BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20999_g2_i1 len=570 path=[541:0-538 1080:539-569]

Length=570
                                                                      Score     E

ref|XP_009601547.1|  PREDICTED: late embryogenesis abundant prote...  90.9    1e-18   
ref|XP_004160631.1|  PREDICTED: late embryogenesis abundant prote...  87.4    3e-17   
ref|XP_004252956.1|  PREDICTED: late embryogenesis abundant prote...  86.7    4e-17   
ref|XP_009803343.1|  PREDICTED: late embryogenesis abundant prote...  85.5    9e-17   
ref|XP_007222687.1|  hypothetical protein PRUPE_ppa008651mg           80.9    5e-15   
ref|XP_008223508.1|  PREDICTED: late embryogenesis abundant prote...  80.5    7e-15   
ref|XP_008439004.1|  PREDICTED: LOW QUALITY PROTEIN: late embryog...  80.5    1e-14   
gb|ADN34043.1|  late embryogenesis abundant protein D-29              80.5    1e-14   
ref|XP_011100670.1|  PREDICTED: late embryogenesis abundant prote...  77.4    4e-14   
ref|XP_011100671.1|  PREDICTED: late embryogenesis abundant prote...  76.3    1e-13   
ref|XP_011100672.1|  PREDICTED: late embryogenesis abundant prote...  75.1    2e-13   
ref|XP_009353429.1|  PREDICTED: late embryogenesis abundant prote...  70.1    4e-11   
ref|XP_009353428.1|  PREDICTED: late embryogenesis abundant prote...  70.5    4e-11   
ref|XP_004147633.1|  PREDICTED: late embryogenesis abundant prote...  69.7    5e-11   
gb|EYU33102.1|  hypothetical protein MIMGU_mgv1a014373mg              67.0    1e-10   
ref|XP_010024874.1|  PREDICTED: late embryogenesis abundant prote...  67.8    4e-10   
gb|KCW61396.1|  hypothetical protein EUGRSUZ_H04126                   67.4    4e-10   
ref|XP_007035997.1|  Late embryogenesis abundant protein D-29, pu...  66.6    8e-10   
ref|XP_008351126.1|  PREDICTED: late embryogenesis abundant prote...  65.9    2e-09   
gb|EYU28568.1|  hypothetical protein MIMGU_mgv1a018278mg              63.2    2e-09   
gb|EYU26208.1|  hypothetical protein MIMGU_mgv1a020191mg              63.2    2e-09   
sp|P13940.1|LEA29_GOSHI  RecName: Full=Late embryogenesis abundan...  63.5    6e-09   Gossypium hirsutum [American cotton]
prf||1601521B  Lea D-29 gene                                          63.5    8e-09
gb|KHG29666.1|  Late embryogenesis abundant D-29                      63.2    9e-09   
ref|XP_006349872.1|  PREDICTED: late embryogenesis abundant prote...  60.5    2e-08   
gb|AAA33074.1|  storage protein                                       61.2    4e-08   Gossypium hirsutum [American cotton]
ref|XP_006419225.1|  hypothetical protein CICLE_v10005815mg           56.2    1e-06   
ref|XP_006488730.1|  PREDICTED: late embryogenesis abundant prote...  56.2    1e-06   
ref|XP_002268697.1|  PREDICTED: late embryogenesis abundant prote...  56.6    1e-06   Vitis vinifera
emb|CBI26016.3|  unnamed protein product                              56.2    2e-06   
ref|XP_004297072.1|  PREDICTED: late embryogenesis abundant prote...  56.2    2e-06   
ref|XP_010278669.1|  PREDICTED: embryonic protein DC-8-like           56.2    3e-06   
gb|AET97664.1|  late embryogenesis abundant protein                   53.9    1e-05   
emb|CAN81145.1|  hypothetical protein VITISV_020810                   53.9    2e-05   Vitis vinifera
ref|XP_008810727.1|  PREDICTED: late embryogenesis abundant prote...  52.4    4e-05   
ref|XP_010098741.1|  hypothetical protein L484_026121                 50.8    1e-04   
gb|AAK81819.1|  cold-induced group 3 LEA WAP27A precursor             50.4    1e-04   Morus bombycis
gb|AAZ82815.1|  cold acclimation-induced protein                      50.1    2e-04   Morus mongolica [Mongolian mulberry]
ref|XP_006878576.1|  hypothetical protein AMTR_s00011p00245810        49.3    3e-04   
gb|AAK81820.1|  cold-induced group 3 LEA WAP27B precursor             48.9    6e-04   Morus bombycis
ref|XP_006649461.1|  PREDICTED: embryonic protein DC-8-like           48.9    8e-04   



>ref|XP_009601547.1| PREDICTED: late embryogenesis abundant protein D-29-like [Nicotiana 
tomentosiformis]
Length=251

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 79/117 (68%), Gaps = 14/117 (12%)
 Frame = +3

Query  240  ESSESWTEWAKDKLSGGLGLKSTHHDG-------DTYDAAKNTKDKITDSASGAGQYVAG  398
            E+SESWT WAKDK+S GLG KST  D         T DAAKN KDKITD+A+G GQYVA 
Sbjct  42   ENSESWTGWAKDKISEGLGFKSTDDDSAAKQASDSTMDAAKNAKDKITDTATGTGQYVAD  101

Query  399  KAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKA---AETAK  560
            KA +IK  A     EAK+ AY+ A  AK+KA E + +AY+K GE K+KA   AETAK
Sbjct  102  KAGDIKNTAE----EAKNKAYETAEAAKQKATEKSSEAYSKAGEEKEKAYSDAETAK  154



>ref|XP_004160631.1| PREDICTED: late embryogenesis abundant protein D-29-like [Cucumis 
sativus]
 gb|KGN57211.1| hypothetical protein Csa_3G171190 [Cucumis sativus]
Length=317

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 10/87 (11%)
 Frame = +3

Query  228  EAKDESSESWTEWAKDKLSGGLGLKSTHHDGD----------TYDAAKNTKDKITDSASG  377
            E KD++ E+WTEWAK+K++GGLGLKS   + D          T D+AK  KDKI + ASG
Sbjct  63   EEKDQTGETWTEWAKEKITGGLGLKSERQEDDEGGVKKVTDFTSDSAKKAKDKIQNVASG  122

Query  378  AGQYVAGKAEEIKRAASDKAGEAKDSA  458
             GQY A KAEE+K  A++KAGEAKD A
Sbjct  123  VGQYGAEKAEEVKGMAAEKAGEAKDKA  149



>ref|XP_004252956.1| PREDICTED: late embryogenesis abundant protein D-29 [Solanum 
lycopersicum]
Length=261

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 85/134 (63%), Gaps = 13/134 (10%)
 Frame = +3

Query  201  TAVDDARHKEAKDESSESWTEWAKDKLSGGLGLKSTHHDGD--------TYDAAKNTKDK  356
              V+    KE ++  S SW  WAK K+S GLGLKS  HD          T DAAKN KDK
Sbjct  32   VVVEQQISKENENSESSSWAGWAK-KISEGLGLKSNDHDDSSVKYASDSTMDAAKNAKDK  90

Query  357  ITDSASGAGQYVAGK----AEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKM  524
            ITD+ASG GQYVAG     AEE+K  A +   EAK+ AY+ A  AK+KA+E +E+AY+K 
Sbjct  91   ITDTASGTGQYVAGNLKNAAEEVKNKAHETGEEAKNRAYETAEAAKQKASEKSEEAYSKA  150

Query  525  GEAKDKAAETAKQA  566
            GEAK+KA   A++A
Sbjct  151  GEAKEKAYSEAEKA  164



>ref|XP_009803343.1| PREDICTED: late embryogenesis abundant protein D-29 [Nicotiana 
sylvestris]
Length=244

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 78/117 (67%), Gaps = 17/117 (15%)
 Frame = +3

Query  240  ESSESWTEWAKDKLSGGLGLKSTHHDG-------DTYDAAKNTKDKITDSASGAGQYVAG  398
            E+SESWT WAKDK+S GLG KST  D         T DAAKN KDKITD+A+G GQYVA 
Sbjct  43   ENSESWTGWAKDKISEGLGFKSTDDDSVAKQASESTMDAAKNAKDKITDTATGTGQYVAD  102

Query  399  KAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKA---AETAK  560
            KA ++K  A     EAK+ AY+    AK+KA E + +AY+K GE K+KA   AETAK
Sbjct  103  KAGDLKNTAE----EAKNKAYE---TAKQKATEKSSEAYSKAGEEKEKAYSDAETAK  152



>ref|XP_007222687.1| hypothetical protein PRUPE_ppa008651mg [Prunus persica]
 gb|EMJ23886.1| hypothetical protein PRUPE_ppa008651mg [Prunus persica]
Length=323

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  246  SESWTEWAKDKLSGGLGLKSTHHDGDT-------YDAAKNTKDKITDSASGAGQYVAGKA  404
            SESW EWAK+K+SGGLGLK    D +        YD AKNTKDK+ D+ASG GQY   KA
Sbjct  63   SESWAEWAKEKISGGLGLKQDDDDENNKKASDAAYDTAKNTKDKVQDTASGTGQYTTEKA  122

Query  405  EEIKRAASDKAGEAKDSA  458
            ++IK  A++KA E K++A
Sbjct  123  KDIKDTAAEKAREVKEAA  140



>ref|XP_008223508.1| PREDICTED: late embryogenesis abundant protein D-29 [Prunus mume]
Length=323

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = +3

Query  246  SESWTEWAKDKLSGGLGLKSTHHDGDT-------YDAAKNTKDKITDSASGAGQYVAGKA  404
            SESW EWAK+K+SGGLGLK    D +        YD AKNTKDK+ D+ASG GQY   KA
Sbjct  63   SESWAEWAKEKISGGLGLKQDDDDENNKKASDAAYDTAKNTKDKVQDTASGTGQYTTEKA  122

Query  405  EEIKRAASDKAGEAKDSA  458
            ++IK  A++KA E K++A
Sbjct  123  KDIKDTAAEKAREMKEAA  140



>ref|XP_008439004.1| PREDICTED: LOW QUALITY PROTEIN: late embryogenesis abundant protein 
D-29 [Cucumis melo]
Length=347

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLKSTHH-----DGD-------TYDAAKNTKDKITDS  368
            K+ KD+++E+WTEWAK+K++GGLGLK+        DG        T D+A   KDKI + 
Sbjct  65   KKEKDQTAETWTEWAKEKITGGLGLKNEREEDQDDDGGVKKVTDFTSDSALKAKDKIQNV  124

Query  369  ASGAGQYVAGKAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKA  545
            ASG GQY   KAEE+K  A++KAGEAKD A +      + A +A EKAYN   E KDK 
Sbjct  125  ASGVGQYGTEKAEEVKGMAAEKAGEAKDKAAKVGTKTTEAAEKAKEKAYNAAKETKDKV  183



>gb|ADN34043.1| late embryogenesis abundant protein D-29 [Cucumis melo subsp. 
melo]
Length=348

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLKSTHH-----DGD-------TYDAAKNTKDKITDS  368
            K+ KD+++E+WTEWAK+K++GGLGLK+        DG        T D+A   KDKI + 
Sbjct  65   KKEKDQTAETWTEWAKEKITGGLGLKNEREEDQDDDGGVKKVTDFTSDSALKAKDKIQNV  124

Query  369  ASGAGQYVAGKAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKA  545
            ASG GQY   KAEE+K  A++KAGEAKD A +      + A +A EKAYN   E KDK 
Sbjct  125  ASGVGQYGTEKAEEVKGMAAEKAGEAKDKAAKVGTKTTEAAEKAKEKAYNAAKETKDKV  183



>ref|XP_011100670.1| PREDICTED: late embryogenesis abundant protein D-29 isoform X1 
[Sesamum indicum]
Length=221

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDSASGAGQYVAGKAEEI  413
            K+ SSESW EWAK+K++ GLG         T DAAKNTKDKIT  A+ A +Y      ++
Sbjct  37   KESSSESWAEWAKEKIAEGLGFNHAAKHTSTSDAAKNTKDKIT-QATTAAEY----GSDV  91

Query  414  KRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKAAETAKQ  563
            K+ A++KAGEA+D A +AA + K+KA++  E+AY +MG+AK+ AAE A+Q
Sbjct  92   KKGAAEKAGEARDKASEAADEVKRKASQKTEEAYERMGQAKEMAAEKARQ  141



>ref|XP_011100671.1| PREDICTED: late embryogenesis abundant protein D-29 isoform X2 
[Sesamum indicum]
Length=219

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDSASGAGQYVAGKAEEI  413
            K+ SSESW EWAK+K++ GLG         T DAAKNTKDKIT + +  G        ++
Sbjct  37   KESSSESWAEWAKEKIAEGLGFNHAAKHTSTSDAAKNTKDKITQATTEYGS-------DV  89

Query  414  KRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKAAETAKQ  563
            K+ A++KAGEA+D A +AA + K+KA++  E+AY +MG+AK+ AAE A+Q
Sbjct  90   KKGAAEKAGEARDKASEAADEVKRKASQKTEEAYERMGQAKEMAAEKARQ  139



>ref|XP_011100672.1| PREDICTED: late embryogenesis abundant protein D-29 isoform X3 
[Sesamum indicum]
Length=215

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDSASGAGQYVAGKAEEI  413
            K+ SSESW EWAK+K++ GLG         T DAAKNTKDKIT + +           ++
Sbjct  37   KESSSESWAEWAKEKIAEGLGFNHAAKHTSTSDAAKNTKDKITQATT-----------DV  85

Query  414  KRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKAAETAKQ  563
            K+ A++KAGEA+D A +AA + K+KA++  E+AY +MG+AK+ AAE A+Q
Sbjct  86   KKGAAEKAGEARDKASEAADEVKRKASQKTEEAYERMGQAKEMAAEKARQ  135



>ref|XP_009353429.1| PREDICTED: late embryogenesis abundant protein D-29 isoform X2 
[Pyrus x bretschneideri]
Length=357

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 5/77 (6%)
 Frame = +3

Query  240  ESSESWTEWAKDKLSGGLGLKSTHHDGDTY--DAAKNTKDKITDSASGAGQYVAGKAEEI  413
            E SESWTEWAK+K++GGLGLK    D + Y  D+AK   D   D+ASGAG+Y   KA  I
Sbjct  69   EGSESWTEWAKEKITGGLGLK---QDDENYLKDSAKKASDATYDTASGAGEYSTEKARNI  125

Query  414  KRAASDKAGEAKDSAYQ  464
            K  A++KAG+  D+A +
Sbjct  126  KETAAEKAGKTMDAAME  142



>ref|XP_009353428.1| PREDICTED: late embryogenesis abundant protein D-29 isoform X1 
[Pyrus x bretschneideri]
Length=368

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 5/75 (7%)
 Frame = +3

Query  240  ESSESWTEWAKDKLSGGLGLKSTHHDGDTY--DAAKNTKDKITDSASGAGQYVAGKAEEI  413
            E SESWTEWAK+K++GGLGLK    D + Y  D+AK   D   D+ASGAG+Y   KA  I
Sbjct  69   EGSESWTEWAKEKITGGLGLK---QDDENYLKDSAKKASDATYDTASGAGEYSTEKARNI  125

Query  414  KRAASDKAGEAKDSA  458
            K  A++K+GE K++A
Sbjct  126  KGTAAEKSGEMKETA  140



>ref|XP_004147633.1| PREDICTED: late embryogenesis abundant protein D-29-like [Cucumis 
sativus]
Length=320

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 13/90 (14%)
 Frame = +3

Query  228  EAKDESSESWTEWAKDKLSGGLGLKSTHHDGD----------TYDAAKNTKDKITDSASG  377
            E KD++ E+WTEWAK+K++GGLGLKS   + D          T D+AK  KDKI + ASG
Sbjct  63   EEKDQTGETWTEWAKEKITGGLGLKSERQEDDEGGVKKVTDFTSDSAKKAKDKIQNVASG  122

Query  378  AGQY---VAGKAEEIKRAASDKAGEAKDSA  458
             GQY    A + EE+K  A++KAGEAKD A
Sbjct  123  VGQYGAEKAEEVEEVKGMAAEKAGEAKDKA  152



>gb|EYU33102.1| hypothetical protein MIMGU_mgv1a014373mg [Erythranthe guttata]
Length=191

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 67/113 (59%), Gaps = 24/113 (21%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDTYD-AAKNTKDKITDSASGAGQYVAGKAEE  410
            +DES+ +WT WAKDK+S GLG K  H+     D AAK +KDK+TD+A+  G+YV+ K+ +
Sbjct  28   EDEST-TWTGWAKDKISEGLGFKEDHNQNIVDDDAAKKSKDKVTDAAAAGGEYVSEKSGD  86

Query  411  IKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKAAETAKQAY  569
            +K+A ++KA EAK+                      K  EAK K AE A++AY
Sbjct  87   VKKATTEKASEAKE----------------------KASEAKRKTAEKAEEAY  117



>ref|XP_010024874.1| PREDICTED: late embryogenesis abundant protein D-29 [Eucalyptus 
grandis]
Length=426

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLKSTHHDGDTY--------DAAKNTKDKITDSASGA  380
            KEAK E+SESW EWAK+K+S GLG K       T         D AK  KDK+ D ASGA
Sbjct  139  KEAK-EASESWAEWAKEKISEGLGFKQDEATESTARRTSDKAADTAKTAKDKVQDMASGA  197

Query  381  GQYVAGKAEEIKRAASDKAGEAK  449
            G Y A KA  +K  AS+KA EAK
Sbjct  198  GHYAAEKASNVKNTASEKAEEAK  220



>gb|KCW61396.1| hypothetical protein EUGRSUZ_H04126 [Eucalyptus grandis]
Length=338

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLKSTHHDGDTY--------DAAKNTKDKITDSASGA  380
            KEAK E+SESW EWAK+K+S GLG K       T         D AK  KDK+ D ASGA
Sbjct  51   KEAK-EASESWAEWAKEKISEGLGFKQDEATESTARRTSDKAADTAKTAKDKVQDMASGA  109

Query  381  GQYVAGKAEEIKRAASDKAGEAK  449
            G Y A KA  +K  AS+KA EAK
Sbjct  110  GHYAAEKASNVKNTASEKAEEAK  132



>ref|XP_007035997.1| Late embryogenesis abundant protein D-29, putative [Theobroma 
cacao]
 gb|EOY06923.1| Late embryogenesis abundant protein D-29, putative [Theobroma 
cacao]
Length=342

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 70/117 (60%), Gaps = 3/117 (3%)
 Frame = +3

Query  222  HKEAKDESSESWTEWAKDKLSGGLGLKSTH-HDGDTYD-AAKNTKDKITDSASGAGQYVA  395
             KEAK ES+ESWTEWAK+++S GLG K  H  D D+    A   K+K  + ASGAG+Y+ 
Sbjct  104  EKEAK-ESTESWTEWAKERISEGLGFKQDHTKDSDSLPGTATKAKEKAQEVASGAGEYIG  162

Query  396  GKAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKAAETAKQA  566
             KA ++K  AS KAG+  ++A +   + +  A E A +  N   E  D A+  A++A
Sbjct  163  DKARDMKNTASKKAGDVTNAAKEKTTETENAAVEKAGELTNAAKEKADTASNAAREA  219



>ref|XP_008351126.1| PREDICTED: late embryogenesis abundant protein 76-like [Malus 
domestica]
Length=436

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 59/91 (65%), Gaps = 8/91 (9%)
 Frame = +3

Query  207  VDDARHKE-AKD--ESSESWTEWAKDKLSGGLGLKSTHHDGDTY--DAAKNTKDKITDSA  371
             DDAR  E A++  E SESWTEWAK+K++GGLGLK    D + +  D++    D   D+A
Sbjct  54   TDDARAAEKAREGKEGSESWTEWAKEKITGGLGLK---QDDENFLKDSSXKASDATYDTA  110

Query  372  SGAGQYVAGKAEEIKRAASDKAGEAKDSAYQ  464
            SGAG+Y   KA  IK  A++KAG+  D+A +
Sbjct  111  SGAGEYSTEKARXIKDKAAEKAGKTMDAAME  141



>gb|EYU28568.1| hypothetical protein MIMGU_mgv1a018278mg, partial [Erythranthe 
guttata]
Length=192

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDSASGAGQYVAGKAEEI  413
            +DES+ +WT WAKDK+S GLG K  H+     DAAK +KDK+TD+A+  G+YV+ K+ ++
Sbjct  32   EDEST-TWTGWAKDKISEGLGFKEDHNQNIVDDAAKKSKDKVTDAAAAGGEYVSEKSVDV  90

Query  414  KRA  422
            K+A
Sbjct  91   KKA  93



>gb|EYU26208.1| hypothetical protein MIMGU_mgv1a020191mg, partial [Erythranthe 
guttata]
Length=189

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDSASGAGQYVAGKAEEI  413
            +DES+ +WT WAKDK+S GLG K  H+     DAAK +KDK+TD+A+  G+YV+ K+ ++
Sbjct  29   EDEST-TWTGWAKDKISEGLGFKEDHNQNIVDDAAKKSKDKVTDAAAAGGEYVSEKSVDV  87

Query  414  KRA  422
            K+A
Sbjct  88   KKA  90



>sp|P13940.1|LEA29_GOSHI RecName: Full=Late embryogenesis abundant protein D-29; Short=LEA 
D-29 [Gossypium hirsutum]
Length=302

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLK-------STHHDGDTY-DAAKNTKDKITDSASGA  380
            KEAK E +ESWTEWAK+K+S GLG K       S     D+  D A  TKDK+ D ASGA
Sbjct  88   KEAK-EYTESWTEWAKEKISEGLGFKQDDDPKGSVEKAFDSVADTATKTKDKLQDMASGA  146

Query  381  GQYVAGKAEEIKRAASDKAGEAKDSA  458
            G+Y AGKA+++K  A  K  + K++A
Sbjct  147  GEYSAGKAKDMKDTAYKKTDDVKNAA  172



>prf||1601521B Lea D-29 gene
Length=338

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 9/86 (10%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLK-------STHHDGDTY-DAAKNTKDKITDSASGA  380
            KEAK E +ESWTEWAK+K+S GLG K       S     D+  D A  TKDK+ D ASGA
Sbjct  88   KEAK-EYTESWTEWAKEKISEGLGFKQDDDPKGSVEKAFDSVADTATKTKDKLQDMASGA  146

Query  381  GQYVAGKAEEIKRAASDKAGEAKDSA  458
            G+Y AGKA+++K  A  K  + K++A
Sbjct  147  GEYSAGKAKDMKDTAYKKTDDVKNAA  172



>gb|KHG29666.1| Late embryogenesis abundant D-29 [Gossypium arboreum]
Length=323

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 9/75 (12%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLK-------STHHDGDTY-DAAKNTKDKITDSASGA  380
            KEAK ES++SWTEWAK+K+S GLG K       S     D+  D A  TKDK+ D ASGA
Sbjct  88   KEAK-ESTDSWTEWAKEKISEGLGFKQDDDPKGSVRKASDSVADTATKTKDKLQDMASGA  146

Query  381  GQYVAGKAEEIKRAA  425
            G+Y AGKA+++K  A
Sbjct  147  GEYSAGKAKDMKDTA  161



>ref|XP_006349872.1| PREDICTED: late embryogenesis abundant protein, group 3-like 
[Solanum tuberosum]
Length=198

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 57/79 (72%), Gaps = 7/79 (9%)
 Frame = +3

Query  330  DAAKNTKDKITDSASGAGQYVAGK-------AEEIKRAASDKAGEAKDSAYQaagdakkk  488
            DAAKN KDKITD+ASG GQYVA K       AEE+K  A   A EAK+ AY+ A  AK+K
Sbjct  2    DAAKNAKDKITDTASGTGQYVADKAGNLKNAAEEVKNRAYQTAEEAKNKAYETAETAKEK  61

Query  489  aaeaaekaYNKMGEAKDKA  545
            AAE +E+AY+K GEAK+KA
Sbjct  62   AAEKSEEAYSKAGEAKEKA  80



>gb|AAA33074.1| storage protein, partial [Gossypium hirsutum]
Length=301

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 9/75 (12%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLK-------STHHDGDTY-DAAKNTKDKITDSASGA  380
            KEAK E +ESWTEWAK+K+S GLG K       S     D+  D A  TKDK+ D ASGA
Sbjct  88   KEAK-EYTESWTEWAKEKISEGLGFKQDDDPKGSVEKAFDSVADTATKTKDKLQDMASGA  146

Query  381  GQYVAGKAEEIKRAA  425
            G+Y AGKA+++K  A
Sbjct  147  GEYSAGKAKDMKDTA  161



>ref|XP_006419225.1| hypothetical protein CICLE_v10005815mg [Citrus clementina]
 gb|ESR32465.1| hypothetical protein CICLE_v10005815mg [Citrus clementina]
Length=225

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 25/129 (19%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDT-------YDAAKNTKDKITDSASGAGQYV  392
            KD+++ESWT+WAKDK+S GL LK +    ++        ++AK  KDK+ D AS  G   
Sbjct  47   KDQATESWTDWAKDKISEGLRLKGSEDSLNSAAAPDKASESAKAAKDKVQDVASEVGAEK  106

Query  393  AG-----------KAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKD  539
            A            KA +I + A+DKAG+ KD+A + A +A   A         K GE KD
Sbjct  107  AKETKDAMYKSSEKASDITKKAADKAGDVKDAATEKASEATDAAK-------EKAGEIKD  159

Query  540  KAAETAKQA  566
            KA ET ++A
Sbjct  160  KAKETEERA  168



>ref|XP_006488730.1| PREDICTED: late embryogenesis abundant protein D-29-like [Citrus 
sinensis]
Length=225

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 25/129 (19%)
 Frame = +3

Query  234  KDESSESWTEWAKDKLSGGLGLKSTHHDGDT-------YDAAKNTKDKITDSASGAGQYV  392
            KD+++ESWT+WAKDK+S GL LK +    ++        ++AK  KDK+ D AS  G   
Sbjct  47   KDQATESWTDWAKDKISEGLRLKGSEDSLNSAAAPDKASESAKAAKDKVQDVASEVGAEK  106

Query  393  AG-----------KAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKD  539
            A            KA +I + A+DKAG+ KD+A + A +A   A         K GE KD
Sbjct  107  AKETKDAMYKSSEKASDITKKAADKAGDVKDAATEKASEATDAAK-------EKAGEIKD  159

Query  540  KAAETAKQA  566
            KA ET ++A
Sbjct  160  KAKETEERA  168



>ref|XP_002268697.1| PREDICTED: late embryogenesis abundant protein D-29 [Vitis vinifera]
 ref|XP_010649688.1| PREDICTED: late embryogenesis abundant protein D-29 [Vitis vinifera]
Length=268

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +3

Query  255  WTEWAKDKLSGGLGLKSTHHDGDT-YDAAKNTKDKITDSASGAGQYVAGKAEEIKRAASD  431
            W EWAKDK+S  L LK      D+  + A  ++D   ++ASGAGQY A KA+E K+   +
Sbjct  68   WAEWAKDKISQNLRLKQEKQASDSATETADKSQDTAEEAASGAGQYSAEKADEAKKVLKE  127

Query  432  KAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKA  545
            K  E K +A Q A +AK+KAAEA E A  K+GEAK+KA
Sbjct  128  KTEETKGAASQKACEAKEKAAEAKETASQKVGEAKEKA  165



>emb|CBI26016.3| unnamed protein product [Vitis vinifera]
Length=242

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +3

Query  255  WTEWAKDKLSGGLGLKSTHHDGDT-YDAAKNTKDKITDSASGAGQYVAGKAEEIKRAASD  431
            W EWAKDK+S  L LK      D+  + A  ++D   ++ASGAGQY A KA+E K+   +
Sbjct  51   WAEWAKDKISQNLRLKQEKQASDSATETADKSQDTAEEAASGAGQYSAEKADEAKKVLKE  110

Query  432  KAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKA  545
            K  E K +A Q A +AK+KAAEA E A  K+GEAK+KA
Sbjct  111  KTEETKGAASQKACEAKEKAAEAKETASQKVGEAKEKA  148



>ref|XP_004297072.1| PREDICTED: late embryogenesis abundant protein D-29-like [Fragaria 
vesca subsp. vesca]
Length=332

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 48/79 (61%), Gaps = 16/79 (20%)
 Frame = +3

Query  240  ESSESWTEWAKDKLSGGLGLKSTHHDGDTY-----DAAKNTKDKITDSASGAGQYV----  392
            E SESWTEWAK+K+    GLKS  H+GD+      DAA +T  K  D+ASGAGQY     
Sbjct  63   EGSESWTEWAKEKI----GLKSDEHEGDSTTKKASDAAYDTTKKTKDTASGAGQYSTEKD  118

Query  393  ---AGKAEEIKRAASDKAG  440
               A KA+ +K  A DKAG
Sbjct  119  NEGAEKAKGMKDMAVDKAG  137



>ref|XP_010278669.1| PREDICTED: embryonic protein DC-8-like [Nelumbo nucifera]
 ref|XP_010278677.1| PREDICTED: embryonic protein DC-8-like [Nelumbo nucifera]
Length=485

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 8/72 (11%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLKSTHHDG-----DTYDAAKNTKDKITDSASGAGQY  389
            +EAK E+++SWT WAKDK+S GLGLK  H DG       YDA  +T   + D+A  AGQY
Sbjct  44   REAK-ETTDSWTNWAKDKISEGLGLK--HDDGKETAKQAYDATGDTARTVQDTACSAGQY  100

Query  390  VAGKAEEIKRAA  425
             A KA ++K  A
Sbjct  101  GADKAGDLKETA  112



>gb|AET97664.1| late embryogenesis abundant protein [Camellia sinensis]
Length=261

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 27/135 (20%)
 Frame = +3

Query  225  KEAKDESSESWTEWAKDKLSGGLGLKSTHH--------------DGDTYDAAKNTKDKIT  362
            +EAK E+SESW EW KDK++ GLG K+                      D   +TKD+I 
Sbjct  69   REAK-EASESWAEWTKDKITKGLGFKAAEEAKDDTDTDTDTDTDTDTDTDTDMHTKDEI-  126

Query  363  DSASGAGQYVAGKAEEIKRA-------ASDKAGE-AKDSAYQaagdakkkaaeaaekaYN  518
               SGAGQY A ++ E+K         +S+K GE AKD AYQAA +AK++ ++ A + Y+
Sbjct  127  ---SGAGQYSADESGEVKNEEAAEEEKSSNKIGEDAKDKAYQAAQEAKEQLSQKAHETYH  183

Query  519  KMGEAKDKAAETAKQ  563
            K  EAK++A   AK+
Sbjct  184  KAEEAKERAPRKAKE  198



>emb|CAN81145.1| hypothetical protein VITISV_020810 [Vitis vinifera]
Length=1147

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +3

Query  255   WTEWAKDKLSGGLGLKSTHHDGDT-YDAAKNTKDKITDSASGAGQYVAGKAEEIKRAASD  431
             W EWAKDK+S  L LK      D+  + A  ++D   ++ASGAGQY A KA+E+K+   +
Sbjct  955   WAEWAKDKISQNLRLKQEKQASDSATETADKSQDTAEEAASGAGQYXAEKADEVKKVLKE  1014

Query  432   KAGEAKDSAYQaagdakkkaaeaaekaYN-KMGEAKDKA  545
             K  E K +A Q A D  K+ A  A++  + K+GEAK+KA
Sbjct  1015  KTEETKGAASQKACDEAKEKAAEAKETXSQKVGEAKEKA  1053



>ref|XP_008810727.1| PREDICTED: late embryogenesis abundant protein D-29-like [Phoenix 
dactylifera]
Length=275

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 8/82 (10%)
 Frame = +3

Query  210  DDARHKEAKDESSESWTEWAKDKLSGGLGLKSTHHDG-----DTYDAAKNTKDKITDSAS  374
            D +  +EAK E++ESW  W +DK++ GLGL+  H +         DAA N  +KI+ +AS
Sbjct  34   DGSAMEEAK-ETTESWANWVQDKVTEGLGLR--HENARMAAEQIKDAAGNAANKISSAAS  90

Query  375  GAGQYVAGKAEEIKRAASDKAG  440
               +Y  G AEEIK AA    G
Sbjct  91   DTAKYATGTAEEIKDAAMKNQG  112



>ref|XP_010098741.1| hypothetical protein L484_026121 [Morus notabilis]
 gb|EXB75644.1| hypothetical protein L484_026121 [Morus notabilis]
Length=240

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 12/84 (14%)
 Frame = +3

Query  237  DESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDS---------ASGAGQY  389
            +E+SE+WTEWAK+K+S GLG    + D D  DA K   D ++D+         AS  G+Y
Sbjct  71   NEASETWTEWAKEKISEGLGY---NKDADAKDAPKKASDTVSDTAKKSKIQEVASETGEY  127

Query  390  VAGKAEEIKRAASDKAGEAKDSAY  461
             A K       A++   EAK+ AY
Sbjct  128  SADKGRSATERAAETISEAKEKAY  151



>gb|AAK81819.1| cold-induced group 3 LEA WAP27A precursor [Morus bombycis]
Length=227

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 11/83 (13%)
 Frame = +3

Query  237  DESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDS-------ASGAGQYVA  395
            +E+SE+WT+WAK+K+S GLG    + D D  DA K   D ++D+       AS  G+Y A
Sbjct  71   NEASETWTDWAKEKISEGLGF---NKDADAKDAPKKASDTVSDTAKKSEEVASETGEYSA  127

Query  396  GKAEE-IKRAASDKAGEAKDSAY  461
             KA    +RAA++    AK+ AY
Sbjct  128  DKARSATERAAAETISGAKEKAY  150



>gb|AAZ82815.1| cold acclimation-induced protein [Morus mongolica]
Length=226

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 62/117 (53%), Gaps = 28/117 (24%)
 Frame = +3

Query  237  DESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDS-------ASGAGQYVA  395
            +E+SE+WT+WAK+K+S GLG    + D D  DA K   D ++D+       AS  G+Y A
Sbjct  71   NEASETWTDWAKEKISEGLGF---NKDADAKDAPKKASDTVSDTAKKSEEVASETGEYSA  127

Query  396  GKAEEIKRAASDKAGEAKDSAYQaagdakkkaaeaaekaYNKMGEAKDKAAETAKQA  566
             KA    R+A+++A E    A +              K Y+    AK+KA ETA++A
Sbjct  128  DKA----RSATERAAETISGAKE--------------KTYDTAKSAKEKAYETAQKA  166



>ref|XP_006878576.1| hypothetical protein AMTR_s00011p00245810 [Amborella trichopoda]
 gb|ERM94721.1| hypothetical protein AMTR_s00011p00245810 [Amborella trichopoda]
Length=196

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 48/93 (52%), Gaps = 21/93 (23%)
 Frame = +3

Query  237  DESSESWTEWAKDKLSGGLGLKS-----THHDGD----------------TYDAAKNTKD  353
            +E +ESW +WAKDK S G G+K        +  D                   AA+ +KD
Sbjct  34   EEMAESWAQWAKDKFSEGFGMKPETKLKAQNIADEAGGGAAEFAKQAKEIMAGAAQMSKD  93

Query  354  KITDSASGAGQYVAGKAEEIKRAASDKAGEAKD  452
            K++D ASGAG+Y + KA +   AA +KAG+  D
Sbjct  94   KMSDIASGAGEYASDKAAQATGAAKEKAGDMSD  126



>gb|AAK81820.1| cold-induced group 3 LEA WAP27B precursor [Morus bombycis]
Length=223

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 18/86 (21%)
 Frame = +3

Query  237  DESSESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDS-------ASGAGQYVA  395
            +E+SE+WT+WAK+K+S GLG    + D D  DA K   D ++D+       A+  G+Y A
Sbjct  68   NEASETWTDWAKEKISEGLGF---NKDADAKDAPKKASDTVSDTAKKSEEVAAETGEYSA  124

Query  396  GKAEEIKRAASDKAGE----AKDSAY  461
             KA    R+A+++A E    AK+ AY
Sbjct  125  DKA----RSATERAAETVSGAKEKAY  146



>ref|XP_006649461.1| PREDICTED: embryonic protein DC-8-like [Oryza brachyantha]
Length=395

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  249  ESWTEWAKDKLSGGLGLKSTHHDGDTYDAAKNTKDKITDSASGAGQYVAGKAEEIKRAAS  428
            ESWTEWAKDK++ GLGLK   HD D  +AA+    K   +A  A +     A E  R  S
Sbjct  51   ESWTEWAKDKITEGLGLKHGVHDVDEEEAAR----KAGHAAKSARESAQHTASEAGRQTS  106

Query  429  DKAGEAKDSA  458
             KAG+AK++A
Sbjct  107  KKAGDAKEAA  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 647059617100