

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY LT   G +  LP   I L  LT+P+ R+V+SYVE+NH DK KIFMAKYYCVRLH+LF
Sbjct  317   LYVLTFTFGLSSALPFTCIFLCALTLPIARLVVSYVEENHNDKHKIFMAKYYCVRLHSLF  376

Query  1474  GATLAAGLVVAR  1509
             GA LAAGLV+ R
Sbjct  377   GAALAAGLVLPR  388



>ref|XP_003543928.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Glycine max]
Length=397

 Score =   247 bits (631),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  495   SDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASS  674
             ++ + EE EE+IS+ TLIWRA+KLPIYSVA VPLTVGSAAAYLQ G+FS   Y  LLASS
Sbjct  75    NEDVGEESEEDISKETLIWRAIKLPIYSVAFVPLTVGSAAAYLQTGIFSARCYFVLLASS  134

Query  675   VLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQS  854
             VL+ITWLNLSNDVYDFDTG DKNKKESVVN+VGSR G  IAAY  L LGF GL W ++  
Sbjct  135   VLVITWLNLSNDVYDFDTGVDKNKKESVVNMVGSRKGIFIAAYSCLALGFLGLTWTAVVE  194

Query  855   ANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTRL  1025
              NLR+IL L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL +S R+
Sbjct  195   RNLRSILFLVCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHASARV  251


 Score =   181 bits (459),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  1117  PISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMAL  1296
             P+SGT+LSAS+LVG TTSLILFCSHFHQ++ DK VGK SPLVRLG K GAEVVK +V  L
Sbjct  256   PLSGTVLSASILVGFTTSLILFCSHFHQVEGDKEVGKMSPLVRLGNKKGAEVVKGAVFML  315

Query  1297  YSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFG  1476
             Y+L +  G  K LP   I L  LT+P+G +V+ +VE N++DK KIFMAKY+CVRLHA+FG
Sbjct  316   YALLVAFGLIKALPLTCISLCTLTLPLGNLVVRFVEDNYKDKNKIFMAKYFCVRLHAMFG  375

Query  1477  ATLAAGLVVAR  1509
               LA GLV+AR
Sbjct  376   VALALGLVLAR  386



>ref|XP_006492625.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X1 [Citrus sinensis]
Length=392

 Score =   243 bits (621),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  429   RWQESRRQCQHPRHFYSCRARHSDAINEE-KEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             R  E ++QC H       +A  S +++ +  EE++SR TLIWRA+KLPIYSVALVPLTVG
Sbjct  45    RELEFKQQCHHALFRSKDKADFSSSMHHQANEEDVSRATLIWRAIKLPIYSVALVPLTVG  104

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
             SAAAYLQ G+FS  RY  LL SSVLIITWLNLSNDVYDFDTGADKNK ESVVN+VGSRTG
Sbjct  105   SAAAYLQTGMFSARRYFVLLISSVLIITWLNLSNDVYDFDTGADKNKTESVVNLVGSRTG  164

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
             TL+AAY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQGLGEPLCF
Sbjct  165   TLVAAYLLLVLGFVGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQGLGEPLCF  224

Query  966   aafgpfattafYLLQSSTR  1022
             AAFGPFATTAFYLL  STR
Sbjct  225   AAFGPFATTAFYLLLGSTR  243


 Score =   185 bits (469),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  238   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  297

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  298   SVVVKWAVMTLYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  357

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVRLHALFGA L AGL+ AR
Sbjct  358   YYCVRLHALFGAALVAGLITAR  379



>ref|XP_009349445.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009349446.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Pyrus x bretschneideri]
Length=404

 Score =   246 bits (627),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 177/233 (76%), Gaps = 15/233 (6%)
 Frame = +3

Query  372   YRSFCCIGCTNRCNSWSA-LRWQ-ESRRQCQH--------PRHFYSCRARHSDAINEEKE  521
             YR F  + C + CN+    LR + E+RRQ Q+           +YS    H +   E+KE
Sbjct  31    YRGFATLSCFS-CNARKVFLRSEAEARRQWQYCGQAFVNNKSDYYSNTTIHQE---EDKE  86

Query  522   E-NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
             E +IS+ TL WRA+KLPIYSVAL+PLTVGSAAAYLQ G+FS  RY  LL SSVLIITWLN
Sbjct  87    EADISKATLTWRAIKLPIYSVALIPLTVGSAAAYLQTGMFSAQRYSILLISSVLIITWLN  146

Query  699   LSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILL  878
             LSNDVYDFDTGAD NKKESVVN+VGSRTGTL++AY+ L LGF GL W S+++ N+RAILL
Sbjct  147   LSNDVYDFDTGADINKKESVVNLVGSRTGTLVSAYLLLALGFLGLAWVSVKAGNMRAILL  206

Query  879   LASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTRLFVFL  1037
             L  A+ CGYIYQCPPFRLSY+GLGEPLCFAAFGPFATT FYLLQ STR  + L
Sbjct  207   LGCAVICGYIYQCPPFRLSYKGLGEPLCFAAFGPFATTGFYLLQGSTREVIHL  259


 Score =   181 bits (459),  Expect(2) = 7e-110, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP + +ILS S+LVG+TT+LILFCSHFHQI+ D+AVGK SPLVRLGT+ G+ VVK +V  
Sbjct  259   LPFTSSILSVSLLVGITTALILFCSHFHQIEGDRAVGKISPLVRLGTERGSGVVKWAVTG  318

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY LT   G +  LP   + L  LT+P+ R+V+SYVE+NH DK KIFMAKYYCVRLH+LF
Sbjct  319   LYVLTFTFGLSSALPFTCLFLCCLTLPISRLVVSYVEENHNDKQKIFMAKYYCVRLHSLF  378

Query  1474  GATLAAGLVVARFFAR  1521
             G  LAAGLV++R F +
Sbjct  379   GTALAAGLVMSRMFPK  394



>ref|XP_010690535.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=397

 Score =   238 bits (606),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +3

Query  480   CRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLA  659
             C  ++ D   +++ +++SR TLIWRA+KLPIYSVA+VPLTV SA+AYLQ G FS+ RYL 
Sbjct  68    CEKKNPDYSCDQENKDVSRATLIWRAIKLPIYSVAVVPLTVASASAYLQTGQFSMLRYLG  127

Query  660   LLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVW  839
             LL SS+ IITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL+AA + L  GF GL  
Sbjct  128   LLISSIFIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLVAANLLLAFGFVGLTG  187

Query  840   ASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQ  1010
              +L + N+R++LLL  A+ CGY+YQCPPFRLSYQGLGEPLCFA+FGPFATTAFY++Q
Sbjct  188   LALVAGNVRSLLLLLCAVMCGYVYQCPPFRLSYQGLGEPLCFASFGPFATTAFYMMQ  244


 Score =   183 bits (465),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = +1

Query  1117  PISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMAL  1296
             P++ T+LSAS+LVG TT+LILFCSHFHQ++ D+AVGK+SPLVR+G K G+EVVK S++AL
Sbjct  255   PLTTTVLSASLLVGCTTTLILFCSHFHQVEGDRAVGKFSPLVRVGQKAGSEVVKISIVAL  314

Query  1297  YSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFG  1476
             Y    +L     LP    +   LTIPMG MV+SYVEKN+ D  KIFMAKYYCVRLHALFG
Sbjct  315   YGALFVLSLGSALPLTCTVFCALTIPMGNMVVSYVEKNYHDNEKIFMAKYYCVRLHALFG  374

Query  1477  ATLAAGLVVARFFARNYNMR  1536
               L AGLV AR F  NY  R
Sbjct  375   VALTAGLVAARRFG-NYTPR  393



>ref|XP_010417994.1| PREDICTED: LOW QUALITY PROTEIN: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Camelina sativa]
Length=380

 Score =   243 bits (621),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   HSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLAS  671
             + DA    +EE I +  LIWRA+KLPIYSVALVPLTVG++AAYL+ GLF   RY  L+ S
Sbjct  68    YGDAAKVYQEEEIPKAKLIWRAIKLPIYSVALVPLTVGASAAYLETGLFVARRYATLMLS  127

Query  672   SVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQ  851
             S+LIITWLNLSNDVYDFDTGADKNKKESVVN++GSR GTL AA  SL LG  G+VW SL 
Sbjct  128   SILIITWLNLSNDVYDFDTGADKNKKESVVNLLGSRAGTLAAAITSLVLGVAGIVWTSLN  187

Query  852   SANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++N+RAILLLASAI CGY+YQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  188   ASNIRAILLLASAILCGYVYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLLGSS  243


 Score =   177 bits (450),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  1117  PISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMAL  1296
             P+SG +LS+S+LVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  L
Sbjct  250   PLSGRVLSSSLLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWAIRLL  309

Query  1297  YSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFG  1476
             YS+ ++LG TK LP A  ++  LT+P+G +V SYVEK+H++  KIFMAKYYCVRLHALFG
Sbjct  310   YSMLLVLGLTKILPLACTLMCFLTLPVGNLVSSYVEKHHKENEKIFMAKYYCVRLHALFG  369

Query  1477  ATLAAGLVVA  1506
               L+ GLV+A
Sbjct  370   IALSLGLVIA  379



>ref|XP_004297559.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   241 bits (616),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  507   NEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLII  686
              +++EENIS+ TLIWRA+KLPIY VA +PLTVGSAAAY + G+FS  RY  L  SSVLII
Sbjct  72    KDKEEENISKATLIWRAIKLPIYFVAFIPLTVGSAAAYFETGIFSWWRYSLLSISSVLII  131

Query  687   TWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLR  866
             TWLNLSNDVYDFDTGADKNK ESVVN+VGSRTGT++AAY  L LGF GL W S ++ N+R
Sbjct  132   TWLNLSNDVYDFDTGADKNKLESVVNLVGSRTGTIVAAYALLVLGFMGLAWVSFEAGNMR  191

Query  867   AILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSS  1016
             AILLLA AI  GYIYQCPPFRLSYQGLGEPLCF+AFGPFATTAFYLLQ S
Sbjct  192   AILLLACAIIFGYIYQCPPFRLSYQGLGEPLCFSAFGPFATTAFYLLQGS  241


 Score =   176 bits (446),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP +G+ILSAS+LVG+TT+LILFCSHFHQI++D+AV K SPLVRLG+K G+ VV+ ++  
Sbjct  248   LPFTGSILSASLLVGITTTLILFCSHFHQIEEDRAVAKMSPLVRLGSKRGSGVVQLAIAG  307

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY L    G ++ LP   I     T+P+ R+V+SYV++NH DK KIFMAKY+CVRLH+LF
Sbjct  308   LYVLAFAFGISRALPITCIFFCAFTLPVARLVVSYVQENHNDKHKIFMAKYFCVRLHSLF  367

Query  1474  GATLAAGLVVAR  1509
             G  LAAGLVVAR
Sbjct  368   GVALAAGLVVAR  379



>ref|XP_010473237.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X1 [Camelina sativa]
Length=377

 Score =   240 bits (612),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   HSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLAS  671
             + DA    +EE I +  LIWRA+KLPIYSVALVPLTVG++AAYL+ G F   RY  L+ S
Sbjct  65    YGDAAKVYQEEEIPKAKLIWRAIKLPIYSVALVPLTVGASAAYLETGFFLARRYATLMLS  124

Query  672   SVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQ  851
             S+LII WLNLSNDVYDFDTGADKNKKESVVN++GSR GTL AA  SL LG  G+VW SL 
Sbjct  125   SILIINWLNLSNDVYDFDTGADKNKKESVVNLLGSRAGTLAAAITSLVLGVAGIVWTSLN  184

Query  852   SANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++N+RAILLLASAI CGY+YQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  185   ASNIRAILLLASAILCGYVYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLLGSS  240


 Score =   177 bits (450),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+S+LVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  
Sbjct  246   LPLSGRVLSSSLLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWAIRL  305

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS+ ++LG TK LP    ++  LT+P+G +V SYVEK+H++  KIFMAKYYCVRLHALF
Sbjct  306   LYSMLLVLGLTKILPLPCTLMCFLTLPVGNLVSSYVEKHHKENEKIFMAKYYCVRLHALF  365

Query  1474  GATLAAGLVVA  1506
             G  L+ GLV+A
Sbjct  366   GTALSFGLVIA  376



>ref|XP_010473238.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=376

 Score =   239 bits (611),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   HSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLAS  671
             + DA    +EE I +  LIWRA+KLPIYSVALVPLTVG++AAYL+ G F   RY  L+ S
Sbjct  64    YGDAAKVYQEEEIPKAKLIWRAIKLPIYSVALVPLTVGASAAYLETGFFLARRYATLMLS  123

Query  672   SVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQ  851
             S+LII WLNLSNDVYDFDTGADKNKKESVVN++GSR GTL AA  SL LG  G+VW SL 
Sbjct  124   SILIINWLNLSNDVYDFDTGADKNKKESVVNLLGSRAGTLAAAITSLVLGVAGIVWTSLN  183

Query  852   SANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++N+RAILLLASAI CGY+YQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  184   ASNIRAILLLASAILCGYVYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLLGSS  239


 Score =   177 bits (450),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+S+LVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  
Sbjct  245   LPLSGRVLSSSLLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWAIRL  304

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS+ ++LG TK LP    ++  LT+P+G +V SYVEK+H++  KIFMAKYYCVRLHALF
Sbjct  305   LYSMLLVLGLTKILPLPCTLMCFLTLPVGNLVSSYVEKHHKENEKIFMAKYYCVRLHALF  364

Query  1474  GATLAAGLVVA  1506
             G  L+ GLV+A
Sbjct  365   GTALSFGLVIA  375



>ref|XP_010520880.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=402

 Score =   253 bits (646),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 161/198 (81%), Gaps = 2/198 (1%)
 Frame = +3

Query  426   LRWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             L   E RRQ + P  F S R    +   ++KEE++S+ TLIWRAVKLPIY VALVPLTVG
Sbjct  55    LNIDERRRQGR-PIVFRS-RGNTVEMCGDDKEEDVSKATLIWRAVKLPIYFVALVPLTVG  112

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
              AAAYL+ G FS  RYL LL SSVL ITWLNLSNDVYDFDTGADKNKKESVVN+VGSRTG
Sbjct  113   GAAAYLETGSFSAGRYLTLLVSSVLTITWLNLSNDVYDFDTGADKNKKESVVNLVGSRTG  172

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
             TLIAA++ L LG  GL W S+++ N+RAI+LLASAI CGYIYQCPPFRLSY GLGEPLCF
Sbjct  173   TLIAAFILLVLGGAGLSWISMEARNIRAIMLLASAIFCGYIYQCPPFRLSYHGLGEPLCF  232

Query  966   aafgpfattafYLLQSST  1019
             AAFGPFATTAFYLL +S+
Sbjct  233   AAFGPFATTAFYLLLASS  250


 Score =   161 bits (408),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+AS    S +P++G ILSAS LVG TTSLIL CSHFHQ++ D AVGK SPLVR+GT+ G
Sbjct  246   LLASSSQTSHVPLNGRILSASFLVGFTTSLILLCSHFHQVESDLAVGKLSPLVRVGTERG  305

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             A+VVK+ V++LYSL ++LG T+ LP    ++  LT+PMG +V SYVEKNH+DK KIFMAK
Sbjct  306   AKVVKSVVVSLYSLLLVLGLTRILPLTCTLMCFLTLPMGILVTSYVEKNHKDKGKIFMAK  365

Query  1444  YYCVRLHALFGATLAAGLVVARFFARNY  1527
             YYCVRLHALFGA L+ GLV AR   R Y
Sbjct  366   YYCVRLHALFGAALSIGLVAARPINRVY  393



>ref|XP_003532605.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X1 [Glycine max]
Length=398

 Score =   229 bits (583),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  525   NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +IS+ TLIWRA+KLPIYSVA VPLTVGSAA Y Q G+FS   Y  LLASSVL ITWLNLS
Sbjct  86    DISKETLIWRAIKLPIYSVAFVPLTVGSAAVYFQTGIFSARCYFVLLASSVLAITWLNLS  145

Query  705   NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
             NDVYDFDTG DKNKKESVVN+ GSR GT IAAY+ L +GF GL W ++   N+R+IL L 
Sbjct  146   NDVYDFDTGVDKNKKESVVNLAGSRKGTFIAAYLCLAIGFLGLTWTAVVERNIRSILFLV  205

Query  885   SAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  206   CAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  250


 Score =   185 bits (469),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ DK VGK SPLVRLGTK GAEVVK +V  
Sbjct  256   FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDKEVGKMSPLVRLGTKKGAEVVKGAVFM  315

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G  K LP   I L  LT+PMG +V+ +VE N+++K KIFMAKY+CVRLHALF
Sbjct  316   LYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYKNKNKIFMAKYFCVRLHALF  375

Query  1474  GATLAAGLVVAR  1509
             G  LA GLV+AR
Sbjct  376   GVALALGLVLAR  387



>ref|XP_010917309.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=378

 Score =   233 bits (594),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = +3

Query  429   RWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGS  608
             +W  + R+   P    S      +   E   + ISR TL+WRA KLPIYSVALVPLTVGS
Sbjct  37    KWAVTARKPWPPLWPRSSSQPTPEVALEGDADKISRATLLWRAAKLPIYSVALVPLTVGS  96

Query  609   AAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGT  788
             AAAYLQ G+F   RY  LL++S+L+ITWLNLSNDVYDFDTGAD++KKESVVNI+GSRT T
Sbjct  97    AAAYLQTGIFFAKRYFVLLSASMLVITWLNLSNDVYDFDTGADRHKKESVVNIIGSRTVT  156

Query  789   LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfa  968
               AA +SL LGF GL+WA  ++ ++R ILL+A AI CGY+YQCPPFRLSYQGLGEPLCFA
Sbjct  157   QYAANISLVLGFMGLIWAFTEAGDIRFILLVAYAIACGYVYQCPPFRLSYQGLGEPLCFA  216

Query  969   afgpfattafYLLQSSTRL  1025
             AFGPFATTAFY   SS  L
Sbjct  217   AFGPFATTAFYFANSSKYL  235


 Score =   181 bits (458),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++GT+LSASVLVGLTT+LILFCSHFHQID D+AVGK SPLVR+GT+ G++VV+ 
Sbjct  238   GISHLPLTGTVLSASVLVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTRAGSKVVRF  297

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              +++LY L +  G  K LP   + L  LT+PMG++V+ YV++NH D  KIFMAKYYCVRL
Sbjct  298   GIISLYFLLLAFGSCKALPLTCLFLCALTLPMGKIVVDYVKENHNDNGKIFMAKYYCVRL  357

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GL +AR
Sbjct  358   HALFGMALALGLWLAR  373



>ref|XP_010267186.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=404

 Score =   258 bits (660),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 2/200 (1%)
 Frame = +3

Query  417   WSALRWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPL  596
             WS  ++   RR+        S   ++ +A+   KE+ ISR TLIWRA+KLPIYSVA+VPL
Sbjct  56    WSKDKFCHWRREAYESEEGRSFTTQNEEAV--PKEDEISRATLIWRAIKLPIYSVAIVPL  113

Query  597   TVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGS  776
             TVGSA AYLQ GLF   RYL LL SSV IITWLNLSNDVYDFDTGADKNKKESVVN+V S
Sbjct  114   TVGSAVAYLQTGLFFARRYLMLLFSSVFIITWLNLSNDVYDFDTGADKNKKESVVNMVDS  173

Query  777   RTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEP  956
             RTGTL++AY+ L +GF GL WAS+++ N+R+ILLL  AITCGYIYQCPPFRLSYQGLGEP
Sbjct  174   RTGTLVSAYMLLVIGFMGLTWASVEAGNIRSILLLICAITCGYIYQCPPFRLSYQGLGEP  233

Query  957   LCfaafgpfattafYLLQSS  1016
             LCFAAFGPFATTAFYLLQSS
Sbjct  234   LCFAAFGPFATTAFYLLQSS  253


 Score =   153 bits (387),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP++GTILSAS+LVG TTSLILFCSHFHQ+D D++VGK SPLVR+GTK G+ VVK +++ 
Sbjct  260   LPLTGTILSASLLVGFTTSLILFCSHFHQVDGDRSVGKISPLVRIGTKKGSLVVKVAIVT  319

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY L   LG +K LP   I+L  LT+P+G++V+SYVE+NH D  KIFMAKYYCVRLHALF
Sbjct  320   LYLLLFTLGLSKALPLTCILLCALTLPIGKLVVSYVEENHTDSNKIFMAKYYCVRLHALF  379

Query  1474  GATLAAGLVVARFFARNYNMRP  1539
             GA LAAGLV  R  A+ Y  +P
Sbjct  380   GAALAAGLVATRTVAKAYVPKP  401



>ref|NP_001117518.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Arabidopsis 
thaliana]
 sp|Q0WUA3.2|MENA_ARATH RecName: Full=1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic; AltName: Full=1,4-dihydroxy-2-naphthoate phytyltransferase; 
AltName: Full=Protein ABERRANT CHLOROPLAST 
DEVELOPMENT 4; AltName: Full=menA-like protein; Short=AtMENA; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33702.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Arabidopsis 
thaliana]
Length=382

 Score =   246 bits (629),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   HSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLAS  671
             + DA    +EE I R  LIWRA+KLP+YSVALVPLTVG++AAYL+ GLF   RY+ LL S
Sbjct  70    YGDAAKVYQEEEIPRAKLIWRAIKLPMYSVALVPLTVGASAAYLETGLFLARRYVTLLLS  129

Query  672   SVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQ  851
             S+LIITWLNLSNDVYDFDTGADKNK ESVVN+VGSRTGTL AA  SL LG  GLVW SL 
Sbjct  130   SILIITWLNLSNDVYDFDTGADKNKMESVVNLVGSRTGTLAAAITSLALGVSGLVWTSLN  189

Query  852   SANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++N+RAILLLASAI CGY+YQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  190   ASNIRAILLLASAILCGYVYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLLGSS  245


 Score =   159 bits (403),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+SVLVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  
Sbjct  251   LPLSGRVLSSSVLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWTIRL  310

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS+ ++LG T+ LP    ++  LT+P+G +V SYVEK+H+D  KIFMAKYYCVRLHAL 
Sbjct  311   LYSMLLVLGLTRILPLPCTLMCFLTLPVGNLVSSYVEKHHKDNGKIFMAKYYCVRLHALL  370

Query  1474  GATLAAGLVVAR  1509
             GA L+ GLV+AR
Sbjct  371   GAALSLGLVIAR  382



>ref|XP_006584972.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X2 [Glycine max]
Length=394

 Score =   218 bits (554),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 132/165 (80%), Gaps = 4/165 (2%)
 Frame = +3

Query  525   NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +IS+ TLIWRA+KLPIYSVA VPLTVGSAA Y Q G+FS   Y  LLASSVL ITWLNLS
Sbjct  86    DISKETLIWRAIKLPIYSVAFVPLTVGSAAVYFQTGIFSARCYFVLLASSVLAITWLNLS  145

Query  705   NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
             NDVYDFDTG DKNKKESVVN+     GT IAAY+ L +GF GL W ++   N+R+IL L 
Sbjct  146   NDVYDFDTGVDKNKKESVVNL----AGTFIAAYLCLAIGFLGLTWTAVVERNIRSILFLV  201

Query  885   SAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  202   CAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  246


 Score =   185 bits (469),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ DK VGK SPLVRLGTK GAEVVK +V  
Sbjct  252   FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDKEVGKMSPLVRLGTKKGAEVVKGAVFM  311

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G  K LP   I L  LT+PMG +V+ +VE N+++K KIFMAKY+CVRLHALF
Sbjct  312   LYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYKNKNKIFMAKYFCVRLHALF  371

Query  1474  GATLAAGLVVAR  1509
             G  LA GLV+AR
Sbjct  372   GVALALGLVLAR  383



>ref|XP_011087913.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Sesamum indicum]
Length=412

 Score =   206 bits (524),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LPIS T++ ASVLVGLTTSLILFCSHFHQI+DDKAVGK SPLVRLGT+ G+ VVK S++ 
Sbjct  268   LPISSTVIWASVLVGLTTSLILFCSHFHQIEDDKAVGKMSPLVRLGTEKGSLVVKWSIIG  327

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYSL + LGFT+TLP  S++LS LT+PMG +V+S+V+KNH DK KIFM KYYCVRLH +F
Sbjct  328   LYSLLLALGFTQTLPFTSVLLSALTLPMGNLVVSFVQKNHTDKRKIFMGKYYCVRLHTIF  387

Query  1474  GATLAAGLVVARFFARN  1524
             G  LAAGLVVAR FA+ 
Sbjct  388   GVALAAGLVVARMFAKQ  404


 Score =   192 bits (488),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 150/226 (66%), Gaps = 7/226 (3%)
 Frame = +3

Query  363   HSVYRSFCCIGCTNRCNSWSALRWQESRRQCQHPRHFYSCR------ARHSDAINEEKEE  524
             H+  R F     T RC   ++     S+ +  +  +   C       A   +A  EE  E
Sbjct  42    HAEQRPFSGCHWTQRCYGKASKLMLRSKLENAYNGNLVECSPVQAVAAVEKEAKAEEGGE  101

Query  525   NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
              ISR TLIWRA KLP+Y+VA +P+TVGSA AY Q GLFSV RY ALLAS +L+I W+NLS
Sbjct  102   -ISRATLIWRAFKLPMYTVAFIPVTVGSAVAYWQTGLFSVGRYFALLASYILVIAWVNLS  160

Query  705   NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
             NDVYDFDTGADKNKKES+VN+ GSRT   I A++ L LG  GL   ++++ N R+++ LA
Sbjct  161   NDVYDFDTGADKNKKESMVNLFGSRTAINIIAWLLLVLGVIGLSLVAVKAGNPRSMMFLA  220

Query  885   SAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTR  1022
             +A+   Y+YQCPPFRLSY G+GEPL F +FGPF+T  FYLL S  R
Sbjct  221   AAMFGFYLYQCPPFRLSYHGVGEPLLFISFGPFSTIPFYLLHSVKR  266



>ref|XP_010648174.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Vitis vinifera]
Length=392

 Score =   247 bits (630),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = +3

Query  435   QESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAA  614
              + R + +  R  + CR   S   N+E    IS+ TLIWRA+KLPIYSVALVPLTVGSAA
Sbjct  62    HDYRNRVKFKR--FECRVEDSYTNNKE----ISKGTLIWRAIKLPIYSVALVPLTVGSAA  115

Query  615   AYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLI  794
             AYLQ GLFS  +Y  LLASSVLII WLNLSNDVYDFDTGADKNKKESVVN+VGSRTGT  
Sbjct  116   AYLQTGLFSARQYFTLLASSVLIIAWLNLSNDVYDFDTGADKNKKESVVNMVGSRTGTHA  175

Query  795   AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaaf  974
             AAY  L LGF GL WAS+ + N RAILLLA A+TCGYIYQCPPFRLSYQGLGEPLCFAAF
Sbjct  176   AAYALLALGFVGLSWASMVAGNFRAILLLACAVTCGYIYQCPPFRLSYQGLGEPLCFAAF  235

Query  975   gpfattafYLLQSST  1019
             GPFATTAFYL+Q++T
Sbjct  236   GPFATTAFYLMQTAT  250


 Score =   151 bits (382),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  1084  LIASMLGDSILP-ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKT  1260
             L+ +   + I P ++ T+LSAS+LVG TT+LILFCSHFHQ++ D+AVGK SPLVRL T+ 
Sbjct  245   LMQTATSEMISPLVTATVLSASLLVGFTTTLILFCSHFHQVEGDRAVGKMSPLVRLDTEK  304

Query  1261  GAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMA  1440
             G+ +VK ++  LYSL +  G  KTLP   I    LTIPM ++V+SYVE NH+D +KIFMA
Sbjct  305   GSRIVKMAMAMLYSLLLAFGLAKTLPFTCIFSCALTIPMAKLVVSYVEDNHKDNSKIFMA  364

Query  1441  KYYCVR  1458
             KYYCVR
Sbjct  365   KYYCVR  370



>ref|XP_002886606.1| hypothetical protein ARALYDRAFT_475272 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62865.1| hypothetical protein ARALYDRAFT_475272 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   217 bits (552),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             +YSVALVPLTVG++AAYL+ GLF   RY+ L+ SS+LIITWLNLSNDVYDFDTGADKNKK
Sbjct  1     MYSVALVPLTVGASAAYLETGLFLARRYVTLMLSSILIITWLNLSNDVYDFDTGADKNKK  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
             ESVVN+VGSRTGTL AA  SL LG  GLVW SL ++N+RAILLLASAI CGY+YQCPPFR
Sbjct  61    ESVVNLVGSRTGTLAAAITSLVLGVSGLVWTSLNASNIRAILLLASAILCGYVYQCPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQSST  1019
             LSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  121   LSYQGLGEPLCFAAFGPFATTAFYLLLGSS  150


 Score =   181 bits (460),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+S+LVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  
Sbjct  156   LPLSGRVLSSSLLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWAIRL  215

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS+ ++LG ++ LP    ++  LT+P+G +V SYVEK+H+D  KIFMAKYYCVRLHALF
Sbjct  216   LYSMLLVLGLSRILPLPCTLMCFLTLPIGNLVSSYVEKHHKDNGKIFMAKYYCVRLHALF  275

Query  1474  GATLAAGLVVAR  1509
             GA L+ GLV+AR
Sbjct  276   GAALSLGLVIAR  287



>ref|XP_010648175.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Vitis vinifera]
 emb|CBI34074.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   246 bits (629),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = +3

Query  435   QESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAA  614
              + R + +  R  + CR   S   N+E    IS+ TLIWRA+KLPIYSVALVPLTVGSAA
Sbjct  56    HDYRNRVKFKR--FECRVEDSYTNNKE----ISKGTLIWRAIKLPIYSVALVPLTVGSAA  109

Query  615   AYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLI  794
             AYLQ GLFS  +Y  LLASSVLII WLNLSNDVYDFDTGADKNKKESVVN+VGSRTGT  
Sbjct  110   AYLQTGLFSARQYFTLLASSVLIIAWLNLSNDVYDFDTGADKNKKESVVNMVGSRTGTHA  169

Query  795   AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaaf  974
             AAY  L LGF GL WAS+ + N RAILLLA A+TCGYIYQCPPFRLSYQGLGEPLCFAAF
Sbjct  170   AAYALLALGFVGLSWASMVAGNFRAILLLACAVTCGYIYQCPPFRLSYQGLGEPLCFAAF  229

Query  975   gpfattafYLLQSST  1019
             GPFATTAFYL+Q++T
Sbjct  230   GPFATTAFYLMQTAT  244


 Score =   151 bits (382),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  1084  LIASMLGDSILP-ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKT  1260
             L+ +   + I P ++ T+LSAS+LVG TT+LILFCSHFHQ++ D+AVGK SPLVRL T+ 
Sbjct  239   LMQTATSEMISPLVTATVLSASLLVGFTTTLILFCSHFHQVEGDRAVGKMSPLVRLDTEK  298

Query  1261  GAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMA  1440
             G+ +VK ++  LYSL +  G  KTLP   I    LTIPM ++V+SYVE NH+D +KIFMA
Sbjct  299   GSRIVKMAMAMLYSLLLAFGLAKTLPFTCIFSCALTIPMAKLVVSYVEDNHKDNSKIFMA  358

Query  1441  KYYCVR  1458
             KYYCVR
Sbjct  359   KYYCVR  364



>gb|EYU18455.1| hypothetical protein MIMGU_mgv1a007846mg [Erythranthe guttata]
Length=297

 Score =   202 bits (515),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP+SGTI+S+S+LVGLTTSLIL CSHFHQI+DDKAVGK SPLVRLGT+ GA+VV  
Sbjct  149   GRSELPVSGTIVSSSILVGLTTSLILLCSHFHQIEDDKAVGKISPLVRLGTERGAKVVNV  208

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             +V  LYSL  +LG  +TLP  S++L  LT+P+GR+V S+VEKNH+D+TKIFMAKYYCVRL
Sbjct  209   AVGLLYSLVFLLGLNQTLPFFSLVLCALTLPVGRLVSSFVEKNHKDETKIFMAKYYCVRL  268

Query  1462  HALFGATLAAGLVVARFFARN  1524
             H +FG  LAAG+V AR FAR 
Sbjct  269   HTVFGGALAAGMVAARMFARR  289


 Score =   195 bits (495),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             +Y+VA +P++VGSAAAYLQ G +   RY  LL SSVL+I WLNLSNDVYDFDTGADKNKK
Sbjct  1     MYTVAFIPISVGSAAAYLQTGKYFAKRYFVLLVSSVLVIAWLNLSNDVYDFDTGADKNKK  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
             ESVVN++GSRTG  + A++ L +GF GL   S+++ ++R+ILLLA A+ CGYIYQCPPFR
Sbjct  61    ESVVNLLGSRTGAHVIAWLLLGIGFTGLTLVSIEAKSIRSILLLACAVVCGYIYQCPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQS  1013
             LSY GLGEPLCFAAFGP ATTAFYLLQS
Sbjct  121   LSYMGLGEPLCFAAFGPLATTAFYLLQS  148



>ref|XP_004985400.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X1 [Setaria italica]
Length=365

 Score =   216 bits (551),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 144/201 (72%), Gaps = 7/201 (3%)
 Frame = +3

Query  444   RRQC------QHPRHFYSCRARHSDAINEEKE-ENISRTTLIWRAVKLPIYSVALVPLTV  602
             RR C      + P      R   + A  E +E   +SR TL+WRA KLPIYSVALVPLTV
Sbjct  22    RRSCVATAAARRPSALRRARCSATAASGEAEEFGELSRATLLWRAAKLPIYSVALVPLTV  81

Query  603   GSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRT  782
             GSA+AY  AGLF   RY  +LA++VL+ITWLNLSNDV+D DTGADKNKKESVVNI+GSR 
Sbjct  82    GSASAYHHAGLFFARRYFTILAAAVLVITWLNLSNDVFDSDTGADKNKKESVVNIIGSRA  141

Query  783   GTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              T  AA VSL LGF GL WA  ++ + R I L+  AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  142   VTQNAANVSLLLGFVGLFWAFAEAGDARFIFLVMCAIFCGYVYQCPPFRLSYQGLGEPLC  201

Query  963   faafgpfattafYLLQSSTRL  1025
             FAAFGP ATTAFY   SS  +
Sbjct  202   FAAFGPLATTAFYFSNSSVNI  222


 Score =   177 bits (448),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G  +LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GT+ G+ +V  
Sbjct  225   GKVVLPLTKTVVASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRVGTEAGSRIVAV  284

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             ++  LY L      +K LPSA  +L  LT+P+G++V+ YV KNHED  KIFMAKYYCVRL
Sbjct  285   AIAMLYILLAAFAISKALPSACTVLCGLTLPVGKLVVDYVLKNHEDNAKIFMAKYYCVRL  344

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  345   HALFGMALASGLVLAR  360



>emb|CDY34126.1| BnaC01g28660D [Brassica napus]
Length=376

 Score =   234 bits (598),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  480   CRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLA  659
             C++   D     +EE I +  LIWRA+KLPIYSVALVPLTV ++AAYL+ GL  V RY  
Sbjct  59    CKSYQEDTEKLYQEEEIPKAKLIWRAIKLPIYSVALVPLTVAASAAYLETGLVLVRRYAT  118

Query  660   LLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVW  839
             L+ SSVLIITWLNLSNDVYDFDTGADKNK+ESVVN+VGSR GT  AA  +L LG  GL+W
Sbjct  119   LMLSSVLIITWLNLSNDVYDFDTGADKNKRESVVNMVGSRAGTFAAAITTLVLGVSGLIW  178

Query  840   ASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLL  1007
              S  ++N+RAILLLASAI CGY+YQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL
Sbjct  179   ISWTASNIRAILLLASAILCGYVYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  234


 Score =   158 bits (400),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+S  +LS+S+LVG TTSLILFCSHFHQ++ D AVGK+SPLVRLGT+ GA VV+ ++  
Sbjct  245   LPLSTRVLSSSLLVGFTTSLILFCSHFHQVEGDLAVGKFSPLVRLGTEKGAFVVRWAIRL  304

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY + ++LG TK LP    +L  LT+P+G +  SYVEK H++  KIFMAKYYCVRLHALF
Sbjct  305   LYLMLLVLGLTKILPVTCTLLCFLTLPVGNLGSSYVEKYHKENEKIFMAKYYCVRLHALF  364

Query  1474  GATLAAGLVVAR  1509
             GA L+ GLV+AR
Sbjct  365   GAALSLGLVIAR  376



>ref|XP_010315115.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=355

 Score =   283 bits (724),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 186/242 (77%), Gaps = 0/242 (0%)
 Frame = +3

Query  294   FHNQGHSFSRLTKFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQESRRQCQHPRHF  473
             F+   H+      F     S+  H   RS CC  CT R  S   L W+E ++     R F
Sbjct  16    FNKTSHAPISSRNFILRTCSLPSHVRQRSICCFQCTGRSGSVIDLGWKEVKQWHSSLRGF  75

Query  474   YSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRY  653
             + C+ +  DA +EE EENIS+ TLIWRA+KLPIYSVAL+PLTVGSAAAYLQ GLFS  RY
Sbjct  76    FMCKVQQHDATSEENEENISQATLIWRAIKLPIYSVALIPLTVGSAAAYLQTGLFSARRY  135

Query  654   LALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL  833
               LLASSV IITWLNLSNDVYDFDTGADK+KKESVVNIVGSRTGT +AA + L LGF GL
Sbjct  136   FMLLASSVFIITWLNLSNDVYDFDTGADKDKKESVVNIVGSRTGTFVAACLLLALGFLGL  195

Query  834   VWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQS  1013
              + S+++ANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS
Sbjct  196   TYTSVEAANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLQS  255

Query  1014  ST  1019
             +T
Sbjct  256   NT  257


 Score =   108 bits (271),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             S LPI+ T LSAS LVG TTSLILFCSHFHQ++ DKAV K+SPLVRLGT+ G+ VVK  V
Sbjct  258   SELPITYTTLSASALVGFTTSLILFCSHFHQVEGDKAVRKFSPLVRLGTEAGSRVVKVGV  317

Query  1288  MALYSLTIILGFTKTLPSASIIL  1356
               LYS  ++LGFT+TLP   I L
Sbjct  318   ATLYSGMLLLGFTQTLPLTCIFL  340



>ref|XP_006423809.1| hypothetical protein CICLE_v10028615mg [Citrus clementina]
 gb|ESR37049.1| hypothetical protein CICLE_v10028615mg [Citrus clementina]
Length=318

 Score =   207 bits (528),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  600   VGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSR  779
             VGSA AYLQ G+FS  RY  LL SSVLIITWLNLSNDVYDFDTGADKNK ESVVN+VGSR
Sbjct  29    VGSATAYLQTGMFSTRRYFVLLISSVLIITWLNLSNDVYDFDTGADKNKTESVVNLVGSR  88

Query  780   TGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPL  959
             TGTL+ AY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQGLGEPL
Sbjct  89    TGTLVTAYLLLVLGFIGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQGLGEPL  148

Query  960   CfaafgpfattafYLLQSSTR  1022
             CFAAFGPFATTAFYLL  STR
Sbjct  149   CFAAFGPFATTAFYLLLGSTR  169


 Score =   182 bits (462),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  164   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  223

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  224   SVVVKWAVMILYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  283

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVR HALFGA L AGL+ AR
Sbjct  284   YYCVRFHALFGAALVAGLITAR  305



>ref|XP_011087912.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Sesamum indicum]
Length=419

 Score =   207 bits (526),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 148/197 (75%), Gaps = 5/197 (3%)
 Frame = +3

Query  444   RRQCQHPRH--FYSCRARHSDAINE---EKEENISRTTLIWRAVKLPIYSVALVPLTVGS  608
             R + +H R+     CRA     + E   EK+E++SR  LIWRA+KLP+Y+V LVP +VG+
Sbjct  68    RAKQEHARNRSLLECRAERGSVLTEKELEKDEDVSRAMLIWRAIKLPMYTVGLVPASVGA  127

Query  609   AAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGT  788
             AAAYL+ GLFS  RY   LA+ VLII WLNLSNDVYD+DTGADKNKKESVVN+VGSRT  
Sbjct  128   AAAYLETGLFSPERYFGSLAAFVLIIAWLNLSNDVYDYDTGADKNKKESVVNLVGSRTAI  187

Query  789   LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfa  968
              I A++ L LGF GL W + ++ + R++LLLA  + C +IYQCPPFRLSY GLGEPLCFA
Sbjct  188   NILAWLLLVLGFGGLSWVADEAGSGRSLLLLACTVFCCFIYQCPPFRLSYLGLGEPLCFA  247

Query  969   afgpfattafYLLQSST  1019
             AFGPFAT  FYLLQS T
Sbjct  248   AFGPFATIGFYLLQSGT  264


 Score =   183 bits (464),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LPIS T++SAS LVG T+SLIL CSHFHQI DD+AVGK SPLVRLGT+ GA VVK 
Sbjct  263   GTSELPISSTVISASTLVGFTSSLILLCSHFHQIKDDEAVGKISPLVRLGTEAGANVVKM  322

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             +V+ LY L    G   TLP AS+I    T+PMG +V+S+V++NH+DK+KIFMAKY+CVRL
Sbjct  323   AVLGLYWLVFAFGLADTLPYASLIFCTATLPMGNLVVSFVQENHKDKSKIFMAKYFCVRL  382

Query  1462  HALFGATLAAGLVVARFF  1515
             H + GA L AGLV +R  
Sbjct  383   HTILGAALTAGLVASRLL  400



>ref|XP_010917310.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=352

 Score =   233 bits (594),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = +3

Query  429   RWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGS  608
             +W  + R+   P    S      +   E   + ISR TL+WRA KLPIYSVALVPLTVGS
Sbjct  37    KWAVTARKPWPPLWPRSSSQPTPEVALEGDADKISRATLLWRAAKLPIYSVALVPLTVGS  96

Query  609   AAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGT  788
             AAAYLQ G+F   RY  LL++S+L+ITWLNLSNDVYDFDTGAD++KKESVVNI+GSRT T
Sbjct  97    AAAYLQTGIFFAKRYFVLLSASMLVITWLNLSNDVYDFDTGADRHKKESVVNIIGSRTVT  156

Query  789   LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfa  968
               AA +SL LGF GL+WA  ++ ++R ILL+A AI CGY+YQCPPFRLSYQGLGEPLCFA
Sbjct  157   QYAANISLVLGFMGLIWAFTEAGDIRFILLVAYAIACGYVYQCPPFRLSYQGLGEPLCFA  216

Query  969   afgpfattafYLLQSSTRL  1025
             AFGPFATTAFY   SS  L
Sbjct  217   AFGPFATTAFYFANSSKYL  235


 Score =   154 bits (388),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 94/136 (69%), Gaps = 26/136 (19%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++GT+LSASVLVGLTT+LILFCSHFHQID D+AVGK SPLVR+GT+ G++V   
Sbjct  238   GISHLPLTGTVLSASVLVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTRAGSKV---  294

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
                                     L  LT+PMG++V+ YV++NH D  KIFMAKYYCVRL
Sbjct  295   -----------------------FLCALTLPMGKIVVDYVKENHNDNGKIFMAKYYCVRL  331

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GL +AR
Sbjct  332   HALFGMALALGLWLAR  347



>ref|XP_010267194.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=391

 Score =   258 bits (660),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 2/200 (1%)
 Frame = +3

Query  417   WSALRWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPL  596
             WS  ++   RR+        S   ++ +A+   KE+ ISR TLIWRA+KLPIYSVA+VPL
Sbjct  56    WSKDKFCHWRREAYESEEGRSFTTQNEEAV--PKEDEISRATLIWRAIKLPIYSVAIVPL  113

Query  597   TVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGS  776
             TVGSA AYLQ GLF   RYL LL SSV IITWLNLSNDVYDFDTGADKNKKESVVN+V S
Sbjct  114   TVGSAVAYLQTGLFFARRYLMLLFSSVFIITWLNLSNDVYDFDTGADKNKKESVVNMVDS  173

Query  777   RTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEP  956
             RTGTL++AY+ L +GF GL WAS+++ N+R+ILLL  AITCGYIYQCPPFRLSYQGLGEP
Sbjct  174   RTGTLVSAYMLLVIGFMGLTWASVEAGNIRSILLLICAITCGYIYQCPPFRLSYQGLGEP  233

Query  957   LCfaafgpfattafYLLQSS  1016
             LCFAAFGPFATTAFYLLQSS
Sbjct  234   LCFAAFGPFATTAFYLLQSS  253


 Score =   125 bits (314),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 102/142 (72%), Gaps = 13/142 (9%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP++GTILSAS+LVG TTSLILFCSHFHQ             VR+GTK G+ VVK +++ 
Sbjct  260   LPLTGTILSASLLVGFTTSLILFCSHFHQ-------------VRIGTKKGSLVVKVAIVT  306

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY L   LG +K LP   I+L  LT+P+G++V+SYVE+NH D  KIFMAKYYCVRLHALF
Sbjct  307   LYLLLFTLGLSKALPLTCILLCALTLPIGKLVVSYVEENHTDSNKIFMAKYYCVRLHALF  366

Query  1474  GATLAAGLVVARFFARNYNMRP  1539
             GA LAAGLV  R  A+ Y  +P
Sbjct  367   GAALAAGLVATRTVAKAYVPKP  388



>gb|ABR16600.1| unknown [Picea sitchensis]
Length=394

 Score =   218 bits (555),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = +3

Query  429   RWQESR-RQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             RW   R ++    R F  C++  S+    E +E++SR TLI RAVKLPIY+VALVPLTVG
Sbjct  60    RWVVGRTKELGLTRGF--CKSGLSEINQGEDKEHVSRATLIRRAVKLPIYTVALVPLTVG  117

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
             SAAAYLQ   F   RY  LL SSVLIITWLNLSND YDF+TGADK+KKESVVNI GS +G
Sbjct  118   SAAAYLQVHSFDAGRYFVLLFSSVLIITWLNLSNDAYDFETGADKDKKESVVNISGSHSG  177

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
              L AAY+ L LG  GL+WA+LQ+ ++R   LL  AI CGY+YQCPP RLSY GLGEPLCF
Sbjct  178   VLCAAYICLALGSSGLLWAALQAGDVRVAALLFCAILCGYVYQCPPCRLSYHGLGEPLCF  237

Query  966   aafgpfattafYLLQSS  1016
             AAFGP AT+AFY  Q++
Sbjct  238   AAFGPLATSAFYFSQAT  254


 Score =   157 bits (398),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = +1

Query  1111  ILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVM  1290
             ILP S T+LS SVL+G+TT+LILFCSHFHQID D  VGK SPLVR+GTK G+EVV+ SV+
Sbjct  260   ILPFSSTVLSVSVLIGVTTTLILFCSHFHQIDGDWEVGKMSPLVRIGTKRGSEVVRYSVI  319

Query  1291  ALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHAL  1470
              LYSL       KTLP      ++LT+P+G+++I +V +NH DK KIFMAKYYCVRLHA 
Sbjct  320   VLYSLLCAFAALKTLPLTCTFFTLLTLPLGKLLIDFVHENHNDKIKIFMAKYYCVRLHAS  379

Query  1471  FGATLAAGLVVARF  1512
             FG  LA GL  ARF
Sbjct  380   FGVALALGLFAARF  393



>ref|NP_176259.2| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Arabidopsis 
thaliana]
 dbj|BAE99295.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33701.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Arabidopsis 
thaliana]
Length=287

 Score =   216 bits (549),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             +YSVALVPLTVG++AAYL+ GLF   RY+ LL SS+LIITWLNLSNDVYDFDTGADKNK 
Sbjct  1     MYSVALVPLTVGASAAYLETGLFLARRYVTLLLSSILIITWLNLSNDVYDFDTGADKNKM  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
             ESVVN+VGSRTGTL AA  SL LG  GLVW SL ++N+RAILLLASAI CGY+YQCPPFR
Sbjct  61    ESVVNLVGSRTGTLAAAITSLALGVSGLVWTSLNASNIRAILLLASAILCGYVYQCPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQSST  1019
             LSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  121   LSYQGLGEPLCFAAFGPFATTAFYLLLGSS  150


 Score =   159 bits (403),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+SVLVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  
Sbjct  156   LPLSGRVLSSSVLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWTIRL  215

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS+ ++LG T+ LP    ++  LT+P+G +V SYVEK+H+D  KIFMAKYYCVRLHAL 
Sbjct  216   LYSMLLVLGLTRILPLPCTLMCFLTLPVGNLVSSYVEKHHKDNGKIFMAKYYCVRLHALL  275

Query  1474  GATLAAGLVVAR  1509
             GA L+ GLV+AR
Sbjct  276   GAALSLGLVIAR  287



>gb|AAS76683.1| At1g60600 [Arabidopsis thaliana]
Length=287

 Score =   213 bits (542),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             +YSVALVPLTVG++AAYL+ GLF   RY+  L SS+LIITWLNLSNDVYDFDTGADKNK 
Sbjct  1     MYSVALVPLTVGASAAYLETGLFLARRYVTQLLSSILIITWLNLSNDVYDFDTGADKNKM  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
             ESVVN+VGSRTGTL AA  SL LG  GLVW SL ++N+RAILLLASAI CGY+YQCPPFR
Sbjct  61    ESVVNLVGSRTGTLAAAITSLALGVSGLVWTSLNASNIRAILLLASAILCGYVYQCPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQSST  1019
             LSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  121   LSYQGLGEPLCFAAFGPFATTAFYLLLGSS  150


 Score =   159 bits (403),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+SVLVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ GA VV+ ++  
Sbjct  156   LPLSGRVLSSSVLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGAFVVRWTIRL  215

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYS+ ++LG T+ LP    ++  LT+P+G +V SYVEK+H+D  KIFMAKYYCVRLHAL 
Sbjct  216   LYSMLLVLGLTRILPLPCTLMCFLTLPVGNLVSSYVEKHHKDNGKIFMAKYYCVRLHALL  275

Query  1474  GATLAAGLVVAR  1509
             GA L+ GLV+AR
Sbjct  276   GAALSLGLVIAR  287



>ref|XP_010520871.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   253 bits (645),  Expect(3) = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +3

Query  438   ESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAA  617
             + RR+   P  F S R    +   ++KEE++S+ TLIWRAVKLPIY VALVPLTVG AAA
Sbjct  58    DERRRQGRPIVFRS-RGNTVEMCGDDKEEDVSKATLIWRAVKLPIYFVALVPLTVGGAAA  116

Query  618   YLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIA  797
             YL+ G FS  RYL LL SSVL ITWLNLSNDVYDFDTGADKNKKESVVN+VGSRTGTLIA
Sbjct  117   YLETGSFSAGRYLTLLVSSVLTITWLNLSNDVYDFDTGADKNKKESVVNLVGSRTGTLIA  176

Query  798   AYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafg  977
             A++ L LG  GL W S+++ N+RAI+LLASAI CGYIYQCPPFRLSY GLGEPLCFAAFG
Sbjct  177   AFILLVLGGAGLSWISMEARNIRAIMLLASAIFCGYIYQCPPFRLSYHGLGEPLCFAAFG  236

Query  978   pfattafYLLQSST  1019
             PFATTAFYLL +S+
Sbjct  237   PFATTAFYLLLASS  250


 Score =   107 bits (267),  Expect(3) = 2e-93, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+AS    S +P++G ILSAS LVG TTSLIL CSHFHQ++ D AVGK SPLVR+GT+ G
Sbjct  246   LLASSSQTSHVPLNGRILSASFLVGFTTSLILLCSHFHQVESDLAVGKLSPLVRVGTERG  305

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
             A+VVK+ V++LYSL ++LG T+ LP    ++  LT+PMG +V SYVEKNH+
Sbjct  306   AKVVKSVVVSLYSLLLVLGLTRILPLTCTLMCFLTLPMGILVTSYVEKNHK  356


 Score = 34.3 bits (77),  Expect(3) = 2e-93, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 4/42 (10%)
 Frame = +3

Query  1419  QNKDLYGKVLLCETPCSVWCYFGCWIGGG*ILCKELQHEACS  1544
             Q +D++G+VLL ET  +VW  F  W  G    CK  Q   CS
Sbjct  366   QGEDIHGEVLLRETARAVWSSFVHWTRG----CKANQQSLCS  403



>ref|XP_006300524.1| hypothetical protein CARUB_v10020546mg [Capsella rubella]
 gb|EOA33422.1| hypothetical protein CARUB_v10020546mg [Capsella rubella]
Length=355

 Score =   242 bits (617),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +3

Query  480   CRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLA  659
             C++    A    +E+ I +  LIWRA+KLPIYSVALVPLTVG++AAYL+ GLF   RY  
Sbjct  58    CKSYGDAAAKMYQEDEIPKAKLIWRAIKLPIYSVALVPLTVGASAAYLETGLFLARRYAI  117

Query  660   LLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVW  839
             L+ SS+LIITWLNLSNDVYDFDTGADKNKKESVVN+VGSR GTL AA  SL LG  GLVW
Sbjct  118   LMLSSILIITWLNLSNDVYDFDTGADKNKKESVVNMVGSRAGTLAAAVTSLVLGVAGLVW  177

Query  840   ASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              S+ ++N+RAILLLASAI CGY+YQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  S+
Sbjct  178   TSVNASNIRAILLLASAILCGYVYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLLGSS  237


 Score =   130 bits (327),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             LP+SG +LS+S+LVG TTSLILFCSHFHQ+D D AVGKYSPLVRLGT+ G+ VV+ ++  
Sbjct  243   LPLSGMVLSSSLLVGFTTSLILFCSHFHQVDGDLAVGKYSPLVRLGTEKGSFVVRWAIRL  302

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIF  1434
             LYS+ + LG T+ LP    ++  LT+P+G +V SYVEK+H+ K KIF
Sbjct  303   LYSMLLALGLTRVLPLPCTLMCFLTLPVGNLVSSYVEKHHKVK-KIF  348



>ref|XP_010648176.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X3 [Vitis vinifera]
Length=371

 Score =   246 bits (629),  Expect(2) = 9e-93, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = +3

Query  435   QESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAA  614
              + R + +  R  + CR   S   N+E    IS+ TLIWRA+KLPIYSVALVPLTVGSAA
Sbjct  62    HDYRNRVKFKR--FECRVEDSYTNNKE----ISKGTLIWRAIKLPIYSVALVPLTVGSAA  115

Query  615   AYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLI  794
             AYLQ GLFS  +Y  LLASSVLII WLNLSNDVYDFDTGADKNKKESVVN+VGSRTGT  
Sbjct  116   AYLQTGLFSARQYFTLLASSVLIIAWLNLSNDVYDFDTGADKNKKESVVNMVGSRTGTHA  175

Query  795   AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaaf  974
             AAY  L LGF GL WAS+ + N RAILLLA A+TCGYIYQCPPFRLSYQGLGEPLCFAAF
Sbjct  176   AAYALLALGFVGLSWASMVAGNFRAILLLACAVTCGYIYQCPPFRLSYQGLGEPLCFAAF  235

Query  975   gpfattafYLLQSST  1019
             GPFATTAFYL+Q++T
Sbjct  236   GPFATTAFYLMQTAT  250


 Score =   123 bits (309),  Expect(2) = 9e-93, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +1

Query  1084  LIASMLGDSILP-ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKT  1260
             L+ +   + I P ++ T+LSAS+LVG TT+LILFCSHFHQ++ D+AVGK SPLVRL T+ 
Sbjct  245   LMQTATSEMISPLVTATVLSASLLVGFTTTLILFCSHFHQVEGDRAVGKMSPLVRLDTEK  304

Query  1261  GAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
             G+ +VK ++  LYSL +  G  KTLP   I    LTIPM ++V+SYVE NH+
Sbjct  305   GSRIVKMAMAMLYSLLLAFGLAKTLPFTCIFSCALTIPMAKLVVSYVEDNHK  356



>ref|XP_006492627.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X3 [Citrus sinensis]
Length=325

 Score =   186 bits (471),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  600   VGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSR  779
             VGSAAAYLQ G+FS  RY  LL SSVLIITWLNLSNDVYDFDTGADKNK ESVVN+VGSR
Sbjct  36    VGSAAAYLQTGMFSARRYFVLLISSVLIITWLNLSNDVYDFDTGADKNKTESVVNLVGSR  95

Query  780   TGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPL  959
             TGTL+AAY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQGLGEPL
Sbjct  96    TGTLVAAYLLLVLGFVGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQGLGEPL  155

Query  960   CfaafgpfattafYLLQSSTR  1022
             CFAAFGPFATTAFYLL  STR
Sbjct  156   CFAAFGPFATTAFYLLLGSTR  176


 Score =   184 bits (467),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  171   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  230

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  231   SVVVKWAVMTLYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  290

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVRLHALFGA L AGL+ AR
Sbjct  291   YYCVRLHALFGAALVAGLITAR  312



>ref|XP_004985401.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X2 [Setaria italica]
Length=356

 Score =   187 bits (475),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 135/201 (67%), Gaps = 16/201 (8%)
 Frame = +3

Query  444   RRQC------QHPRHFYSCRARHSDAINEEKE-ENISRTTLIWRAVKLPIYSVALVPLTV  602
             RR C      + P      R   + A  E +E   +SR TL+WRA KLPIYSVALVPLTV
Sbjct  22    RRSCVATAAARRPSALRRARCSATAASGEAEEFGELSRATLLWRAAKLPIYSVALVPLTV  81

Query  603   GSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRT  782
             GSA+AY  AGLF   RY  +LA++VL+ITWLNLSNDV+D DTGADKNKKESVVNI+GSR 
Sbjct  82    GSASAYHHAGLFFARRYFTILAAAVLVITWLNLSNDVFDSDTGADKNKKESVVNIIGSRA  141

Query  783   GTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              T  AA VSL LGF GL WA  ++ + R I L+  AI CGY+         YQGLGEPLC
Sbjct  142   VTQNAANVSLLLGFVGLFWAFAEAGDARFIFLVMCAIFCGYV---------YQGLGEPLC  192

Query  963   faafgpfattafYLLQSSTRL  1025
             FAAFGP ATTAFY   SS  +
Sbjct  193   FAAFGPLATTAFYFSNSSVNI  213


 Score =   177 bits (448),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G  +LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GT+ G+ +V  
Sbjct  216   GKVVLPLTKTVVASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRVGTEAGSRIVAV  275

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             ++  LY L      +K LPSA  +L  LT+P+G++V+ YV KNHED  KIFMAKYYCVRL
Sbjct  276   AIAMLYILLAAFAISKALPSACTVLCGLTLPVGKLVVDYVLKNHEDNAKIFMAKYYCVRL  335

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  336   HALFGMALASGLVLAR  351



>gb|KHN26511.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic 
[Glycine soja]
Length=369

 Score =   229 bits (584),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  525   NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +IS+ TLIWRA+KLPIYSVA VPLTVGSAA Y Q G+FS   Y  LLASSVL ITWLNLS
Sbjct  93    DISKETLIWRAIKLPIYSVAFVPLTVGSAAVYFQTGIFSARCYFVLLASSVLAITWLNLS  152

Query  705   NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
             NDVYDFDTG DKNKKESVVN+ GSR GT IAAY+ L +GF GL W ++   N+R+IL L 
Sbjct  153   NDVYDFDTGVDKNKKESVVNLAGSRKGTFIAAYLCLAIGFLGLTWTAVVERNIRSILFLV  212

Query  885   SAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  213   CAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  257


 Score =   134 bits (338),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ D+ VGK SPLVRLGTK GAEVVK ++  
Sbjct  263   FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDREVGKMSPLVRLGTKKGAEVVKGAIFM  322

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIF  1434
             LY+L +  G  K LP   I L  LT+PMG +V+ +VE N++     F
Sbjct  323   LYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYKASEFFF  369



>ref|XP_007138251.1| hypothetical protein PHAVU_009G192700g [Phaseolus vulgaris]
 gb|ESW10245.1| hypothetical protein PHAVU_009G192700g [Phaseolus vulgaris]
Length=353

 Score =   239 bits (611),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  507   NEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLII  686
              EE EE+IS+ TLIWRA+KLPIYSVA VPLTVGSAAAYL  G+FS   Y  LLASSVL+I
Sbjct  79    GEETEEDISKETLIWRAIKLPIYSVAFVPLTVGSAAAYLATGIFSARCYFVLLASSVLVI  138

Query  687   TWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLR  866
             TWLNLSNDV+DFDTG DKNK+ESVVN+VGSR GT IAAY+ L LGF GL W ++   N+R
Sbjct  139   TWLNLSNDVHDFDTGVDKNKRESVVNLVGSRKGTFIAAYLCLALGFIGLAWIAVAEKNMR  198

Query  867   AILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSS  1016
             ++L L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT+AFYLL  S
Sbjct  199   SMLFLVCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATSAFYLLHGS  248


 Score =   115 bits (288),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             +P+SGT+LSAS+LVGLTTSLILFCSHFHQ++ DK VGK SPLVRLGTK GAEVVK +V+ 
Sbjct  255   VPLSGTVLSASILVGLTTSLILFCSHFHQVEGDKEVGKMSPLVRLGTKKGAEVVKGAVLM  314

Query  1294  LYSLTIILGFTKTLPSASIILS  1359
             LY+L  + G +K LP   I+ +
Sbjct  315   LYALLAVFGLSKALPLTCIVCT  336



>gb|EYU26901.1| hypothetical protein MIMGU_mgv1a022266mg [Erythranthe guttata]
Length=290

 Score =   184 bits (466),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             S LPI+ TI+ +S+LVGLTTSLILFCSHFHQI DDKAVGK SPLVRLGT+TG+ VVK +V
Sbjct  144   SELPITSTIVWSSILVGLTTSLILFCSHFHQIKDDKAVGKMSPLVRLGTETGSRVVKFAV  203

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
             + LYS+ ++LGFT+ LP AS+IL  +T+PMG +V+S+VEKNH+DKTKIFM KY CVRLH 
Sbjct  204   VGLYSIILVLGFTQNLPLASVILCAMTLPMGNLVVSFVEKNHKDKTKIFMGKYLCVRLHT  263

Query  1468  LFGATLAAGLVVARFFA  1518
             +FGA LAAGLVVAR FA
Sbjct  264   VFGAALAAGLVVARKFA  280


 Score =   167 bits (423),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +3

Query  600   VGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSR  779
             VG+AAAY Q GL+S  RY  +LAS VL+I WLNLSNDVYDFDTG D NKKESV+N+ GSR
Sbjct  4     VGTAAAYWQTGLYSSARYFKILASYVLVIVWLNLSNDVYDFDTGVDVNKKESVINLFGSR  63

Query  780   TGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPL  959
             TG  I A++ L LGF GL W ++++ N R+++LLASA+ C ++YQCPPFRLSY G+GEPL
Sbjct  64    TGINIIAWLILVLGFLGLAWVAVEARNPRSMILLASAVFCFFLYQCPPFRLSYYGVGEPL  123

Query  960   CfaafgpfattafYLLQS  1013
              F AFGP +T AFYLL S
Sbjct  124   LFVAFGPLSTIAFYLLHS  141



>ref|XP_002980796.1| hypothetical protein SELMODRAFT_57400, partial [Selaginella moellendorffii]
 gb|EFJ17981.1| hypothetical protein SELMODRAFT_57400, partial [Selaginella moellendorffii]
Length=282

 Score =   166 bits (421),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             IYSVAL+PL+VGSA A+L++G F   +Y  LL SSVL+ITWLNLSND +D DTG DKNKK
Sbjct  1     IYSVALIPLSVGSATAFLESGAFDGGQYSLLLVSSVLVITWLNLSNDAFDADTGVDKNKK  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
             ESVVNI GS+ G L+A++  L  G  GL+ A+L ++++R   LLA+AI+CGYIYQCPPFR
Sbjct  61    ESVVNITGSQRGVLLASFACLAFGCAGLLRAALVASDIRVASLLAAAISCGYIYQCPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQS  1013
             LSY+GLGEPLCF AFGPFATTAFYL QS
Sbjct  121   LSYKGLGEPLCFLAFGPFATTAFYLSQS  148


 Score =   143 bits (360),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             +ILP++ T+  AS LVG+TT+LIL CSHFHQI+DDKAVGK SPLVRLGT+ G++VV   V
Sbjct  151   AILPLTPTLWGASALVGITTTLILLCSHFHQIEDDKAVGKISPLVRLGTENGSKVVTFLV  210

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
               LY+    L   K LP     L +LT+P+G+MV+ +V  NH DK KIF+AKY+CVRLH 
Sbjct  211   TGLYTGLCALAALKALPLPCAALCLLTLPVGKMVVDFVSSNHHDKKKIFLAKYFCVRLHI  270

Query  1468  LFGATLAAGLVV  1503
              FG+ L  G+++
Sbjct  271   AFGSALVLGMLL  282



>gb|KDP40919.1| hypothetical protein JCGZ_24918 [Jatropha curcas]
Length=393

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = +3

Query  429   RWQESRRQCQHPRHFYSCRARHSDAINEE-KEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             R  E +RQ Q  + F    + ++   NE  KEE+I++ TL+WRA+KLPIYSVALVPLTVG
Sbjct  39    RQLEVKRQRQCGQIFCESTSHYTTNANEGGKEEDIAKVTLVWRAIKLPIYSVALVPLTVG  98

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
              AAAYL  G+FS  RY  LLASS+LIITWLNLSNDVYDFDTGADKNKKESVVN+VGSR+G
Sbjct  99    GAAAYLHTGVFSARRYFVLLASSILIITWLNLSNDVYDFDTGADKNKKESVVNLVGSRSG  158

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
             TL AAY+SL LGF GL   SL + N++AILLLA A+ CGYIYQCPPFRLSYQGLGEPLCF
Sbjct  159   TLFAAYLSLALGFLGLTRTSLGAGNVQAILLLACAVICGYIYQCPPFRLSYQGLGEPLCF  218

Query  966   aafgpfattafYLLQSSTRLFVFL  1037
             +AFGPFATT FYLL  S+    +L
Sbjct  219   SAFGPFATTGFYLLLGSSSDMTYL  242


 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S    + LP++GTILS S+LVGLTTSLILFCSHFHQI+ DKAVGK SPLVRLGT+ G
Sbjct  232   LLGSSSDMTYLPLTGTILSVSLLVGLTTSLILFCSHFHQIEGDKAVGKISPLVRLGTEKG  291

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +++ALYSL  I   +  LP   ++L  LTIPMG +V+ YVE+NH+DK KIFMAK
Sbjct  292   SLVVKVAIVALYSLLSIFVLSNALPFTCLLLCDLTIPMGNLVVRYVEENHKDKGKIFMAK  351

Query  1444  YYCVRLHALFGATLAAGLVVARFFARNY  1527
             YYCVRLHALFGA LAAGLV AR  A  Y
Sbjct  352   YYCVRLHALFGAALAAGLVAARMLAERY  379



>ref|XP_002961856.1| hypothetical protein SELMODRAFT_67325, partial [Selaginella moellendorffii]
 gb|EFJ37116.1| hypothetical protein SELMODRAFT_67325, partial [Selaginella moellendorffii]
Length=282

 Score =   165 bits (417),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             IYSVAL+PL+VGSA A+L++G F   +Y  LL SSVL+ITWLNLSND +D DTG DKNKK
Sbjct  1     IYSVALIPLSVGSATAFLESGAFDGGQYSLLLVSSVLVITWLNLSNDAFDADTGVDKNKK  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
             ESVVNI GS+ G L+A+   L  G  GL+ A+L ++++R   LLA+AI+CGYIYQCPPFR
Sbjct  61    ESVVNITGSQRGVLLASVACLAFGCAGLLRAALVASDIRVASLLAAAISCGYIYQCPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQS  1013
             LSY+GLGEPLCF AFGPFATTAFYL QS
Sbjct  121   LSYKGLGEPLCFLAFGPFATTAFYLSQS  148


 Score =   143 bits (360),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             +ILP++ T+  AS LVG+TT+LIL CSHFHQI+DDKAVGK SPLVRLGT+ G++VV   V
Sbjct  151   AILPLTPTLWGASALVGITTTLILLCSHFHQIEDDKAVGKISPLVRLGTENGSKVVTFLV  210

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
               LY+    L   K LP     L +LT+P+G+MV+ +V  NH DK KIF+AKY+CVRLH 
Sbjct  211   TGLYTGLCALAALKALPLPCAALCLLTLPVGKMVVDFVSSNHHDKKKIFLAKYFCVRLHI  270

Query  1468  LFGATLAAGLVV  1503
              FG+ L  G+++
Sbjct  271   AFGSALVLGMLL  282



>ref|XP_006392143.1| hypothetical protein EUTSA_v10023528mg [Eutrema salsugineum]
 gb|ESQ29429.1| hypothetical protein EUTSA_v10023528mg [Eutrema salsugineum]
Length=377

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = +3

Query  411   NSWSALRWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALV  590
             +S +  RW   RR+       + C++ + D     +EE I + TLIWRAVKLPIYSVALV
Sbjct  40    DSIARERWNVKRRRNLGIGTVF-CKS-YGDTAKVHQEEEIPKATLIWRAVKLPIYSVALV  97

Query  591   PLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIV  770
             PLTVG++AAYL+ GLF V RY AL+ SSVLIITWLNLSNDVYDFDTGADKNKKESVVN+V
Sbjct  98    PLTVGASAAYLETGLFLVRRYAALMLSSVLIITWLNLSNDVYDFDTGADKNKKESVVNMV  157

Query  771   GSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLG  950
             GSRTGTL AA  SL LG  GLVW SL ++N+RAILLL SAI CGY+YQCPPFRLSYQGLG
Sbjct  158   GSRTGTLAAAITSLVLGVSGLVWTSLIASNIRAILLLVSAILCGYVYQCPPFRLSYQGLG  217

Query  951   EPLCfaafgpfattafYLLQSST  1019
             EPLCFAAFGPFATTAFYLL  S+
Sbjct  218   EPLCFAAFGPFATTAFYLLLGSS  240


 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKT  1332
             VG TTSLILFCSHFHQ+D D AVGK+SPLVR+GT+ GA VV+ ++  LYS+ ++LG TK 
Sbjct  259   VGFTTSLILFCSHFHQVDGDLAVGKFSPLVRVGTERGAFVVRWAIRFLYSMLLVLGLTKI  318

Query  1333  LPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVAR  1509
             LP    ++  LT+P+G +V SYVEK+HE+  KIFMAKYYCVRLHA FGA L+ GLV+AR
Sbjct  319   LPVTCALMCFLTLPVGNLVSSYVEKHHEENEKIFMAKYYCVRLHAFFGAALSLGLVIAR  377



>gb|KDO45007.1| hypothetical protein CISIN_1g023777mg [Citrus sinensis]
 gb|KDO45008.1| hypothetical protein CISIN_1g023777mg [Citrus sinensis]
Length=276

 Score =   182 bits (463),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  122   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  181

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  182   SVVVKWAVMILYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  241

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVR HALFGA L AGL+ AR
Sbjct  242   YYCVRFHALFGAALVAGLITAR  263


 Score =   114 bits (285),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  765   IVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQG  944
             ++GSRTGTL+ AY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQG
Sbjct  42    LLGSRTGTLVTAYLLLVLGFIGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQG  101

Query  945   LGEPLCfaafgpfattafYLLQSSTR  1022
             LGEPLCFAAFGPFATTAFYLL  STR
Sbjct  102   LGEPLCFAAFGPFATTAFYLLLGSTR  127



>gb|KCW63305.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
 gb|KCW63306.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
Length=304

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  447  RQCQHPRHFY-----SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSA  611
            +Q +  R F      S +  HS  +   KE++IS  TLIWRA+KLPIYSVALVPLT+GSA
Sbjct  56   KQVEVKRRFKLHQVSSGKNAHSSEL--AKEDDISMATLIWRAIKLPIYSVALVPLTIGSA  113

Query  612  AAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL  791
            +AYLQ+  F  TRY  LL SS+L+ITWLNLSNDVYDFDTGADKNK+ESVVN++GSRTGTL
Sbjct  114  SAYLQSSTFPATRYFVLLVSSILVITWLNLSNDVYDFDTGADKNKRESVVNLIGSRTGTL  173

Query  792  IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +AAY+ L LG  GL W SL++ +LRA+LLLA AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  174  LAAYMFLVLGLIGLTWVSLEAGHLRAMLLLACAIFCGYIYQCPPFRLSYHGLGEPLC  230


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLV  1242
             + LP++GT+L AS+L+G TTSLILFCSHFHQ+++D  VGK SPLV
Sbjct  253   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQVEEDTTVGKISPLV  297



>gb|KCW63304.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
Length=350

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  447  RQCQHPRHFY-----SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSA  611
            +Q +  R F      S +  HS  +   KE++IS  TLIWRA+KLPIYSVALVPLT+GSA
Sbjct  56   KQVEVKRRFKLHQVSSGKNAHSSEL--AKEDDISMATLIWRAIKLPIYSVALVPLTIGSA  113

Query  612  AAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL  791
            +AYLQ+  F  TRY  LL SS+L+ITWLNLSNDVYDFDTGADKNK+ESVVN++GSRTGTL
Sbjct  114  SAYLQSSTFPATRYFVLLVSSILVITWLNLSNDVYDFDTGADKNKRESVVNLIGSRTGTL  173

Query  792  IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +AAY+ L LG  GL W SL++ +LRA+LLLA AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  174  LAAYMFLVLGLIGLTWVSLEAGHLRAMLLLACAIFCGYIYQCPPFRLSYHGLGEPLC  230


 Score =   113 bits (282),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 13/103 (13%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+L+G TTSLILFCSHFHQ             VRLGT+ G+ VVK ++
Sbjct  253   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQ-------------VRLGTEKGSSVVKVAI  299

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
              ALYSL +I G ++ LPS+ IIL +LT+PMG  V+S+V++NHE
Sbjct  300   TALYSLLLIFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHE  342



>gb|KCW63299.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
Length=386

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  447  RQCQHPRHFY-----SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSA  611
            +Q +  R F      S +  HS  +   KE++IS  TLIWRA+KLPIYSVALVPLT+GSA
Sbjct  56   KQVEVKRRFKLHQVSSGKNAHSSEL--AKEDDISMATLIWRAIKLPIYSVALVPLTIGSA  113

Query  612  AAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL  791
            +AYLQ+  F  TRY  LL SS+L+ITWLNLSNDVYDFDTGADKNK+ESVVN++GSRTGTL
Sbjct  114  SAYLQSSTFPATRYFVLLVSSILVITWLNLSNDVYDFDTGADKNKRESVVNLIGSRTGTL  173

Query  792  IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +AAY+ L LG  GL W SL++ +LRA+LLLA AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  174  LAAYMFLVLGLIGLTWVSLEAGHLRAMLLLACAIFCGYIYQCPPFRLSYHGLGEPLC  230


 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 108/140 (77%), Gaps = 13/140 (9%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+L+G TTSLILFCSHFHQ             VRLGT+ G+ VVK ++
Sbjct  253   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQ-------------VRLGTEKGSSVVKVAI  299

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +I G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKYYCVRLHA
Sbjct  300   TALYSLLLIFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYYCVRLHA  359

Query  1468  LFGATLAAGLVVARFFARNY  1527
             LFGA+LAAGLV+A+F ++ Y
Sbjct  360   LFGASLAAGLVIAKFVSKRY  379



>gb|KCW63298.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
Length=398

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  447  RQCQHPRHFY-----SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSA  611
            +Q +  R F      S +  HS  +   KE++IS  TLIWRA+KLPIYSVALVPLT+GSA
Sbjct  56   KQVEVKRRFKLHQVSSGKNAHSSEL--AKEDDISMATLIWRAIKLPIYSVALVPLTIGSA  113

Query  612  AAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL  791
            +AYLQ+  F  TRY  LL SS+L+ITWLNLSNDVYDFDTGADKNK+ESVVN++GSRTGTL
Sbjct  114  SAYLQSSTFPATRYFVLLVSSILVITWLNLSNDVYDFDTGADKNKRESVVNLIGSRTGTL  173

Query  792  IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +AAY+ L LG  GL W SL++ +LRA+LLLA AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  174  LAAYMFLVLGLIGLTWVSLEAGHLRAMLLLACAIFCGYIYQCPPFRLSYHGLGEPLC  230


 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+L+G TTSLILFCSHFHQ+++D  VGK SPLVRLGT+ G+ VVK ++
Sbjct  252   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQVEEDTTVGKISPLVRLGTEKGSSVVKVAI  311

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +I G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKYYCVRLHA
Sbjct  312   TALYSLLLIFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYYCVRLHA  371

Query  1468  LFGATLAAGLVVARFFARNY  1527
             LFGA+LAAGLV+A+F ++ Y
Sbjct  372   LFGASLAAGLVIAKFVSKRY  391



>ref|XP_010065687.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Eucalyptus grandis]
 ref|XP_010065690.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Eucalyptus grandis]
Length=399

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  447  RQCQHPRHFY-----SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSA  611
            +Q +  R F      S +  HS  +   KE++IS  TLIWRA+KLPIYSVALVPLT+GSA
Sbjct  56   KQVEVKRRFKLHQVSSGKNAHSSEL--AKEDDISMATLIWRAIKLPIYSVALVPLTIGSA  113

Query  612  AAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL  791
            +AYLQ+  F  TRY  LL SS+L+ITWLNLSNDVYDFDTGADKNK+ESVVN++GSRTGTL
Sbjct  114  SAYLQSSTFPATRYFVLLVSSILVITWLNLSNDVYDFDTGADKNKRESVVNLIGSRTGTL  173

Query  792  IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +AAY+ L LG  GL W SL++ +LRA+LLLA AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  174  LAAYMFLVLGLIGLTWVSLEAGHLRAMLLLACAIFCGYIYQCPPFRLSYHGLGEPLC  230


 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+L+G TTSLILFCSHFHQ+++D  VGK SPLVRLGT+ G+ VVK ++
Sbjct  253   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQVEEDTTVGKISPLVRLGTEKGSSVVKVAI  312

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +I G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKYYCVRLHA
Sbjct  313   TALYSLLLIFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYYCVRLHA  372

Query  1468  LFGATLAAGLVVARFFARNY  1527
             LFGA+LAAGLV+A+F ++ Y
Sbjct  373   LFGASLAAGLVIAKFVSKRY  392



>ref|XP_010065685.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010065686.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010065688.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010065689.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW63300.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
 gb|KCW63301.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
 gb|KCW63302.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
Length=399

 Score =   241 bits (616),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  447  RQCQHPRHFY-----SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSA  611
            +Q +  R F      S +  HS  +   KE++IS  TLIWRA+KLPIYSVALVPLT+GSA
Sbjct  56   KQVEVKRRFKLHQVSSGKNAHSSEL--AKEDDISMATLIWRAIKLPIYSVALVPLTIGSA  113

Query  612  AAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTL  791
            +AYLQ+  F  TRY  LL SS+L+ITWLNLSNDVYDFDTGADKNK+ESVVN++GSRTGTL
Sbjct  114  SAYLQSSTFPATRYFVLLVSSILVITWLNLSNDVYDFDTGADKNKRESVVNLIGSRTGTL  173

Query  792  IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +AAY+ L LG  GL W SL++ +LRA+LLLA AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  174  LAAYMFLVLGLIGLTWVSLEAGHLRAMLLLACAIFCGYIYQCPPFRLSYHGLGEPLC  230


 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+L+G TTSLILFCSHFHQ+++D  VGK SPLVRLGT+ G+ VVK ++
Sbjct  253   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQVEEDTTVGKISPLVRLGTEKGSSVVKVAI  312

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +I G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKYYCVRLHA
Sbjct  313   TALYSLLLIFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYYCVRLHA  372

Query  1468  LFGATLAAGLVVARFFARNY  1527
             LFGA+LAAGLV+A+F ++ Y
Sbjct  373   LFGASLAAGLVIAKFVSKRY  392



>gb|KDO45006.1| hypothetical protein CISIN_1g023777mg [Citrus sinensis]
Length=277

 Score =   177 bits (450),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQI-DDDKAVGKYSPLVRLGTKT  1260
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ+ + D+ VGK SPLVRLGT+ 
Sbjct  122   LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVVEGDRNVGKMSPLVRLGTER  181

Query  1261  GAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMA  1440
             G+ VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMA
Sbjct  182   GSVVVKWAVMILYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMA  241

Query  1441  KYYCVRLHALFGATLAAGLVVAR  1509
             KYYCVR HALFGA L AGL+ AR
Sbjct  242   KYYCVRFHALFGAALVAGLITAR  264


 Score =   114 bits (285),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  765   IVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQG  944
             ++GSRTGTL+ AY+ L LGF GL WAS+++ NLRAI+LL  A+ CGYIYQCPPFRLSYQG
Sbjct  42    LLGSRTGTLVTAYLLLVLGFIGLTWASVEAGNLRAIMLLTCAVICGYIYQCPPFRLSYQG  101

Query  945   LGEPLCfaafgpfattafYLLQSSTR  1022
             LGEPLCFAAFGPFATTAFYLL  STR
Sbjct  102   LGEPLCFAAFGPFATTAFYLLLGSTR  127



>ref|XP_011043106.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Populus euphratica]
Length=401

 Score =   241 bits (614),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +3

Query  438  ESRRQCQHPRHFYSCRARHSDAINE-EKEENISRTTLIWRAVKLPIYSVALVPLTVGSAA  614
            E ++  Q  R F    A ++D  +E E  E++ + TLIWRAVKLPIYSVALVPLTVG AA
Sbjct  63   EFKKGIQCWRAFSGSIANYADNAHEGESGEDVPQATLIWRAVKLPIYSVALVPLTVGGAA  122

Query  615  AYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLI  794
            AYL+ G+FS  RY  LL SS+LIITWLNLSNDVYDFDTGADKNKKESVVN+VGSR+   I
Sbjct  123  AYLETGIFSARRYFLLLVSSILIITWLNLSNDVYDFDTGADKNKKESVVNLVGSRSVAFI  182

Query  795  AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            AAY SL LGF GL W S+   N+ AIL LA AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  183  AAYSSLLLGFVGLAWTSMGEGNVPAILFLACAILCGYVYQCPPFRLSYQGLGEPLC  238


 Score =   191 bits (486),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 4/145 (3%)
 Frame = +1

Query  1093  SMLGDS----ILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKT  1260
             S+LG +    ILP++G ILSAS+LVG TT+LILFCSHFHQ+++DKAVGK+SPLVRLGT+ 
Sbjct  252   SILGSTSEMRILPLTGAILSASLLVGFTTTLILFCSHFHQVEEDKAVGKFSPLVRLGTER  311

Query  1261  GAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMA  1440
             G+ VVK +V  LYSL    G ++TLP A I+L  LT+P+G++V+ +VE+N++DK KIFMA
Sbjct  312   GSGVVKVAVAMLYSLLFAFGLSRTLPLACILLCSLTLPVGKLVVGFVEENYKDKGKIFMA  371

Query  1441  KYYCVRLHALFGATLAAGLVVARFF  1515
             KY+CVRLHALFGA LA+GLV AR F
Sbjct  372   KYFCVRLHALFGAALASGLVAARAF  396



>emb|CDY24540.1| BnaA01g22440D [Brassica napus]
Length=376

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             +EE I +  LIWRA+KLPIYSVALVPLTVG++AAYL+ GL  V RY  L+ SSVLIITWL
Sbjct  71    EEEEIPKAKLIWRAIKLPIYSVALVPLTVGASAAYLETGLVLVRRYATLMLSSVLIITWL  130

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             NLSNDVYDFDTGADKNK+ESVVN+VGSR GT  AA  +L LG  GL+W S  ++N+RAIL
Sbjct  131   NLSNDVYDFDTGADKNKRESVVNMVGSRAGTFAAAITTLVLGVSGLIWISWTASNIRAIL  190

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLL  1007
             LLASAI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL
Sbjct  191   LLASAILCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  234


 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKT  1332
             VG TTSLILFCSHFHQ++ D AVGK+SPLVRLGT+ GA VV+ ++  LY + ++LG TK 
Sbjct  258   VGFTTSLILFCSHFHQVEGDLAVGKFSPLVRLGTEKGAFVVRWAIRLLYFMLLVLGLTKI  317

Query  1333  LPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVAR  1509
             LP    +L  LT+P+G +V SYVE +H++  KIFMAKYYCVRLHALFGA L+ GLV+AR
Sbjct  318   LPVTCTLLCFLTLPVGNLVSSYVENHHKEDEKIFMAKYYCVRLHALFGAALSLGLVIAR  376



>ref|XP_009103842.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Brassica rapa]
 ref|XP_009103846.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Brassica rapa]
Length=376

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             +EE I +  LIWRA+KLPIYSVALVPLTVG++AAYL+ GL  V RY  L+ SSVLIITWL
Sbjct  71    EEEEIPKAKLIWRAIKLPIYSVALVPLTVGASAAYLETGLVLVRRYATLMLSSVLIITWL  130

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             NLSNDVYDFDTGADKNK+ESVVN+VGSR GT  AA  +L LG  GL+W S  ++N+RAIL
Sbjct  131   NLSNDVYDFDTGADKNKRESVVNMVGSRAGTFAAAITTLVLGVSGLIWISWTASNIRAIL  190

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLL  1007
             LLASAI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL
Sbjct  191   LLASAILCGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  234


 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKT  1332
             VG TTSLILFCSHFHQ++ D AVGK+SPLVRLGT+ GA VV+ ++  LY + ++LG TK 
Sbjct  258   VGFTTSLILFCSHFHQVEGDLAVGKFSPLVRLGTEKGAFVVRWAIRLLYFMLLVLGLTKI  317

Query  1333  LPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVAR  1509
             LP    +L  LT+P+G +V SYVE +H++  KIFMAKYYCVRLHA FGA L+ GLV+AR
Sbjct  318   LPVTCTLLCFLTLPVGNLVSSYVENHHKEDEKIFMAKYYCVRLHAFFGAALSLGLVIAR  376



>ref|XP_009383578.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=385

 Score =   232 bits (591),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 141/191 (74%), Gaps = 8/191 (4%)
 Frame = +3

Query  402  NRCNSWSAL---RWQ-ESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLP  569
             +  +W  L   RW   +RR    P     C+   ++A+ +  E+ +SR TL+WRA KLP
Sbjct  35   QKSTAWLPLTKSRWVVAARRTSLLP----PCQMSFAEAVGKGDEDGVSRATLLWRAAKLP  90

Query  570  IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
            IYSVALVPL+VG AAAYLQ+GLFS+  YL LL +SVL+ITWLNLSNDVYDFDTGAD+NKK
Sbjct  91   IYSVALVPLSVGCAAAYLQSGLFSLKHYLVLLFASVLVITWLNLSNDVYDFDTGADQNKK  150

Query  750  ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
            ESVVNI+GSR  T  AA  SL LGF GL WA  ++ ++R I+L+  AI CGY+YQCPPFR
Sbjct  151  ESVVNILGSRGVTQFAANASLALGFMGLFWACAEAGDIRFIILVTCAILCGYVYQCPPFR  210

Query  930  LSYQGLGEPLC  962
            LSYQGLGEPLC
Sbjct  211  LSYQGLGEPLC  221


 Score =   182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++G +L +S LVGLTT+L+LFCSHFHQID D+AVGK SPLVR+GT+ G++VVK 
Sbjct  245   GISPLPVTGRVLFSSFLVGLTTTLVLFCSHFHQIDGDQAVGKMSPLVRIGTRAGSKVVKY  304

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              V++LY L+++ G  K LP+  + LS LTIPMG+MVI YVEKNH+DK KIFMAKYYCVRL
Sbjct  305   GVISLYVLSLVFGLCKALPATCVFLSALTIPMGKMVIDYVEKNHDDKIKIFMAKYYCVRL  364

Query  1462  HALFGA  1479
             H LFG+
Sbjct  365   HTLFGS  370



>ref|XP_008804769.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Phoenix dactylifera]
Length=352

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  498  DAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSV  677
            +   E   + ISR TL+WRA KLPIYSVALVPLTVGSAAAYLQ GLF    Y  +L++S+
Sbjct  60   EVAREGDADEISRATLLWRAAKLPIYSVALVPLTVGSAAAYLQTGLFFAKHYFVILSASM  119

Query  678  LIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSA  857
            L+ITWLNLSNDVYDFDTGAD++KKESVVNI+GSR  T  AA +SL LG  GL+WAS+++ 
Sbjct  120  LVITWLNLSNDVYDFDTGADRHKKESVVNIIGSRMVTQYAANISLALGLMGLIWASIEAG  179

Query  858  NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            ++R+ILL+A AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  180  DVRSILLVAYAILCGYVYQCPPFRLSYQGLGEPLC  214


 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 93/136 (68%), Gaps = 26/136 (19%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++GT+LSASVLVGLTT+ ILFCSHFHQID D+AVGK SPLVR+GT+ G++V   
Sbjct  238   GLSHLPLTGTVLSASVLVGLTTTFILFCSHFHQIDGDRAVGKMSPLVRIGTRAGSKV---  294

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
                                     L  LT+P+G++V+ YVE+NH D  KIFMAKYYCVRL
Sbjct  295   -----------------------FLCALTLPVGKIVVDYVEENHNDNNKIFMAKYYCVRL  331

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GL +AR
Sbjct  332   HALFGIALALGLWLAR  347



>ref|XP_008804768.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Phoenix dactylifera]
Length=378

 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  498  DAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSV  677
            +   E   + ISR TL+WRA KLPIYSVALVPLTVGSAAAYLQ GLF    Y  +L++S+
Sbjct  60   EVAREGDADEISRATLLWRAAKLPIYSVALVPLTVGSAAAYLQTGLFFAKHYFVILSASM  119

Query  678  LIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSA  857
            L+ITWLNLSNDVYDFDTGAD++KKESVVNI+GSR  T  AA +SL LG  GL+WAS+++ 
Sbjct  120  LVITWLNLSNDVYDFDTGADRHKKESVVNIIGSRMVTQYAANISLALGLMGLIWASIEAG  179

Query  858  NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            ++R+ILL+A AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  180  DVRSILLVAYAILCGYVYQCPPFRLSYQGLGEPLC  214


 Score =   183 bits (464),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++GT+LSASVLVGLTT+ ILFCSHFHQID D+AVGK SPLVR+GT+ G++VV+ 
Sbjct  238   GLSHLPLTGTVLSASVLVGLTTTFILFCSHFHQIDGDRAVGKMSPLVRIGTRAGSKVVRF  297

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              +++LY L +  G  KTLP   + L  LT+P+G++V+ YVE+NH D  KIFMAKYYCVRL
Sbjct  298   GIVSLYFLLLAFGLCKTLPLTCVFLCALTLPVGKIVVDYVEENHNDNNKIFMAKYYCVRL  357

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GL +AR
Sbjct  358   HALFGIALALGLWLAR  373



>ref|NP_001152170.1| LOC100285808 [Zea mays]
 gb|ACG46195.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Zea mays]
Length=362

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 130/178 (73%), Gaps = 2/178 (1%)
 Frame = +3

Query  429  RWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGS  608
            R + +    + PR     R   + A  E  E  +SR TL+WRA KLPIYSVAL+PLTVGS
Sbjct  22   RSRVATSAARRPRALQRARCSATAASGEAGE--LSRATLLWRAAKLPIYSVALIPLTVGS  79

Query  609  AAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGT  788
            A+AY  AGLF   RY  LL ++VL+ITWLNLSNDVYD DTGAD++KKESVV+I GSR  T
Sbjct  80   ASAYYHAGLFFTKRYFVLLTAAVLVITWLNLSNDVYDSDTGADRDKKESVVSITGSRAMT  139

Query  789  LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              AA  SL LGF GL+WA  ++ ++R ILL+ SAI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  140  QNAANFSLFLGFAGLLWAFAEAKDIRFILLVISAIFCGYVYQCPPFRLSYQGLGEPLC  197


 Score =   176 bits (447),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GTK+G+ +V  
Sbjct  222   GAALLPLTKTVIASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRIGTKSGSRIVSI  281

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY L    G   +LP + I+L  LT+PMG+ V+ YV K+HED  KIFMAKYYCVRL
Sbjct  282   GIVMLYILLATFGTCGSLPPSCIVLCALTLPMGKTVVDYVLKHHEDNAKIFMAKYYCVRL  341

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  342   HALFGMALASGLVLAR  357



>gb|AFK47288.1| unknown [Lotus japonicus]
Length=203

 Score =   190 bits (483),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ DK VGK SPLVRLGT  GAEVV+  V+ 
Sbjct  59    FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDKEVGKMSPLVRLGTNRGAEVVQVVVLM  118

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L    G +K LP   I+L  LT+PMG +V+ +V++NH+DK+KIFMAKY+CVRLHALF
Sbjct  119   LYALLFTFGLSKALPLTCILLCTLTLPMGNLVVRFVQENHKDKSKIFMAKYFCVRLHALF  178

Query  1474  GATLAAGLVVARFFARNYNMRPV  1542
             G  LA G+V+AR     +  RP+
Sbjct  179   GTALAFGMVLARVVNTTFTSRPI  201


 Score = 70.9 bits (172),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  861   LRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTRLFVF  1034
             +R++L L+ AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT+AFYLLQ S  +  +
Sbjct  1     MRSMLFLSCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATSAFYLLQGSASVMTY  58



>gb|ACN26005.1| unknown [Zea mays]
 gb|ACR36889.1| unknown [Zea mays]
 tpg|DAA43808.1| TPA: 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Zea mays]
Length=362

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 129/178 (72%), Gaps = 2/178 (1%)
 Frame = +3

Query  429  RWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGS  608
            R + +    + PR     R   + A  E  E  +S  TL+WRA KLPIYSVAL+PLTVGS
Sbjct  22   RSRVATSAARRPRALQRARCSATAASGEAGE--LSHATLLWRAAKLPIYSVALIPLTVGS  79

Query  609  AAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGT  788
            A+AY  AGLF   RY  LL ++VL+ITWLNLSNDVYD DTGAD++KKESVV+I GSR  T
Sbjct  80   ASAYYHAGLFFTKRYFVLLTAAVLVITWLNLSNDVYDSDTGADRDKKESVVSITGSRAMT  139

Query  789  LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              AA  SL LGF GL+WA  ++ ++R ILL+ SAI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  140  QNAANFSLFLGFAGLLWAFAEAKDIRFILLVISAIFCGYVYQCPPFRLSYQGLGEPLC  197


 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GTK G+ +V  
Sbjct  222   GAALLPLTKTVIASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRIGTKAGSRIVSI  281

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY L    G   +LP + I+L  LT+PMG+ V+ YV K+HED  KIFMAKYYCVRL
Sbjct  282   GIVMLYILLATFGTCGSLPPSCIVLCALTLPMGKTVVDYVLKHHEDNAKIFMAKYYCVRL  341

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  342   HALFGMALASGLVLAR  357



>ref|XP_003558621.2| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X1 [Brachypodium distachyon]
Length=368

 Score =   213 bits (542),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  525  NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +SR TL+WRA KLPIYSVALVPLTVGSAAAY  AGLF   RY  LLA++VL+ITWLNLS
Sbjct  59   ELSRATLLWRAAKLPIYSVALVPLTVGSAAAYNNAGLFFAKRYFGLLAAAVLVITWLNLS  118

Query  705  NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
            NDVYD DTGADKNKKESVVN+VGSR  T  AA +SL LGF GL WA  ++ ++R I L+ 
Sbjct  119  NDVYDSDTGADKNKKESVVNLVGSRAVTQYAANISLLLGFVGLFWAFAEAGDVRFIFLVI  178

Query  885  SAITCGYIYQCPPFRLSYQGLGEPLC  962
             AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  179  CAIACGYVYQCPPFRLSYRGLGEPLC  204


 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G  +LP++ T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTK GA +V  
Sbjct  228   GIMLLPLNKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKAGARLVTL  287

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY+L +  G TK LPS+ I+L  LT+P+G+ V+ YV KNH+D +KIFMAKYYCVRL
Sbjct  288   GIVTLYTLLVAFGITKCLPSSCIVLGALTLPLGKWVVDYVLKNHDDNSKIFMAKYYCVRL  347

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  348   HALFGMALASGLVLAR  363



>ref|XP_002465728.1| hypothetical protein SORBIDRAFT_01g044560 [Sorghum bicolor]
 gb|EER92726.1| hypothetical protein SORBIDRAFT_01g044560 [Sorghum bicolor]
Length=362

 Score =   213 bits (541),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +3

Query  501  AINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVL  680
            A + E  E +SR TL+WRA KLPIYSVALVPLTVGSA+AY  AGLF   RY  LL ++VL
Sbjct  45   AASGEAGE-LSRATLLWRAAKLPIYSVALVPLTVGSASAYHHAGLFFTKRYFVLLTAAVL  103

Query  681  IITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSAN  860
            +ITWLNLSNDVYD DTGADKNKKESVV+I GSR  T  AA +SL LGF GL WA  ++ +
Sbjct  104  VITWLNLSNDVYDSDTGADKNKKESVVSITGSRAMTQNAANISLFLGFAGLFWAFAEARD  163

Query  861  LRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +R ILL+ SAI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  164  IRFILLVMSAIFCGYVYQCPPFRLSYQGLGEPLC  197


 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GTK G+ +V  
Sbjct  222   GMALLPLTKTVIASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRIGTKAGSRIVSI  281

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY L    G  ++LP A I+L  LT+PMG++V+ YV KNHED TKIFMAKYYCVRL
Sbjct  282   GILTLYILLAAFGLCRSLPPACIVLCALTLPMGKLVVDYVLKNHEDNTKIFMAKYYCVRL  341

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GL +AR
Sbjct  342   HALFGMALASGLFLAR  357



>ref|XP_006593110.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Glycine max]
Length=277

 Score =   186 bits (471),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGTILSAS+LVG TTSLILFCSHFHQ++ D+ VGK SPLVRLGTK GAEVVK ++  
Sbjct  78    FPLSGTILSASILVGFTTSLILFCSHFHQVEGDREVGKMSPLVRLGTKKGAEVVKGAIFM  137

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G  K LP   I L  LT+PMG +V+ +VE N++DK KIFMAKY+CVRLHALF
Sbjct  138   LYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYKDKNKIFMAKYFCVRLHALF  197

Query  1474  GATLAAGLVVAR  1509
             G  LA GLV+AR
Sbjct  198   GVALALGLVLAR  209


 Score = 71.2 bits (173),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  858   NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             N+R+IL L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  19    NIRSILFLVCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  72



>gb|EMS49790.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic 
[Triticum urartu]
Length=507

 Score =   215 bits (547),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  525  NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +SR TL+WRA +LPIYSVALVPLTVG+AAAY  AGLF   RY  LLA++VL+ITWLNLS
Sbjct  58   ELSRATLLWRAARLPIYSVALVPLTVGTAAAYNHAGLFFARRYFGLLAAAVLVITWLNLS  117

Query  705  NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
            NDVYD DTGADKNKKESVVNIVGSR  T  AA VSL LGF GL WA  ++ ++R I+L+ 
Sbjct  118  NDVYDSDTGADKNKKESVVNIVGSRAATQYAANVSLLLGFGGLFWAFAEAGDVRFIVLVL  177

Query  885  SAITCGYIYQCPPFRLSYQGLGEPLC  962
             AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  178  CAILCGYVYQCPPFRLSYRGLGEPLC  203


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 13/81 (16%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             ++LP+S T++++S+LVGLTT+LILFCSHFHQ             VR+GTKTGA +V  ++
Sbjct  229   ALLPLSKTVIASSILVGLTTTLILFCSHFHQ-------------VRIGTKTGATLVTVAI  275

Query  1288  MALYSLTIILGFTKTLPSASI  1350
               LY+L    G ++ LP + I
Sbjct  276   GTLYTLLTAFGISRCLPPSCI  296



>gb|AAN64152.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=346

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  480  CRARHSDAINEEKEENI--SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRY  653
            C A  + A  E   +++  SR TL+WRA KLPIYSVALVPLTVGSA AY   G F   RY
Sbjct  43   CSATATAASGEGAGDDVELSRGTLLWRAAKLPIYSVALVPLTVGSACAYHHVGSFFGKRY  102

Query  654  LALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL  833
              LL +SVL+ITWLNLSNDVYD DTGADKNKKESVVNIVGSRT T  AA +SL  GF GL
Sbjct  103  FVLLVASVLVITWLNLSNDVYDSDTGADKNKKESVVNIVGSRTMTQYAANISLLFGFMGL  162

Query  834  VWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             WA  Q+ + R IL +  AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  163  FWAFAQAGDARFILSVTCAIICGYVYQCPPFRLSYRGLGEPLC  205


 Score =   134 bits (337),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP+S T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTKTG+ +V  
Sbjct  229   GTALLPLSKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKTGSRLVTL  288

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
              V+ LY L    G +K+LPSA  +L  LT+P+G+ V+ YV KNHE
Sbjct  289   GVVTLYVLLAAFGMSKSLPSACTVLCALTLPVGKWVVDYVLKNHE  333



>gb|EAY88854.1| hypothetical protein OsI_10327 [Oryza sativa Indica Group]
Length=346

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  480  CRARHSDAINEEKEENI--SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRY  653
            C A  + A  E   +++  SR TL+WRA KLPIYSVALVPLTVGSA AY   G F   RY
Sbjct  43   CSATATAASGEGAGDDVELSRGTLLWRAAKLPIYSVALVPLTVGSACAYHHVGSFFGKRY  102

Query  654  LALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL  833
              LL +SVL+ITWLNLSNDVYD DTGADKNKKESVVNIVGSRT T  AA +SL  GF GL
Sbjct  103  FVLLVASVLVITWLNLSNDVYDSDTGADKNKKESVVNIVGSRTMTQYAANISLLFGFMGL  162

Query  834  VWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             WA  Q+ + R IL +  AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  163  FWAFAQAGDARFILSVTCAIICGYVYQCPPFRLSYRGLGEPLC  205


 Score =   134 bits (337),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP+S T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTKTG+ +V  
Sbjct  229   GTALLPLSKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKTGSRLVTL  288

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
              V+ LY L    G +K+LPSA  +L  LT+P+G+ V+ YV KNHE
Sbjct  289   GVVTLYVLLAAFGMSKSLPSACTVLCALTLPVGKWVVDYVLKNHE  333



>ref|NP_001049226.1| Os03g0190100 [Oryza sativa Japonica Group]
 gb|ABF94394.1| 1,4-dihydroxy-2-naphthoate phytyltransferase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11140.1| Os03g0190100 [Oryza sativa Japonica Group]
 dbj|BAG88170.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89917.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58470.1| hypothetical protein OsJ_09720 [Oryza sativa Japonica Group]
Length=369

 Score =   209 bits (533),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  480  CRARHSDAINEEKEENI--SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRY  653
            C A  + A  E   +++  SR TL+WRA KLPIYSVALVPLTVGSA AY   G F   RY
Sbjct  43   CSATATAASGEGAGDDVELSRGTLLWRAAKLPIYSVALVPLTVGSACAYHHVGSFFGKRY  102

Query  654  LALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL  833
              LL +SVL+ITWLNLSNDVYD DTGADKNKKESVVNIVGSRT T  AA +SL  GF GL
Sbjct  103  FVLLVASVLVITWLNLSNDVYDSDTGADKNKKESVVNIVGSRTMTQYAANISLLFGFMGL  162

Query  834  VWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             WA  Q+ + R IL +  AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  163  FWAFAQAGDARFILSVTCAIICGYVYQCPPFRLSYRGLGEPLC  205


 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP+S T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTKTG+ +V  
Sbjct  229   GTALLPLSKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKTGSRLVTL  288

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              V+ LY L    G +K+LPSA  +L  LT+P+G+ V+ YV KNHED +KIFMAKYYCVRL
Sbjct  289   GVVTLYVLLAAFGMSKSLPSACTVLCALTLPVGKWVVDYVLKNHEDNSKIFMAKYYCVRL  348

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  349   HALFGMALASGLVLAR  364



>ref|XP_001764177.1| predicted protein [Physcomitrella patens]
 gb|EDQ71018.1| predicted protein [Physcomitrella patens]
Length=285

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  507  NEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLII  686
             E +EE +S+  LIWRA+KLP+YSVA +PLTVG+AAAYLQ+G+ S+ RY  LL SS L+I
Sbjct  5    KEAQEEELSQAILIWRAIKLPLYSVAFIPLTVGAAAAYLQSGVISMGRYWLLLGSSFLVI  64

Query  687  TWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLR  866
            TWLNLSND YD +TG DK KKESVVNI GS+ G L AAY  L LG  G+V A+ Q  ++R
Sbjct  65   TWLNLSNDAYDAETGVDKGKKESVVNITGSQRGVLSAAYACLVLGAMGIVKAAQQIGDMR  124

Query  867  AILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             + L ++AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  125  VVALFSAAILCGYVYQCPPFRLSYKGLGEPLC  156


 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             L ++ T+L A+VLVG+TT+LILFCSHFHQID D +VGK SPLVRLGT+ G++VV+A+V++
Sbjct  184   LAVTPTVLGAAVLVGITTALILFCSHFHQIDGDLSVGKMSPLVRLGTEKGSKVVQAAVVS  243

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNH  1413
             LY++  +L   K LP     LS+LT+P+GR+V+ ++ KNH
Sbjct  244   LYTIITLLTALKALPVTCFALSLLTVPIGRLVLQFIGKNH  283



>ref|XP_006649533.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Oryza brachyantha]
Length=373

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +3

Query  480  CRARHSDAINEEKEE-NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYL  656
            C A  + A  E  E+  +SR TL+WRA KLPIYSVALVPLTVGSA AY  AG F   RY 
Sbjct  48   CCATATAASGEGAEDGELSRGTLLWRAAKLPIYSVALVPLTVGSACAYHHAGSFFGKRYF  107

Query  657  ALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLV  836
             LLA++VL+ITWLNLSNDVYD DTGADK+KKESVV+I+GSRT T  AA +SL  GF GL 
Sbjct  108  VLLAAAVLVITWLNLSNDVYDSDTGADKDKKESVVHIIGSRTVTQNAANISLLFGFVGLF  167

Query  837  WASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            WA  ++ + R ILL+  AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  168  WAFAKAGDARFILLVICAILCGYVYQCPPFRLSYKGLGEPLC  209


 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S+LP++ T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTK G+ +V  
Sbjct  233   GTSLLPLNKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKMGSRLVTL  292

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              V+ LY L    G +K LPS   +L   T+P+G++V+ YV  NHED  KIFMAKYYCVRL
Sbjct  293   GVVMLYVLLAAFGMSKCLPSTCTVLCAFTLPVGKLVVDYVLNNHEDNNKIFMAKYYCVRL  352

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GLV+AR
Sbjct  353   HALFGMALACGLVLAR  368



>gb|KDO45009.1| hypothetical protein CISIN_1g023777mg [Citrus sinensis]
 gb|KDO45010.1| hypothetical protein CISIN_1g023777mg [Citrus sinensis]
Length=199

 Score =   182 bits (462),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             L+ S   +  L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G
Sbjct  45    LLGSTRENLCLSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERG  104

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             + VVK +VM LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAK
Sbjct  105   SVVVKWAVMILYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAK  164

Query  1444  YYCVRLHALFGATLAAGLVVAR  1509
             YYCVR HALFGA L AGL+ AR
Sbjct  165   YYCVRFHALFGAALVAGLITAR  186


 Score = 68.2 bits (165),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  873   LLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTR  1022
             +LL  A+ CGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLL  STR
Sbjct  1     MLLTCAVICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATTAFYLLLGSTR  50



>ref|XP_011087910.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X1 [Sesamum indicum]
Length=400

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 180/255 (71%), Gaps = 15/255 (6%)
 Frame = +3

Query  261   GFGFSKVNYCYFHNQGHSFSRLTKFDFAINSVLPHSVYRSFCCIGCTNRCNSWSALRWQE  440
             G+G +KVNY Y  N+  + +R+    + + S LP +  R+ C    T  C + +A+R   
Sbjct  12    GYGVNKVNY-YLSNR-RNINRI----YQVLS-LPDAGQRALC----TRTCFNETAIRQLH  60

Query  441   SRRQCQHPRHFYSCRARHSDAINEEKEENISRT-TLIWRAVKLPIYSVALVPLTVGSAAA  617
             S  +  H      CRA H+++  EE++E    T TLIWRA+KLP+Y+VALVP+TVGSAAA
Sbjct  61    S--EGVHHGTLLKCRAEHTESSIEEEKEERISTATLIWRAIKLPMYTVALVPITVGSAAA  118

Query  618   YLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIA  797
             Y+Q G +   RYL L+ SSV II WLNLSNDVYDFDTGADKNKKESVVN+VG RTGT I 
Sbjct  119   YMQTGQYFGERYLKLVVSSVFIIAWLNLSNDVYDFDTGADKNKKESVVNLVG-RTGTHIL  177

Query  798   AYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafg  977
             A++ L LG  GL   SL++ ++R+I LLA AI CGYIYQCPPFRLSY GLGEPLCFAAFG
Sbjct  178   AWLLLALGLAGLTRVSLEAGSVRSISLLAYAIICGYIYQCPPFRLSYLGLGEPLCFAAFG  237

Query  978   pfattafYLLQSSTR  1022
             PFATTAFY LQ   R
Sbjct  238   PFATTAFYWLQGGPR  252


 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKT  1332
             VGLTTSLILFCSHFHQIDDDKAVGK SPLVRLGT+ GA+ VK +V  LYSL  ILG  +T
Sbjct  267   VGLTTSLILFCSHFHQIDDDKAVGKRSPLVRLGTEGGAKAVKVAVGLLYSLLFILGLGQT  326

Query  1333  LPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVARF  1512
             LP ++++L  LT+PMG++V+ +VE+NH +K KIFMAKYYCVRLH LFG  LAAGL  ARF
Sbjct  327   LPFSAVVLGALTLPMGKLVVRFVEENHREKRKIFMAKYYCVRLHTLFGGALAAGLFAARF  386

Query  1513  FARN  1524
             FAR 
Sbjct  387   FARK  390



>ref|XP_010065683.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X1 [Eucalyptus grandis]
 ref|XP_010065684.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X2 [Eucalyptus grandis]
Length=153

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+LVG TTSLILFCSHFHQ+++D AVGK SPLVRLGT+ G+ VVK ++
Sbjct  7     NCLPLTGTVLCASLLVGFTTSLILFCSHFHQVEEDTAVGKISPLVRLGTEKGSSVVKVAI  66

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +  G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKY+CVRLHA
Sbjct  67    TALYSLLLTFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYHCVRLHA  126

Query  1468  LFGATLAAGLVVARFFARNY  1527
             LFGA+LAAGLV+A+F  + Y
Sbjct  127   LFGASLAAGLVMAKFVCKRY  146



>gb|KCW63303.1| hypothetical protein EUGRSUZ_G00932 [Eucalyptus grandis]
Length=260

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+L+G TTSLILFCSHFHQ+++D  VGK SPLVRLGT+ G+ VVK ++
Sbjct  114   NCLPLTGTVLCASLLIGFTTSLILFCSHFHQVEEDTTVGKISPLVRLGTEKGSSVVKVAI  173

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +I G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKYYCVRLHA
Sbjct  174   TALYSLLLIFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYYCVRLHA  233

Query  1468  LFGATLAAGLVVARFFARNYNMR  1536
             LFGA+LAAGLV+A+F ++ Y  R
Sbjct  234   LFGASLAAGLVIAKFVSKRYIPR  256


 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +3

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
            SNDVYDFDTGADKNK+ESVVN++GSRTGTL+AAY+ L LG  GL W SL++ +LRA+LLL
Sbjct  5    SNDVYDFDTGADKNKRESVVNLIGSRTGTLLAAYMFLVLGLIGLTWVSLEAGHLRAMLLL  64

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPLC  962
            A AI CGYIYQCPPFRLSY GLGEPLC
Sbjct  65   ACAIFCGYIYQCPPFRLSYHGLGEPLC  91



>dbj|BAJ91549.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  525  NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +SR TL+WRA KLPIYSVALVPLTVG+AAAY  AGLF   RY  LLA++VL+ITWLNLS
Sbjct  59   ELSRATLLWRAAKLPIYSVALVPLTVGAAAAYNHAGLFFAGRYFGLLAAAVLVITWLNLS  118

Query  705  NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
            NDVYD DTGADKNKKESVVNIVGSR  T  AA +SL LGF GL WA  ++ ++R I+L+ 
Sbjct  119  NDVYDSDTGADKNKKESVVNIVGSRAVTQYAANLSLLLGFGGLFWAFAEAGDVRFIVLVL  178

Query  885  SAITCGYIYQCPPFRLSYQGLGEPLC  962
             AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  179  CAILCGYVYQCPPFRLSYRGLGEPLC  204


 Score =   181 bits (459),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LPI+ T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTKTG+ VV  
Sbjct  228   GTALLPITKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKTGSTVVTL  287

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             ++ ALY+L    G ++ LP + I+L  LT+P+G+ V+ YV++NH+D  KIFMAKYYCVRL
Sbjct  288   AIGALYALLAAFGISRCLPPSCIVLGALTLPLGKWVVDYVQRNHDDDAKIFMAKYYCVRL  347

Query  1462  HALFGATLAAGLVVAR  1509
             HA+ G  LA+GL +AR
Sbjct  348   HAVLGMALASGLALAR  363



>ref|XP_011043107.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Populus euphratica]
Length=377

 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 4/145 (3%)
 Frame = +1

Query  1093  SMLGDS----ILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKT  1260
             S+LG +    ILP++G ILSAS+LVG TT+LILFCSHFHQ+++DKAVGK+SPLVRLGT+ 
Sbjct  228   SILGSTSEMRILPLTGAILSASLLVGFTTTLILFCSHFHQVEEDKAVGKFSPLVRLGTER  287

Query  1261  GAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMA  1440
             G+ VVK +V  LYSL    G ++TLP A I+L  LT+P+G++V+ +VE+N++DK KIFMA
Sbjct  288   GSGVVKVAVAMLYSLLFAFGLSRTLPLACILLCSLTLPVGKLVVGFVEENYKDKGKIFMA  347

Query  1441  KYYCVRLHALFGATLAAGLVVARFF  1515
             KY+CVRLHALFGA LA+GLV AR F
Sbjct  348   KYFCVRLHALFGAALASGLVAARAF  372


 Score =   177 bits (450),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 111/176 (63%), Gaps = 25/176 (14%)
 Frame = +3

Query  438  ESRRQCQHPRHFYSCRARHSDAINE-EKEENISRTTLIWRAVKLPIYSVALVPLTVGSAA  614
            E ++  Q  R F    A ++D  +E E  E++ + TLIWRAVKLPIYSVALVPLTVG AA
Sbjct  63   EFKKGIQCWRAFSGSIANYADNAHEGESGEDVPQATLIWRAVKLPIYSVALVPLTVGGAA  122

Query  615  AYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLI  794
            AYL+ G+FS  RY  LL SS+LIITWLNLS  V                          I
Sbjct  123  AYLETGIFSARRYFLLLVSSILIITWLNLSRSV------------------------AFI  158

Query  795  AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            AAY SL LGF GL W S+   N+ AIL LA AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  159  AAYSSLLLGFVGLAWTSMGEGNVPAILFLACAILCGYVYQCPPFRLSYQGLGEPLC  214



>gb|EPS57604.1| hypothetical protein M569_17213, partial [Genlisea aurea]
Length=200

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = +3

Query  519   EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
             + NISR  L WRA+KLPIY+VAL+P+TVG AAAYLQ G++   RYL LL SSVL+I WLN
Sbjct  1     DHNISREILAWRAIKLPIYTVALIPITVGCAAAYLQTGVYFGKRYLVLLVSSVLVIAWLN  60

Query  699   LSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILL  878
             LSNDVYDFDTGAD+NK+ESVV +VGSR  T  AA++ L LG  GL   ++++ N++ +LL
Sbjct  61    LSNDVYDFDTGADENKRESVVKLVGSRRWTHSAAWLLLALGMTGLGSVAVEAQNMKPLLL  120

Query  879   LASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTRLFVFLI  1040
             L  ++ CGY+YQCPPFRLSY+G+GEPLCFAAFGP ATTAFYLLQ+ TR FVF I
Sbjct  121   LCCSVLCGYVYQCPPFRLSYKGVGEPLCFAAFGPLATTAFYLLQTRTR-FVFAI  173



>gb|EYU26903.1| hypothetical protein MIMGU_mgv1a021810mg [Erythranthe guttata]
Length=190

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +1

Query  1105  DSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKAS  1284
              S LPI+ TI+ +S+LVGLTTSLILFCSHFHQI DDKAVGK SPLVRLGT+TG+ VVK +
Sbjct  43    KSELPITSTIVWSSILVGLTTSLILFCSHFHQIKDDKAVGKMSPLVRLGTETGSRVVKFA  102

Query  1285  VMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             V+ LYS+ ++LGFT+ LP AS+IL  +T+PMG +V+S+VEKNH DKTKIFM KY CVRLH
Sbjct  103   VVGLYSIILVLGFTQNLPLASVILCAMTLPMGNLVVSFVEKNHMDKTKIFMGKYLCVRLH  162

Query  1465  ALFGATLAAGLVVARFFA  1518
              +FGA LAAGLVVAR FA
Sbjct  163   TVFGAALAAGLVVARKFA  180



>ref|XP_008804771.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X4 [Phoenix dactylifera]
Length=225

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++GT+LSASVLVGLTT+ ILFCSHFHQID D+AVGK SPLVR+GT+ G++VV+ 
Sbjct  85    GLSHLPLTGTVLSASVLVGLTTTFILFCSHFHQIDGDRAVGKMSPLVRIGTRAGSKVVRF  144

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              +++LY L +  G  KTLP   + L  LT+P+G++V+ YVE+NH D  KIFMAKYYCVRL
Sbjct  145   GIVSLYFLLLAFGLCKTLPLTCVFLCALTLPVGKIVVDYVEENHNDNNKIFMAKYYCVRL  204

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GL +AR
Sbjct  205   HALFGIALALGLWLAR  220


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  795  AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            AA +SL LG  GL+WAS+++ ++R+ILL+A AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  6    AANISLALGLMGLIWASIEAGDVRSILLVAYAILCGYVYQCPPFRLSYQGLGEPLC  61



>gb|KDO45011.1| hypothetical protein CISIN_1g023777mg [Citrus sinensis]
Length=166

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
             L I+ T+LSAS+LVGLTTSLILFCSHFHQ++ D+ VGK SPLVRLGT+ G+ VVK +VM 
Sbjct  22    LSITATVLSASLLVGLTTSLILFCSHFHQVEGDRNVGKMSPLVRLGTERGSVVVKWAVMI  81

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LYSL   +G ++ LP + I L  +T P+G++V+SYVE+NH+DK KIFMAKYYCVR HALF
Sbjct  82    LYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKGKIFMAKYYCVRFHALF  141

Query  1474  GATLAAGLVVAR  1509
             GA L AGL+ AR
Sbjct  142   GAALVAGLITAR  153



>ref|XP_008804770.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X3 [Phoenix dactylifera]
Length=260

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G S LP++GT+LSASVLVGLTT+ ILFCSHFHQID D+AVGK SPLVR+GT+ G++VV+ 
Sbjct  120   GLSHLPLTGTVLSASVLVGLTTTFILFCSHFHQIDGDRAVGKMSPLVRIGTRAGSKVVRF  179

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              +++LY L +  G  KTLP   + L  LT+P+G++V+ YVE+NH D  KIFMAKYYCVRL
Sbjct  180   GIVSLYFLLLAFGLCKTLPLTCVFLCALTLPVGKIVVDYVEENHNDNNKIFMAKYYCVRL  239

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA GL +AR
Sbjct  240   HALFGIALALGLWLAR  255


 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  675  VLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQS  854
            +L+ITWLNLSNDVYDFDTGAD++KKESVVNI+GSR  T  AA +SL LG  GL+WAS+++
Sbjct  1    MLVITWLNLSNDVYDFDTGADRHKKESVVNIIGSRMVTQYAANISLALGLMGLIWASIEA  60

Query  855  ANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             ++R+ILL+A AI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  61   GDVRSILLVAYAILCGYVYQCPPFRLSYQGLGEPLC  96



>ref|XP_010229059.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic isoform X2 [Brachypodium distachyon]
Length=368

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G  +LP++ T++++S+LVGLTT+LILFCSHFHQID D+AVGK SPLVR+GTK GA +V  
Sbjct  228   GIMLLPLNKTVIASSILVGLTTTLILFCSHFHQIDGDRAVGKMSPLVRIGTKAGARLVTL  287

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY+L +  G TK LPS+ I+L  LT+P+G+ V+ YV KNH+D +KIFMAKYYCVRL
Sbjct  288   GIVTLYTLLVAFGITKCLPSSCIVLGALTLPLGKWVVDYVLKNHDDNSKIFMAKYYCVRL  347

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  348   HALFGMALASGLVLAR  363


 Score =   182 bits (461),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  525  NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +SR TL+WRA KLPIYSVALVPLT G A  +  A    ++     L ++VL+ITWLNLS
Sbjct  59   ELSRATLLWRAAKLPIYSVALVPLTEGIANIWCCAMTNPISILYLRLDAAVLVITWLNLS  118

Query  705  NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
            NDVYD DTGADKNKKESVVN+VGSR  T  AA +SL LGF GL WA  ++ ++R I L+ 
Sbjct  119  NDVYDSDTGADKNKKESVVNLVGSRAVTQYAANISLLLGFVGLFWAFAEAGDVRFIFLVI  178

Query  885  SAITCGYIYQCPPFRLSYQGLGEPLC  962
             AI CGY+YQCPPFRLSY+GLGEPLC
Sbjct  179  CAIACGYVYQCPPFRLSYRGLGEPLC  204



>ref|WP_015218328.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanobacterium 
aponinum]
 ref|YP_007160641.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanobacterium 
aponinum PCC 10605]
 gb|AFZ52597.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanobacterium 
aponinum PCC 10605]
Length=309

 Score =   117 bits (292),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 94/159 (59%), Gaps = 5/159 (3%)
 Frame = +3

Query  501  AINEEK-----EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALL  665
            ++ EEK     EE  S+  L + A+K P+Y+VA++P+  G+A AY + G+F+   ++  L
Sbjct  2    SVAEEKIKPIVEEIPSKGKLWYAAIKPPMYTVAVIPICFGTALAYGETGIFNPLIFVTFL  61

Query  666  ASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWAS  845
             S++LII WLNLSND +D  TG D NK  SVVN+ G+       + + L LG  G++  +
Sbjct  62   FSAILIIAWLNLSNDFFDSYTGIDVNKAHSVVNLTGNAPLIFWISNICLALGLMGIIMIN  121

Query  846  LQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            L   +   + L+ +    GY YQ PPFR  Y GLGE +C
Sbjct  122  LWLGDWTVMGLIFACCFLGYTYQGPPFRFGYLGLGEIIC  160


 Score =   105 bits (262),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 88/145 (61%), Gaps = 1/145 (1%)
 Frame = +1

Query  1069  TFRD*LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRL  1248
             TF    IAS         S + L ASVL+G++TS+ILFCSHFHQ++DD   GK SP+VRL
Sbjct  163   TFGPMAIASAYYSQAQNFSVSSLWASVLIGISTSIILFCSHFHQVEDDIKAGKKSPIVRL  222

Query  1249  GTKTGAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTK  1428
             GT  GA+V+  S +  Y L I+  F   LP +S+I+  L++P    +I++V +NH+  + 
Sbjct  223   GTANGAKVLTTSTLVFYGLCILFTFLHLLPYSSLIV-FLSLPPAIKMINHVHENHDRPSL  281

Query  1429  IFMAKYYCVRLHALFGATLAAGLVV  1503
             +  +K+  V+ H   G  L+  L++
Sbjct  282   VQNSKFIAVKYHFFSGLLLSVSLIL  306



>gb|ACN29030.1| unknown [Zea mays]
Length=225

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GTK G+ +V  
Sbjct  85    GAALLPLTKTVIASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRIGTKAGSRIVSI  144

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY L    G   +LP + I+L  LT+PMG+ V+ YV K+HED  KIFMAKYYCVRL
Sbjct  145   GIVMLYILLATFGTCGSLPPSCIVLCALTLPMGKTVVDYVLKHHEDNAKIFMAKYYCVRL  204

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  205   HALFGMALASGLVLAR  220


 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  795  AAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            AA  SL LGF GL+WA  ++ ++R ILL+ SAI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  5    AANFSLFLGFAGLLWAFAEAKDIRFILLVISAIFCGYVYQCPPFRLSYQGLGEPLC  60



>ref|WP_010872655.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Synechocystis sp. 
PCC 6803]
 ref|NP_441350.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechocystis 
sp. PCC 6803]
 ref|YP_005383216.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803 substr. GT-I]
 ref|YP_005386385.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803 substr. PCC-P]
 ref|YP_005409092.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803 substr. PCC-N]
 ref|YP_005651407.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803]
 ref|YP_007451232.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803]
 sp|P73962.1|MENA_SYNY3 RecName: Full=1,4-dihydroxy-2-naphthoate phytyltransferase; Short=DHNA-phytyltransferase 
[Synechocystis sp. PCC 6803 substr. 
Kazusa]
 dbj|BAA18030.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803]
 dbj|BAK50202.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803]
 dbj|BAL29201.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803 substr. GT-I]
 dbj|BAL32370.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803 substr. PCC-N]
 dbj|BAL35539.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803 substr. PCC-P]
 dbj|BAM51789.1| 1,4-dihydroxy-2-naphthoateoctaprenyltransferase [Synechocystis 
sp. PCC 6803]
 gb|AGF51718.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Synechocystis 
sp. PCC 6803]
Length=307

 Score =   117 bits (292),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+Y+VA+VP+TVGSA AY   G +    +   L S++ II W+NLSNDV+D DTG 
Sbjct  22    AIKPPMYTVAVVPITVGSAVAYGLTGQWHGDVFTIFLLSAIAIIAWINLSNDVFDSDTGI  81

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D  K  SVVN+ G+R    + +   L  G  GL+  S ++ +   + L+  AI  GY YQ
Sbjct  82    DVRKAHSVVNLTGNRNLVFLISNFFLLAGVLGLMSMSWRAQDWTVLELIGVAIFLGYTYQ  141

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL Y GLGE +C   FGP A  A Y  QS +
Sbjct  142   GPPFRLGYLGLGELICLITFGPLAIAAAYYSQSQS  176


 Score =   100 bits (250),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S  +L+ SV VG++T++ILFCSHFHQ++DD A GK SP+VRLGTK G++V+  SV++LY 
Sbjct  178   SWNLLTPSVFVGISTAIILFCSHFHQVEDDLAAGKKSPIVRLGTKLGSQVLTLSVVSLYL  237

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             +T I       P  ++++ + ++P    +I +V + H+   ++   K+  V LH   G  
Sbjct  238   ITAIGVLCHQAPWQTLLI-IASLPWAVQLIRHVGQYHDQPEQVSNCKFIAVNLHFFSGML  296

Query  1483  LAAG  1494
             +AAG
Sbjct  297   MAAG  300



>ref|WP_015141929.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pleurocapsa minor]
 ref|YP_007079178.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pleurocapsa sp. 
PCC 7327]
 gb|AFY75621.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pleurocapsa sp. 
PCC 7327]
Length=303

 Score =   117 bits (292),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 103/169 (61%), Gaps = 12/169 (7%)
 Frame = +3

Query  531   SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
             SR  L   A+K P+YSVA++P+T+G+A A+ +   F    + A L +++LII WLNLSND
Sbjct  10    SRRKLWLAAIKPPMYSVAIIPITMGTAVAFAETNRFHQEIFFAFLGAAILIIAWLNLSND  69

Query  711   VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVS------LELGFCGLVWASLQSANLRAI  872
             V+D +TG DKNK ESVVN+ G++T   +  ++S        LG   + W   Q   +  I
Sbjct  70    VFDSETGIDKNKAESVVNLTGNKT---LVFWISNLLLGLGILGIISIAWLQ-QDWMVLGI  125

Query  873   LLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             +LL  A+  GY YQ PPFRL YQGLGE +CF  FGP    A Y  Q+ T
Sbjct  126   VLLCCAL--GYSYQGPPFRLGYQGLGEIICFVTFGPLTIAAAYYSQAKT  172


 Score =   100 bits (248),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS ++GL+TS+ILFCSHFHQ++DD A GK SP+VR+GT  G++V+     +L+  T++
Sbjct  178   LAASAIIGLSTSIILFCSHFHQVEDDLAAGKRSPIVRMGTARGSQVLAWLTASLFVFTVL  237

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                 +  P  S +L   ++P+   ++ +V+++H++   +   K+  V LH + G  LA G
Sbjct  238   FVLLRVFP-VSTLLIFGSLPLANRLVRHVQQHHDNPEIVRTCKFLAVNLHFVSGILLALG  296

Query  1495  LVVAR  1509
              V+ R
Sbjct  297   FVLPR  301



>ref|WP_015216392.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena cylindrica]
 ref|YP_007158686.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena cylindrica 
PCC 7122]
 gb|AFZ59776.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena cylindrica 
PCC 7122]
Length=299

 Score =   117 bits (293),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +3

Query  513   EKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITW  692
             + + +I +  L   A+K P+YSVA++P+ VGSA A+ +  +F+   +   + +++LI+ W
Sbjct  3     QNQISIPKNKLWLAAIKPPMYSVAIMPIWVGSAVAFAETKVFNGVIFAVFMTAAILILAW  62

Query  693   LNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLR  866
              N+SNDV+D +TG D+NK  S+VN+ G +        + L  G  G++  +L  Q   + 
Sbjct  63    ENISNDVFDAETGIDQNKHHSLVNLTGDKQLMFWLGNLCLGSGLLGIIAIALLQQDPAVI  122

Query  867   AILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             AI+LL  A+  GY+YQ PPFRL YQGLGE LCF AFGP   TA Y  Q+ T
Sbjct  123   AIILLCCAL--GYMYQGPPFRLGYQGLGEILCFFAFGPLGMTAAYYSQTQT  171


 Score = 98.6 bits (244),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 77/126 (61%), Gaps = 1/126 (1%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+ASV+VG+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT+TGA+V+     ++Y  T
Sbjct  175   TNLAASVIVGIVTSLVLFCSHFHQVKDDIAAGKKSPIVRLGTETGAKVLVWFTASIYPFT  234

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLA  1488
             ++       P  + +LS L++P    +  +V +NH    K+   K+  V++H L    L 
Sbjct  235   MLFVILNIFPIWT-LLSFLSLPYAYKLCRHVLENHNQPDKVNNCKFIAVKVHFLSCLFLG  293

Query  1489  AGLVVA  1506
              G V+ 
Sbjct  294   IGFVIG  299



>ref|XP_008680598.1| PREDICTED: LOC100285808 isoform X1 [Zea mays]
Length=344

 Score =   176 bits (446),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G ++LP++ T++++SVLVGLTT+LILFCSHFHQID D AVGK SPLVR+GTK G+ +V  
Sbjct  204   GAALLPLTKTVIASSVLVGLTTTLILFCSHFHQIDGDLAVGKMSPLVRIGTKAGSRIVSI  263

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
              ++ LY L    G   +LP + I+L  LT+PMG+ V+ YV K+HED  KIFMAKYYCVRL
Sbjct  264   GIVMLYILLATFGTCGSLPPSCIVLCALTLPMGKTVVDYVLKHHEDNAKIFMAKYYCVRL  323

Query  1462  HALFGATLAAGLVVAR  1509
             HALFG  LA+GLV+AR
Sbjct  324   HALFGMALASGLVLAR  339


 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 105/178 (59%), Gaps = 20/178 (11%)
 Frame = +3

Query  429  RWQESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGS  608
            R + +    + PR     R   + A  E  E  +S  TL+WRA KLPIYSVAL+PLT   
Sbjct  22   RSRVATSAARRPRALQRARCSATAASGEAGE--LSHATLLWRAAKLPIYSVALIPLT---  76

Query  609  AAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGT  788
               ++    F +   + +  S + ++              GAD++KKESVV+I GSR  T
Sbjct  77   --NWIPRSCFGIGIAMTIHISRLCMVA-------------GADRDKKESVVSITGSRAMT  121

Query  789  LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              AA  SL LGF GL+WA  ++ ++R ILL+ SAI CGY+YQCPPFRLSYQGLGEPLC
Sbjct  122  QNAANFSLFLGFAGLLWAFAEAKDIRFILLVISAIFCGYVYQCPPFRLSYQGLGEPLC  179



>ref|WP_016874824.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Chlorogloeopsis 
fritschii]
Length=303

 Score =   120 bits (301),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 102/167 (61%), Gaps = 0/167 (0%)
 Frame = +3

Query  519   EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
               N +   L   A+K P+YSVA++P+ VG+A A+ +  +F+   +   LA+++LI+ W N
Sbjct  10    NHNPTNRKLWMAAIKPPMYSVAMMPIWVGTAVAFTETKIFNAAIFFTFLAAAILILAWEN  69

Query  699   LSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILL  878
             LSNDV+D +TG DKNK  S+VN+ G++    +   + L LG  G++  +    +   I L
Sbjct  70    LSNDVFDSETGIDKNKPHSLVNLTGNKLLIFLLGNLFLCLGLLGILAIAWWQHDPTVIGL  129

Query  879   LASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             +      GY+YQ PPFRL YQGLGE LCF AFGP A +A Y  Q+ T
Sbjct  130   IVVCCILGYLYQGPPFRLGYQGLGEILCFFAFGPLAVSAAYYSQTQT  176


 Score = 93.6 bits (231),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 74/123 (60%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LIL+CSHFHQ++DD A GK SP+VRLGT+ GA+V+     ++Y  T +
Sbjct  182   LAASVIVGIATTLILYCSHFHQVEDDLAAGKRSPIVRLGTQRGAQVLHWFTGSIYIFTFL  241

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS +++P    +  +V++NH    K+   K+  V +H        AG
Sbjct  242   FVLWGIFPVWT-LLSWVSLPFAIKLCRHVQENHYQPEKVSNCKFIAVAVHFWCCLLFGAG  300

Query  1495  LVV  1503
              +V
Sbjct  301   FIV  303



>ref|WP_028090904.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Dolichospermum 
circinale]
Length=299

 Score =   121 bits (304),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA A+ +  +F+ T +   +A+S+LI+ W N+SNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGSAVAFRETKIFNFTIFSLFIAASILILAWENISNDVFDAETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D+NK  S+VN+ G++T       + L LGF  ++  +L   +   I+++      GY+YQ
Sbjct  77    DQNKHHSLVNLTGNKTLMFWLGNLCLGLGFLAIIAIALWQKDPTIIVIILLCCGLGYMYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF AFGP    A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEILCFFAFGPLGMGAAYYSQTQT  171


 Score = 92.0 bits (227),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS+++GL TSL+LFCSHFHQ+ DD A GK SP+VRLGT+ GA+V+      +Y L ++
Sbjct  177   LAASIILGLVTSLVLFCSHFHQVADDIAAGKKSPIVRLGTQAGAKVLVVFTTIIYPLILL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS L++P    +  +V +NH    K+  +K+  + +H L    L  G
Sbjct  237   FVILNIFPICT-LLSFLSLPFAVKLCRHVLENHHQPDKVSNSKFIAINVHFLSCLFLGLG  295

Query  1495  LV  1500
              +
Sbjct  296   FI  297



>ref|WP_015178934.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoria nigro-viridis]
 ref|YP_007118144.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ09728.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoria nigro-viridis 
PCC 7112]
Length=298

 Score =   119 bits (298),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P++VG+A A+ +    + + +   L S++LII WLNLSNDV+D +TG 
Sbjct  17    AIKPPMYSVAVIPISVGTAIAFAETQTINWSIFSTFLISAILIIAWLNLSNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             DKNK  S+VN+ G++T     A + L +G  G+   S    +   ILL+      GY YQ
Sbjct  77    DKNKAHSLVNLTGNKTLIFGLANLFLAVGVSGICAISWWQKDPTVILLVVLCCALGYTYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE +CF  FGP A  A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEIICFFTFGPLALAAAYYSQTQT  171


 Score = 93.6 bits (231),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T  +AS +VG+TTS+ILFCSHFHQ++DD A GK SP+VRLGTK GA++++    ++Y+
Sbjct  173   SATNFAASAIVGITTSIILFCSHFHQVEDDLAAGKKSPIVRLGTKKGAQLLQWLCGSVYA  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT++       P  ++++   ++P    +  +V   H+   K+  +K+  V LH   G  
Sbjct  233   LTVLFVALGMFPIWTLLI-FGSLPFAIDLCRHVTDYHDQPGKVSNSKFIAVTLHFSSGLL  291

Query  1483  LAAGLVV  1503
             LA G V+
Sbjct  292   LALGFVL  298



>ref|WP_015170623.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Geitlerinema sp. 
PCC 7407]
 ref|YP_007108107.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Geitlerinema sp. 
PCC 7407]
 gb|AFY65055.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Geitlerinema sp. 
PCC 7407]
Length=302

 Score =   117 bits (292),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 98/163 (60%), Gaps = 0/163 (0%)
 Frame = +3

Query  531   SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
             +R  L   A+K P+Y+VA++P+ VG+A A+      + T +   L S+VLII WLNLSND
Sbjct  10    NRKKLWMAAIKPPMYTVAVIPIWVGTAIAFFDLQGINQTIFWTFLGSAVLIIAWLNLSND  69

Query  711   VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
             V+D +TG D NK  SVVN+ G+++     A ++L  G  G++  +    +   I L+  A
Sbjct  70    VFDSETGIDVNKPHSVVNLTGNKSLVFWIANLALISGILGVLSIAWWQQDFTVIGLVLVA  129

Query  891   ITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
                GY YQ PPFRL YQGLGE +CF  FGP A  A Y  Q+ T
Sbjct  130   CALGYTYQGPPFRLGYQGLGEIICFFTFGPLAVAAAYYSQAQT  172


 Score = 95.9 bits (237),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S   L+ASV+VG+ TS+ILFCSHFHQ+ +D A GK SP+VRLGT  GA ++       Y 
Sbjct  174   SSNSLAASVIVGVLTSVILFCSHFHQVKEDVAAGKRSPIVRLGTLRGARLLPWICGVTYG  233

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             L  +L     LP  + +LS++++P+   ++ +V + H+   K+   K+  V LH  +G  
Sbjct  234   LNAMLAIAGILPPWT-LLSLISVPLAHKLVRHVRQFHDQPEKVSNCKFIAVGLHFWYGLM  292

Query  1483  LAAGLVVA  1506
                G  VA
Sbjct  293   FGLGYWVA  300



>gb|EPS59958.1| hypothetical protein M569_14848, partial [Genlisea aurea]
Length=164

 Score =   169 bits (427),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 104/163 (64%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  525   NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             NISR TL+WRA+KLP+Y+VAL+P+TVGSAAAYLQ GL+   RYL LL S V++I WLNLS
Sbjct  1     NISRETLLWRAIKLPMYTVALIPVTVGSAAAYLQTGLYFWNRYLVLLVSFVIVIAWLNLS  60

Query  705   NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
             NDVYDFDTGAD NK+ESVVN+ G+R  T  AA++ L LG  GL   ++++ N++ +LLL 
Sbjct  61    NDVYDFDTGADVNKRESVVNLSGNRALTHAAAWLLLALGMTGLGSVAVEARNMKPLLLLC  120

Query  885   SAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQS  1013
              ++ C Y YQ PPFR SY+G+GEPL FAAFGP ATTAFYLLQ+
Sbjct  121   CSVLCFYAYQGPPFRWSYKGVGEPLLFAAFGPLATTAFYLLQT  163



>ref|XP_008358355.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like, partial [Malus domestica]
Length=270

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  1147  VLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFT  1326
             +LVG+TT+LILFCSHFHQI+ D+AVGK SPLVRLGT+ G+ VVK +V  LY LT   G +
Sbjct  136   LLVGITTALILFCSHFHQIEGDRAVGKISPLVRLGTERGSGVVKWAVTGLYVLTFTFGLS  195

Query  1327  KTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               LP   I L  LT+P+ R+V+SYVE+NH DK KIFMAKYYCVRLH+LFG  LAAGLVV+
Sbjct  196   SALPFTCIFLCCLTLPIARLVVSYVEENHNDKQKIFMAKYYCVRLHSLFGTALAAGLVVS  255

Query  1507  RFFAR  1521
             R F +
Sbjct  256   RMFPK  260


 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +3

Query  663   LASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWA  842
             L +SVLIITWLNLSNDVYDFDTGAD NKKESVVN+VGSRTGTL++AY+ L LGF GL W 
Sbjct  1     LXTSVLIITWLNLSNDVYDFDTGADINKKESVVNLVGSRTGTLVSAYLLLALGFLGLAWV  60

Query  843   SLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTR  1022
             S+++ ++RAILLL  A+TCGYIYQCPPFRLSY+GLGEPLCFAAFGPFATT  YLLQ ST+
Sbjct  61    SVKAGSMRAILLLGCAVTCGYIYQCPPFRLSYKGLGEPLCFAAFGPFATTGXYLLQGSTK  120

Query  1023  L  1025
             L
Sbjct  121   L  121



>gb|EMT04177.1| Putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Aegilops 
tauschii]
Length=265

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  594  LTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVG  773
            + VG+A AY  AGLF   RY  LLA++VL+ITWLNLSNDVYD DTGADKNKKESVVNIVG
Sbjct  1    MVVGTAVAYNHAGLFFARRYFGLLAAAVLVITWLNLSNDVYDSDTGADKNKKESVVNIVG  60

Query  774  SRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGE  953
            SR  T  AA VSL LGF GL WA  ++ ++R I+L+  AI CGY+YQCPPFRLSY+GLGE
Sbjct  61   SRAVTEYAANVSLLLGFGGLFWAFAEAGDVRFIVLVLCAILCGYVYQCPPFRLSYRGLGE  120

Query  954  PLC  962
            PLC
Sbjct  121  PLC  123


 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 22/136 (16%)
 Frame = +1

Query  1102  GDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKA  1281
             G  +LP++ T++++S+LVGLTT+LILFCSHFHQI+ D+AVGK SPLVR+GTKTGA +V  
Sbjct  147   GAVLLPLTKTVIASSILVGLTTTLILFCSHFHQIEGDRAVGKMSPLVRIGTKTGATLVTV  206

Query  1282  SVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRL  1461
             ++ ALY+L    G ++ LP + I                      D TKIFMAKYYCVRL
Sbjct  207   AIGALYTLLAAFGISRCLPPSCI----------------------DDTKIFMAKYYCVRL  244

Query  1462  HALFGATLAAGLVVAR  1509
             HAL G  LA+GLV+AR
Sbjct  245   HALLGMALASGLVLAR  260



>ref|WP_015111493.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 
7107]
 ref|YP_007048403.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 
7107]
 gb|AFY41253.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 
7107]
Length=299

 Score =   121 bits (303),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 105/168 (63%), Gaps = 0/168 (0%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             K+ +  ++ L   A+K P+YSVA++P+ +G+A A+ +  +F+ T +   L +++LI+ W 
Sbjct  4     KQISHPKSKLWMAAIKPPMYSVAIMPIWIGTAIAFAETNIFNTTVFSTFLVAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             N+SNDV+D +TG DKNK  S+VN+ G ++     A + L +G  G++  +    +   I+
Sbjct  64    NMSNDVFDSETGIDKNKHHSLVNLTGKKSLIFWLANLCLVIGLLGILAIATWQQDPTVII  123

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++  A   G+IYQ PPFRL YQGLGE LCF AFGP    A Y  Q+ T
Sbjct  124   MVLLACGLGHIYQAPPFRLGYQGLGEILCFFAFGPLLVPAVYYSQTQT  171


 Score = 90.1 bits (222),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
              +ASV+VG+ TSLIL+CSHFHQ+ DD A GK SP+VRLGT  GA+V+     ++Y  +++
Sbjct  177   FAASVIVGIVTSLILYCSHFHQVKDDIAAGKRSPIVRLGTANGAKVLVWFTASIYPFSLL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  + +LS L++P    +  +V++NH    K+   K+  V +H
Sbjct  237   FILLGVFPVWT-LLSWLSLPSAIKLCRHVQQNHNQPEKVSNCKFIAVAVH  285



>ref|WP_006633954.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcoleus vaginatus]
 gb|EGK86339.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcoleus vaginatus 
FGP-2]
Length=298

 Score =   119 bits (298),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P++VG+A A+ +    + + +   L S++LII WLNLSNDV+D +TG 
Sbjct  17    AIKPPMYSVAVIPISVGTAIAFAETQTINSSNFSTFLMSAILIIAWLNLSNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             DKNK  S+VN+ G++      A + L +G  G+   S    +   ILL+      GY YQ
Sbjct  77    DKNKAHSLVNLTGNKALIFGLANLFLAVGVSGICAISWWQKDPTVILLVVLCCALGYTYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE +CF  FGP A  A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEIICFFTFGPLAFAAAYYSQTQT  171


 Score = 90.5 bits (223),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T  +AS +VG+TTS+ILFCSHFHQI DD A GK SP+VRLGTK GA++++    ++Y+
Sbjct  173   SATNFAASAIVGITTSIILFCSHFHQIADDLAAGKKSPIVRLGTKKGAQLLEWLCGSVYA  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             LT++       P  ++++   ++P    +  +V   H   TK+  +K+  V LH
Sbjct  233   LTVLFVALGMFPIWTLLI-FGSLPFAIDLCRHVTDYHNQPTKVSNSKFIAVTLH  285



>ref|WP_016950297.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Anabaena sp. PCC 
7108]
Length=299

 Score =   117 bits (294),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 104/169 (62%), Gaps = 0/169 (0%)
 Frame = +3

Query  513   EKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITW  692
             + + +I +  L   A+K P+YSVA++P+ VGSA A+ +  + + T +   +A+++LI+ W
Sbjct  3     QNQISIPKNKLWLAAIKPPMYSVAIMPIWVGSAVAFAETKILNPTIFSIFIAAAILILAW  62

Query  693   LNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAI  872
              N+SNDV+D +TG DKNK  S+VN+ G++        + L  G  G++  +L   N   I
Sbjct  63    ENISNDVFDAETGIDKNKHHSLVNLTGNKQLMFWLGNLCLGSGLLGIIAIALLQQNPTVI  122

Query  873   LLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              ++      GY+YQ PPFRL YQGLGE LCF AFGP  T+A Y  Q+ T
Sbjct  123   GIILLCCGLGYMYQGPPFRLGYQGLGEILCFFAFGPLGTSAAYYSQTQT  171


 Score = 92.0 bits (227),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+ASV+VG+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT+TGA+V+     ++Y   
Sbjct  175   TNLAASVIVGIVTSLVLFCSHFHQVKDDIAAGKRSPIVRLGTQTGAKVLVWFTASIYPFN  234

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             ++       P  + +LS +++P    +  +V +NH    K+   K+  V +H
Sbjct  235   LLFVLLGIFPVWT-LLSWVSLPFAFKLCRHVLENHNQPDKVSNCKFIAVAVH  285



>ref|XP_006607039.1| PREDICTED: uncharacterized protein LOC100813101 [Glycine max]
Length=350

 Score =   134 bits (338),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ D+ VGK SPLVRLGTK GAEVVK ++  
Sbjct  244   FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDREVGKMSPLVRLGTKKGAEVVKGAIFM  303

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
             LY+L +  G  K LP   I L  LT+PMG +V+ +VE N++
Sbjct  304   LYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYK  344


 Score = 72.4 bits (176),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  858   NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             N+R+IL L  AI CGYIYQCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  185   NIRSILFLVCAIICGYIYQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  238



>ref|WP_011319395.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Anabaena variabilis]
 ref|YP_323142.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Anabaena variabilis 
ATCC 29413]
 gb|ABA22247.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena variabilis 
ATCC 29413]
Length=301

 Score =   108 bits (270),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 103/170 (61%), Gaps = 4/170 (2%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             K+ + ++  L   A+K P+YSVA++P+ VGSA A+ +  +F++  +   + +++LI+ W 
Sbjct  4     KQISHTKIKLWMAAIKPPMYSVAIMPIWVGSAVAFAENKVFNLAVFSTFIFAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRA  869
             N+SNDV+D +TG D NK  S+VN+ G +        + L  G  G++  +   Q   +  
Sbjct  64    NISNDVFDSETGIDVNKHHSLVNLTGKKALVFWLGNLCLVSGLSGILAIATWQQDPTVIG  123

Query  870   ILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             I+LL   +  GY+YQ PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  124   IILLCCGL--GYMYQGPPFRLGYQGLGEILCFFAFGPLGVSAGYYSQTQT  171


 Score = 97.8 bits (242),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 76/129 (59%), Gaps = 7/129 (5%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVV---KASVMALY  1299
             T L+ASV+VG+ TSLILFCSHFHQ+DDD   GK SP+VRLGT  GA+V+    AS+    
Sbjct  175   TSLAASVIVGIVTSLILFCSHFHQVDDDIKAGKRSPIVRLGTANGAKVLTWFTASIYPFS  234

Query  1300  SLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGA  1479
              L +ILGF         +LS L++P    +  +V++NH    K+   K+  V +H     
Sbjct  235   LLFVILGFFPVW----TLLSWLSLPYAFKLCRHVQQNHNQPEKVSNCKFIAVAVHFWSCL  290

Query  1480  TLAAGLVVA  1506
              L  G V+A
Sbjct  291   LLGLGFVIA  299



>ref|WP_002782974.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa]
 emb|CCI12656.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9806]
Length=302

 Score =   120 bits (302),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 98/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18    ALKPPMYSVAIIPIILGTAIAYQETGRFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D NK  S+VN+ G+++     + + L LG  G++  S    +   + L+A     GY YQ
Sbjct  78    DVNKAHSIVNLTGNKSLIFWLSNLFLLLGIAGILAISYGRGDWTILELIALCCFLGYTYQ  137

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE +CF  FGP A  A Y  Q+ T
Sbjct  138   GPPFRLGYQGLGEIICFFTFGPLAIAAAYYSQAGT  172


 Score = 85.1 bits (209),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS++VG+TTS+ILFCSHFHQ+DDD   GK SP+ RLGT  G++V+    + +Y LT++
Sbjct  178   LAASIIVGITTSIILFCSHFHQVDDDLKAGKKSPIARLGTLKGSKVLTVVTVLVYVLTVV  237

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                 +  P  ++++  L++P    ++++V +NH+    +   K+  V LH   G   + G
Sbjct  238   FVLLQVYPPLTLLI-FLSLPFAWQLVNHVNQNHDQPQLVSNCKFIAVNLHFFSGLLFSLG  296

Query  1495  LVVA  1506
               +A
Sbjct  297   YCLA  300



>ref|XP_010068285.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Eucalyptus grandis]
Length=303

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+LVG TTSLILFCSHFHQ+++D  VGK SPLVRLGT+ G+ VVK ++
Sbjct  183   NCLPLTGTVLCASLLVGFTTSLILFCSHFHQVEEDTTVGKISPLVRLGTEKGSSVVKVAI  242

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
              ALYSL +  G ++ LPS+ IIL +LT+PMG  V+S+V++NHEDK  IFMAKY+CVRLHA
Sbjct  243   TALYSLLLTFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHEDKRSIFMAKYHCVRLHA  302

Query  1468  L  1470
              
Sbjct  303   F  303


 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  768  VGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGL  947
            VGSRTGTL+AAY+ L LG  GL W SL++ +LRA++LLA AI CGYIYQCPPFRLSY GL
Sbjct  96   VGSRTGTLLAAYMFLVLGLIGLTWVSLEAGHLRAMMLLACAIICGYIYQCPPFRLSYHGL  155

Query  948  GEPLC  962
            GE LC
Sbjct  156  GETLC  160



>ref|XP_010096941.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Morus notabilis]
 gb|EXB66518.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Morus notabilis]
Length=337

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             LI S +G    P++G+ILSAS+LVG TT+LILFCSHFHQ + D AVGK SPLVR+GT+ G
Sbjct  185   LIGSGIGQ---PLTGSILSASLLVGFTTTLILFCSHFHQTEGDLAVGKLSPLVRIGTERG  241

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAK  1443
             A+VVK ++ ALY LT   G +  LP   I+L   T+PM R+V+SYVE+NH+DK KIFMAK
Sbjct  242   AQVVKLAITALYLLTFGFGLSSKLPFTCILLCAFTLPMARLVVSYVEENHKDKQKIFMAK  301

Query  1444  YYCVRLHALFG  1476
             YYCVRLH +FG
Sbjct  302   YYCVRLHTVFG  312


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +3

Query  606  SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
            SAAA+ Q G+FS  RY  +L SSV IITWLNLSNDVYDFDTGADKNKKESVVN++GS  G
Sbjct  132  SAAAFFQTGIFSSGRYFVVLVSSVFIITWLNLSNDVYDFDTGADKNKKESVVNLIGSGIG  191

Query  786  TLIAAYV---SLELGF  824
              +   +   SL +GF
Sbjct  192  QPLTGSILSASLLVGF  207



>ref|WP_008199406.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis sp. 
T1-4]
 emb|CCI31573.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
sp. T1-4]
Length=318

 Score =   119 bits (297),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  34   ALKPPMYSVAIIPIILGTAIAYQETGRFSLPIFATFILSAILILAWLNLSNDVFDADTGI  93

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  94   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYGRGDWTILELIALCCFLGYTYQ  153

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  154  GPPFRLGYQGLGEIIC  169


 Score = 85.9 bits (211),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 85/146 (58%), Gaps = 1/146 (1%)
 Frame = +1

Query  1069  TFRD*LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRL  1248
             TF    IA+     +   S + L+AS++VG+TTS+ILFCSHFHQ+DDD   GK SP+ RL
Sbjct  172   TFGPLAIAAAYYSQVGAFSLSSLAASIIVGITTSIILFCSHFHQVDDDLKAGKKSPIARL  231

Query  1249  GTKTGAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTK  1428
             GT  G++V+    + +Y LT++    +  P  ++++  L++P    ++++V +NH+    
Sbjct  232   GTLKGSKVLTVVTVLVYVLTVVFVLLQVYPPLTLLI-FLSLPFAWQLVNHVNQNHDQPQL  290

Query  1429  IFMAKYYCVRLHALFGATLAAGLVVA  1506
             +   K+  V LH   G   + G  +A
Sbjct  291   VSNCKFIAVNLHFFSGILFSLGYCLA  316



>ref|XP_006590098.1| PREDICTED: uncharacterized protein LOC100788238 [Glycine max]
Length=412

 Score =   134 bits (338),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ D+ VGK SPLVRLGTK GAEVVK ++  
Sbjct  306   FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDREVGKMSPLVRLGTKKGAEVVKGAIFM  365

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
             LY+L +  G  K LP   I L  LT+PMG +V+ +VE N++
Sbjct  366   LYALLVAFGLIKALPLTCIFLCALTLPMGNLVVRFVEDNYK  406


 Score = 68.6 bits (166),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  858   NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             N+R+IL L  AI CGYIYQCPPFRLSYQGLGEPL FAAFGPFAT AFYLL  S+
Sbjct  247   NIRSILFLVCAIICGYIYQCPPFRLSYQGLGEPLSFAAFGPFATCAFYLLHGSS  300



>ref|WP_015126781.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Calothrix sp. PCC 
7507]
 ref|YP_007063787.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Calothrix sp. PCC 
7507]
 gb|AFY30953.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Calothrix sp. PCC 
7507]
Length=298

 Score =   110 bits (275),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 0/168 (0%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             K+    +T L   A+K P+YSVA++P+ VG+A A+ +  +F+   +   +A+++LI+ W 
Sbjct  4     KQILYPKTKLWMAAIKPPMYSVAIMPIWVGTAVAFAETKIFNGVIFSTFVAAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             NLSNDV+D  TG D+NK  S+VN+ G++        + L +G   ++  +L   +   I 
Sbjct  64    NLSNDVFDSATGIDQNKHHSLVNLTGNKQLIFWMGNLCLGVGLLLIIAIALWQQDFTVIG  123

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++      GY YQ PPFRL YQGLGE +CF AFGP A +A Y  Q+ T
Sbjct  124   IILLCCALGYTYQGPPFRLGYQGLGEIICFFAFGPLAVSAAYYSQTQT  171


 Score = 92.0 bits (227),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L ASV+VG+ TSLILFCSHFHQ+ DD A GK SP+VRLGT   A+V+     ++Y 
Sbjct  173   STTSLLASVIVGIVTSLILFCSHFHQVKDDIAAGKRSPIVRLGTAKAAQVLTWFTGSIYP  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             L++I       P  + +LS +++P    +  +V+ NH    K+   K+  V +H      
Sbjct  233   LSLIFVLLGIFPVWT-LLSWVSLPFAFKLCCHVQANHHLPDKVNNCKFIAVAVHFWSCLL  291

Query  1483  LAAGLVV  1503
             L AG +V
Sbjct  292   LGAGFMV  298



>ref|XP_011087911.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like isoform X2 [Sesamum indicum]
Length=281

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKT  1332
             VGLTTSLILFCSHFHQIDDDKAVGK SPLVRLGT+ GA+ VK +V  LYSL  ILG  +T
Sbjct  148   VGLTTSLILFCSHFHQIDDDKAVGKRSPLVRLGTEGGAKAVKVAVGLLYSLLFILGLGQT  207

Query  1333  LPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVARF  1512
             LP ++++L  LT+PMG++V+ +VE+NH +K KIFMAKYYCVRLH LFG  LAAGL  ARF
Sbjct  208   LPFSAVVLGALTLPMGKLVVRFVEENHREKRKIFMAKYYCVRLHTLFGGALAAGLFAARF  267

Query  1513  FARN  1524
             FAR 
Sbjct  268   FARK  271


 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  702   SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
             SNDVYDFDTGADKNKKESVVN+VG RTGT I A++ L LG  GL   SL++ ++R+I LL
Sbjct  28    SNDVYDFDTGADKNKKESVVNLVG-RTGTHILAWLLLALGLAGLTRVSLEAGSVRSISLL  86

Query  882   ASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTR  1022
             A AI CGYIYQCPPFRLSY GLGEPLCFAAFGPFATTAFY LQ   R
Sbjct  87    AYAIICGYIYQCPPFRLSYLGLGEPLCFAAFGPFATTAFYWLQGGPR  133



>ref|WP_028084271.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Dolichospermum 
circinale]
Length=299

 Score =   108 bits (270),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 8/159 (5%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA A+ +  +F++T +   +A+S+LI+ W N+SNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGSAVAFRETKIFNLTIFSLFIAASILILAWENISNDVFDAETGI  76

Query  735   DKNKKESVVNIVGSRTGTL----IAAYVSLELGFCGLVWASLQSANLRAILLLASAITCG  902
             D+NK  S+VN+ G++T       +   + L       +W   +   +  I+LL   +  G
Sbjct  77    DQNKHHSLVNLTGNKTLMFWVGNLCLGLGLLGIIAIALWQ--KDPTIIGIILLCCGL--G  132

Query  903   YIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             YIYQ PPFRL YQGLGE LCF AFGP    A Y  Q+ T
Sbjct  133   YIYQGPPFRLGYQGLGEILCFFAFGPLGMGAAYYSQTQT  171


 Score = 92.8 bits (229),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 75/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L+AS+++G+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT+ GA+V+      +Y 
Sbjct  173   SSTNLAASIILGIVTSLVLFCSHFHQVADDIAAGKKSPIVRLGTQAGAKVLVVFTTIIYP  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             L ++       P  + +LS L++P    +  +V +NH    K+  +K+  + +H L    
Sbjct  233   LILLFVILNIFPICT-LLSFLSLPFAVKLCRHVLENHHQPDKVSNSKFIAINVHFLSCLF  291

Query  1483  LAAGLV  1500
             L  G +
Sbjct  292   LGLGFI  297



>ref|WP_027402297.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Aphanizomenon 
flos-aquae]
Length=299

 Score =   107 bits (266),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA A+ +  +F++T +   +A+++L++ W N+SNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGSAVAFREVKIFNITIFSLFIAAAILLLAWENISNDVFDAETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D+NK  S+VN+ G++T       + L LG  G++  +    +   I ++      GY+YQ
Sbjct  77    DQNKHHSLVNLTGNKTLMFWIGNLCLGLGLLGIIAIAFVQKDPTVIAIILLCCGLGYMYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF AFGP    A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEFLCFFAFGPLGMGAAYYSQTQT  171


 Score = 94.7 bits (234),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS+++G+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT+TGA+V+     ++Y LT++
Sbjct  177   LAASMILGIVTSLVLFCSHFHQVADDIAAGKKSPIVRLGTQTGAKVLVGFTASIYPLTLL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS L++P    +  +V +NH    K+  +K+  +R+  +    L  G
Sbjct  237   FVILNIFPIWT-LLSFLSLPFAIQLCRHVLENHNQPDKVSNSKFIAIRVQFVSCLFLGVG  295

Query  1495  LVVA  1506
              ++ 
Sbjct  296   FILG  299



>ref|WP_015137035.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 
7524]
 ref|YP_007074173.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 
7524]
 gb|AFY46576.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc sp. PCC 
7524]
Length=301

 Score =   110 bits (274),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             K+ + S++ L   A+K P+YSVA++P+ VG++ A+ +  + +V  +   +A+++LI+ W 
Sbjct  4     KQISRSQSKLWMAAIKPPMYSVAIMPIWVGTSVAFAENKIVNVGIFSTFIAAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRA  869
             N+SNDV+D +TG D NK  S+VN+ G +T       + L  G  G++  +   Q   +  
Sbjct  64    NISNDVFDSETGIDVNKHHSLVNLTGKKTLVFWLGNLCLIAGLLGILAIATWQQDPTIIG  123

Query  870   ILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             I+LL   +  GY+YQ PPFRL YQGLGE LCF AFGP   TA Y  Q+ T
Sbjct  124   IILLCCFL--GYMYQGPPFRLGYQGLGEVLCFFAFGPLGITAAYYSQTKT  171


 Score = 90.1 bits (222),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L+ASV+VG+ TSLILFCSHFHQ+ DD A GK SP+VRLGT TGA+V+      +Y 
Sbjct  173   SATSLAASVIVGIVTSLILFCSHFHQVKDDIAAGKRSPIVRLGTATGAKVLIWFTGIIYP  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
              T++       P  + +LS L++P    +  +V++NH    K+   K+  V +H      
Sbjct  233   FTLVFVLLGFFPLWT-LLSWLSLPYAFKLCRHVQQNHNQPEKVSNCKFIAVAVHFWSCLL  291

Query  1483  LAAGLVVA  1506
             L  G  +A
Sbjct  292   LGVGFAIA  299



>ref|WP_039203153.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Aphanizomenon 
flos-aquae]
 gb|KHG40393.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Aphanizomenon 
flos-aquae 2012/KM/D3]
Length=299

 Score =   104 bits (260),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA A+ +  +F++T +   +A+++L++ W N+SNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGSAVAFREVKIFNITIFSLFIAAAILLLAWENISNDVFDAETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D+NK  S+VN+ G++T       + L LG  G++  +L   +   I ++      GY+YQ
Sbjct  77    DQNKHHSLVNLTGNKTLMFWIGNLCLGLGLLGIIAIALVQKDPTVIAIILLCCGLGYMYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE +CF AFGP    A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEFICFFAFGPLGMGAAYYSQTQT  171


 Score = 94.7 bits (234),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS+++G+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT+TGA+V+     ++Y LT++
Sbjct  177   LAASMILGIVTSLVLFCSHFHQVADDIAAGKKSPIVRLGTQTGAKVLVGFTASIYPLTLL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS L++P    +  +V +NH    K+  +K+  +R+  +    L  G
Sbjct  237   FVVLNIFPIWT-LLSFLSLPFAIQLCRHVLENHNQPDKVSNSKFIAIRVQFVSCLFLGVG  295

Query  1495  LVVA  1506
              ++ 
Sbjct  296   FILG  299



>ref|WP_026103115.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Pseudanabaena 
sp. PCC 6802]
Length=298

 Score =   118 bits (296),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 106/177 (60%), Gaps = 0/177 (0%)
 Frame = +3

Query  510   EEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIIT  689
              + +++ ++  L   A+K P+YSVA++P+T G+A A+ + G+     +   L S++LI+ 
Sbjct  2     PDPQDSAAKRKLWLAAIKPPMYSVAIIPITTGTAIAFHETGIMHWGVFANFLISAILILV  61

Query  690   WLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRA  869
             W NLSNDV+D +TG D+NK  S+VN+ G ++     A + L LG  G++  S    N   
Sbjct  62    WENLSNDVFDSETGIDRNKAHSIVNLTGKKSAIFWLANICLMLGILGVLAISWWQRNFVV  121

Query  870   ILLLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSSTRLFVFLI  1040
             + L+A     GY YQ PPFR  Y+G GE +CF AFGP A +A Y  Q+ T  +V L+
Sbjct  122   VGLIALCCFLGYTYQGPPFRFGYRGWGEIICFFAFGPLAVSAAYYSQAQTYSWVALL  178


 Score = 79.7 bits (195),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S   L AS +VG+ TSLILFCSHFHQ +DD A GK SP+V+LGT   A ++     ++Y+
Sbjct  173   SWVALLASGIVGIVTSLILFCSHFHQAEDDIAAGKRSPIVKLGTSRSARLLPWLCGSIYA  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT +LG           L   ++P    + ++V +NH+    +   K+  V LH   G  
Sbjct  233   LT-LLGIGLGAFPIWTALVFTSLPAAIGLCTWVGRNHDRPELVNNCKFIAVGLHFWSGVC  291

Query  1483  LAAGLVV  1503
             L  G ++
Sbjct  292   LGLGFIL  298



>ref|WP_017655474.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microchaete sp. 
PCC 7126]
Length=298

 Score =   107 bits (267),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 100/168 (60%), Gaps = 0/168 (0%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             K+    +T L   A+K P+YSVA++P+ VG+A A+ Q  +F    +   L +++LI+ W 
Sbjct  4     KQITYPQTKLWLAAIKPPMYSVAIMPIWVGTAVAFTQTKIFHQAIFFTFLGAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             N++NDV+D  TG D+NK  S+VN+ G++        + L LG  G++  +    +L  I 
Sbjct  64    NITNDVFDSATGIDQNKHHSLVNLTGNKQLIFWLGNLCLGLGLLGIMAIAFWQQDLTVIG  123

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++      GY YQ PPFRL YQGLGE LCF AFGP A +A Y  Q+ T
Sbjct  124   IILLCCVLGYAYQGPPFRLGYQGLGEILCFFAFGPLAVSAAYYSQTKT  171


 Score = 90.5 bits (223),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L A+ +VG+ TSLILFCSHFHQ+ DD A GK SP+VRLGT   A+V+     ++Y 
Sbjct  173   STTNLLAAAIVGIVTSLILFCSHFHQVKDDIAAGKRSPVVRLGTAKAAQVLTWFTGSIYP  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT+I   +   P  + +L+ L++P    +  +V++NH    K+   K+  V +H      
Sbjct  233   LTLIFVLSGVFPVWT-LLTWLSLPFAFKLCRHVQENHHLPDKVNNCKFIAVAVHFWSCLL  291

Query  1483  LAAGLVV  1503
             L  G ++
Sbjct  292   LGVGFIL  298



>emb|CEG02143.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Ostreococcus tauri]
Length=403

 Score =   114 bits (284),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 109/197 (55%), Gaps = 4/197 (2%)
 Frame = +3

Query  429   RW-QESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             RW ++  R+ + P    + R            + +    L  RA K+P+YSVA +P+   
Sbjct  59    RWTRDGVRRTRMPGRARAVRGVEG---GSGAGDGVDAAELWRRAAKIPMYSVAWIPIACA  115

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
             ++  + Q G   V    AL   +  ++ WLNLSND +D  T  D  K ESVV ++G    
Sbjct  116   ASLVFCQYGKVDVKHLGALALGATAVVAWLNLSNDAFDATTNVDARKPESVVALLGGNAS  175

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
              + A  V   +  CGL+W + + A+  A   LA+AI  GY YQ PPFRLSY+GLGEP+CF
Sbjct  176   IVHAMAVVALVSGCGLLWGAARGASGVAWKALAAAIAMGYAYQGPPFRLSYKGLGEPICF  235

Query  966   aafgpfattafYLLQSS  1016
              AFGP ATTAFYL+ SS
Sbjct  236   LAFGPLATTAFYLMMSS  252


 Score = 83.2 bits (204),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 74/146 (51%), Gaps = 2/146 (1%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             +++S +  +   +   + S  VL+GLTT+ ILF SHFHQ + D+A GK SP+VR+G    
Sbjct  249   MMSSRVAAATSAVPAIVWSCGVLIGLTTAFILFTSHFHQEEGDRAAGKLSPVVRMGLPGA  308

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDK--TKIFM  1437
               V    + A Y+    L     LP  ++   ++T P+ R ++   +   +    + +F 
Sbjct  309   LLVADNLIGAHYATVATLAAAGWLPYTAVFGLIITYPLARHIVDQAQSTADAGAISDLFF  368

Query  1438  AKYYCVRLHALFGATLAAGLVVARFF  1515
              KY  VR H + G  LA G+   R +
Sbjct  369   TKYLAVRFHVIHGLALALGVCAQRAY  394



>gb|KFM27531.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic 
[Auxenochlorella protothecoides]
Length=278

 Score =   108 bits (271),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 89/146 (61%), Gaps = 1/146 (1%)
 Frame = +3

Query  588   VPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNI  767
             +P+ V +AA +   G   + R L L  SS+LII WLNLSND +D  TG D +K ES VNI
Sbjct  1     MPILVSAAAVFATTGQADMLRTLGLCLSSILIIAWLNLSNDYFDSLTGVDTHKYESWVNI  60

Query  768   VGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGL  947
               S     + A+ SL  G   L W   QS  + + +L A AI CGY+YQ PPFRLSYQGL
Sbjct  61    TRSPRTIFVTAHASLLAGAGMLFWLLSQSPAIASKMLYA-AICCGYLYQGPPFRLSYQGL  119

Query  948   GEPLCfaafgpfattafYLLQSSTRL  1025
             GE LCF AFGP A  AFYL Q +  L
Sbjct  120   GEALCFVAFGPLAVNAFYLAQGAPAL  145


 Score = 88.2 bits (217),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 0/122 (0%)
 Frame = +1

Query  1144  SVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGF  1323
             SVLVG++TS ILFCSHFHQ+  D A GK SP+VRLGT+TGA+V+K +V  ++   +    
Sbjct  153   SVLVGVSTSAILFCSHFHQVKGDLAAGKRSPIVRLGTETGAQVLKVTVGLVHVGLLATSL  212

Query  1324  TKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVV  1503
                LP      +++       ++S  EKN  D   +   K    R H LF   L  GLV+
Sbjct  213   LGYLPLTCWTSAMVAYGSANAMVSLAEKNAHDPEALRPLKLLATRWHILFCTMLCLGLVL  272

Query  1504  AR  1509
              R
Sbjct  273   KR  274



>ref|WP_013190658.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Trichormus azollae]
 ref|YP_003720763.1| 1,4-dihydroxy-2-naphthoate phytyltransferase ['Nostoc azollae' 
0708]
 gb|ADI63640.1| 1,4-dihydroxy-2-naphthoate phytyltransferase ['Nostoc azollae' 
0708]
Length=299

 Score =   112 bits (279),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 98/165 (59%), Gaps = 0/165 (0%)
 Frame = +3

Query  525   NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             ++ +  L   A+K P+YSVA++P+ VGS  A+ +  +F+   +   + +++LI+ W N+S
Sbjct  7     SMPKNKLWIAAIKPPMYSVAIMPIWVGSGVAFAETKIFNGVIFAVFMTAAILILAWENIS  66

Query  705   NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
             NDV+D +TG DKNK  S+VN+ G++        + L  G  G++  +L   +   I ++ 
Sbjct  67    NDVFDSETGIDKNKHHSLVNLSGNKQLMFWLGNLCLGSGLLGIIVIALLQKDPTVIGIIL  126

Query  885   SAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
                  GY+YQ PPFRL YQGLGE LCF AFGP    A Y  Q+ T
Sbjct  127   LCCGLGYMYQGPPFRLGYQGLGEILCFVAFGPLGMAAAYYSQTQT  171


 Score = 85.1 bits (209),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+ASV+VG+ TSL+LFCSHFHQI DD A GK SP+VRLGT+  A+V+     ++Y L+
Sbjct  175   TNLAASVIVGIVTSLVLFCSHFHQIKDDIAAGKRSPIVRLGTQKSAQVLVWFTASIYPLS  234

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH----ALFG  1476
             ++L      P  + +LS +++P    +  +V +NH+   K+   K+  V +H     LFG
Sbjct  235   LLLVGLGVFPIWT-LLSWVSLPFAFKLCRHVLENHDLPDKVSNCKFIAVTVHFWSCLLFG  293

Query  1477  ATLAAG  1494
                  G
Sbjct  294   TGFMLG  299



>ref|WP_027840956.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Mastigocoleus 
testarum]
Length=301

 Score =   105 bits (261),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 94/155 (61%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA+VP+ VGSA A+ +  +F    +   L S++ I+ W NLSNDV+D +TG 
Sbjct  17    AIKPPMYSVAIVPIWVGSAVAFWETKIFDGAVFYTFLVSAIFILAWENLSNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D+NK  S+VN+ G++        + L LG  G++  S    ++  I ++      GY+YQ
Sbjct  77    DRNKYHSLVNLTGNKLLVFWLGNLFLLLGLLGIIVISYWQRDVTVIGIILLCCFLGYLYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL Y+G+GE LCF AFGP    A Y  Q+ T
Sbjct  137   GPPFRLGYRGMGEILCFFAFGPLGVNAAYYSQTQT  171


 Score = 91.7 bits (226),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 76/122 (62%), Gaps = 5/122 (4%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
              +AS++VG+ TSLILFCSHFHQ++DD + GK SP+VR+GT+  A V+K    ++Y+ T  
Sbjct  177   FAASIIVGIATSLILFCSHFHQVEDDVSAGKQSPIVRMGTQKSATVLKWFTGSIYATT--  234

Query  1315  LGFTKT-LPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAA  1491
             LGF    L     +LS +++P G  +  +V +NH+   K+   K+  V +H  F + L  
Sbjct  235   LGFVAWGLFPVWTLLSWVSLPFGFQLCRHVGENHDQPEKVSNCKFIAVAVH--FWSCLLF  292

Query  1492  GL  1497
             GL
Sbjct  293   GL  294



>ref|WP_012412664.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Nostoc punctiforme]
 ref|YP_001869671.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Nostoc punctiforme 
PCC 73102]
 gb|ACC84728.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Nostoc punctiforme 
PCC 73102]
Length=298

 Score =   100 bits (249),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 103/168 (61%), Gaps = 1/168 (1%)
 Frame = +3

Query  519   EENISRTTLIWRA-VKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             ++ +  +T +W A +K P+YSVA++P+ VG+A A+ +  +F+   +   + +++LI+ W 
Sbjct  4     KQILYPSTKLWMAAIKPPMYSVAIMPIWVGTAVAFAETKVFNGAVFSTFVIAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             N+SNDV+D +TG D+NK  S+VN+  ++        + L LG  G++  +    +L  I 
Sbjct  64    NISNDVFDSETGIDQNKHHSLVNLTSNKPLVFWIGNLCLGLGLLGILAIAFWQQDLTVIA  123

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             ++      GY+YQ PPFRL YQGLGE LCF AFGP A  A Y  Q+ T
Sbjct  124   IILLCCVLGYMYQGPPFRLGYQGLGEILCFFAFGPLAVEAAYYSQTQT  171


 Score = 95.9 bits (237),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 77/125 (62%), Gaps = 3/125 (2%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L+ SV+VG+ T+LILFCSHFHQ+ DD A GK SP+VRLGT+ GA+V+     ++Y 
Sbjct  173   SMTSLAVSVIVGIATTLILFCSHFHQVKDDIAAGKRSPIVRLGTQKGAQVLVWFTASIYP  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT++       P  + +LS +++P    +  +V++NH    K+   K+  V +H  F A 
Sbjct  233   LTLLFVLLGISPGWT-LLSWVSLPFAVKLCRHVQENHNQPDKVSNCKFIAVAVH--FWAC  289

Query  1483  LAAGL  1497
             L  GL
Sbjct  290   LLFGL  294



>ref|WP_015211008.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cylindrospermum 
stagnale]
 ref|YP_007150454.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ27774.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cylindrospermum 
stagnale PCC 7417]
Length=299

 Score =   103 bits (257),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 100/168 (60%), Gaps = 0/168 (0%)
 Frame = +3

Query  516   KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             K+     T L   A+K P+YSVA++P+ VG+A A+ +  +F+   +   LA+++LI+ W 
Sbjct  4     KQILYPNTKLWMAAIKPPMYSVAIMPIWVGTAVAFAETKIFNAVVFSIFLAAAILILAWE  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             N+SNDV+D +TG D NK  S+VN+ G ++       + L LG  G++  +    +   I 
Sbjct  64    NISNDVFDSETGIDLNKHHSLVNLTGKKSLVFWLGNLCLGLGLLGILAIAFWQQDPTVIG  123

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             +++     GY+YQ PPFRL YQGLGE LCF AFGP    A Y  Q+ T
Sbjct  124   IISVCCGLGYMYQGPPFRLGYQGLGEILCFFAFGPLGMGAAYYSQTQT  171


 Score = 92.8 bits (229),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+AS +VG+ TSLILFCSHFHQ+ DD A GK SP+VRLGT  GA V+     ++Y LT
Sbjct  175   TNLAASAVVGIATSLILFCSHFHQVKDDIAAGKRSPIVRLGTAKGALVLIGFTASIYPLT  234

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLA  1488
             ++   +   P  + +LS +++P    +  +V++NH    K+   K+  V +H      L 
Sbjct  235   LLFVLSGLFPVWT-LLSWVSLPFAIKLCRHVQENHNQPEKVNNCKFIAVAVHFWSCLLLG  293

Query  1489  AGLVVA  1506
              G ++ 
Sbjct  294   VGFILG  299



>ref|WP_015080747.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena sp. 90]
 ref|YP_006997406.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena sp. 90]
 gb|AFW95593.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Anabaena sp. 90]
Length=299

 Score =   103 bits (257),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA A+ +  +F+   +   +A+++LI+ W N+SNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGSAVAFREIKIFNSIIFSLFIAAAILILAWENISNDVFDAETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D+NK  S+VN+ G++T       + L LG  G++  ++   +   I ++      GY+YQ
Sbjct  77    DQNKHHSLVNLTGNKTLMFWIGNLCLGLGLLGIIAIAILQKDPTVIAIILLCCCLGYMYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEILCFFAFGPLGMSAAYYSQTQT  171


 Score = 92.4 bits (228),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L+ASV++G+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT TGA+V+     ++Y 
Sbjct  173   SMTNLAASVILGIVTSLVLFCSHFHQVVDDIAAGKKSPIVRLGTHTGAKVLVGFTASIYP  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L ++       P  + +LS L++P    +  +V +NH    K+  +K+  +R+ 
Sbjct  233   LILLFVILNIFPIWT-LLSFLSLPFAVKLCRHVLENHNQPDKVSNSKFIAIRVQ  285



>ref|XP_003083066.1| Predicted membrane protein (ISS), partial [Ostreococcus tauri]
Length=515

 Score =   112 bits (281),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 109/197 (55%), Gaps = 4/197 (2%)
 Frame = +3

Query  429   RW-QESRRQCQHPRHFYSCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVG  605
             RW ++  R+ + P    + R            + +    L  RA K+P+YSVA +P+   
Sbjct  171   RWTRDGVRRTRMPGRARAVRGVEG---GSGAGDGVDAAELWRRAAKIPMYSVAWIPIACA  227

Query  606   SAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTG  785
             ++  + Q G   V    AL   +  ++ WLNLSND +D  T  D  K ESVV ++G    
Sbjct  228   ASLVFCQYGKVDVKHLGALALGATAVVAWLNLSNDAFDATTNVDARKPESVVALLGGNAS  287

Query  786   TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLCf  965
              + A  V   +  CGL+W + + A+  A   LA+AI  GY YQ PPFRLSY+GLGEP+CF
Sbjct  288   IVHAMAVVALVSGCGLLWGAARGASGVAWKALAAAIAMGYAYQGPPFRLSYKGLGEPICF  347

Query  966   aafgpfattafYLLQSS  1016
              AFGP ATTAFYL+ SS
Sbjct  348   LAFGPLATTAFYLMMSS  364


 Score = 82.8 bits (203),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 74/146 (51%), Gaps = 2/146 (1%)
 Frame = +1

Query  1084  LIASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTG  1263
             +++S +  +   +   + S  VL+GLTT+ ILF SHFHQ + D+A GK SP+VR+G    
Sbjct  361   MMSSRVAAATSAVPAIVWSCGVLIGLTTAFILFTSHFHQEEGDRAAGKLSPVVRMGLPGA  420

Query  1264  AEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDK--TKIFM  1437
               V    + A Y+    L     LP  ++   ++T P+ R ++   +   +    + +F 
Sbjct  421   LLVADNLIGAHYATVATLAAAGWLPYTAVFGLIITYPLARHIVDQAQSTADAGAISDLFF  480

Query  1438  AKYYCVRLHALFGATLAAGLVVARFF  1515
              KY  VR H + G  LA G+   R +
Sbjct  481   TKYLAVRFHVIHGLALALGVCAQRAY  506



>ref|WP_006619924.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Arthrospira platensis]
 gb|KDR58479.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
platensis str. Paraca]
Length=298

 Score =   109 bits (273),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 97/163 (60%), Gaps = 0/163 (0%)
 Frame = +3

Query  531   SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
             S + L   A+K P+YSVA++P+ VG+A A  + GL +   ++A L +++ I+ W NL ND
Sbjct  9     SNSKLWLAAIKPPMYSVAIMPIWVGTALAKSETGLINWGVFMAFLTAAIFILAWENLLND  68

Query  711   VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
             V+D +TG DKNK  S+VN+ G++   L    + L +    ++       +L    L+  +
Sbjct  69    VFDSETGIDKNKHHSLVNLTGNKALILTIGNICLVVAIAQIILICWWQQDLTIFGLIILS  128

Query  891   ITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
                GY+YQ PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  129   CFLGYLYQGPPFRLGYQGLGEFLCFFAFGPVGMSAVYYSQTQT  171


 Score = 85.1 bits (209),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LILFCSHFHQ++DD A GK SP+VRLGT+ GA+++     +++ LT+I
Sbjct  177   LAASVIVGIATTLILFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQILPWFCGSIFGLTLI  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P+ +++  V   P  ++   +V + H    ++   K+  V +H  F + L  G
Sbjct  237   AVVGGFFPAWTLLSFVGVFPAIQLC-RHVLQYHNQPQQVSNCKFIAVSVH--FWSCLLLG  293

Query  1495  L  1497
             L
Sbjct  294   L  294



>ref|WP_014274528.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
platensis]
 ref|YP_005067440.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
platensis NIES-39]
 dbj|BAI88902.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
platensis NIES-39]
Length=298

 Score =   108 bits (271),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 94/155 (61%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VG+A A  + GL +   ++A L +++ I+ W NL NDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGTALAKSETGLINWGVFMAFLTAAIFILAWENLLNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             DKNK  S+VN+ G++   L    + L +    ++       +L    L+  +   GY+YQ
Sbjct  77    DKNKHHSLVNLTGNKALILTIGNICLVVAIAQIMLICWWQQDLTIFGLIILSCFLGYLYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEFLCFFAFGPVGMSAVYYSQTQT  171


 Score = 84.7 bits (208),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LILFCSHFHQ++DD A GK SP+VRLGT+ GA+++     +++ LT+I
Sbjct  177   LAASVIVGIATTLILFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQILPWFCGSIFGLTLI  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
              G       A  +LS + +     +  +V + H    ++   K+  V +H  F + L  G
Sbjct  237   -GVVGGFFPAWTLLSFVGVFPAIQLCRHVLQYHNQPQQVSNCKFIAVSVH--FWSCLLLG  293

Query  1495  L  1497
             L
Sbjct  294   L  294



>gb|ABB51237.1| UbiA [Arthrospira platensis]
Length=298

 Score =   108 bits (270),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 94/155 (61%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VG+A A  + GL +   ++A L +++ I+ W NL NDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIWVGTALAKSETGLINWGVFMAFLTAAIFILAWENLLNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             DKNK  S+VN+ G++   L    + L +    ++       +L    L+  +   GY+YQ
Sbjct  77    DKNKHHSLVNLTGNKALILTIGNICLVVAIAQIMLICWWQQDLTIFGLIILSCFLGYLYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEFLCFFAFGPVGMSAVYYSQTQT  171


 Score = 84.3 bits (207),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LILFCSHFHQ++DD A GK SP+VRLGT+ GA+++     +++ LT+I
Sbjct  177   LAASVIVGIATTLILFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQILPWFCGSIFGLTLI  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
              G       A  +LS + +     +  +V + H    ++   K+  V +H  F + L  G
Sbjct  237   -GVVGGFFPAWTLLSFVGVFPAIQLCRHVLQYHNQPQQVSNCKFIAVSVH--FWSCLLLG  293

Query  1495  L  1497
             L
Sbjct  294   L  294



>ref|XP_009337905.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like, partial [Pyrus x bretschneideri]
Length=171

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 97/144 (67%), Gaps = 13/144 (9%)
 Frame = +3

Query  372  YRSFCCIGCTNRCNSWSAL--RWQESRRQCQH--------PRHFYSCRARHSDAINEEKE  521
            YR F  + C + CN+      R  E+RRQ QH            YS    H +  NEE +
Sbjct  31   YRGFATLSCFS-CNAQKVFLRREVEARRQWQHRGQAFVNNKSDCYSNTTIHQEEDNEEAD  89

Query  522  ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
              IS  TL WRA+KLPIYSVAL+PLTVGSAAAYLQ G+FS  RY  LL SSVLIITWLNL
Sbjct  90   --ISIATLTWRAIKLPIYSVALIPLTVGSAAAYLQTGMFSAQRYSILLISSVLIITWLNL  147

Query  702  SNDVYDFDTGADKNKKESVVNIVG  773
            SNDVYDFDTGAD NKKESVVN+VG
Sbjct  148  SNDVYDFDTGADINKKESVVNLVG  171



>ref|WP_010477786.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Acaryochloris sp. 
CCMEE 5410]
Length=296

 Score =   104 bits (260),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 101/166 (61%), Gaps = 0/166 (0%)
 Frame = +3

Query  522   ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
             + +    L + A+K P+YSVA++P+ VGSA A+ +    +   +   L++++LII WLNL
Sbjct  4     QTLPTRKLWFAALKPPMYSVAVIPIWVGSAIAWSEQQHLNAPIFWTFLSAAILIIAWLNL  63

Query  702   SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
             +NDV+D DTG D NK  S+VN+ G+++     A   L LG  GLV  +    ++  + L+
Sbjct  64    TNDVFDADTGIDVNKAHSLVNLTGNQSLIFWLANGFLGLGCLGLVAIAWWQQDITVLALI  123

Query  882   ASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
               +   GY YQ PPFRL YQGLGE +CF  FGP A +A Y  Q+ T
Sbjct  124   LLSCFLGYTYQGPPFRLGYQGLGELICFVTFGPLAVSAAYYSQTQT  169


 Score = 86.7 bits (213),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 70/111 (63%), Gaps = 3/111 (3%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L A++++GLTTSLILFCSHFHQ+ DD + GK SP+ RLGT  GA ++      ++ L +I
Sbjct  175   LPAAIIIGLTTSLILFCSHFHQVADDLSAGKRSPIARLGTARGARLLPWICGGIFGLILI  234

Query  1315  -LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
              +GF   L S  ++LS +++P+   +  +V + H+   ++   K+  V LH
Sbjct  235   FMGF--NLFSNGVVLSWVSLPLAIHLCRHVWRYHDQPDQVKDCKFIAVGLH  283



>ref|WP_006625485.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Arthrospira maxima]
 gb|EDZ94199.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Arthrospira maxima 
CS-328]
 gb|EKD06611.1| 14-dihydroxy-2-naphthoate phytyltransferase [Arthrospira platensis 
C1]
Length=299

 Score =   110 bits (276),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 0/163 (0%)
 Frame = +3

Query  531   SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
             S + L   A+K P+YSVA++P+ VG+A A  + GL +   ++A L +++LI+ W NL ND
Sbjct  10    SNSKLWLAAIKPPMYSVAIMPIWVGTALAKSETGLINWGVFMAFLTAAILILAWENLLND  69

Query  711   VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
             V+D +TG DKNK  S+VN+ G++   L    + L +    ++       +L  + L+  +
Sbjct  70    VFDSETGIDKNKHHSLVNLTGNKALILTIGNLCLLVAIAQIMLICWWQQDLTVLGLIILS  129

Query  891   ITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
                GY+YQ PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  130   CFLGYLYQGPPFRLGYQGLGEFLCFFAFGPVGMSAVYYSQTQT  172


 Score = 80.1 bits (196),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ S++VG+ TSLILFCSHFHQ++DD A GK SP+VRLGT+ GA+++     +++ LT+I
Sbjct  178   LAVSLIVGIATSLILFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQILPWFCGSIFGLTLI  237

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  +++      P  ++   +V + H    ++   K+  V +H
Sbjct  238   GVLGGFFPIWTLLSFAGVFPAIQLC-RHVREYHHQPQQVSNCKFIAVSVH  286



>ref|WP_035759563.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
platensis]
Length=298

 Score =   110 bits (276),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 0/163 (0%)
 Frame = +3

Query  531   SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
             S + L   A+K P+YSVA++P+ VG+A A  + GL +   ++A L +++LI+ W NL ND
Sbjct  9     SNSKLWLAAIKPPMYSVAIMPIWVGTALAKSETGLINWGVFMAFLTAAILILAWENLLND  68

Query  711   VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
             V+D +TG DKNK  S+VN+ G++   L    + L +    ++       +L  + L+  +
Sbjct  69    VFDSETGIDKNKHHSLVNLTGNKALILTIGNLCLLVAIAQIMLICWWQQDLTVLGLIILS  128

Query  891   ITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
                GY+YQ PPFRL YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  129   CFLGYLYQGPPFRLGYQGLGEFLCFFAFGPVGMSAVYYSQTQT  171


 Score = 80.1 bits (196),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ S++VG+ TSLILFCSHFHQ++DD A GK SP+VRLGT+ GA+++     +++ LT+I
Sbjct  177   LAVSLIVGIATSLILFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQILPWFCGSIFGLTLI  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  +++      P  ++   +V + H    ++   K+  V +H
Sbjct  237   GVLGGFFPIWTLLSFAGVFPAIQLC-RHVREYHHQPQQVSNCKFIAVSVH  285



>gb|KHN41270.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic 
[Glycine soja]
Length=243

 Score =   139 bits (350),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 85/132 (64%), Gaps = 26/132 (20%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ D+ VGK SPLVRLGTK GAEVVK ++  
Sbjct  91    FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDREVGKMSPLVRLGTKKGAEVVKGAIFM  150

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G  K LP   I                          IFMAKY+CVRLHALF
Sbjct  151   LYALLVAFGLIKALPLTCI--------------------------IFMAKYFCVRLHALF  184

Query  1474  GATLAAGLVVAR  1509
             G  LA GLV+AR
Sbjct  185   GVALALGLVLAR  196


 Score = 48.5 bits (114),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  909   YQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             +QCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  49    FQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  85



>gb|KHN15691.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase, chloroplastic 
[Glycine soja]
Length=243

 Score =   139 bits (350),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 85/132 (64%), Gaps = 26/132 (20%)
 Frame = +1

Query  1114  LPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMA  1293
              P+SGT+LSAS+LVG TTSLILFCSHFHQ++ D+ VGK SPLVRLGTK GAEVVK ++  
Sbjct  91    FPLSGTVLSASILVGFTTSLILFCSHFHQVEGDREVGKMSPLVRLGTKKGAEVVKGAIFM  150

Query  1294  LYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
             LY+L +  G  K LP   I                          IFMAKY+CVRLHALF
Sbjct  151   LYALLVAFGLIKALPLTCI--------------------------IFMAKYFCVRLHALF  184

Query  1474  GATLAAGLVVAR  1509
             G  LA GLV+AR
Sbjct  185   GVALALGLVLAR  196


 Score = 48.5 bits (114),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  909   YQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             +QCPPFRLSYQGLGEPLCFAAFGPFAT AFYLL  S+
Sbjct  49    FQCPPFRLSYQGLGEPLCFAAFGPFATCAFYLLHGSS  85



>ref|WP_036008931.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Leptolyngbya 
sp. JSC-1]
Length=288

 Score =   103 bits (257),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 92/155 (59%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+  P+YSVA+ P+ +G+A A+ +        +L  L S++LI+ W NLSNDV+D +TG 
Sbjct  3     ALMPPMYSVAIFPIALGTAVAFAETHTLHWGTFLTFLGSAILILAWENLSNDVFDAETGI  62

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D N+  S+VN+ G+++       + L LG  G+V  S    +   + L+      GY+Y 
Sbjct  63    DANEPTSLVNLTGNKSLIFWIGNLCLGLGIAGIVAISWWQQDFTVLGLILLCCGLGYVYH  122

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF +FGP A +A Y  Q+ T
Sbjct  123   GPPFRLGYQGLGEILCFFSFGPLAVSAAYYSQTQT  157


 Score = 83.2 bits (204),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T L+ SV++G++TSLILFCSHFHQ++DD A GK SP+VRLGT+  A+++      +++
Sbjct  159   SATSLAVSVILGISTSLILFCSHFHQVEDDLAAGKRSPVVRLGTQRSAQLIPWLSGGIFA  218

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L  +L   K  P   ++L +++ P    +  +  + H+   ++   K++ V LH
Sbjct  219   LAGLLVGLKLFP-VWVLLILVSAPTAVSLSRHALQYHDQPERVRNCKFFAVGLH  271



>ref|WP_008050963.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Arthrospira sp. 
PCC 8005]
 emb|CCE16675.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
sp. PCC 8005]
 emb|CDM95350.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Arthrospira 
sp. PCC 8005]
Length=277

 Score =   105 bits (262),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 92/150 (61%), Gaps = 0/150 (0%)
 Frame = +3

Query  570   IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
             +YSVA++P+ VG+A A  Q GL +   ++A L +++LI+ W NL NDV+D +TG DKNK 
Sbjct  1     MYSVAIMPIWVGTALAKSQTGLINWGVFMAFLTAAILILAWENLLNDVFDSETGIDKNKH  60

Query  750   ESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPFR  929
              S+VN+ G++   L    + L +    ++       +L  + L+  +   GY+YQ PPFR
Sbjct  61    HSLVNLTGNKALILTIGNLCLLVAIAQIMLICWWQQDLTVLGLIILSCFLGYLYQGPPFR  120

Query  930   LSYQGLGEPLCfaafgpfattafYLLQSST  1019
             L YQGLGE LCF AFGP   +A Y  Q+ T
Sbjct  121   LGYQGLGEFLCFFAFGPVGMSAVYYSQTQT  150


 Score = 80.1 bits (196),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ S++VG+ TSLILFCSHFHQ++DD A GK SP+VRLGT+ GA+++     +++ LT+I
Sbjct  156   LAVSLIVGIATSLILFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQILPWFCGSIFGLTLI  215

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  +++      P  ++   +V + H    ++   K+  V +H
Sbjct  216   GVLGGFFPIWTLLSFAGVFPAIQLC-RHVREYHHQPQQVSNCKFIAVSVH  264



>ref|XP_010068283.1| PREDICTED: 1,4-dihydroxy-2-naphthoate polyprenyltransferase, 
chloroplastic-like [Eucalyptus grandis]
Length=118

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  1108  SILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASV  1287
             + LP++GT+L AS+LVG TTSLILFCSHFHQ+++D AVGK SPLVRLGT+ G+ VVK ++
Sbjct  8     NCLPLTGTVLCASLLVGFTTSLILFCSHFHQVEEDTAVGKISPLVRLGTEKGSSVVKVAI  67

Query  1288  MALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHE  1416
              ALYSL +  G ++ LPS+ IIL +LT+PMG  V+S+V++NHE
Sbjct  68    TALYSLLLTFGLSRDLPSSCIILCLLTLPMGNRVVSFVDENHE  110



>ref|XP_002525833.1| hypothetical protein RCOM_0822650 [Ricinus communis]
 gb|EEF36527.1| hypothetical protein RCOM_0822650 [Ricinus communis]
Length=176

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  1240  VRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHED  1419
             VRLGT+ G+ VVKA+ + LYSL +  G ++ LP   I+L  LT+P G++V+S+VE+NH+D
Sbjct  74    VRLGTERGSYVVKAATITLYSLLLAFGLSRALPFPCILLCALTVPTGKLVVSFVEENHKD  133

Query  1420  KTKIFMAKYYCVRLHALFGATLAAGLVVARFFARNY  1527
             K KIFMAKYYCVRLHALFG  LAAGLV AR   R +
Sbjct  134   KGKIFMAKYYCVRLHALFGTALAAGLVAARMLTRKH  169


 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
            SNDVYDFDTGADKNKKESVVN+VGSR+GT IAAY+SL LGF GL W SL +++++AILLL
Sbjct  3    SNDVYDFDTGADKNKKESVVNLVGSRSGTSIAAYLSLGLGFVGLTWTSLGASSMQAILLL  62

Query  882  ASAITCGYIYQ  914
            A AITCGYIYQ
Sbjct  63   ACAITCGYIYQ  73



>ref|WP_012594849.1| MULTISPECIES: 1,4-dihydroxy-2-naphthoate prenyltransferase [Cyanothece]
 ref|YP_002371732.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Cyanothece 
sp. PCC 8801]
 ref|YP_003137295.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Cyanothece 
sp. PCC 8802]
 gb|ACK65576.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanothece sp. 
PCC 8801]
 gb|ACV00460.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanothece sp. 
PCC 8802]
Length=310

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             E + S+  L + A+K P+Y+VA++P+TVG+AAA+ +   FS   +   L S++ II WL
Sbjct  10   PEISPSQRKLWFAAIKPPMYTVAIIPITVGTAAAFWENNHFSSQIFWTFLLSAIFIIAWL  69

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRA  869
            NLSNDV+D DTG DKNK  SVVN+ G+++     A V L LG  G+   +   +   +  
Sbjct  70   NLSNDVFDSDTGIDKNKAHSVVNLTGNKSLVFALANVFLTLGILGIFLIAWWQKEVTVLG  129

Query  870  ILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            I+LL  A+  GY YQ PPFRL YQGLGE +C
Sbjct  130  IILLCCAL--GYSYQGPPFRLGYQGLGEIIC  158


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ++DD A GK SP+VRLGT+ G++V+    + ++SL  I     T+P  ++++
Sbjct  197   LFCSHFHQVEDDLAAGKKSPIVRLGTQLGSQVLTGVTIGIFSLIGIFIILGTIPPTTLLI  256

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVAR  1509
               L++P+   ++++V + H+   ++   K+  V LH + G  LA GL++  
Sbjct  257   -FLSVPLAYQLVTHVAEFHDQPDRVNNCKFIAVNLHFVSGMLLALGLILPH  306



>ref|XP_006853281.1| hypothetical protein AMTR_s00038p00239380 [Amborella trichopoda]
 gb|ERN14748.1| hypothetical protein AMTR_s00038p00239380 [Amborella trichopoda]
Length=127

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +1

Query  1231  SPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKN  1410
             SPLV++GT+ G++VVK S++ LYS   +LG  + LP   ++L  LT+P+G++V+ YV+ N
Sbjct  2     SPLVQIGTEKGSKVVKFSILILYSFLFVLGALRALPLTCVVLCTLTLPIGKLVVDYVQDN  61

Query  1411  HEDKTKIFMAKYYCVRLHALFGATLAAGLVVARFFARNYN  1530
             H DKTKIFMAKYYCVRLHALFG  LA GL +AR  A   N
Sbjct  62    HNDKTKIFMAKYYCVRLHALFGIALAIGLAMARRMAHFLN  101



>ref|WP_017286479.1| hypothetical protein [Leptolyngbya boryana]
Length=302

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L + A+K P+YSVA++P+ VGSA A+ +    ++  +   L S++LI+ W NLSND
Sbjct  9    SKKKLWYAAIKPPMYSVAVMPIWVGSAVAFAETRSLNLLVFFTFLISAILILAWENLSND  68

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG D NK  SVVN+ G+++     +   L  G  G++  +L   +   I L+ + 
Sbjct  69   VFDSETGVDVNKANSVVNLTGNKSLIFWISNAFLVAGLSGILAIALMQGDFTVIGLVLAC  128

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GYIYQ PPFRLSYQGLGEPLC
Sbjct  129  CAIGYIYQGPPFRLSYQGLGEPLC  152


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             SGT L+AS+ VG+ TSLILFCSHF+Q++DD A+GK SP+VRLG K  A+++     + Y+
Sbjct  173   SGTNLAASIGVGIATSLILFCSHFNQVEDDAAIGKKSPVVRLGAKRSAQLLPWICGSFYA  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             LTI+    K  P  + +LS+L+ P+ + +   +   +    K+   +   V LH
Sbjct  233   LTILFVILKLFPVWT-LLSLLSFPVAKRLCHTIGSQYHQPHKLLRCRLIAVELH  285



>ref|WP_002768157.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI02458.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9443]
Length=303

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + GLFS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   AIKPPMYSVAIIPIILGTAIAYQETGLFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L LG  G++  S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLLGIAGILAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFIGILFSLGYFLA  300



>ref|WP_021834695.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Crocosphaera 
watsonii]
 emb|CCQ60311.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Crocosphaera 
watsonii WH 0401]
Length=302

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 90/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L + A+K P+YSVA++P+TVG+A A+ Q  +F        L S++LII WLN+SND
Sbjct  10   SKGKLWFAAIKPPMYSVAIIPITVGTATAFGQNAIFDPKILGIFLTSAILIIAWLNISND  69

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D DTG DKNK  S+VN+ G++   L  A   L LG  G++  +    ++  + ++   
Sbjct  70   VFDADTGIDKNKAHSLVNLTGNKALMLWLANGFLSLGVLGILLIAWLQQDITVLSIILLC  129

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE +C
Sbjct  130  CVLGYTYQGPPFRLGYQGLGELIC  153


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S +IL+   L+G++TS+ILFCSHFHQ++DD A GK SP+VRLGT+ G++V+  + +  ++
Sbjct  174   SWSILAPGTLIGISTSIILFCSHFHQVEDDLAAGKRSPIVRLGTQLGSQVLMVTTILFFA  233

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L ++        S    L+ L+IP+   ++S+V +NH    ++   K+  VRLH
Sbjct  234   LIVLFSLLGIF-SIWTFLTFLSIPLAYQLVSHVNQNHAQPDRVSNCKFIAVRLH  286



>ref|WP_011433869.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Synechococcus sp. 
JA-2-3B'a(2-13)]
 ref|YP_478503.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechococcus 
sp. JA-2-3B'a(2-13)]
 gb|ABD03240.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
JA-2-3B'a(2-13)]
Length=313

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 87/151 (58%), Gaps = 0/151 (0%)
 Frame = +3

Query  510  EEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIIT  689
            E    N SR  L   A+K P+YSVA++P+ VGSA AY Q+G+  +        +++ I+ 
Sbjct  13   EAAWSNRSRRQLWMAALKPPMYSVAIMPIWVGSAIAYAQSGVLDLGVLGVFWGAAICILA  72

Query  690  WLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRA  869
            W+NLSNDV+D  TG DKNK  S+VN+ G            L LG  G++W S +  +   
Sbjct  73   WVNLSNDVFDAQTGVDKNKLHSLVNLTGKPGQVFWVGNAFLALGLLGILWLSWRQWDPTV  132

Query  870  ILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +LL+  A   GY YQ PP RL YQGLGE LC
Sbjct  133  LLLVLVACGLGYAYQGPPLRLGYQGLGEILC  163


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 1/126 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS++VG+ TSLILFCSHFHQ+ DD A GK SP+ RLGT   A ++     +L+ L ++
Sbjct  188   LAASLVVGMATSLILFCSHFHQVQDDLACGKRSPVARLGTLRSARLIPWLCGSLFGLMLL  247

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P A  +LS+  IP    +   +   H+   +I  +K+  V LH   G  L  G
Sbjct  248   FVGLGIFP-AWTLLSLAGIPFAVRLSRLLGTYHDQPQRISHSKFIAVSLHFWLGLFLGLG  306

Query  1495  LVVARF  1512
              +++R+
Sbjct  307   FILSRY  312



>ref|WP_002763692.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI00148.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9717]
Length=302

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ +G+A AY + GLFS   +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18    AIKPPMYSVAIIPIILGTAIAYQETGLFSPPVFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D NK  S+VN+ G+++     + + L LG  G+   S    +   + L+A     GY YQ
Sbjct  78    DVNKAHSIVNLTGNKSLIFWLSNLFLLLGIAGIFAISYGRGDWMLLELIALCCFLGYTYQ  137

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE +CF  FGP A  A Y  Q+ T
Sbjct  138   GPPFRLGYQGLGEIICFFTFGPLAIAAAYYSQAGT  172


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 63/110 (57%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+VRLGT  G++V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIVRLGTLKGSKVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++++V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVNHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_004161629.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI17481.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9807]
Length=303

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + GLFS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   AIKPPMYSVAIIPIILGTAIAYQETGLFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G++  S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGILAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 59/110 (54%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G   A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFFA  300



>ref|WP_002798226.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI27183.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9809]
Length=303

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + GLFS   +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   AIKPPMYSVAIIPIILGTAIAYQETGLFSPPVFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L LG  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLLGIAGIFAISYGRGDWMLLELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++++V +NH+    +   K+  V LH   G   + G   A
Sbjct  252   -FLSLPFAWQLVNHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYCFA  300



>ref|WP_007309766.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Crocosphaera watsonii]
 gb|EHJ14007.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Crocosphaera 
watsonii WH 0003]
 emb|CCQ49673.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Crocosphaera 
watsonii WH 8502]
 emb|CCQ59559.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Crocosphaera 
watsonii WH 0005]
 emb|CCQ68501.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Crocosphaera 
watsonii WH 0402]
Length=302

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+YSVA++P+TVG+A A+ Q  +F        L S++LII WLN+SND
Sbjct  10   SKGKLWLAAIKPPMYSVAIIPITVGTATAFGQNAIFDPKILGIFLTSAILIIAWLNISND  69

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D DTG DKNK  S+VN+ G++   L  A   L LG  G++  +    ++  + ++   
Sbjct  70   VFDADTGIDKNKAHSLVNLTGNKALMLWLANGFLSLGVLGILLIAWLQQDITVLSIILLC  129

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE +C
Sbjct  130  CVLGYTYQGPPFRLGYQGLGELIC  153


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S +IL+   L+G++TS+ILFCSHFHQ++DD A GK SP+VRLGT+ G++V+  + +  ++
Sbjct  174   SWSILAPGTLIGISTSIILFCSHFHQVEDDLAAGKRSPIVRLGTQLGSQVLMVTTILFFA  233

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L ++        S    L+ L+IP+   ++S+V +NH    ++   K+  VRLH
Sbjct  234   LIVLFSLLGIF-SIWTFLTFLSIPLAYQLVSHVNQNHAQPDRVSNCKFIAVRLH  286



>ref|WP_007304368.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Crocosphaera watsonii]
 gb|EAM51729.1| UbiA prenyltransferase [Crocosphaera watsonii WH 8501]
Length=302

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+YSVA++P+TVG+A A+ Q  +F        L S++LII WLN+SND
Sbjct  10   SKGKLWLAAIKPPMYSVAVIPITVGTATAFGQNAIFDPKILGIFLTSAILIIAWLNISND  69

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D DTG DKNK  S+VN+ G++   L  A   L LG  G++  +    ++  + ++   
Sbjct  70   VFDADTGIDKNKAHSLVNLTGNKALMLWLANGFLSLGVLGILLIAWLQQDITVLSIILLC  129

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE +C
Sbjct  130  CVLGYTYQGPPFRLGYQGLGELIC  153


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 74/114 (65%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S +IL+   L+G++TS+ILFCSHFHQ++DD A GK SP+VRLGT+ G++V+  + +  ++
Sbjct  174   SWSILAPGTLIGISTSIILFCSHFHQVEDDLAAGKRSPIVRLGTQLGSQVLMVTTILFFA  233

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L ++        S    L+ L+IP+   ++S+V +NH    ++   K+  VRLH
Sbjct  234   LIVLFSLLGIF-SIWTFLTFLSIPLAYQLVSHVNQNHAQPDRVSNCKFIAVRLH  286



>ref|WP_015193571.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Stanieria cyanosphaera]
 ref|YP_007132869.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ35903.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Stanieria cyanosphaera 
PCC 7437]
Length=310

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 89/139 (64%), Gaps = 6/139 (4%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+AAAY Q G F    +   L++++LII WLNLSNDV+D +TG 
Sbjct  17   AIKPPMYSVAVIPIMVGTAAAYNQTGNFEPQIFFTFLSAAILIIAWLNLSNDVFDAETGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCG---LVWASLQSANLRAILLLASAITCGY  905
            D NK  SVVN+ G+++     A + L LG  G   + W   Q   +  I+LL  A+  GY
Sbjct  77   DINKAHSVVNLTGNKSLVFWIANLCLSLGIFGIFAITWWQ-QDGTVLGIILLCCAL--GY  133

Query  906  IYQCPPFRLSYQGLGEPLC  962
             YQ PPFRL Y GLGE +C
Sbjct  134  TYQGPPFRLGYLGLGEFIC  152


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S   L++S+L+G++TS+ILFCSHFHQ++DD A GK SP+VRLGT  G++V+     +++ 
Sbjct  173   SSQCLASSILIGISTSIILFCSHFHQVEDDLAAGKKSPIVRLGTLKGSQVLNWLTASIFI  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             LT+I      LP  S ++  ++ P+   ++++V + H    K+   K+  V LH
Sbjct  233   LTVIFIALNYLPWGSGLI-FISFPLAYQLMNHVNQYHNRPDKVSNCKFLAVNLH  285



>ref|XP_005644911.1| hypothetical protein COCSUDRAFT_57519 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20367.1| hypothetical protein COCSUDRAFT_57519 [Coccomyxa subellipsoidea 
C-169]
Length=385

 Score =   122 bits (306),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 104/182 (57%), Gaps = 3/182 (2%)
 Frame = +3

Query  426  LRWQESRRQCQH-PRHFYSCRARHSDAINEEKEENISRTTLIW-RAVKLPIYSVALVPLT  599
            L  Q+ +    H P    S  A+ S A+      +  R   +W  AVK P+Y+V +VP+ 
Sbjct  40   LELQQRQAAAVHLPSASASSSAQGSTALQGTDSSSRERQRRLWFAAVKPPMYAVGIVPIL  99

Query  600  VGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSR  779
            V + AAY   G+F    +  L+A + L+I WLNLSND YD DTG D+ K+ESVVN+ G  
Sbjct  100  VSAGAAYYSTGVFISACFWKLVAGATLVIAWLNLSNDAYDADTGVDQAKEESVVNLTGGN  159

Query  780  TGTLIAAYVSLELGFCGLVWASLQSA-NLRAILLLASAITCGYIYQCPPFRLSYQGLGEP  956
               ++A   +  L    L+    ++A ++   + LA AI  GY+YQ PPFRLSY+GLGEP
Sbjct  160  KKGVLALANACLLAGAWLLHTGTKAAGDVHVGMALALAIGMGYMYQGPPFRLSYKGLGEP  219

Query  957  LC  962
            LC
Sbjct  220  LC  221


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +1

Query  1162  TTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPS  1341
             TT+ +LFCSHFHQI+ D A  K SPLVRLG   G +V++A V+  Y    I    K LP 
Sbjct  263   TTTSVLFCSHFHQIEGDTAANKMSPLVRLGPNLGYQVLRAGVLLTYVFLDIAAALKWLPL  322

Query  1342  ASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFG  1476
               +   +L++P    ++ + ++ H+    +   K Y ++ H   G
Sbjct  323   TCLFAQILSVPSAMALLDFAKRTHQQPEAVRPLKRYALKWHMALG  367



>gb|AAL85697.1|AF474982_1 hypothetical protein T17F15.140-like protein [Hordeum vulgare 
subsp. vulgare]
Length=381

 Score =   122 bits (306),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  525  NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
             +S  TL+WRA KL IYSVALVPLTVG+AAAY  AGLF   RY  LLA++ L+ITWLNLS
Sbjct  59   ELSHATLLWRAAKLSIYSVALVPLTVGAAAAYNHAGLFFARRYFGLLAAASLVITWLNLS  118

Query  705  NDVYDFDTGADKNKKESVVNIV  770
            NDVYD DTGADKN KESVVNIV
Sbjct  119  NDVYDSDTGADKNNKESVVNIV  140



>ref|WP_012266417.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 ref|YP_001658579.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa NIES-843]
 dbj|BAG03387.1| phylloquinone biosynthesis protein [Microcystis aeruginosa NIES-843]
Length=303

 Score =   120 bits (302),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   AIKPPMYSVAIIPIILGTAIAYQETGRFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L LG  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLLGIAGIFAISYGRGDWMLLELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++++V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVNHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>gb|EKV00712.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Leptolyngbya sp. 
PCC 7375]
Length=311

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 91/157 (58%), Gaps = 4/157 (3%)
 Frame = +3

Query  504  INEEKEENIS----RTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLAS  671
            I   K+E IS    R +L   A+K P+YSVA++P+  GS  AYL+            L S
Sbjct  3    IPTVKQERISAADTRKSLWLAAIKPPMYSVAVIPILAGSLLAYLETEQLDGHILGLFLMS  62

Query  672  SVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQ  851
            +VL++ W NLSNDVYD DTG DKNK  S+VN+  ++        +SL LG  G+   +L 
Sbjct  63   AVLLLVWENLSNDVYDADTGIDKNKHHSLVNLTHNQALIFWLGNLSLALGIAGVSAIALM  122

Query  852  SANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              ++  + L+      GY+YQ PPFRL YQGLGEPLC
Sbjct  123  QQDMTILGLILICCALGYLYQGPPFRLGYQGLGEPLC  159


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (60%), Gaps = 5/119 (4%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG--FT  1326
             +G+ T+L+LFCSHFHQ++DD A GK SP+VRLGT  GA ++     +++   I+LG    
Sbjct  189   IGMATTLVLFCSHFHQVNDDIAAGKRSPIVRLGTLGGATLLPWLCGSIF--VILLGGMLL  246

Query  1327  KTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVV  1503
             +  PS S+IL++++ P    +  +V++ H     +  AK+  +R     G  +  GL++
Sbjct  247   QVFPS-SLILTLVSAPFAIQLCRHVKRYHNQPELVQNAKFVAIRFQFCCGILVCLGLLL  304



>ref|WP_023076946.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA32354.1| hypothetical protein N836_27575 [Leptolyngbya sp. Heron Island 
J]
Length=311

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = +3

Query  504  INEEKEE-NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLAL-LASSV  677
            +N+E+ +   +R +L   A+K P+YSVA++P+ VGS  AYL+       R LA+ L S+V
Sbjct  6    VNQERIQFADTRKSLWLAAIKPPMYSVAVIPILVGSLLAYLETEQLD-GRILAIFLLSAV  64

Query  678  LIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSA  857
            L++ W NLSNDVYD DTG DKNK  S+VN+  ++        +SL LG  G+   +L   
Sbjct  65   LLLVWENLSNDVYDADTGIDKNKHHSLVNLTQNQALIFWLGNLSLALGVAGVSTITLMQR  124

Query  858  NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +   + L+      GY+YQ PPFRL YQGLGEPLC
Sbjct  125  DATILGLILVCCILGYLYQGPPFRLGYQGLGEPLC  159


 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 63/108 (58%), Gaps = 7/108 (6%)
 Frame = +1

Query  1150  LVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG---  1320
             ++G+ T+L+LFCSHFHQ+ DD A GK SP+VRLGT  GA+++     +++   +ILG   
Sbjct  188   VIGMATTLVLFCSHFHQVSDDIAAGKRSPIVRLGTLGGAKLLPWLCGSIF---VILGGGL  244

Query  1321  FTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                  P+ S+ L++ + P    +  +V + H+    +  AK+  +R  
Sbjct  245   LVGVFPN-SLALALASAPFAIQLCHHVNRYHDQPELVQNAKFVAIRFQ  291



>ref|XP_006833567.1| hypothetical protein AMTR_s00216p00022320 [Amborella trichopoda]
 gb|ERM98845.1| hypothetical protein AMTR_s00216p00022320 [Amborella trichopoda]
Length=283

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +1

Query  1216  AVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVIS  1395
             AVGK SPLVR+GT+ G++VVK S++ LYS   +LG  ++LP   ++L  LT+P+G++V+ 
Sbjct  156   AVGKMSPLVRIGTEKGSKVVKFSILTLYSFLFVLGALRSLPLKCVVLCTLTLPIGKLVVD  215

Query  1396  YVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVARFFA  1518
             YV+ NH   TKIFMAKYYCVRLHALFG  LA GL +AR  A
Sbjct  216   YVQDNHN--TKIFMAKYYCVRLHALFGIALAIGLAMARRMA  254


 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  600  VGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSR  779
            VG AAAYL  G F+  RYL LL +S  IITWLNLSNDVYD+DTGADK+KKESVVNI GSR
Sbjct  48   VGGAAAYLLTGFFAARRYLVLLLASASIITWLNLSNDVYDYDTGADKDKKESVVNIFGSR  107

Query  780  TGTLIAAYVSLELGFCGLVWASLQSANL  863
              TL AA+  L  GF GLV+AS+++ ++
Sbjct  108  GMTLYAAFALLASGFVGLVFASIEAGSI  135



>ref|WP_015160112.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Chamaesiphon minutus]
 ref|YP_007097495.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Chamaesiphon minutus 
PCC 6605]
 gb|AFY93968.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Chamaesiphon minutus 
PCC 6605]
Length=299

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 1/149 (1%)
 Frame = +3

Query  519  EENISRTTLIW-RAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            E  +   + +W  A+K P+Y+VA++P+TVGSA AY Q     +      L S++ II WL
Sbjct  5    ESVVQPKSKLWLAAIKPPMYTVAIIPITVGSAVAYAQTQAIDLNILGTFLLSAIAIIAWL  64

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            N+SNDVYD DTG D NK ESVVN+ G+R        + L LG  G+   S    +L  + 
Sbjct  65   NISNDVYDSDTGIDINKAESVVNLTGNRNLMFWLGNLFLGLGITGIATISWWQQDLTVVE  124

Query  876  LLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            ++  +   GY YQ PPFRL YQGLGE +C
Sbjct  125  IVLLSCFLGYSYQGPPFRLGYQGLGEIIC  153


 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L AS+++G++TS+ILFCSHFHQ+ DD A GK SP+VR+GTK GA V+K S  ++Y+L+ +
Sbjct  178   LLASLVIGISTSIILFCSHFHQVKDDLAAGKLSPIVRMGTKIGAVVLKWSTASIYALSAV  237

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                +   P A++++  L++P+   + ++V + H+   ++   KY  VRLH   G  LA G
Sbjct  238   GVASGLFPVATLLI-FLSLPLAIKLTNFVSEYHDRPERVRTCKYLAVRLHFASGLLLAVG  296



>ref|WP_012953917.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Candidatus Atelocyanobacterium 
thalassa]
 ref|YP_003421610.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95252.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=304

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            SR  L   A+K+P+YSV+++P+ VGS+AA+ +   F    +   L SS+LII W+N+SND
Sbjct  11   SRQRLWLAAIKVPVYSVSVIPIIVGSSAAFEKISTFDFRIFTTFLISSILIIAWINISND  70

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
             +D DTG DKNK  S+VN++ +++     + + L LG  G+V  S    +L  + ++   
Sbjct  71   YFDADTGIDKNKPHSIVNLINNKSLIFWLSNIFLILGIGGIVLISWLQKDLTVLFMVILC  130

Query  891  ITCGYIYQCPPFRLSYQGLGE  953
               GY YQ PPFRL Y+GLGE
Sbjct  131  CILGYSYQGPPFRLGYKGLGE  151


 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L++ +L+G++TS+ILFCSHFHQ+ DD   GK SP+V LGTK G+ V+K   + L  L I 
Sbjct  179   LASGILIGISTSIILFCSHFHQVKDDFFAGKRSPIVFLGTKLGSIVLKVITVFLMFLVIF  238

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                 K LP  +  LS+L+ P+   ++ +V + H   +K+  +K+  ++ H   G  L+ G
Sbjct  239   FPILKILPFWT-FLSLLSFPVAHKLVQHVSQYHNQTSKVKNSKFIAIKFHFFSGILLSVG  297

Query  1495  LVVARF  1512
             L++++F
Sbjct  298   LILSKF  303



>ref|WP_036487910.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Myxosarcina 
sp. GI1]
Length=302

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 102/168 (61%), Gaps = 1/168 (1%)
 Frame = +3

Query  519   EENISRTTLIW-RAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
             E+ I++ + +W  A+K PIYSVA+VP+ VG+A AY    LF V  +   LA+++ I+ WL
Sbjct  4     EQTITKNSQLWLAAIKPPIYSVAVVPIAVGTAMAYFDTRLFDVRAFGTFLAAAISILAWL  63

Query  696   NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
             NL+NDV+D +TG D NK  SVVN+ G+++     A + L  G  G++  +    +   + 
Sbjct  64    NLTNDVFDSETGIDVNKAHSVVNLTGNKSLVFAIANIFLSCGLLGILALTWWQQDFTVLG  123

Query  876   LLASAITCGYIYQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             L++     GY YQ PPFR  Y GLGE +CF  FGP A +A Y  Q+ T
Sbjct  124   LVSLCCLLGYAYQGPPFRWGYLGLGEIICFFTFGPGAVSAAYYAQTET  171


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (62%), Gaps = 7/115 (6%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT---IILGFTKTLPSAS  1347
             LFCSHFHQ++DD A GK SP+VRLGT+TGA+++  S  ++Y LT   IILG+   L   S
Sbjct  191   LFCSHFHQVEDDLAAGKRSPIVRLGTETGAQILAWSTASIYILTVIGIILGYLPLL--TS  248

Query  1348  IILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVARF  1512
             I+ +  ++P    +I+++   H+   K+  +K+  V L+      L AGLV + +
Sbjct  249   IVFA--SLPWAAQLINHINCYHDCPAKVSNSKFIAVNLYLTSSGLLIAGLVWSTY  301



>ref|WP_022609084.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Rubidibacter lacunae]
 gb|ERN40178.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Rubidibacter lacunae 
KORDI 51-2]
Length=304

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+KLPIYSVA+ P+T+G+A AY   G +  + + + + ++V I+TWLN SNDV+D DTG 
Sbjct  18   AIKLPIYSVAIAPITLGTAVAYCDTGRWLPSHFWSFIGAAVCILTWLNTSNDVFDDDTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S V +VG++     A+   L LG  G+   +    +   + L+  A+  GY YQ
Sbjct  78   DVNKDSSYVKVVGNKVLVFWASNAFLLLGLAGIGAIAWWQQDWTVLGLIVLAVALGYSYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL Y GLGEP+C
Sbjct  138  GPPFRLGYLGLGEPIC  153


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 75/135 (56%), Gaps = 7/135 (5%)
 Frame = +1

Query  1120  ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVK---ASVM  1290
             +S + L AS+ VG +TSLILFCSHFHQ+ DD A GK SP+VRLGT+  A ++    AS  
Sbjct  173   VSPSALVASLAVGSSTSLILFCSHFHQVADDIAAGKRSPVVRLGTQRAARLLPWIVASPF  232

Query  1291  ALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHAL  1470
             A+ ++ ++LG      S   +L V + P+   ++ +V   H    ++   K+   +LH  
Sbjct  233   AVVAIGVVLGMF----SPWTLLIVASAPVAVELVRHVNAEHARPERVSNCKFIAAKLHIQ  288

Query  1471  FGATLAAGLVVARFF  1515
                 L  G V+ ++ 
Sbjct  289   SSILLCLGFVLVQWL  303



>ref|WP_024970270.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa]
Length=302

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGQFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK S + RLGT  G+ V+    + +Y LT++    +  PS ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSTIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPSLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_002750368.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCH92177.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9432]
Length=302

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGQFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 59/110 (54%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK S + RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSTIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_002776353.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI06763.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 7941]
Length=302

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGQFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++++V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVNHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_016516794.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa]
 gb|EPF18868.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa SPC777]
Length=302

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGQFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    +++ V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVNQVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_002744108.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcystis aeruginosa]
 emb|CAO90889.1| menA [Microcystis aeruginosa PCC 7806]
 gb|ELS47838.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcystis aeruginosa 
DIANCHI905]
Length=302

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS   +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGQFSPPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L LG  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLLGIAGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G++V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSKVLTVVTVLIYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_002800653.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI36498.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9701]
Length=302

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGGFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWMILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G++V+ A  + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSKVLTAVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_015200003.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Calothrix parietina]
 ref|YP_007139357.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Calothrix sp. PCC 
6303]
 gb|AFZ03385.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Calothrix sp. PCC 
6303]
Length=301

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VGS  AY +  +F    +   L S++LI+ W N SNDV+D +TG 
Sbjct  20   AMKPPMYSVAIMPIWVGSMVAYAETKVFQSLTFSVFLGSAILILIWENFSNDVFDAETGI  79

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D+NK  S+VNI G+++       +SL LG  G++  +    +L  ++++      GY+YQ
Sbjct  80   DENKHHSLVNITGNKSLIYWLGNLSLFLGLLGILMITWWQQDLTVMVMILLCCCLGYVYQ  139

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE LC
Sbjct  140  GPPFRLGYQGLGEILC  155


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L AS++VG+ TSLILFCSHFHQ++DD A GKYSP+VRLGT  G++V+  + +++Y L+++
Sbjct  180   LVASIIVGIATSLILFCSHFHQVEDDLAAGKYSPIVRLGTARGSQVLILATISIYVLSLM  239

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS +++P    +  +V++ H+   ++  +K+  V +H         G
Sbjct  240   FVVLGYFPIWT-LLSWVSVPFAVKLCRHVQQYHQQPDRVSNSKFIAVAVHFWCCLLFGLG  298

Query  1495  LVV  1503
              VV
Sbjct  299   FVV  301



>ref|WP_002736788.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcystis aeruginosa]
 gb|ELP54261.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcystis aeruginosa 
TAIHU98]
Length=302

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGGFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_006528398.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Gloeocapsa sp. 
PCC 73106]
 gb|ELR98775.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Gloeocapsa sp. 
PCC 73106]
Length=299

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+Y+VA++P+ VG+A A+ Q   F+   +   L +++ II WLNLSNDV+D +TG 
Sbjct  14   AIKPPMYTVAVIPIIVGTAVAFAQTQQFTGRIFFIFLTAAIAIIAWLNLSNDVFDSETGI  73

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWAS--LQSANLRAILLLASAITCGYI  908
            D+NK  SVVN+ G++      +   L LG  G++  +  L++  + A++LL+ A+  GY 
Sbjct  74   DQNKAHSVVNLTGNKVLVFWLSNAFLALGILGIILITWWLRNGTVLALVLLSCAL--GYT  131

Query  909  YQCPPFRLSYQGLGEPLC  962
            YQ PPFRL YQGLGE +C
Sbjct  132  YQGPPFRLGYQGLGELIC  149


 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV++GLTTS+ILFCSHFHQ++DD+   K SP+VRLGT   A+V+  +V++++ L ++
Sbjct  174   LAASVIIGLTTSVILFCSHFHQVEDDQRALKRSPVVRLGTAKSAQVLTWAVISIFLLILL  233

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  ++I +V++ P+   ++++V++ H+    +  +K+  V  H + G  LA G
Sbjct  234   FIGLGIFPIWTLI-TVVSFPLAYRLVAHVKQYHDQPKLVSNSKFLAVNFHFVSGLLLALG  292

Query  1495  LVVARF  1512
              ++  F
Sbjct  293   FILEVF  298



>ref|WP_036020136.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Leptolyngbya 
sp. PCC 7375]
Length=301

 Score =   118 bits (295),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            +R +L   A+K P+YSVA++P+  GS  AYL+            L S+VL++ W NLSND
Sbjct  6    TRKSLWLAAIKPPMYSVAVIPILAGSLLAYLETEQLDGHILGLFLMSAVLLLVWENLSND  65

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            VYD DTG DKNK  S+VN+  ++        +SL LG  G+   +L   ++  + L+   
Sbjct  66   VYDADTGIDKNKHHSLVNLTHNQALIFWLGNLSLALGIAGVSAIALMQQDMTILGLILIC  125

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY+YQ PPFRL YQGLGEPLC
Sbjct  126  CALGYLYQGPPFRLGYQGLGEPLC  149


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 71/119 (60%), Gaps = 5/119 (4%)
 Frame = +1

Query  1153  VGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG--FT  1326
             +G+ T+L+LFCSHFHQ++DD A GK SP+VRLGT  GA ++     +++   I+LG    
Sbjct  179   IGMATTLVLFCSHFHQVNDDIAAGKRSPIVRLGTLGGATLLPWLCGSIF--VILLGGMLL  236

Query  1327  KTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVV  1503
             +  PS S+IL++++ P    +  +V++ H     +  AK+  +R     G  +  GL++
Sbjct  237   QVFPS-SLILTLVSAPFAIQLCRHVKRYHNQPELVQNAKFVAIRFQFCCGILVCLGLLL  294



>ref|WP_002790797.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Microcystis aeruginosa]
 emb|CCI27436.1| putative 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Microcystis 
aeruginosa PCC 9808]
Length=302

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+A AY + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTAIAYQETGGFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S++N+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIINLTGNKSLIFWLSNLFLLVGITGIFAISYWRGDWTILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_015223527.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanobacterium 
stanieri]
 ref|YP_007165861.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanobacterium 
stanieri PCC 7202]
 gb|AFZ48212.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanobacterium 
stanieri PCC 7202]
Length=304

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 95/153 (62%), Gaps = 1/153 (1%)
 Frame = +3

Query  507  NEEKEENISRTTLIW-RAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLI  683
            N   + N    + +W  A+K P+Y+VA++P++ G+A AY   G+F+++ +L  L S++ I
Sbjct  5    NPITQANPQTKSKLWLAAIKPPMYTVAVIPISFGTAFAYFATGIFNLSVFLTFLLSAIAI  64

Query  684  ITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANL  863
            I WLNL+NDV+D DTG D NK  SVVN+ G++T     A + L LG  G+   +    + 
Sbjct  65   IAWLNLTNDVFDADTGIDVNKHHSVVNLTGNKTLVFWIANIILLLGLGGIFLINWWQQDW  124

Query  864  RAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              + L+ ++   GY YQ PPFRL YQGLGE +C
Sbjct  125  TVLWLILASCFLGYTYQGPPFRLGYQGLGEIIC  157


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +1

Query  1180  FCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIILS  1359
             FCSHFHQI DD A GK SP+VRLGTKTGA V+  SV  +Y L+ I  FT  LP    +L 
Sbjct  197   FCSHFHQIKDDLAAGKKSPIVRLGTKTGANVLIISVALVYILSTIFTFTGQLPQ-QCLLV  255

Query  1360  VLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGL  1497
              L+ P+   +I++V + H    KI  +K+  V  H L G  L  GL
Sbjct  256   WLSFPVAYQLINHVNQYHHQPEKIKNSKFIAVNFHFLSGILLCLGL  301



>ref|WP_007353321.1| MULTISPECIES: 1,4-dihydroxy-2-naphthoate prenyltransferase [Kamptonema]
 emb|CBN54094.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [ [[Oscillatoria] 
sp. PCC 6506]
Length=301

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S + L   A+K P+YSVA++P+ VG+A A+ +    +   +   L +++LI+ WLNLSND
Sbjct  9    SNSKLWLAAIKPPMYSVAIIPIWVGTAIAFAETKRINAPIFSTFLMAAILILAWLNLSND  68

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D DTG DKNK  SVVN+ G++T     + + L LG  G+   S    +   I L+   
Sbjct  69   VFDADTGIDKNKAHSVVNLTGNKTLIFWLSNLFLALGVSGIFAISWWQQDPTVIWLVIVC  128

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE +C
Sbjct  129  CILGYSYQGPPFRLGYQGLGEIIC  152


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T  +ASV+VG+ TS+ILFCSHFHQI+DD A GK SP+VRLGTKTGA ++     +L++
Sbjct  173   SRTNFAASVIVGVVTSIILFCSHFHQIEDDLAAGKKSPIVRLGTKTGANLLVWLCGSLFA  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             LTI        P  ++++   ++P    +  +V + H    K+  +K+  V LH
Sbjct  233   LTIAFYALGFFPIWTLLI-FGSLPFAIKLCRHVNEYHGQPGKVSNSKFIAVALH  285



>ref|WP_026072455.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Nodosilinea 
nodulosa]
Length=304

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VGSA AY + G F+   +   L ++VLI+ W NLSNDV+D DTG 
Sbjct  17   AIKPPMYSVAIMPMVVGSAIAYAETGQFNSGIFALFLVAAVLILAWENLSNDVFDSDTGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  SVVN+  +R   L  A + L LG  G+V  +L   +   +LL+      GY+YQ
Sbjct  77   DINKAHSVVNLTRNRGLVLALANLCLGLGIAGIVAIALLQQDPTVLLLILLCCGLGYMYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE LC
Sbjct  137  GPPFRLGYQGLGEFLC  152


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (60%), Gaps = 7/126 (6%)
 Frame = +1

Query  1144  SVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVK---ASVMALYSLTII  1314
              V+VGLTT+L+LFCSHFHQ+DDD A GK SP+VRLGT+ GA ++      V A+ ++ ++
Sbjct  180   GVIVGLTTTLVLFCSHFHQVDDDLAAGKRSPIVRLGTRRGAALIPWVCGIVFAIAAIGLL  239

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
             LG      +    L  L++P    +  +V + H+   ++F AK++ +  H   G  LA G
Sbjct  240   LGIFPIWTA----LVFLSLPSAWRLGRHVTRFHDQPERVFNAKFFAIGFHFWSGVLLALG  295

Query  1495  LVVARF  1512
               ++ +
Sbjct  296   FWLSTW  301



>gb|AIE73921.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechocystis 
sp. PCC 6714]
Length=307

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 87/149 (58%), Gaps = 1/149 (1%)
 Frame = +3

Query  519  EENISRTTLIW-RAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            E N      +W  A+K P+Y+VA+VP+TVGSA AY   G +    +   L S++ II W+
Sbjct  9    ESNPPSERKLWLAAIKPPMYTVAVVPITVGSAVAYGATGQWQGGVFTIFLLSAIAIIAWI  68

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NLSNDV+D DTG D  K  SVVN+ G+R      +   L  G  GL+  S  + +   + 
Sbjct  69   NLSNDVFDSDTGIDVRKAHSVVNLTGNRNLVFWLSNFFLLAGLVGLISISWLAQDWTVLG  128

Query  876  LLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            L+A AI  GY YQ PPFRL Y GLGE +C
Sbjct  129  LIAVAIFLGYTYQGPPFRLGYLGLGELIC  157


 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = +1

Query  1144  SVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGF  1323
             S  VGL+T++ILFCSHFHQ++DD A GK SP+VRLGTK G++V+  SV++LY +T I G 
Sbjct  185   SFFVGLSTAIILFCSHFHQVEDDLAAGKKSPIVRLGTKLGSQVLTLSVISLYLITAI-GV  243

Query  1324  TKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                L    I+L  +++P    ++ +V + H+   K+   K+  V LH + G  +AAG
Sbjct  244   LFNLAPWQILLVTVSLPWAVQLVHHVGQYHDQPEKVSNCKFIAVNLHFISGMLMAAG  300



>ref|WP_015204775.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Crinalium epipsammum]
 ref|YP_007144185.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Crinalium epipsammum 
PCC 9333]
 gb|AFZ14675.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Crinalium epipsammum 
PCC 9333]
Length=298

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+Y+VA++P+ VGSA  + Q  + ++  +   L S++L I W+N+SNDV+D DTG 
Sbjct  17   AIKPPMYTVAVIPIWVGSAIGFAQTKILNLQIFAVFLTSAILFIAWMNVSNDVFDDDTGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRAILLLASAITCGYI  908
            D+NK  SVV + G+++ T + A + L  G  G+   S   +   + A++L+ASAI   Y 
Sbjct  77   DQNKAHSVVKLTGNKSLTFLIANLCLITGVLGVSLISWWQRDITVMALVLVASAI--AYT  134

Query  909  YQCPPFRLSYQGLGEPLC  962
            YQ PPFRL YQGLGE +C
Sbjct  135  YQGPPFRLGYQGLGEIIC  152


 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 1/113 (1%)
 Frame = +1

Query  1165  TSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSA  1344
             TSLILFCSH HQ++DD   GK SP+VRLGTK  +++V     ++Y+LT +    +  P A
Sbjct  186   TSLILFCSHIHQVEDDLVAGKRSPIVRLGTKKASQIVPWFGGSIYALTALFVLLQIFPVA  245

Query  1345  SIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVV  1503
             + +L  L++P+   +  +V   H+   K+  +K+  V +H   G  L  G ++
Sbjct  246   T-LLVFLSLPLAIKLFRHVHNYHDQPAKVSNSKFMAVGMHFAMGLLLGIGFLI  297



>ref|WP_026097960.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Geitlerinema 
sp. PCC 7105]
Length=307

 Score =   115 bits (289),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 91/152 (60%), Gaps = 2/152 (1%)
 Frame = +3

Query  507  NEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLII  686
            +  +  N S+  L + A+K P+Y+VA++P+ VG+A A  +     V  +   L S++LI+
Sbjct  6    DPSQAPNTSK--LWFAAIKPPMYTVAVIPIWVGTAVAVAETHRLEVRSFSTFLISAILIL  63

Query  687  TWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLR  866
             WLNLSNDV+D DTG DKNK  S+VN+ G+R+     + + L LG  G+   +    +L 
Sbjct  64   AWLNLSNDVFDSDTGIDKNKAHSLVNLTGNRSLIFWMSNLFLALGIAGIFAIAAWQRDLT  123

Query  867  AILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             + ++ +    GY YQ PPFRL Y GLGE +C
Sbjct  124  VLEIVLACCALGYSYQGPPFRLGYHGLGESIC  155


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (61%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             ++ S  VGL TSLILFCSHFHQ++DD A GK SP+VRLGT+ GA+V+      ++    I
Sbjct  186   VATSTFVGLATSLILFCSHFHQVEDDLAAGKRSPIVRLGTERGAKVLPWLSGTMFGAVAI  245

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                + ++ S   +L + ++P+   ++ +V +NH+    +   K+  V LH
Sbjct  246   AVISGSV-SPWTLLCLASLPLAVQLVQHVGENHDRPELVSNCKFIAVNLH  294



>ref|WP_009543466.1| MULTISPECIES: 1,4-dihydroxy-2-naphthoate prenyltransferase [Cyanothece]
 ref|YP_001805893.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Cyanothece 
sp. ATCC 51142]
 gb|ACB53827.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Cyanothece sp. 
ATCC 51142]
Length=307

 Score =   115 bits (289),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+YSVA++P+TVG+AAA+ + GLF    +   L S++LII WLN+SND
Sbjct  14   SKGKLWLAAIKPPMYSVAIIPITVGTAAAFGETGLFDTKIFGTFLTSAILIIAWLNISND  73

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG DKNK  S+VN+ G+++     A   L LG  G++  +    ++  + ++   
Sbjct  74   VFDAETGIDKNKAHSIVNLTGNKSLMFWLANAFLGLGILGILLIAWWQKDVTVLSIIVLC  133

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFR  YQGLGE +C
Sbjct  134  CALGYTYQGPPFRFGYQGLGEIIC  157


 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+  +L+G++TS+ILFCSHFHQ++DD A GK SP+VRLGTK G+ V+  +    + L  I
Sbjct  182   LAPGILIGISTSIILFCSHFHQVEDDLAAGKRSPIVRLGTKLGSVVLMVTTALFFFLIGI  241

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                   L S    L  L+ P+   ++S+V KNH+   ++   K+  VRLH
Sbjct  242   FSLFN-LFSFWTALVFLSCPIAYQLVSHVNKNHDQPAQVSNCKFIAVRLH  290



>ref|WP_016871474.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Fischerella thermalis]
Length=302

 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            ++  L   A+K P+YSVA++P+ VG+A AY +  +++ T +   LA+++LI+ W NLSND
Sbjct  13   AKNKLWMAAIKPPMYSVAIMPIWVGTAVAYAERKIWNWTVFSVFLAAAILILAWENLSND  72

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG D+NK  S+VN+ G++        + L LG  G++  +    +   I L+   
Sbjct  73   VFDSETGIDQNKHHSLVNLTGNKLLIFWLGNIFLCLGLLGILAIAWWQHDWTVIGLILVC  132

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE LC
Sbjct  133  CALGYFYQGPPFRLGYQGLGEILC  156


 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS +VG+ T+LIL+CSHFHQ+ DD A GK SP+VRLGT+ GA+++     ++Y+LT++
Sbjct  181   LAASAIVGIATTLILYCSHFHQVKDDLAAGKRSPIVRLGTQRGAQLLSWFTASIYALTLV  240

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  + +LS +++P    +  +V++NH +  ++   K+  V +H
Sbjct  241   FVLAAVFPPWT-LLSWVSLPFAIKLCRHVQQNHHNPEQVSNCKFIAVAVH  289



>ref|WP_009459023.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Fischerella sp. 
JSC-11]
 gb|EHC10217.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Fischerella sp. 
JSC-11]
Length=303

 Score =   115 bits (288),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            ++  L   A+K P+YSVA++P+ VG+A AY +  +++ T +   LA+++LI+ W NLSND
Sbjct  14   AKNKLWMAAIKPPMYSVAIMPIWVGTAVAYAERKIWNWTVFSVFLAAAILILAWENLSND  73

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG D+NK  S+VN+ G++        + L LG  G++  +    +   I L+   
Sbjct  74   VFDSETGIDQNKHHSLVNLTGNKLLIFWLGNIFLCLGLLGILAIAWWQHDWTVIGLILVC  133

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE LC
Sbjct  134  CALGYFYQGPPFRLGYQGLGEILC  157


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS +VG+ T+LIL+CSHFHQ+ DD A GK SP+VRLGT+ GA+++     ++Y+LT++
Sbjct  182   LAASAIVGIATTLILYCSHFHQVKDDLAAGKRSPIVRLGTQRGAQLLSWFTASIYALTLV  241

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  + +LS +++P    +  +V++NH +  ++   K+  V +H
Sbjct  242   FVLAAVFPPWT-LLSWVSLPFAIKLCRHVQQNHHNPEQVSNCKFIAVAVH  290



>ref|XP_005849506.1| hypothetical protein CHLNCDRAFT_48633 [Chlorella variabilis]
 gb|EFN57404.1| hypothetical protein CHLNCDRAFT_48633 [Chlorella variabilis]
Length=287

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 79/132 (60%), Gaps = 1/132 (1%)
 Frame = +3

Query  570  IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
            +YSVA  P+ V +AAAY+Q G F+  R L L  ++  II WLNLSNDV+D  TG DK K 
Sbjct  1    MYSVAWAPILVSAAAAYVQTGAFAPARTLLLCLAATAIIAWLNLSNDVFDSVTGVDKTKP  60

Query  750  ESVVNIVGSRTG-TLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQCPPF  926
            ESVVN++G       + A   L  G   L W      N  A  +L +AI  GY+YQ PPF
Sbjct  61   ESVVNLLGGDARLVFLLATAMLAAGTGLLFWLLHGVGNPLAARMLYAAIAMGYVYQGPPF  120

Query  927  RLSYQGLGEPLC  962
            R SY GLGEPLC
Sbjct  121  RWSYLGLGEPLC  132


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 65/114 (57%), Gaps = 0/114 (0%)
 Frame = +1

Query  1132  ILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTI  1311
             I++ S LVG+TT++ILFC+HFHQ++ D+  GK SPLVRLGT+   EV+K  V   +  T+
Sbjct  160   IVALSGLVGITTTVILFCAHFHQVEGDRKHGKLSPLVRLGTEKATEVLKFVVGFTHIATL  219

Query  1312  ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALF  1473
              +G    LP A    +++   +   ++   E N ++   +   K+   R H  F
Sbjct  220   AMGLLGVLPFACWTSAMVAYGLAGEMVKLAETNAQNPEGLRPLKFLATRWHIAF  273



>ref|WP_008314998.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Leptolyngbya sp. 
PCC 6406]
Length=302

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA AY +  +F +  +   L S+VLI+ W NLSNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPIVVGSAVAYQETQVFHLGVFATFLLSAVLILIWENLSNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRAILLLASAITCGYI  908
             D NK  S+VN+  ++T        +L LG  G++  +L  +   +  ++LL  A+  GY 
Sbjct  77    DLNKAHSLVNLTRNKTLIFALGNGALMLGLAGIIAIALYQRDGTVLGLILLCCAL--GYT  134

Query  909   YQCPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
             YQ PPFRL YQGLGE LCF +FGP A  A Y  Q+ T
Sbjct  135   YQGPPFRLGYQGLGEILCFLSFGPLAVGAAYYSQAQT  171


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = +1

Query  1141  ASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG  1320
             A  +VG+TT+L+LFCSHFHQ++DD A GK SP+VRLGT+ GA+++  S   L ++ +I G
Sbjct  179   AGAIVGITTTLVLFCSHFHQVEDDLAAGKRSPIVRLGTQRGAQIIPWSC-GLVAILVIGG  237

Query  1321  FTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLV  1500
                    A  +L++ + P    +  +V + H+   ++  AK++ +  H   G  LA   V
Sbjct  238   VGLDAFPAWSLLTLASTPSAVRLSQHVLRYHDQPDQVSNAKFFAIGFHFWSGLLLALSFV  297

Query  1501  V  1503
             +
Sbjct  298   L  298



>ref|WP_011431251.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Synechococcus sp. 
JA-3-3Ab]
 ref|YP_475841.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechococcus 
sp. JA-3-3Ab]
 gb|ABD00578.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
JA-3-3Ab]
Length=325

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 90/162 (56%), Gaps = 0/162 (0%)
 Frame = +3

Query  477  SCRARHSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYL  656
            S +A       +   E  SR  L   A+K P+YSVA++P+ VGSA AY Q+G   V    
Sbjct  14   SPKASPVQLAEKGTWEGRSRRQLWMAALKPPMYSVAIMPIWVGSAIAYAQSGAMDVGVLA  73

Query  657  ALLASSVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLV  836
              L +++ ++ W+N+SNDV+D  TG DKNK  S+V++ G            L LG  G++
Sbjct  74   VFLGAAICLLAWVNISNDVFDAQTGVDKNKLHSLVSLTGRPVQVFWVGNAFLALGLAGIL  133

Query  837  WASLQSANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            W S + ++   +LL+  A   GY YQ PP RL Y GLGE LC
Sbjct  134  WLSWRQSDPTVLLLVLLACGLGYAYQGPPLRLGYYGLGELLC  175


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 70/125 (56%), Gaps = 1/125 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS++VG+ TSLILFCSHFHQ++DD A GK SP+ RLGT+  A ++     +++ L ++
Sbjct  200   LAASLVVGMVTSLILFCSHFHQVEDDLAAGKRSPVARLGTRRSARLIPWICGSIFGLLLL  259

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P A  +L    IP    +   +   H+   +I  +K+  V LH   G  L  G
Sbjct  260   FVGLGAFP-AWTLLGFAGIPFAVRLSRLLGAYHDQPQRISHSKFIAVGLHFWLGLFLGLG  318

Query  1495  LVVAR  1509
              +++R
Sbjct  319   FILSR  323



>ref|WP_016867896.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Fischerella muscicola]
Length=302

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 90/147 (61%), Gaps = 0/147 (0%)
 Frame = +3

Query  522  ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
            +N ++  L   A+K P+YSVA++P+ VG+A A+ +  +++   +   LA+++LI+ W NL
Sbjct  10   KNNAKNKLWMAAIKPPMYSVAIMPIWVGTAVAFAETKIWNWAVFSVFLAAAILILAWENL  69

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
            SNDV+D +TG D+NK  S+VN+ G++        + L LG  G++  +    +   I L+
Sbjct  70   SNDVFDSETGIDQNKHHSLVNLTGNKLLIFWLGNIFLCLGLLGILAIAWWQHDWTVIGLI  129

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPLC  962
                  GY YQ PPFRL YQGLGE LC
Sbjct  130  MVCCALGYAYQGPPFRLGYQGLGEVLC  156


 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS +VG+ T+LIL+CSHFHQ+ DD A GK SP+VRLGT+ GA+++     ++Y+LT++
Sbjct  181   LAASAIVGIATTLILYCSHFHQVKDDLAAGKRSPIVRLGTQRGAQLLSWFTASIYALTLV  240

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                T   P+ + +LS +++P    +  +V++NH +  ++   K+  V +H
Sbjct  241   FVLTAIFPTWT-LLSWVSLPFAIKLCRHVQQNHHNPEQVSNCKFIAVAVH  289



>ref|WP_026082454.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Mastigocladopsis 
repens]
Length=301

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 85/143 (59%), Gaps = 0/143 (0%)
 Frame = +3

Query  534  RTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDV  713
             T L   A+K P+YSVA++P+ VG+A A+ +   F    +   L +++LI+ W NLSNDV
Sbjct  10   NTKLWMAAIKPPMYSVAIMPIWVGTAVAFAETKTFHGAVFSTFLGAAILILAWENLSNDV  69

Query  714  YDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAI  893
            +D +TG DKNK  S+VN+ G++        + L LG  G+   +    +L  I ++    
Sbjct  70   FDSETGIDKNKHHSLVNLTGNKLLIFWLGILFLSLGLLGIGAIAWWQQDLTVIGIILLCC  129

Query  894  TCGYIYQCPPFRLSYQGLGEPLC  962
              GYIYQ PPFRL YQGLGE +C
Sbjct  130  ALGYIYQGPPFRLGYQGLGEIIC  152


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
              +AS++VG+ TSLILFCSHFHQ++DD A GK SP+VR+GT+  A+++     ++Y+LT++
Sbjct  177   FAASIIVGIATSLILFCSHFHQVEDDIAAGKRSPIVRIGTQKAAQLLSWLTGSIYALTLL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P A  +LS  ++P  R + ++V++NH    K+   K+  V +H      L  G
Sbjct  237   FVLCGVFP-AWTLLSFASLPNARKLCTHVQQNHNQPEKVSNCKFIAVSVHFWSCLLLGVG  295

Query  1495  LVVARF  1512
              ++A F
Sbjct  296   FLLAGF  301



>ref|WP_024125203.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA [Thermosynechococcus 
sp. NK55a]
 ref|YP_008900327.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA [Thermosynechococcus 
sp. NK55a]
 gb|AHB88814.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA [Thermosynechococcus 
sp. NK55a]
Length=298

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 90/151 (60%), Gaps = 6/151 (4%)
 Frame = +3

Query  519  EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
             E+I R+ L W A+KLP+YSVA++P+ +G+A A  + G      +   L ++VLI+ WLN
Sbjct  5    SESIDRSRLWWAAIKLPMYSVAVMPIWLGTAGAIAKTGRVHWWPFGLFLTAAVLILAWLN  64

Query  699  LSNDVYDFDTGADKNKKESVVNIVGSRT---GTLIAAYVSLELGFCGLVWASLQSANLRA  869
            LSNDV+D +TG D++K  SVVN+ G +           +   LG   + W   Q   +  
Sbjct  65   LSNDVFDAETGIDRHKYHSVVNLTGKKQLIFWLSNLCLLLGLLGIAAISWLQ-QDGTVLG  123

Query  870  ILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            ++LL  A+  GY YQ PPFRL Y GLGEP+C
Sbjct  124  LVLLCCAL--GYSYQGPPFRLGYLGLGEPIC  152


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 69/126 (55%), Gaps = 1/126 (1%)
 Frame = +1

Query  1087  IASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGA  1266
             IA+     +   S +I   + L GLTT+LILFCSHFHQ+ DD A GK SP+VRLGT   A
Sbjct  161   IAAAYYSQVQTFSPSIWPVATLNGLTTTLILFCSHFHQVADDLAAGKRSPVVRLGTARSA  220

Query  1267  EVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKY  1446
             ++V  +    Y + +       LP  + +L++ ++P    +   + + H    +I  +K+
Sbjct  221   QLVYGACGLFYGVLVASVLWGLLPGPT-LLALGSLPWAIYLCQRMAQFHSVPEQIENSKF  279

Query  1447  YCVRLH  1464
               V+LH
Sbjct  280   IAVQLH  285



>ref|WP_017311241.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Fischerella sp. 
PCC 9339]
Length=302

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 90/148 (61%), Gaps = 0/148 (0%)
 Frame = +3

Query  519  EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
             +N ++  L   A+K P+YSVA++P+ VG+A A+ +  + +   +   LA+++LI+ W N
Sbjct  9    PKNNAKNQLWMAAIKPPMYSVAIMPIWVGTAVAFAETHILNWAVFGVFLAAAILILAWEN  68

Query  699  LSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILL  878
            LSNDV+D +TG D+NK  S+VN+ G++        + L LG  G++  +    +   I L
Sbjct  69   LSNDVFDSETGIDQNKHHSLVNLTGNKLLIFWLGNLFLCLGLLGILAIAWWQGDWTVIGL  128

Query  879  LASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +      GY+YQ PPFRL YQGLGE LC
Sbjct  129  VLVCCALGYVYQGPPFRLGYQGLGEILC  156


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LIL+CSHFHQ+ DD A GK SP+VRLGTK GA+V+     ++Y LT++
Sbjct  181   LAASVIVGIPTTLILYCSHFHQVTDDLAAGKRSPIVRLGTKRGAQVLNWFTASIYLLTLL  240

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  + +LS +++P    +  +V++NH +  K+   K+  V +H
Sbjct  241   FVLGGIFPVWT-LLSWVSLPFAIKLCRHVQQNHSNPEKVSNCKFIAVAVH  289



>gb|EDX86986.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 7335]
Length=337

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 92/157 (59%), Gaps = 0/157 (0%)
 Frame = +3

Query  492  HSDAINEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLAS  671
            HS + +   ++  S+  L   A+K P+Y VA++P+ VGSA AY+Q G F    +     S
Sbjct  20   HSASAHSADDQLRSQKRLWLAALKPPMYCVAVMPICVGSAVAYVQTGRFRADVFSMFALS  79

Query  672  SVLIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQ  851
            ++L++ W NLSNDV+D +TG D NK  S+VN+  +R        V L LG  G++  SL 
Sbjct  80   AILLLVWENLSNDVFDAETGIDVNKHHSLVNLTSNRQLIFWIGNVCLLLGVAGVLTISLT  139

Query  852  SANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              +   + ++ +    GY+YQ PPFRL Y+G+GE LC
Sbjct  140  QHDSTVLAMVLACCALGYLYQGPPFRLGYRGIGEILC  176


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = +1

Query  1120  ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALY  1299
             +S  +L A+++VG+ T+L+LFCSHFHQI+DD   GK SP+ RLGT+ GA+++ A+  A+ 
Sbjct  207   LSSPLLPAAIIVGIGTTLVLFCSHFHQIEDDLKAGKRSPVARLGTQRGAQLLPAACTAVL  266

Query  1300  SLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGA  1479
                +       LP  ++++ + ++P    +  +V   H    ++  +K+  +  H   G+
Sbjct  267   LTALAAIAQGGLPLGTLLI-LGSLPAAIKLCLHVLTFHNQPERVKNSKFLAIHFHFWSGS  325

Query  1480  TLAAGLVVA  1506
              L  GL+ +
Sbjct  326   LLLIGLIAS  334



>ref|WP_037221988.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase, partial [Richelia 
intracellularis]
Length=151

 Score =   110 bits (274),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 51/133 (38%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+  A+ +   F    ++  +A+++LI+ W NLSNDV+D DTG 
Sbjct  18   AIKPPMYSVAIMPIWIGTTVAFAETQNFDGGVFVTFVAAAILILAWENLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            DKNK  S+VN+  ++        + L LG  G++  ++   +L  + ++      GY+YQ
Sbjct  78   DKNKHHSLVNLTRNKKLIFWLGNLFLVLGLLGIIAIAIWQKDLTVVGMITLCCLLGYLYQ  137

Query  915  CPPFRLSYQGLGE  953
             PPFRL Y GLGE
Sbjct  138  GPPFRLGYHGLGE  150



>dbj|GAL92312.1| 1,4-dihydroxy-2-naphthoate polyprenyltransferase [Microcystis 
aeruginosa NIES-44]
Length=302

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ +G+  A  + G FS+  +   + S++LI+ WLNLSNDV+D DTG 
Sbjct  18   ALKPPMYSVAIIPIILGTVIADQETGRFSLPIFATFILSAILILAWLNLSNDVFDADTGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ G+++     + + L +G  G+   S    +   + L+A     GY YQ
Sbjct  78   DVNKAHSIVNLTGNKSLIFWLSNLFLLVGIAGIFAISYWRGDWMILELIALCCFLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  138  GPPFRLGYQGLGEIIC  153


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+ RLGT  G+ V+    + +Y LT++    +  P  ++++
Sbjct  192   LFCSHFHQVADDLKAGKKSPIARLGTLKGSRVLTVVTVLVYVLTVVFVLLQVYPPLTLLI  251

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               L++P    ++ +V +NH+    +   K+  V LH   G   + G  +A
Sbjct  252   -FLSLPFAWQLVHHVNQNHDQPQLVSNCKFIAVNLHFFSGILFSLGYFLA  300



>ref|WP_009633114.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechocystis sp. 
PCC 7509]
Length=299

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+A A+ +  +F    +   L S++LI+ W+NLSNDV+D +TG 
Sbjct  17   AIKPPMYSVAIIPIWVGTAVAFAETKVFVGWHFATFLMSAILIVAWINLSNDVFDSETGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            DKNK  S+VN+ G++        + L +G  G+   +    ++  I L+      GY YQ
Sbjct  77   DKNKAHSLVNLTGNKQLIFWLGNLFLGVGLLGIGAIAFWQKDVTIIGLIMLCCGLGYTYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  137  GPPFRLGYQGLGEIIC  152


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = +1

Query  1120  ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALY  1299
             +S T LSASV+VG+ TSLILFCSHFHQI DD A GK SP+VRLGT   A ++     ++Y
Sbjct  172   LSMTSLSASVVVGVATSLILFCSHFHQITDDLAAGKKSPIVRLGTLKAANLLPWLGGSIY  231

Query  1300  SLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGA  1479
              LT +L      P  ++++  L+ P    ++ +V+KNH+    +   K+  V LH   G 
Sbjct  232   LLTTMLAIVGNFPIWTLLIW-LSCPFAIKLVQHVQKNHDRPDIVSNCKFIAVALHFWSGL  290

Query  1480  TLAAGLVVA  1506
              L+ G ++ 
Sbjct  291   LLSLGFMLG  299



>ref|WP_009628241.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pseudanabaena biceps]
 gb|ELS31670.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pseudanabaena biceps 
PCC 7429]
Length=304

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 88/153 (58%), Gaps = 0/153 (0%)
 Frame = +3

Query  504  INEEKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLI  683
            ++  +   I    L   A+KLP+YSVA+VP+  G+A AY   G  +   +   LA++++I
Sbjct  6    VDTPQISPIPSRKLWMAAIKLPMYSVAIVPIATGTAVAYRDTGAINWAVFATFLAAAIVI  65

Query  684  ITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANL  863
            + W NL NDV+D +TG D +K  SVVN+ G +   L  A + L +G  G++  S    + 
Sbjct  66   LVWENLCNDVFDAETGIDIHKAHSVVNLTGKKNLILAIANICLLMGIGGVLAISWLQQDA  125

Query  864  RAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              + L+A     GY+YQ PPFRL YQG GE LC
Sbjct  126  VVVSLVALCCLLGYMYQGPPFRLGYQGWGEILC  158


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+A+V+VG+ TSLILFCSHF+Q++DD A GK SP+VRLGTK  ++++      +Y++TI+
Sbjct  183   LAAAVVVGIITSLILFCSHFNQVEDDLAAGKRSPVVRLGTKRASQLLPWVCAVIYAVTIV  242

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                 +  P  + I+ ++++P+   + +++  +HE    +   ++  V LH + G+ L+  
Sbjct  243   AIALQFFPIWTAIV-LVSLPIAWKLCTFIGDHHEQSEMLLNCRFIAVALHFVVGSCLSVS  301

Query  1495  LV  1500
             L+
Sbjct  302   LI  303



>ref|WP_026079671.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Spirulina subsalsa]
Length=299

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            SR  L W A+K P+Y+VA+ P++V +AA Y   G  +   +   L S + +I W+NLSND
Sbjct  10   SRRELWWAAIKPPMYTVAITPISVATAAVYGVIGQINGFLFGLFLISGIAVIAWINLSND  69

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG D+NK  SVVN+ G+++     +   L +G  G+   +    + R +  +A A
Sbjct  70   VFDSETGIDQNKAHSVVNLTGNKSLVFWLSNACLLVGISGIGAIAFFQQDWRVLGAIALA  129

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL YQGLGE +C
Sbjct  130  CALGYTYQGPPFRLGYQGLGELIC  153


 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 7/132 (5%)
 Frame = +1

Query  1117  PISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMAL  1296
             P S T+  AS+ VG++T++ILFCSHFHQ++DD A GK SP+VRLGT  G+ V+  S  +L
Sbjct  172   PPSPTLWGASLFVGISTAIILFCSHFHQVEDDLAAGKRSPIVRLGTAKGSTVLAVSTASL  231

Query  1297  YSLT---IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHA  1467
             Y LT   I+LG+     S   +L   T+P+   ++ +V + H    K+   K+  V+LH 
Sbjct  232   YVLTPLFILLGYF----SPWTLLLFFTVPVAYELVHHVGQYHNQPDKVRNCKFIAVKLHF  287

Query  1468  LFGATLAAGLVV  1503
               G  L+ GL++
Sbjct  288   WTGLVLSLGLIL  299



>ref|XP_005714922.1| unnamed protein product [Chondrus crispus]
 emb|CDF35103.1| unnamed protein product [Chondrus crispus]
Length=305

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 6/137 (4%)
 Frame = +3

Query  570  IYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGADKNKK  749
            +Y+VA+ P+ VGS AA+ + G  S+      L S+VLII WLN++NDV+D+D G D NK 
Sbjct  1    MYTVAITPILVGSLAAHAETGFLSLRTLCHFLLSAVLIIAWLNITNDVFDYDAGIDGNKP  60

Query  750  ESVVNIVG----SRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL--LLASAITCGYIY  911
            ES+VN+ G    +R    + A V L  GF  L   S         +  L++ A+  GY+Y
Sbjct  61   ESIVNLCGATRTARNTLFLIANVILAAGFACLAKLSKTGGQFDPTVPALISVAVAGGYVY  120

Query  912  QCPPFRLSYQGLGEPLC  962
            Q PPFRLS+ GLGEP+C
Sbjct  121  QGPPFRLSHYGLGEPIC  137


 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = +1

Query  1132  ILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTI  1311
             +L+A+ LV   T+LIL CSHFHQ+DDDK  GK SP+VRLGT   + +++A++ A  S   
Sbjct  164   LLAAAFLVATPTALILLCSHFHQLDDDKLAGKRSPIVRLGTLRASILLEAALFAFMSAHS  223

Query  1312  ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAA  1491
             +      LP     LS+L IP G  + ++V KNH+    +  AKY+ VR H + G  ++ 
Sbjct  224   VFYGMGMLPVRPFFLSLLAIPSGVKLGAFVRKNHQTPHAVRPAKYHAVRFHFVHGILISI  283

Query  1492  GL  1497
             G 
Sbjct  284   GF  285



>ref|WP_011058030.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Thermosynechococcus 
elongatus]
 ref|NP_682986.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC09748.1| 1,4-dihydroxy-2-naphtoic acid prenyltransferase [Thermosynechococcus 
elongatus BP-1]
Length=298

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 90/153 (59%), Gaps = 6/153 (4%)
 Frame = +3

Query  513  EKEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITW  692
               E+I R+ L W A+KLP+YSVA++P+ +G+A A  + G      +   L ++VLI+ W
Sbjct  3    SSSESIDRSRLWWAAIKLPLYSVAVMPIWLGTAVAIAKTGRGHWWPFGLFLTAAVLILAW  62

Query  693  LNLSNDVYDFDTGADKNKKESVVNIVGSRT---GTLIAAYVSLELGFCGLVWASLQSANL  863
            LNLSNDV+D +TG D++K  SVVN+ G +           +   LG   + W   Q   +
Sbjct  63   LNLSNDVFDAETGIDRHKYHSVVNLTGKKQLIFWLSNLCLLLGLLGIAAISWLQ-QDGTV  121

Query  864  RAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              ++LL  A+  GY YQ PPFRL Y GLGEP+C
Sbjct  122  LGLVLLCCAL--GYSYQGPPFRLGYLGLGEPIC  152


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 70/126 (56%), Gaps = 1/126 (1%)
 Frame = +1

Query  1087  IASMLGDSILPISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGA  1266
             IA+     +   S +I   ++L GLTT+LILFCSHFHQ+ DD A GK SP+VRLGT   A
Sbjct  161   IAAAYYSQVQTFSASIWPVAILNGLTTTLILFCSHFHQVADDLAAGKRSPVVRLGTARSA  220

Query  1267  EVVKASVMALYSLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKY  1446
             ++V  +    Y + +       LP  + +L++ ++P    +   + + H    +I  +K+
Sbjct  221   QLVYGACGLFYGVLVASVLWGLLPWPT-LLALSSLPWAIYLCQRMAQFHSVPEQIKNSKF  279

Query  1447  YCVRLH  1464
               V+LH
Sbjct  280   IAVQLH  285



>ref|WP_030007854.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechococcus 
sp. NKBG042902]
Length=316

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 4/138 (3%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K PIY+VA+ P+ V +AAAY + G+F   R+   L +++ +I W+NLSNDV+D DTG 
Sbjct  21   AIKPPIYTVAVTPVIVTTAAAYGEFGVFDPVRFGLFLGAAICLIAWMNLSNDVFDADTGI  80

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRAILLLASAITCGYI  908
            D NK  SVVN+ G R      A   L LG  G+   S   Q   +  +LLLA+AI   Y 
Sbjct  81   DVNKATSVVNLTGDRPLVFGIALGFLGLGITGIALISYLQQDWTVFNLLLLATAI--AYT  138

Query  909  YQCPPFRLSYQGLGEPLC  962
            YQ PPFRL Y G+GE +C
Sbjct  139  YQGPPFRLGYLGIGEFVC  156


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 7/129 (5%)
 Frame = +1

Query  1141  ASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG  1320
             AS  V LTTS+ILFCSHFHQ +DD A GK SP+VRLGT  GA+V+  S+ A+  LT +L 
Sbjct  182   ASTWVALTTSIILFCSHFHQAEDDLAAGKKSPIVRLGTYQGAQVLTYSLGAVLVLTCLLV  241

Query  1321  FTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLV  1500
                T  S  ++L+  + P    +I++V  NH+   K+   K++ V+ H       A+GL+
Sbjct  242   AVGTW-SPWMLLTFASAPFALSLINHVRLNHDQPDKVSNCKFFAVKFH------FASGLL  294

Query  1501  VARFFARNY  1527
             +A  +  +Y
Sbjct  295   LAIAYVLSY  303



>ref|WP_009555890.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ68973.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoriales 
cyanobacterium JSC-12]
Length=300

 Score =   112 bits (281),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = +3

Query  540  TLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYD  719
            TL   A+K P+YSVA++P+ VGSA AY + G+ +   +   L S++LI+ W NLSNDV+D
Sbjct  13   TLWLAAIKPPMYSVAIMPIWVGSAVAYAETGILNTVVFFTFLLSAILILAWENLSNDVFD  72

Query  720  FDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITC  899
             +TG D NK  SVVN+ G+++     +   L LG  G+   +    +L  I L+      
Sbjct  73   SETGVDVNKANSVVNLTGNKSLVFWLSNACLGLGLLGIGVIAYWQQDLTVIGLILLCCAI  132

Query  900  GYIYQCPPFRLSYQGLGEPLC  962
            GYIYQ PPFRLSYQGLGE LC
Sbjct  133  GYIYQGPPFRLSYQGLGEFLC  153


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 1/128 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T  +AS+++G+ TSLILFCSHF+Q++DD AVGK +P+VRLGT+  A+++     ++Y 
Sbjct  174   SVTSFAASIIIGIATSLILFCSHFNQVNDDAAVGKKTPVVRLGTQRAAQLLPWICSSVYG  233

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT +    K LP  + +L   ++P  R +   +   H     +   ++  V  H   G  
Sbjct  234   LTCLFVLLKLLPVWT-LLVFASVPYARKLCHCIWTQHHQPETLLSCRFIAVAFHFWTGLM  292

Query  1483  LAAGLVVA  1506
             L  G V+ 
Sbjct  293   LGIGFVMG  300



>ref|WP_012307593.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Synechococcus sp. 
PCC 7002]
 ref|YP_001735226.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechococcus 
sp. PCC 7002]
 gb|ACA99970.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 7002]
Length=316

 Score =   112 bits (281),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K PIY+VA+ P+ V +AAAY + G+F+  R+   L +++ +I W+NLSNDV+D DTG 
Sbjct  21   AIKPPIYTVAVTPVIVTTAAAYGEFGVFNPVRFGLFLGAAICLIAWMNLSNDVFDADTGI  80

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRAILLLASAITCGYI  908
            D NK  SVVN+ G R      A   L LG  G+   S   Q   +  +LLLA+AI   Y 
Sbjct  81   DVNKATSVVNLTGDRPLVFGIALGFLGLGITGIALISYLQQDWMVFNLLLLATAI--AYT  138

Query  909  YQCPPFRLSYQGLGEPLC  962
            YQ PPFRL Y G+GE +C
Sbjct  139  YQGPPFRLGYLGIGEFVC  156


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 75/124 (60%), Gaps = 1/124 (1%)
 Frame = +1

Query  1141  ASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG  1320
             AS  V LTTS+ILFCSHFHQ +DD A GK SP+VRLGT  GA+V+  S+ A+  LT +L 
Sbjct  182   ASAWVALTTSIILFCSHFHQAEDDLAAGKKSPIVRLGTYQGAQVLTYSLGAVLVLTCLLV  241

Query  1321  FTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLV  1500
                T  S  ++L+  + P    +I++V  NH+   K+   K++ V+ H   G  LA   V
Sbjct  242   AVGTW-SPWMLLTFASAPFALSLINHVRLNHDQPDKVSNCKFFAVKFHFASGLLLAIAYV  300

Query  1501  VARF  1512
             ++ +
Sbjct  301   LSYY  304



>ref|WP_008277770.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Cyanothece sp. 
CCY0110]
 gb|EAZ89124.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Cyanothece 
sp. CCY0110]
Length=307

 Score =   112 bits (281),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+Y+VA++P+TVG+A A+ + G+F    +   L S++LII WLN+SND
Sbjct  14   SKAKLWLAAIKPPMYTVAIIPITVGTAFAFGETGIFDSKIFGTFLTSAILIIAWLNISND  73

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D DTG DKNK  S+VN+ G ++     A + L LG  G++  +    ++  +L++   
Sbjct  74   VFDADTGIDKNKAHSIVNLTGDKSLMFWLANLFLCLGILGILLIAWWQKDITVLLIILLC  133

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFR  YQGLGE +C
Sbjct  134  CALGYSYQGPPFRFGYQGLGEFIC  157


 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 72/110 (65%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+  +L+G++TS+ILFCSHFHQ++DD A GK SP+VR+GT+  ++V+  + +  ++L ++
Sbjct  182   LAPGILIGISTSIILFCSHFHQVEDDLAAGKKSPIVRMGTQLASQVLTVTTVLFFALVVL  241

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                   L S   +L   ++P+   ++++V KNH+   ++   K+  VRLH
Sbjct  242   FSLLH-LFSFWTLLVFSSVPIAYQLVTHVNKNHDKPNQVSNCKFIAVRLH  290



>ref|WP_019505811.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=302

 Score =   112 bits (280),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K PIYSVA++P+ VG+A A+ Q GLF    +   L S++LII WLNLSNDV+D +TG 
Sbjct  17   AIKPPIYSVAVIPIAVGTAIAFAQTGLFDSQIFFTFLGSAILIIAWLNLSNDVFDSETGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D +K  SVVN+ G++      A   L LG  G+        +   + L+      GY YQ
Sbjct  77   DIHKDHSVVNLTGNKFLVFWIANCCLGLGLAGIFALCWWQKDWTVLGLVLLCCLLGYTYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL Y GLGE +C
Sbjct  137  GPPFRLGYLGLGEIIC  152


 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             SG  L+ S ++G++TS+ILFCSHFHQ++DD A GK SP+VRLGT  GA+++     ++Y 
Sbjct  173   SGASLAISSIIGISTSIILFCSHFHQVEDDLAAGKRSPIVRLGTSKGAQILTWLTASIYF  232

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVR  1458
             L +IL     LPS S+I+   ++P    ++S+V +NH+   K+  +K+  V 
Sbjct  233   LAVILVVLSVLPSLSLII-FGSLPFAYQLVSHVLRNHDSPQKVSNSKFIAVN  283



>ref|WP_015182113.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcoleus sp. 
PCC 7113]
 ref|YP_007121367.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcoleus sp. 
PCC 7113]
 gb|AFZ17961.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Microcoleus sp. 
PCC 7113]
Length=301

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S + L   A+K P+Y+VA++P+ VG+A AY +    +   +   L S++LII WLN SND
Sbjct  9    SNSKLWLAAIKPPMYTVAIIPIWVGTAVAYAETRNINGAIFSTFLMSAILIIAWLNCSND  68

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG DKNK  S+VN+ G++      + + L +G  G+V  +    +L  I L+   
Sbjct  69   VFDAETGIDKNKAHSLVNLTGNKPLIFALSNLFLAVGILGIVAIAWWQRDLTVIGLIFLC  128

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFR  YQGLGE +C
Sbjct  129  CALGYTYQGPPFRFGYQGLGEIIC  152


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 78/123 (63%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
              +AS++VG+ TS+ILFCSHFHQ++DD A GK SP+VRLGTK G++V+    +++Y+LT +
Sbjct  177   FAASIVVGIATSIILFCSHFHQVEDDIAAGKRSPIVRLGTKRGSQVLWVFSVSVYALTGL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  ++ +   ++P+   +  +V ++H+   K+  +K+  V +H   G  L+ G
Sbjct  237   FVLLGHFPIWTLFV-FASLPVALKLCWHVHQHHDQPEKVSNSKFIAVGMHFWSGLLLSLG  295

Query  1495  LVV  1503
              V+
Sbjct  296   FVL  298



>ref|WP_026732594.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Fischerella 
sp. PCC 9605]
Length=302

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 87/147 (59%), Gaps = 0/147 (0%)
 Frame = +3

Query  522  ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
            +N  +T L   A+K P+YSVA++P+ VG+A A+ +    +   +   L +++ I+ W N+
Sbjct  10   KNNPKTKLWMAAIKPPMYSVAIMPIWVGTAVAFAENKSLNGANFFTFLVAAIFILAWENI  69

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
            SNDV+D +TG D+NK  S+VN+ G++        + L LG  G++  +    +L  I L+
Sbjct  70   SNDVFDSETGIDRNKYHSLVNLTGNKLLIFWLGNIFLCLGLLGILAIAWWQRDLTVIGLI  129

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPLC  962
                  GY YQ PPFRL YQGLGE LC
Sbjct  130  LVCCALGYAYQGPPFRLGYQGLGEILC  156


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LIL+CSHFHQ+ DD A GK SP+VRLGT+ GA+ +     ++Y+L  +
Sbjct  181   LTASVIVGIATTLILYCSHFHQVKDDLAAGKRSPIVRLGTQKGAQFLHWFTGSIYALNFL  240

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS +++P    + ++V++NH++  K+   K+  V +H      L AG
Sbjct  241   CVVWGIFPVWT-LLSWVSLPFAIKLCTHVQQNHDNPEKVSNCKFIAVAVHFWCCLLLGAG  299

Query  1495  LVV  1503
              ++
Sbjct  300   FML  302



>ref|WP_015134406.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Leptolyngbya sp. 
PCC 7376]
 ref|YP_007071479.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Leptolyngbya sp. 
PCC 7376]
 gb|AFY38645.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Leptolyngbya sp. 
PCC 7376]
Length=315

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 87/138 (63%), Gaps = 4/138 (3%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K PIY+VA+ P+ V +A+AY + GLF   R+   L +SV +I W+NLSNDV+D DTG 
Sbjct  20   AIKPPIYTVAVTPIIVATASAYGELGLFDGLRFGLFLFASVCMIAWMNLSNDVFDSDTGI  79

Query  735  DKNKKESVVNIVGSRTGT--LIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYI  908
            D NK  S+VNI G R     L   +++L LG   L+    Q   +  +L++A+AI   Y 
Sbjct  80   DVNKASSLVNITGDRQLIFWLANGFLALGLGNIALISYLQQDWTVLGLLVVAAAI--AYT  137

Query  909  YQCPPFRLSYQGLGEPLC  962
            YQ PPFRL Y G+GE +C
Sbjct  138  YQGPPFRLGYLGIGEFVC  155


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 76/124 (61%), Gaps = 1/124 (1%)
 Frame = +1

Query  1141  ASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG  1320
             AS+ V LTTS+ILFCSHFHQ +DD A GK SP+VRLGT  GAEV+  S++ +  LT  L 
Sbjct  181   ASMWVALTTSIILFCSHFHQAEDDLAAGKKSPIVRLGTALGAEVLTYSLVGVLVLTCGL-  239

Query  1321  FTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLV  1500
                 L S  ++++  + P    +I++V  NH D  K+  AK++ V+ H   G  LA   +
Sbjct  240   IAFGLWSPWMLITFGSAPFALQLINHVRTNHADPDKVKNAKFFAVKFHFSSGILLAIAYI  299

Query  1501  VARF  1512
             ++ +
Sbjct  300   LSYY  303



>ref|WP_026222139.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [filamentous 
cyanobacterium ESFC-1]
Length=303

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 97/150 (65%), Gaps = 5/150 (3%)
 Frame = +3

Query  519  EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
            E+ I++  L + A+K P+YSVA++P+ VG+A AY        + +L  L+S+VLII WLN
Sbjct  7    EQQINKK-LWFAAIKPPMYSVAVIPIWVGTAMAYGDTQQIYWSIFLTFLSSAVLIIAWLN  65

Query  699  LSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRAI  872
            LSNDV+D DTG DKNK  SVVN+  +++     + + L LG  G+V  +L  Q   +  I
Sbjct  66   LSNDVFDADTGIDKNKAHSVVNLTQNKSLVFWISNLCLLLGLGGIVAIALWQQDMMIVGI  125

Query  873  LLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +LL  A+  GY YQ PPFRL YQGLGE +C
Sbjct  126  VLLCCAL--GYTYQGPPFRLGYQGLGEIIC  153


 Score = 94.7 bits (234),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 76/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  1132  ILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTI  1311
             +L AS L+GLTTS+ILFCSHFHQ+ DD A GK SP+VRLGT   A V+  S   +++LT+
Sbjct  177   VLIASTLIGLTTSIILFCSHFHQVQDDLAAGKRSPIVRLGTALSARVLAWSTGIIFALTV  236

Query  1312  ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAA  1491
             +L      P  ++++   ++P+   ++S+V  +H+    +   K+  V+LH   G     
Sbjct  237   LLICLGYTPLGTVLI-FFSLPVAYQLVSHVNAHHDQPKLVSNCKFLAVKLHFWSGLLWGF  295

Query  1492  GLVVARFF  1515
             G ++   F
Sbjct  296   GFIIPGVF  303



>ref|WP_015225671.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Halothece sp. PCC 
7418]
 ref|YP_007168009.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Halothece sp. PCC 
7418]
 gb|AFZ43795.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Halothece sp. PCC 
7418]
Length=297

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 82/139 (59%), Gaps = 6/139 (4%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K PIYSVALVP+T+G+  AY +      + +L  L S +LII WLNLSNDV+D +TG 
Sbjct  5    AIKPPIYSVALVPITMGTLVAYRETNQLDWSIFLLFLLSGILIIAWLNLSNDVFDSETGI  64

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLE---LGFCGLVWASLQSANLRAILLLASAITCGY  905
            D NK  SVVNI G+++     + + L     G   + W       +  +LL   A   GY
Sbjct  65   DINKTTSVVNITGNKSLVFWMSNICLMGAVFGLGAIAWLQQDWLVVGCVLL---ACFLGY  121

Query  906  IYQCPPFRLSYQGLGEPLC  962
             YQ PPFRL YQGLGE +C
Sbjct  122  TYQGPPFRLGYQGLGEIIC  140


 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             SG  L+ S L+G++TS+ILFCSHFHQ++DD A GK SP+VRLGT+TGA V+ AS  +++ 
Sbjct  161   SGFALAISTLIGISTSIILFCSHFHQVEDDLAAGKRSPIVRLGTQTGANVLLASTASIFL  220

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT+        P A++++  L +P    ++ +V++ H+   K+  +K+  V  +      
Sbjct  221   LTLFWIGLGYFPIATLLI-FLAVPWAYQLVRHVQRYHDQPEKVSNSKFLAVNFYFWSSLF  279

Query  1483  LAAGLVV  1503
             L AG+++
Sbjct  280   LGAGMLI  286



>ref|WP_026087108.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Fischerella 
muscicola]
Length=302

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 90/147 (61%), Gaps = 0/147 (0%)
 Frame = +3

Query  522  ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
            +N ++  L   A+K P+YSVA++P+ VG+A A+ +  + +   +   LA+++LI+ W NL
Sbjct  10   KNNAKKKLWMAAIKPPMYSVAIMPIWVGTAVAFAETNILNWVVFGVFLAAAILILAWENL  69

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
            SNDV+D +TG D+NK  S+V++ G++        + L LG  G++  +    +   I L+
Sbjct  70   SNDVFDSETGIDQNKHHSLVSLTGNKLLIFWLGNLFLCLGLLGILAIAWWQRDWTVIGLI  129

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPLC  962
                  GY+YQ PPFRL YQGLGE LC
Sbjct  130  LVCCALGYLYQGPPFRLGYQGLGEILC  156


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LIL+CSHFHQ+ DD A GK SP+VRLGT+ GA+V+     ++Y LT+ 
Sbjct  181   LAASVIVGIATTLILYCSHFHQVTDDLAAGKRSPIVRLGTQRGAQVLSWFTASIYFLTLF  240

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH----ALFGA  1479
                    P  + +LS +++P    +  +V++NH    ++   K+  V +H     LFGA
Sbjct  241   FVLGGIFPVWT-LLSWVSLPFAIKLCRHVQQNHSQPEQVSNCKFIAVAVHFWCCLLFGA  298



>ref|WP_026723187.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Fischerella 
sp. PCC 9431]
Length=302

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = +3

Query  519  EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
             +N  +  L   A+K P+YSVA++P+ VG+A A+ +  + +   +   LA+++LI+ W N
Sbjct  9    PKNHPKNKLWMAAIKPPMYSVAIMPICVGTAVAFAETNILNWVVFGVFLAAAILILAWEN  68

Query  699  LSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILL  878
            LSNDV+D +TG D+NK  S+V++ G++        + L LG  G++  +    +   I L
Sbjct  69   LSNDVFDSETGIDQNKHHSLVSLTGNKLLIFWLGNLFLCLGLLGILAIAWWQRDWTVIGL  128

Query  879  LASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +      GY+YQ PPFRL YQGLGE LC
Sbjct  129  ILVCCALGYVYQGPPFRLGYQGLGEILC  156


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+V + T+LIL+CSHFHQ+ DD A GK SP+VRLGT+ GA+V+     ++Y LT++
Sbjct  181   LAASVIVAIPTTLILYCSHFHQVTDDLAAGKRSPIVRLGTERGAQVLVWFTASIYVLTLL  240

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +L+ L++P    +  +V +NH    ++   K+  V +H        AG
Sbjct  241   FVLGGIFPMWT-LLNWLSLPFAIKLCRHVLQNHNKPEQVSNCKFIAVAVHFWCCLLFGAG  299

Query  1495  LVV  1503
              +V
Sbjct  300   FMV  302



>ref|WP_011613412.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Trichodesmium erythraeum]
 ref|YP_723555.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Trichodesmium 
erythraeum IMS101]
 gb|ABG53082.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Trichodesmium erythraeum 
IMS101]
Length=298

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (59%), Gaps = 0/146 (0%)
 Frame = +3

Query  525  NISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLS  704
            N S   L   A+K P+YSVA++P+ +G+A A  +      + +L  + S++LI+ W N+S
Sbjct  7    NKSDKKLWLAAIKPPMYSVAIMPIWIGTAIAIWEKNGIDWSIFLTFITSAILILGWENIS  66

Query  705  NDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLA  884
            NDV+D +TG DKNK  S+VN+ G++        + L LG  G+   S    +L  I L+ 
Sbjct  67   NDVFDSETGIDKNKHHSLVNLTGNKNLMFWLGNLCLFLGILGVATISWWLQDLTVIGLIL  126

Query  885  SAITCGYIYQCPPFRLSYQGLGEPLC  962
                 GY+YQ PPFRL YQGLGE +C
Sbjct  127  LCCFLGYVYQGPPFRLGYQGLGEIIC  152


 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 1/125 (1%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+AS+++G+TT++ILFCSHFHQ+ DD A GK SP+VR+GTK G++V+  S   ++ L 
Sbjct  175   TSLTASIIIGITTTIILFCSHFHQVKDDLAAGKRSPIVRMGTKAGSQVLNWSCGIVFVLI  234

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLA  1488
              I    K  P  + +LS   +P    +  ++   H+   KI   K+  V LH   G  L 
Sbjct  235   SICVGLKLFPVWA-LLSFAGLPFAIHLCRHLSHYHDQPEKISNCKFIAVYLHFFSGLLLG  293

Query  1489  AGLVV  1503
              G V+
Sbjct  294   LGFVI  298



>ref|WP_035154130.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Calothrix sp. 
336/3]
 gb|KFB84075.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Calothrix sp. 
336/3]
Length=296

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 0/147 (0%)
 Frame = +3

Query  522  ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
            + IS   L   A+K P+YSVA++P+ VG+  A  +   FS   +L  L +++LI+ W NL
Sbjct  4    QQISSNKLWLAAIKPPMYSVAIMPIWVGNMIALGEKKNFSWYIFLTFLVAAILILAWENL  63

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
            SNDV+D +TG DKNK  S+VN+ G++          L  G  G+   +    +L  ++ +
Sbjct  64   SNDVFDSETGIDKNKHHSLVNLTGNKRLIFWLGNFCLFCGLLGIAAITWWQQDLTVVVTI  123

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPLC  962
             +    GY YQ PPFRL YQGLGE LC
Sbjct  124  LACCVLGYFYQGPPFRLGYQGLGEILC  150


 Score = 94.7 bits (234),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ T+LILFCSHFHQ++DD A GK SP+VRLGT T A+V+  +V+++Y  T +
Sbjct  175   LAASVIVGIATTLILFCSHFHQVEDDIAAGKRSPVVRLGTATAAKVLTIAVISIYIFTAL  234

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  + +LS L++P    +  +V+ NH    K+  +K+  V +H      L  G
Sbjct  235   FVILGIFPHWT-LLSFLSLPSAWKLCRHVQDNHYLPEKVSNSKFIAVAVHFWCCLFLGIG  293

Query  1495  LVV  1503
              V+
Sbjct  294   FVI  296



>ref|WP_013320592.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Cyanothece sp. 
PCC 7822]
 ref|YP_003885757.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanothece sp. 
PCC 7822]
 gb|ADN12482.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanothece sp. 
PCC 7822]
Length=300

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 90/147 (61%), Gaps = 6/147 (4%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+YSVA++P+  G+A A+ +    +++ +L  L S++LI+ W NLSND
Sbjct  10   SKKKLWLAAIKPPMYSVAIMPIIAGTAIAFRETHRLNLSIFLTFLISAILILAWENLSND  69

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGL---VWASLQSANLRAILLL  881
            V+D +TG DKNK  SVVN+ G++      +   L LG  G+    W   Q   +  I+LL
Sbjct  70   VFDSETGIDKNKTHSVVNLTGNKPLIFGLSNFCLGLGILGIFAIAWWQ-QDWTVLEIILL  128

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPLC  962
              A+  GY YQ PPFRL YQGLGE +C
Sbjct  129  CCAL--GYSYQGPPFRLGYQGLGEIIC  153


 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +1

Query  1123  SGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYS  1302
             S T+L  SV +G++TS+ILFCSHFHQ++DD A GK SP+VRLGT  GA+++K S  +LY 
Sbjct  174   SATMLGGSVFIGISTSIILFCSHFHQVEDDIAAGKRSPIVRLGTARGAKLLKWSTASLYV  233

Query  1303  LTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
             LT++L      P  + +L VL++P    + S+V++ H+   K+   K+  V LH   G  
Sbjct  234   LTVLLIGLGIYPLGT-LLVVLSLPFAIALTSHVQQYHDQPEKVSNCKFLAVNLHFFSGIL  292

Query  1483  LAAGLVV  1503
              A G ++
Sbjct  293   FALGFLL  299



>ref|WP_017293894.1| hypothetical protein [Geminocystis herdmanii]
Length=305

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 4/155 (3%)
 Frame = +3

Query  510  EEKEENI----SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSV  677
            + K  NI    S+  L + A+K P+Y+VA++P+  G+A AY + G+F +  +L  L S +
Sbjct  6    QAKSSNINTSPSKNKLWFAAIKPPMYTVAVIPIGFGTALAYGETGIFHLNIFLTFLLSGI  65

Query  678  LIITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSA  857
             II WLNLSNDV+D DTG D NK  SVVN+ G+R      +   L LG  G++  +    
Sbjct  66   FIIAWLNLSNDVFDSDTGIDVNKAHSVVNLTGNRNLIFWISIGFLLLGLGGILLINYWLK  125

Query  858  NLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            +   + L+ ++   GY YQ PPFR  Y GLGE +C
Sbjct  126  DWTVLWLIIASCALGYTYQGPPFRFGYLGLGEIIC  160


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = +1

Query  1177  LFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTLPSASIIL  1356
             LFCSHFHQ+ DD   GK SP+VRLGT  GA+V+  SV+  YSL ++L   K LP  ++I+
Sbjct  199   LFCSHFHQVTDDITAGKKSPIVRLGTDLGAKVLIISVILFYSLCVVLTLIKILPDNALIV  258

Query  1357  SVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLV  1500
              +L++P+   +I++V + H+   K+  +K+  V LH   G  L  GL+
Sbjct  259   -MLSLPIAYQLINHVRQYHDQPEKVKNSKFIAVNLHFFSGLLLCLGLI  305



>ref|WP_038019139.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Synechococcus 
sp. PCC 7335]
Length=307

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+Y VA++P+ VGSA AY+Q G F    +     S++L++ W NLSND
Sbjct  3    SQKRLWLAALKPPMYCVAVMPICVGSAVAYVQTGRFRADVFSMFALSAILLLVWENLSND  62

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG D NK  S+VN+  +R        V L LG  G++  SL   +   + ++ + 
Sbjct  63   VFDAETGIDVNKHHSLVNLTSNRQLIFWIGNVCLLLGVAGVLTISLTQHDSTVLAMVLAC  122

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY+YQ PPFRL Y+G+GE LC
Sbjct  123  CALGYLYQGPPFRLGYRGIGEILC  146


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = +1

Query  1120  ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALY  1299
             +S  +L A+++VG+ T+L+LFCSHFHQI+DD   GK SP+ RLGT+ GA+++ A+  A+ 
Sbjct  177   LSSPLLPAAIIVGIGTTLVLFCSHFHQIEDDLKAGKRSPVARLGTQRGAQLLPAACTAVL  236

Query  1300  SLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGA  1479
                +       LP  ++++ + ++P    +  +V   H    ++  +K+  +  H   G+
Sbjct  237   LTALAAIAQGGLPLGTLLI-LGSLPAAIKLCLHVLTFHNQPERVKNSKFLAIHFHFWSGS  295

Query  1480  TLAAGLVVA  1506
              L  GL+ +
Sbjct  296   LLLIGLIAS  304



>ref|WP_015227911.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Dactylococcopsis 
salina]
 ref|YP_007170255.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Dactylococcopsis 
salina PCC 8305]
 gb|AFZ48898.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Dactylococcopsis 
salina PCC 8305]
Length=305

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 92/153 (60%), Gaps = 11/153 (7%)
 Frame = +3

Query  516  KEENISRTTLIW-RAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITW  692
            K+ NIS    +W  A+K PIY+VA++P+T+G+  AY ++G  +   +   L S +LII W
Sbjct  12   KKINIS----LWLAAIKPPIYTVAIIPITMGTIIAYRESGQLNWMIFSLFLLSGILIIAW  67

Query  693  LNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLE---LGFCGLVWASLQSANL  863
            LNLSNDV+D +TG D NK  SVVNI G+++     +   L    L    + W   Q   +
Sbjct  68   LNLSNDVFDSETGIDVNKTTSVVNITGNKSLVFWVSNFCLAGAILALSAIGWLQ-QDWGV  126

Query  864  RAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              ++LLA  +  GY YQ PPFRL YQGLGE +C
Sbjct  127  IGLVLLACFL--GYTYQGPPFRLGYQGLGEIIC  157


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 71/127 (56%), Gaps = 7/127 (6%)
 Frame = +1

Query  1132  ILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTI  1311
             +L  S ++G++TSLILFCSHFHQ++DD A GK SP+VRLGTKTGA V+     +++ LTI
Sbjct  181   LLVTSTIIGISTSLILFCSHFHQVEDDLAAGKRSPIVRLGTKTGANVLAGFTASIFILTI  240

Query  1312  ---ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGAT  1482
                ILG+         +       + R V +Y    H    K+  +K+  V+ +      
Sbjct  241   FWTILGYFPLSSLLIFLSLPSAYQLVRHVQTY----HNQPQKVSNSKFIAVQFYCWSSCF  296

Query  1483  LAAGLVV  1503
             L  GL++
Sbjct  297   LGLGLLI  303



>ref|XP_002505417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66675.1| predicted protein [Micromonas sp. RCC299]
Length=533

 Score =   113 bits (282),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 93/165 (56%), Gaps = 17/165 (10%)
 Frame = +3

Query  519  EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLN  698
            +   +R  L  RA+KLP+YSVAL PL V  A  +   G  +V ++ AL   + L+I WLN
Sbjct  185  QPTPTRAELWRRAIKLPMYSVALAPLLVAGALCHHWYGCVNVPQWGALAGGACLVIAWLN  244

Query  699  LSNDVYDFDTGADKNKKESVVNIVG------SRTGTLIAAYV----SLELGFCGLVWASL  848
            LSND +D  TG D +K ESVV ++G      +R   +   +      L LG  GL +A+ 
Sbjct  245  LSNDAWDAATGVDDSKPESVVRLLGGDESEDARKAAVNKVHAIALGCLALGAGGLCYAAT  304

Query  849  QSANLRA-------ILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
            Q A   A       + +L +A+  G+ YQ PPFRLSY+G+GEPLC
Sbjct  305  QLATNAAADVVYTVLAMLGAAVAAGHAYQGPPFRLSYKGMGEPLC  349


 Score = 88.2 bits (217),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  1132  ILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTI  1311
             +L A+VLVGLTT+ ILF SHFHQ + D+A GK SP+VRLG +   +V++  V+  + L  
Sbjct  389   VLGAAVLVGLTTTCILFTSHFHQEEGDRAAGKKSPVVRLGLRKAIDVLRGGVLFHHFLAS  448

Query  1312  ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAA  1491
              L F   LP    +   + +P+   V S+  ++ +   ++F  KY  VR H      LA 
Sbjct  449   FLAFNGWLPIMGAVGVFIAMPLSIGVSSFAARHADAPAELFRTKYGAVRWHVAHAVFLAL  508

Query  1492  GLVVARFFARNYNMRP  1539
             G  +  +   N++  P
Sbjct  509   GCWLDPWMVWNWHRIP  524



>ref|WP_015124706.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 6312]
 ref|YP_007061706.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 6312]
 gb|AFY61163.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 6312]
Length=317

 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 82/140 (59%), Gaps = 0/140 (0%)
 Frame = +3

Query  543  LIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDF  722
            L W A+K P+YSVA++P+  G+A A+      +   +   L ++VLI+ WLNL+NDV+D 
Sbjct  31   LWWAALKPPMYSVAVMPIWGGTALAWHLEKTLNGPVFATFLGAAVLILAWLNLTNDVFDS  90

Query  723  DTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCG  902
            +TG D+NK  S+VN+ G +T     A + L LG   L   S+   N     L+      G
Sbjct  91   ETGIDQNKHHSIVNLTGRKTLIFWIANLCLGLGLVSLAILSVLQGNFVVFGLVLLCCGLG  150

Query  903  YIYQCPPFRLSYQGLGEPLC  962
            Y YQ PPFRL Y GLGEP+C
Sbjct  151  YTYQGPPFRLGYLGLGEPIC  170


 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = +1

Query  1132  ILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTI  1311
             I    +++GLTT+LILFCSHFHQ++DD A GKYSP+VR+GTKTGA V +  +  ++ LT 
Sbjct  194   IWPVGMIIGLTTTLILFCSHFHQVEDDLAAGKYSPIVRIGTKTGAVVTQIMIGLVFGLT-  252

Query  1312  ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAA  1491
             +LG+       +++L + ++P G  +  YV++ H+  + I  +K+  V LH   G  L  
Sbjct  253   VLGWGLGQFPVTVLLVLASLPWGIYLGQYVQRYHDTPSMIQSSKFIAVSLHFWSGLLLGL  312

Query  1492  GLVVA  1506
             G + A
Sbjct  313   GWIWA  317



>ref|WP_006196062.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Nodularia spumigena]
 gb|EAW45587.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Nodularia spumigena 
CCY9414]
 gb|AHJ31111.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Nodularia spumigena 
CCY9414]
Length=301

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+A A+ +    ++  +   +A+++LI+ W N+SNDV+D +TG 
Sbjct  17   AIKPPMYSVAIMPIWVGTAVAFAETKSLNLVVFSTFIAAAILILAWENISNDVFDSETGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D+NK  S+VN+ G++        + L  G  G++  ++   +   I L+      GY YQ
Sbjct  77   DENKHHSLVNLTGNKLLIFWLGNLCLVSGLLGIIAIAIWQKDFTVIGLILLCCALGYTYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE LC
Sbjct  137  GPPFRLGYQGLGEILC  152


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+ASV+VG+ TSL+LFCSHFHQ+ DD A GK SP+VRLGT   A+++      +Y L ++
Sbjct  177   LAASVIVGIATSLVLFCSHFHQVKDDIAAGKRSPVVRLGTAKAAKLLSWFTGGIYPLILL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
                    P  + +LS L++P G  +  +V++NH    K+   K+  V LH
Sbjct  237   FVLLGMFPVWT-LLSWLSLPFGFQLCRHVQENHHLPEKVSNCKFIAVNLH  285



>gb|KFF42133.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=304

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 90/144 (63%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K+P+YSV+++P+ VGS+AA+     F+   +   L SS+LII W+N+SND
Sbjct  11   SKQKLWLAAIKIPVYSVSIIPIIVGSSAAFENISTFNFRIFTTFLISSILIIAWINVSND  70

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            ++D DTG DKNK  S+VN+  +++     + + L LG  G++  S    +L  + ++   
Sbjct  71   IFDADTGIDKNKAHSIVNLTKNKSLIFWLSNIFLILGIVGIILISWWQKDLTVLCIVTVC  130

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PPFRL Y+GLGE +C
Sbjct  131  CILGYSYQGPPFRLGYKGLGEIIC  154


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L++ +L+G++TS+ILFCSHFHQI+DD + GK SP+V LGT+ G+ V+    + L  L ++
Sbjct  179   LASGILIGISTSIILFCSHFHQIEDDFSAGKRSPIVFLGTELGSIVLTIITVLLMFLVLL  238

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                 K L S    LS+L+ P+   ++ +V K H   + +  +K+  ++ H   G  L+  
Sbjct  239   FPILKIL-SFWTFLSLLSFPIAYQLVCHVLKYHNQASNVKNSKFIAIKFHFFNGILLSVS  297

Query  1495  LVVAR  1509
             L++++
Sbjct  298   LILSK  302



>ref|WP_017320202.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [cyanobacterium 
PCC 7702]
Length=303

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+A A+ +  + +   +L  L +++LI+ W NLSNDV+D +TG 
Sbjct  22   AIKPPMYSVAIMPVWVGTAIAFAETKVINKAIFLTFLVAAILILAWENLSNDVFDSETGI  81

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            DKNK  S+VN+ G++        + L LG   +   +    ++  + L+ +    GY+YQ
Sbjct  82   DKNKHHSLVNLTGNKLLIFWLGNLFLCLGLLAVAAIAWWQQDITVVGLVVTGCILGYLYQ  141

Query  915  CPPFRLSYQGLGEPLC  962
             PPFR  YQG+GE LC
Sbjct  142  GPPFRWGYQGVGEILC  157


 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+AS++VG+ TSLIL+CSHFHQ++DD A GK SP+VRLGT+ GA+++     ++Y LT +
Sbjct  182   LAASIVVGIATSLILYCSHFHQVEDDLAAGKRSPIVRLGTQAGAKLLNLFAASIYVLTFL  241

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L      P A  +LS L++P    +  +V++NH+   K+   K+  V +H
Sbjct  242   LVLGGIFP-AWTLLSWLSLPFAIKLCRHVQENHQQPDKVSNCKFIAVAVH  290



>ref|WP_026093445.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Calothrix sp. 
PCC 7103]
Length=299

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+A AY Q        +   L +++LI+ W NLSNDVYD +TG 
Sbjct  17   AIKPPMYSVAIMPIWVGTAVAYAQTQHLDTIIFSTFLGAAILILAWENLSNDVYDSETGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASL--QSANLRAILLLASAITCGYI  908
            D NK  S+VN+ G++        + L  G  G+   S   Q   +  I+LL   +  GYI
Sbjct  77   DINKHHSLVNLTGNKPLVFWLGNLCLIFGLLGIFTISWWQQDPTVIGIILLCCGL--GYI  134

Query  909  YQCPPFRLSYQGLGEPLC  962
            YQ PPFRL Y+GLGE LC
Sbjct  135  YQGPPFRLGYKGLGEILC  152


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT--  1308
             L AS++VG+ TSLILFCSHFHQ+ DD A GK SP+VRLGT  GA+V+     ++Y+LT  
Sbjct  177   LVASIVVGVATSLILFCSHFHQVKDDLAAGKLSPIVRLGTLRGAQVLTVCTTSIYALTAI  236

Query  1309  -IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH----ALF  1473
              ++LGF         +LS +++P    +  +V  NH+    +   K+  V +H     LF
Sbjct  237   FVVLGFFPIW----TLLSWVSLPFAVKLCRHVNLNHDKPELVSNCKFIAVAVHFWCCTLF  292

Query  1474  G  1476
             G
Sbjct  293   G  293



>ref|WP_006511269.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Xenococcus sp. 
PCC 7305]
 gb|ELS01591.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Xenococcus sp. 
PCC 7305]
Length=306

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 91/156 (58%), Gaps = 5/156 (3%)
 Frame = +3

Query  504  INEEKEENISRTTLIWRA-VKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVL  680
            I    E N      +WRA +KLP+YSV +VP+ VG+A A  + G  +    +  L S+++
Sbjct  3    IELTSELNKPNQRQLWRAAIKLPLYSVIIVPMWVGTAVAIAETGTINWQNLILFLISALV  62

Query  681  IITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGF--CGLVWASLQS  854
            I TW NL+NDV+D +TG D +K  SVV + G +T  L  A   L +G    GL+    + 
Sbjct  63   IQTWTNLTNDVFDDETGVDIHKYHSVVKLTGKKTAILWLANGLLIMGLLITGLICWWQRD  122

Query  855  ANLRAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
             NL  I+++   +  GYIYQ PPFRLSY G+GE LC
Sbjct  123  LNLMIIVVIDCFL--GYIYQGPPFRLSYHGVGEILC  156


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 79/133 (59%), Gaps = 1/133 (1%)
 Frame = +1

Query  1120  ISGTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALY  1299
             +S TIL++S+ VG  TS+ILFCSHFHQ++DD A GKYSP+VR GT+  A+++  S +  Y
Sbjct  175   VSETILASSICVGFATSMILFCSHFHQVEDDLAGGKYSPVVRFGTEKSAQILSWSAVINY  234

Query  1300  SLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGA  1479
             SL  +  +   LP   +I  +L++     + SYV + H    K+   K+  V ++  FG 
Sbjct  235   SLIGLFVWLGMLPIWGLI-CLLSVFYAIKLCSYVNRYHSQPQKVSNCKFIAVAMYFWFGL  293

Query  1480  TLAAGLVVARFFA  1518
              L  G+V+    A
Sbjct  294   LLGVGIVIPSLIA  306



>ref|WP_039729444.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Lyngbya confervoides]
 gb|KIF16654.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Aphanocapsa 
montana BDHKU210001]
 gb|KIF41662.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Lyngbya confervoides 
BDU141951]
Length=299

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 10/153 (7%)
 Frame = +3

Query  519  EENISRTTLIWRAVKLPIYSVALVPLTVGSAAAY-----LQAGLFSVTRYLALLASSVLI  683
            E    R  L   A+K P+YSVA++P+ VGS  A+     LQAG+F     +  + S++LI
Sbjct  2    EVAAKRKKLWLAALKPPMYSVAIMPMLVGSLVAFAETQRLQAGIF-----VTFVVSAILI  56

Query  684  ITWLNLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANL  863
            + W N+SNDV+D  TG D NK  S+VN+ G +          L LG  G++  +LQ  + 
Sbjct  57   LAWENISNDVFDSATGIDVNKHHSLVNLTGKKRLVFAIGNGCLGLGIAGIIAIALQQQDP  116

Query  864  RAILLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              ++L+  +   GY YQ PPFRL YQGLGE LC
Sbjct  117  TVLVLILLSCLLGYAYQGPPFRLGYQGLGEILC  149


 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +1

Query  1141  ASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVK---ASVMALYSLTI  1311
             A V++G+TTSL+LFCSHFHQ++DD A GK SP+VRLGT+ GA+++      V+ L  +  
Sbjct  176   AGVIIGITTSLVLFCSHFHQVEDDIAAGKRSPIVRLGTQRGAQLIPWLCGLVLVLIVVAA  235

Query  1312  ILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             I G+       +++  +  I +    ++Y    H+   KIF  K+Y +  H
Sbjct  236   IGGYLPLWSLLALLSGISAIRLSLQALTY----HDQPVKIFNLKFYAIGFH  282



>ref|WP_015116250.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Rivularia sp. PCC 
7116]
 ref|YP_007053219.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Rivularia sp. PCC 
7116]
 gb|AFY52672.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Rivularia sp. PCC 
7116]
Length=298

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+Y VA++P+ VG+A A+ +  +     +   LA+++LI+ W NLSNDV+D DTG 
Sbjct  17   ALKPPMYCVAIMPIWVGTAIAFAETRVLHTAVFCTFLAAAILILAWENLSNDVFDSDTGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D NK  S+VN+ GSR   L      L  G  G++  S    +L  I ++      GY+YQ
Sbjct  77   DINKHHSLVNLTGSRQLILWLGNCFLASGLFGILTISWWQKDLTLIGIILICCGLGYLYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL Y+GLGE LC
Sbjct  137  GPPFRLGYKGLGEILC  152


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 77/121 (64%), Gaps = 8/121 (7%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+ASV+VG+TT+LILFCSHFHQ++DD A GK SP+VRLGT  G++V+K    ++Y+L 
Sbjct  175   TSLAASVIVGITTTLILFCSHFHQVEDDLAAGKLSPIVRLGTLKGSQVLKWFTGSIYALI  234

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKI----FMA---KYYCVRLHA  1467
              I       P  + +LS  ++P    + ++V +NH+   +I    F+A   +++C  L  
Sbjct  235   FIFILCGIFPLWT-LLSWFSLPFAAKLYNHVSQNHDKPLEISNLKFIAIAVQFWCCLLLG  293

Query  1468  L  1470
             L
Sbjct  294   L  294



>ref|WP_038654964.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Prochlorococcus 
sp. MIT 0801]
Length=311

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            K     R  L   A+K P+YSVA++P+ V +      +G   + +++  L +S+LI+ W 
Sbjct  6    KSSTTDRKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWE  65

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NL+ND++D +TG DK K  SVV + GS++     AY SL LG   +   +L+S     I 
Sbjct  66   NLTNDLFDDETGVDKYKFHSVVALTGSKSTVSRVAYFSLLLGLFIIFILALKS----KIT  121

Query  876  LLASAITC---GYIYQCPPFRLSYQGLGEPLC  962
            +L   I C   GY+YQ PPFRL Y+GLGEPLC
Sbjct  122  VLFLVIICCFLGYLYQGPPFRLGYKGLGEPLC  153


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = +1

Query  1126  GTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSL  1305
             GT L       + T+L+LFCSHFHQI+ D AVGK SPLV LGT   AE +   V  ++ L
Sbjct  181   GTSLIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVILGTHRAAEFLPWFVGLIFLL  240

Query  1306  TIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATL  1485
              ++       P  ++I  ++++P G  +I  ++++H    +I  +K+  +R   + G  L
Sbjct  241   ELLPVLLGIWPITTLI-CLISLPSGLDLIKLIKRHHNQPERIKNSKFLALRFQTINGLCL  299

Query  1486  AAGLVVARFF  1515
             + G  ++ FF
Sbjct  300   SIGFAISSFF  309



>gb|AIQ96357.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Prochlorococcus 
sp. MIT 0801]
Length=329

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            K     R  L   A+K P+YSVA++P+ V +      +G   + +++  L +S+LI+ W 
Sbjct  24   KSSTTDRKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWE  83

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NL+ND++D +TG DK K  SVV + GS++     AY SL LG   +   +L+S     I 
Sbjct  84   NLTNDLFDDETGVDKYKFHSVVALTGSKSTVSRVAYFSLLLGLFIIFILALKS----KIT  139

Query  876  LLASAITC---GYIYQCPPFRLSYQGLGEPLC  962
            +L   I C   GY+YQ PPFRL Y+GLGEPLC
Sbjct  140  VLFLVIICCFLGYLYQGPPFRLGYKGLGEPLC  171


 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = +1

Query  1126  GTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSL  1305
             GT L       + T+L+LFCSHFHQI+ D AVGK SPLV LGT   AE +   V  ++ L
Sbjct  199   GTSLIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVILGTHRAAEFLPWFVGLIFLL  258

Query  1306  TIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATL  1485
              ++       P  ++I  ++++P G  +I  ++++H    +I  +K+  +R   + G  L
Sbjct  259   ELLPVLLGIWPITTLI-CLISLPSGLDLIKLIKRHHNQPERIKNSKFLALRFQTINGLCL  317

Query  1486  AAGLVVARFF  1515
             + G  ++ FF
Sbjct  318   SIGFAISSFF  327



>ref|WP_035991238.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Leptolyngbya 
sp. KIOST-1]
Length=304

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 94/155 (61%), Gaps = 0/155 (0%)
 Frame = +3

Query  555   AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
             A+K P+YSVA++P+ VGSA AY +   F+   +   + ++VLI+ W NLSNDV+D +TG 
Sbjct  17    AIKPPMYSVAIMPMVVGSAIAYAETSQFNSGIFALFVLAAVLILAWENLSNDVFDSETGI  76

Query  735   DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
             D NK  SVVN+  +R      A   L LG  G+V  +L   +   + L+      GY+YQ
Sbjct  77    DVNKAHSVVNLTRNRRLVFGLANGCLGLGIAGIVAIALIQQDPTVLGLILLCCGLGYLYQ  136

Query  915   CPPFRLSYQGLGEPLCfaafgpfattafYLLQSST  1019
              PPFRL YQGLGE LCF +FGP A  A Y  Q+ T
Sbjct  137   GPPFRLGYQGLGEVLCFFSFGPLAMGAAYYSQTQT  171


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  1141  ASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILG  1320
             A ++VGLTT+L+LFCSHFHQ++DD A GK SP+VRLGT+ GA ++  +    +++     
Sbjct  179   AGIIVGLTTTLVLFCSHFHQVEDDLAAGKRSPIVRLGTRRGAALIPWTCGVAFAIAAACL  238

Query  1321  FTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLV  1500
                  P+ S ++  L++P    +  +V + H+   ++F AK++ +  H   G  LA G  
Sbjct  239   TLGLFPAWSALV-FLSLPSAWRLSRHVTRYHDQPARVFNAKFFAIGFHFWSGVLLAMGFW  297

Query  1501  VARFFA  1518
             ++ + +
Sbjct  298   LSTWLS  303



>ref|WP_036904880.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Prochlorococcus 
marinus]
Length=311

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            K     R  L   A+K P+YSVA++P+ V +      +G   + +++  L +S+LI+ W 
Sbjct  6    KSSTTERKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWE  65

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NL+ND++D +TG DK K  SVV + GS++     AY SL LG   +   +L+S     I 
Sbjct  66   NLTNDLFDDETGVDKYKFHSVVALTGSKSTVSRVAYFSLLLGLFIIFILALKS----KIT  121

Query  876  LLASAITC---GYIYQCPPFRLSYQGLGEPLC  962
            +L   I C   GY+YQ PPFRL Y+GLGEPLC
Sbjct  122  VLFLVIICCFLGYLYQGPPFRLGYKGLGEPLC  153


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = +1

Query  1126  GTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSL  1305
             GT L       + T+L+LFCSHFHQI+ D AVGK SPLV LGT   AE +   V  ++ L
Sbjct  181   GTALIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVILGTHRAAEFLPWFVGLIFLL  240

Query  1306  TIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATL  1485
              ++       P  ++I  ++++P G  +I  ++++H    +I  +K+  +R   + G  L
Sbjct  241   ELLPVLLGIWPITTLI-CLISLPSGLDLIKLIKRHHNQPERIKNSKFLALRFQTINGLCL  299

Query  1486  AAGLVVARFF  1515
             + G  ++ FF
Sbjct  300   SIGFAISSFF  309



>ref|WP_011823035.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Prochlorococcus 
marinus]
 ref|YP_001014080.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Prochlorococcus 
marinus str. NATL1A]
 gb|ABM74815.1| 1,4-dihydroxy-2-naphthoate (DHNA) octaprenyltransferase; UbiA 
prenyltranferase family [Prochlorococcus marinus str. NATL1A]
Length=329

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            K     R  L   A+K P+YSVA++P+ V +      +G   + +++  L +S+LI+ W 
Sbjct  24   KSSTTERKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWE  83

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NL+ND++D +TG DK K  SVV + GS++     AY SL LG   +   +L+S     I 
Sbjct  84   NLTNDLFDDETGVDKYKFHSVVALTGSKSTVSRVAYFSLLLGLFIIFILALKS----KIT  139

Query  876  LLASAITC---GYIYQCPPFRLSYQGLGEPLC  962
            +L   I C   GY+YQ PPFRL Y+GLGEPLC
Sbjct  140  VLFLVIICCFLGYLYQGPPFRLGYKGLGEPLC  171


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 71/130 (55%), Gaps = 1/130 (1%)
 Frame = +1

Query  1126  GTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSL  1305
             GT L       + T+L+LFCSHFHQI+ D AVGK SPLV LGT   AE +   V  +  L
Sbjct  199   GTALIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVILGTHRAAEFLPWFVGLILLL  258

Query  1306  TIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATL  1485
              ++       P  ++I  ++++P G  +I  ++++H    +I  +K+  +R   + G  L
Sbjct  259   ELLPVLLGIWPITTLI-CLISLPSGLDLIKLIKRHHNQPERIKNSKFLALRFQTINGLCL  317

Query  1486  AAGLVVARFF  1515
             + G  ++ FF
Sbjct  318   SIGFAISSFF  327



>gb|KGG21670.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Prochlorococcus 
marinus str. PAC1]
Length=329

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            K     R  L   A+K P+YSVA++P+ V +      +G   + +++  L +S+LI+ W 
Sbjct  24   KSSTTERKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWE  83

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NL+ND++D +TG DK K  SVV + GS++     AY SL LG   +   +L+S     I 
Sbjct  84   NLTNDLFDDETGVDKYKFHSVVALTGSKSTVSRVAYFSLLLGLFIIFILALKS----KIT  139

Query  876  LLASAITC---GYIYQCPPFRLSYQGLGEPLC  962
            +L   I C   GY+YQ PPFRL Y+GLGEPLC
Sbjct  140  VLFLVIICCFLGYLYQGPPFRLGYKGLGEPLC  171


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = +1

Query  1126  GTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSL  1305
             GT L       + T+L+LFCSHFHQI+ D AVGK SPLV LGT   AE +   V  ++ L
Sbjct  199   GTALIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVILGTHRAAEFLPWFVGLIFLL  258

Query  1306  TIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATL  1485
              ++       P  ++I  ++++P G  +I  ++++H    +I  +K+  +R   + G  L
Sbjct  259   ELLPVLLGIWPITTLI-CLISLPSGLDLIKLIKRHHNQPERIKNSKFLALRFQTINGLCL  317

Query  1486  AAGLVVARFF  1515
             + G  ++ FF
Sbjct  318   SIGFAISSFF  327



>ref|XP_007509891.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Bathycoccus 
prasinos]
 emb|CCO19006.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Bathycoccus 
prasinos]
Length=468

 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVP-LTVGSAAAYL-----QAGLFSVTRYLALLASSV  677
            KE  +S ++L WR  KLP+YSVA++P L   S+A+YL     + G  ++   L LL  + 
Sbjct  150  KERELSSSSLWWRCAKLPMYSVAIIPVLVAASSASYLNLIDPKIGASAMNLTLRLLLGAC  209

Query  678  LIITWLNLSNDVYDFDTGADKN--KKESVVNIVGSRTGTLIAAYV-SLELGFCGLVWASL  848
             +I WLN+SND +D+ TG D    K ES+VN++    G + AA+V S      G+V    
Sbjct  210  SVIAWLNISNDAWDYQTGVDSGNRKPESIVNLL---NGDVKAAHVTSAFFLIAGVVTLLP  266

Query  849  QSANLRAI--LLLASAITCGYIYQCPPFRLSYQGLGEPLC  962
              AN  A+  + L  AI CGY YQ PP RLSY+GLGEPLC
Sbjct  267  LFANAPAVAPMALLLAIGCGYAYQAPPLRLSYKGLGEPLC  306


 Score = 84.0 bits (206),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 0/123 (0%)
 Frame = +1

Query  1150  LVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTK  1329
             +VG+TTS+ILF SH HQ + D+  GK SP VR G       ++  V A Y+L        
Sbjct  343   MVGVTTSMILFASHLHQREGDEVSGKLSPCVRFGVDFCVSSIQHVVSAYYALIATFVSCG  402

Query  1330  TLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVAR  1509
              LPS +  +  +T P+ R + +Y   N E++  +F  KY+ VR H   G  LA GL ++R
Sbjct  403   WLPSVAGAMIFITYPLARAMQNYALDNVENEKMLFKTKYFAVRWHVAHGVALAFGLWLSR  462

Query  1510  FFA  1518
               A
Sbjct  463   RLA  465



>ref|WP_015165002.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pseudanabaena sp. 
PCC 7367]
 ref|YP_007102464.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pseudanabaena sp. 
PCC 7367]
 gb|AFY70036.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Pseudanabaena sp. 
PCC 7367]
Length=331

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 85/144 (59%), Gaps = 0/144 (0%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+YSVA++P+ VG+A A+ Q    +   +L  + +++L++ W NLSND
Sbjct  26   SQRKLWLAAIKPPMYSVAIMPIVVGTAIAFYQTQQLNWRNFLTFMFAAILVLAWENLSND  85

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASA  890
            V+D +TG D+NK  SVVN+ G++      A + L LG  G+V  S    +   + ++   
Sbjct  86   VFDSETGIDQNKAHSVVNLTGNKNLVFAIANLFLLLGISGVVAISWWQRDFVVLGIVVLT  145

Query  891  ITCGYIYQCPPFRLSYQGLGEPLC  962
               GY YQ PP RL Y G GEP+C
Sbjct  146  CLLGYSYQGPPLRLGYLGWGEPIC  169


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 75/123 (61%), Gaps = 1/123 (1%)
 Frame = +1

Query  1147  VLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFT  1326
             ++VG+  +L+LFCSHFHQ++DD   GK SP+VRLG+K  A+++  + +++Y+ TI+   +
Sbjct  209   IIVGVGVTLVLFCSHFHQVEDDIKAGKRSPVVRLGSKRAAQLIPWAAVSIYATTIVSMIS  268

Query  1327  KTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVA  1506
               LP  S ++ +L+ P    + S + K H+    I  +KY  V L    G  L+ GLV+A
Sbjct  269   GFLPLWSGLV-LLSAPFAWKLSSLLGKYHDQPAMITESKYVAVLLQFSSGLGLSVGLVIA  327

Query  1507  RFF  1515
             R  
Sbjct  328   RLL  330



>ref|WP_015956695.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Cyanothece sp. 
PCC 7424]
 ref|YP_002379980.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Cyanothece 
sp. PCC 7424]
 gb|ACK73112.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanothece sp. 
PCC 7424]
Length=301

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+ SV +G++TS+ILFCSHFHQ++DD A GK SP+VRLGT TGA+V+K +  +LY+LT
Sbjct  176   TSLAVSVFIGMSTSIILFCSHFHQVEDDLAAGKKSPIVRLGTATGAKVLKWATTSLYALT  235

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLA  1488
             ++       P   I+L  +++P    ++++VE+ H +  K+  +K+  + LH + G  LA
Sbjct  236   VLFVVFNLYPRW-ILLVFMSLPFAIALVNHVEQYHAEPDKVNNSKFLAINLHFVSGILLA  294

Query  1489  AGLVVAR  1509
              G ++  
Sbjct  295   LGFILPH  301


 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+A A+ +    + + +   L S++LI+ W NLSNDV+D +TG 
Sbjct  18   AIKPPMYSVAIMPIIVGTAVAFGETNKINQSIFFTFLISAILILAWENLSNDVFDSETGI  77

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D+NK  SVVN+ G+++     + + L LG  G++  +    +   ++++      GY YQ
Sbjct  78   DQNKPHSVVNLTGNKSLIFWLSNLCLGLGILGILLIAWWQQDWTVLIIILFCCLLGYTYQ  137

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE LC
Sbjct  138  GPPFRLGYQGLGEILC  153



>ref|WP_015148203.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoria acuminata]
 ref|YP_007085479.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoria acuminata 
PCC 6304]
 gb|AFY81559.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Oscillatoria acuminata 
PCC 6304]
Length=298

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VG+A A  +    + + +   ++S++LI+ W N+SNDV+D DTG 
Sbjct  17   AIKPPMYSVAIMPIWVGTAVALYEHHSLNWSIFSTFISSAILILAWENISNDVFDSDTGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            DK K  S+VN+ G+++    A  + L LG  G+        +L  + L+      GY+YQ
Sbjct  77   DKKKHHSLVNLTGNKSLIFWAGNLCLALGILGIGAICWWQQDLTVLGLILLCCFLGYMYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE LC
Sbjct  137  GPPFRLGYQGLGEFLC  152


 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L AS++VG+ T+L+LFCSHFHQ++DD A GK SPLVR+GT+ GA+++     +++++T +
Sbjct  177   LLASIVVGIATTLVLFCSHFHQVEDDLAAGKRSPLVRMGTQRGAQLLPWFCGSIFAITGV  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
             L    + P  + +LS + IP    +  +V   H+   ++   K+  + +H
Sbjct  237   LVALGSFPVWT-LLSFVGIPASLKLCRHVATYHDSPDQVSNCKFIAIAVH  285



>ref|WP_011294177.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Prochlorococcus 
marinus]
 ref|YP_292735.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Prochlorococcus 
marinus str. NATL2A]
 gb|AAZ59032.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Prochlorococcus 
marinus str. NATL2A]
Length=306

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +3

Query  516  KEENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWL  695
            K     R  L   A+K P+YSVA++P+ V +      +G   + +++  L +S+LI+ W 
Sbjct  2    KSSTTERKHLWQAAIKWPLYSVAIMPVIVSAGWELGNSGNIRLGQFIGFLIASILILLWE  61

Query  696  NLSNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAIL  875
            NL+ND++D +TG DK K  SVV + G++T     AY SL LG   +   +L+S     I 
Sbjct  62   NLTNDLFDDETGVDKYKFHSVVALTGNKTTVSRVAYFSLLLGLFIIFILALKS----KIT  117

Query  876  LLASAITC---GYIYQCPPFRLSYQGLGEPLC  962
            +L   I C   GY+YQ PPFRL Y+GLGEPLC
Sbjct  118  VLFLVIICCFLGYLYQGPPFRLGYKGLGEPLC  149


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 1/130 (1%)
 Frame = +1

Query  1126  GTILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSL  1305
             GT L       + T+L+LFCSHFHQI+ D AVGK SPLV LGT   A  +   V  ++ L
Sbjct  177   GTALIVGAGPAMATTLVLFCSHFHQINQDAAVGKKSPLVVLGTNRAANFLPWLVGLIFLL  236

Query  1306  TIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATL  1485
              ++       P  + ++ ++++P G  +I  ++++H     I  +K+  +R   + G  L
Sbjct  237   ELLPVLNGIWP-ITTLMCLISLPSGLDLIKLIKRHHNKPELIKNSKFSALRFQTINGLCL  295

Query  1486  AAGLVVARFF  1515
             + G   + FF
Sbjct  296   SIGFATSYFF  305



>ref|WP_012630441.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Cyanothece sp. 
PCC 7425]
 ref|YP_002485773.1| 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Cyanothece 
sp. PCC 7425]
 gb|ACL47412.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Cyanothece sp. 
PCC 7425]
Length=300

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +3

Query  555  AVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTGA  734
            A+K P+YSVA++P+ VGSA A    G+   + +   L S++ II WLNLSNDV+D +TG 
Sbjct  17   ALKPPMYSVAVIPVWVGSAIALSTTGIIHWSIFFTFLGSALSIIAWLNLSNDVFDAETGI  76

Query  735  DKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIYQ  914
            D++K  S+VN+ G++      A + L LG  G++  +    +   + L+      GY YQ
Sbjct  77   DRHKYHSLVNLTGNKPLIFWLANLLLGLGIVGILAIAWWQQDWTVLGLVLLCCFLGYTYQ  136

Query  915  CPPFRLSYQGLGEPLC  962
             PPFRL YQGLGE +C
Sbjct  137  GPPFRLGYQGLGEIIC  152


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 75/123 (61%), Gaps = 1/123 (1%)
 Frame = +1

Query  1135  LSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTII  1314
             L+   +VG+TTS+ILFCSHFHQ++DD A GK SP+VRLGTK GA+++     ++Y++T++
Sbjct  177   LAVGAIVGITTSIILFCSHFHQVEDDLAAGKRSPIVRLGTKRGADLLPWCCGSIYAMTVL  236

Query  1315  LGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAG  1494
                    P  ++++   ++P    +  +V + H+   ++   K+  V+LH   G  L  G
Sbjct  237   FASLGLFPLWTLLIFA-SLPFAIHLSRHVGQYHDQPQQVSNCKFIAVKLHFWSGLLLGLG  295

Query  1495  LVV  1503
              ++
Sbjct  296   FMI  298



>ref|WP_015168429.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 7502]
 ref|YP_007105907.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 7502]
 gb|AFY73772.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Synechococcus sp. 
PCC 7502]
Length=300

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 82/144 (57%), Gaps = 0/144 (0%)
 Frame = +3

Query  522  ENISRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNL  701
            E+  R  L   A+K P+YSVA++P+T G+A AY Q    +   +   L  +VLI+ W NL
Sbjct  6    ESSDRKKLWLAAIKPPMYSVAIIPITTGTAIAYYQTAAINWEIFSTFLVGAVLILVWENL  65

Query  702  SNDVYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLL  881
             NDV+D DTG DKNK  S+VN+ G +   L  A + L  G   ++  S Q  +L  + ++
Sbjct  66   CNDVFDADTGIDKNKHHSLVNLTGRKNLILAIANICLITGIGLVLSISWQQQDLTVVGII  125

Query  882  ASAITCGYIYQCPPFRLSYQGLGE  953
            +     GY YQ  PFRL Y GLGE
Sbjct  126  SLCCFLGYTYQGHPFRLGYHGLGE  149


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 7/115 (6%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALY---  1299
             T L AS+++G+TT  ILFCSHFHQ+ DD A GK SP+VRLGT+  AE++   V+A++   
Sbjct  175   TALFASMIIGITTGAILFCSHFHQLQDDLAAGKRSPIVRLGTQKAAELLPWFVIAVFLII  234

Query  1300  SLTIILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLH  1464
              + I LG+   L      L  L++ +   + ++V + H    ++   K+  V  H
Sbjct  235   PVGISLGYFPLLTG----LVFLSLAIALKLTNFVSQYHNQPAEVSNCKFIAVAWH  285



>ref|WP_019475506.1| hypothetical protein [Prochlorococcus sp. W3]
Length=303

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +3

Query  552  RAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSNDVYDFDTG  731
            +A+K P+YSVA++P+ +  A  +          +     +S+LI+ W NL+ND+YD DTG
Sbjct  11   QAIKWPLYSVAIIPIFICGAYNFYAFKDIKFLNFFWFTMASILILLWENLTNDLYDSDTG  70

Query  732  ADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLVWASLQSANLRAILLLASAITCGYIY  911
             D+ K  S++N++ ++    + AY+SL LG   +   SL S ++  ++L+  + T GY+Y
Sbjct  71   IDQFKFHSIINLIKNKKLIFLIAYLSLFLGLLIIYIISL-SLSINILILVILSCTLGYLY  129

Query  912  QCPPFRLSYQGLGEPLC  962
            Q PPFRL Y GLGEPLC
Sbjct  130  QGPPFRLGYLGLGEPLC  146


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  1156  GLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLTIILGFTKTL  1335
              L+ +L+LFCSHFHQI++DK  GK S LV +G K  A +V   V+ +Y       F + +
Sbjct  185   ALSITLVLFCSHFHQINEDKKYGKRSLLVLMGIKKSASLVPLIVLFIYCFQTFTIFVEFI  244

Query  1336  PSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLAAGLVVARF  1512
             P     L ++++P    +I+ +   + +   +   K+  ++   + G  L  GL+   F
Sbjct  245   PKLC-FLYLISLPYALKLINILNSYNYNPKVLKNCKFIALKFQTMNGFGLIMGLLFYSF  302



>ref|WP_008187028.1| 1,4-dihydroxy-2-naphthoate prenyltransferase [Moorea producens]
 gb|EGJ31249.1| 1,4-dihydroxy-2-naphthoate phytyltransferase [Moorea producens 
3L]
Length=306

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 91/146 (62%), Gaps = 6/146 (4%)
 Frame = +3

Query  531  SRTTLIWRAVKLPIYSVALVPLTVGSAAAYLQAGLFSVTRYLALLASSVLIITWLNLSND  710
            S+  L   A+K P+YSVA++ + V +A A+ +    + T +L  +++S+LI+ W NLSND
Sbjct  14   SKQKLWLAAIKPPMYSVAIIYVWVAAAVAWFETNHLNWTIFLTFVSASILILAWENLSND  73

Query  711  VYDFDTGADKNKKESVVNIVGSRTGTLIAAYVSLELGFCGLV---WASLQSANLRAILLL  881
            V+D +TG DKNK  S+VN+ G+++       + L L   G++   W   Q   L A++LL
Sbjct  74   VFDSETGIDKNKAHSIVNLTGNKSLIFWLGNLCLGLAILGMLLICWWQ-QDLTLMALVLL  132

Query  882  ASAITCGYIYQCPPFRLSYQGLGEPL  959
              ++  GY+YQ PPFRL YQGLGE L
Sbjct  133  CCSL--GYMYQGPPFRLGYQGLGEIL  156


 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 71/125 (57%), Gaps = 1/125 (1%)
 Frame = +1

Query  1129  TILSASVLVGLTTSLILFCSHFHQIDDDKAVGKYSPLVRLGTKTGAEVVKASVMALYSLT  1308
             T L+AS++VGL T LILFCSHFHQ+ DD A GK SP+V LGTK GA+++     +L++ T
Sbjct  180   TNLAASIIVGLGTMLILFCSHFHQVKDDIAAGKRSPIVCLGTKRGAQLLPWICGSLFAAT  239

Query  1309  IILGFTKTLPSASIILSVLTIPMGRMVISYVEKNHEDKTKIFMAKYYCVRLHALFGATLA  1488
                      P  + +L+++ +P    +  +V  ++    K+   K+  V LH   G  L 
Sbjct  240   GGFVLMGLFPIWT-LLTLVGLPFAIKLCRHVNAHYNQPEKVSNCKFIAVALHFWSGLLLG  298

Query  1489  AGLVV  1503
              G V+
Sbjct  299   VGFVI  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5309665725034