BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20976_g2_i1 len=3098 path=[5110:0-470 5581:471-538 5646:539-1232
1733:1233-1273 6379:1274-1475 1574:1476-1514 6619:1515-2207
7312:2208-2266 7371:2267-3097]

Length=3098
                                                                      Score     E

gb|AGL96414.1|  9-lipoxygenase                                         1191   0.0     
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1190   0.0     
gb|ADN92993.2|  lipoxygenase LOX1                                      1190   0.0     
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5              1189   0.0     
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1185   0.0     
emb|CAA58859.1|  lipoxygenase                                          1185   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1180   0.0     
gb|ABF19102.2|  9-lipoxygenase                                         1179   0.0     Capsicum annuum
gb|ACO57136.1|  lipoxygenase 1                                         1170   0.0     Capsicum annuum
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1170   0.0     
gb|ABW75772.2|  lipoxygenase                                           1169   0.0     Camellia sinensis [black tea]
ref|NP_001234098.1|  lipoxygenase                                      1164   0.0     
emb|CDP15504.1|  unnamed protein product                               1163   0.0     
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6            1156   0.0     
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g            1156   0.0     
gb|AGK82779.1|  lipoxygenase                                           1152   0.0     
gb|AFU51542.1|  lipoxygenase 3                                         1152   0.0     
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...   1152   0.0     Solanum tuberosum [potatoes]
gb|ACG56281.1|  lipoxygenase                                           1152   0.0     Olea europaea
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6            1151   0.0     
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g            1151   0.0     
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1151   0.0     
gb|AAP83134.1|  lipoxygenase                                           1150   0.0     Nicotiana attenuata
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...   1150   0.0     Solanum tuberosum [potatoes]
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1149   0.0     
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                1149   0.0     
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                       1148   0.0     
gb|AAP83135.1|  lipoxygenase                                           1148   0.0     Nicotiana attenuata
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1147   0.0     
gb|AGU28274.1|  lipoxygenase 1                                         1147   0.0     
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1145   0.0     
emb|CBI36802.3|  unnamed protein product                               1145   0.0     
emb|CDP20618.1|  unnamed protein product                               1144   0.0     
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5              1144   0.0     
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1142   0.0     
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like         1142   0.0     
ref|NP_001268178.1|  lipoxygenase                                      1142   0.0     
emb|CAD10740.1|  lipoxygenase                                          1140   0.0     Corylus avellana [European hazelnut]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                       1139   0.0     
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1139   0.0     
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...   1139   0.0     Solanum tuberosum [potatoes]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...   1139   0.0     Solanum tuberosum [potatoes]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1138   0.0     
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...   1136   0.0     Solanum tuberosum [potatoes]
ref|NP_001275351.1|  5-lipoxygenase                                    1135   0.0     
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...   1135   0.0     Solanum tuberosum [potatoes]
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1133   0.0     
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                1131   0.0     
emb|CAA64765.1|  lipoxygenase                                          1130   0.0     Solanum tuberosum [potatoes]
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                1130   0.0     
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                1129   0.0     
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1129   0.0     
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5              1128   0.0     
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg            1126   0.0     
emb|CAB94852.1|  lipoxygenase                                          1125   0.0     Prunus dulcis [sweet almond]
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg            1123   0.0     
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1123   0.0     
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg            1122   0.0     
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1121   0.0     
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1121   0.0     
gb|AHX56187.1|  lipoxygenase                                           1120   0.0     
gb|AAZ04411.1|  lipoxygenase                                           1120   0.0     Adelostemma gracillimum
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1120   0.0     
emb|CAD10779.2|  lipoxygenase                                          1119   0.0     Prunus dulcis [sweet almond]
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg               1119   0.0     
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1118   0.0     
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1118   0.0     
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1116   0.0     
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1116   0.0     
ref|XP_002311617.1|  lipoxygenase family protein                       1116   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007030817.1|  Lipoxygenase 1                                    1113   0.0     
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase               1112   0.0     Gossypium hirsutum [American cotton]
ref|XP_002319014.2|  lipoxygenase family protein                       1112   0.0     Populus trichocarpa [western balsam poplar]
gb|AGI16382.1|  lipoxygenase                                           1111   0.0     
gb|AGI16379.1|  lipoxygenase                                           1108   0.0     
gb|AGI16378.1|  lipoxygenase                                           1108   0.0     
gb|AGI16377.1|  lipoxygenase                                           1108   0.0     
gb|AGI16380.1|  lipoxygenase                                           1107   0.0     
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1107   0.0     
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1106   0.0     
gb|AGK82798.1|  lipoxygenase                                           1103   0.0     
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1103   0.0     
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...   1102   0.0     
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like       1101   0.0     
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1101   0.0     
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1101   0.0     
ref|XP_002315780.1|  lipoxygenase family protein                       1101   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1100   0.0     
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...   1100   0.0     
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1098   0.0     
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1098   0.0     
gb|KDP23508.1|  hypothetical protein JCGZ_23341                        1098   0.0     
ref|XP_002512386.1|  lipoxygenase, putative                            1098   0.0     Ricinus communis
gb|AAA74393.1|  lipoxygenase                                           1097   0.0     Solanum lycopersicum
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                       1097   0.0     
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1097   0.0     
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1096   0.0     
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1096   0.0     
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1096   0.0     
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg               1096   0.0     
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1096   0.0     
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1095   0.0     
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg            1095   0.0     
gb|ABF60002.1|  lipoxygenase 2                                         1095   0.0     Actinidia deliciosa [Chinese gooseberry]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                   1095   0.0     
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                  1093   0.0     
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1093   0.0     
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1091   0.0     
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg            1090   0.0     
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1088   0.0     
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1088   0.0     
gb|KDP40158.1|  hypothetical protein JCGZ_02156                        1088   0.0     
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1087   0.0     
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                  1087   0.0     
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g            1087   0.0     
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1087   0.0     
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1087   0.0     
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g            1087   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1087   0.0     
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g            1086   0.0     
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1086   0.0     
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1085   0.0     
gb|AGK82783.1|  lipoxygenase                                           1085   0.0     
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1084   0.0     
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5              1083   0.0     
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1083   0.0     
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1082   0.0     
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1081   0.0     
ref|XP_002516771.1|  lipoxygenase, putative                            1080   0.0     Ricinus communis
gb|ABF19103.2|  9-lipoxygenase                                         1080   0.0     Capsicum annuum
ref|XP_004296897.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1080   0.0     
gb|AEQ30071.1|  lipoxygenase                                           1080   0.0     
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1079   0.0     
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1078   0.0     
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg            1078   0.0     
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1078   0.0     
emb|CAE17327.1|  lipoxygenase                                          1078   0.0     Fragaria x ananassa
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4   1077   0.0     
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5              1077   0.0     
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1076   0.0     
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1076   0.0     
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1073   0.0     
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                       1073   0.0     
emb|CDP20620.1|  unnamed protein product                               1073   0.0     
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1072   0.0     
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4   1072   0.0     
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g            1072   0.0     
gb|AGK82776.1|  lipoxygenase                                           1072   0.0     
dbj|BAH57745.1|  lipoxygenase                                          1071   0.0     Actinidia arguta
gb|AGK82775.1|  lipoxygenase                                           1070   0.0     
gb|AGK82774.1|  lipoxygenase                                           1070   0.0     
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1069   0.0     
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                   1068   0.0     
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1068   0.0     
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1068   0.0     
emb|CDO99039.1|  unnamed protein product                               1068   0.0     
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1068   0.0     
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1068   0.0     
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                 1067   0.0     
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1067   0.0     
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1065   0.0     
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like       1065   0.0     
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1064   0.0     
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1064   0.0     
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5              1063   0.0     
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1063   0.0     
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1061   0.0     
ref|XP_003591120.1|  Lipoxygenase                                      1061   0.0     
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1060   0.0     
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...   1060   0.0     
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...   1058   0.0     
gb|AIC82456.1|  lipoxygenase                                           1058   0.0     
gb|ACH91370.1|  lipoxygenase LOX-3                                     1058   0.0     Prunus persica
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg            1057   0.0     
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1056   0.0     
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                   1056   0.0     
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1055   0.0     
gb|ABV32552.1|  lipoxygenase                                           1055   0.0     Prunus persica
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1055   0.0     
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic             1054   0.0     
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...   1054   0.0     
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1054   0.0     
ref|XP_003626279.1|  Chalcone synthase                                 1054   0.0     
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1053   0.0     
gb|AGN75068.1|  lipoxygenase 2                                         1053   0.0     
gb|AHX56188.1|  lipoxygenase                                           1052   0.0     
gb|AGH13205.1|  lipoxygenase                                           1052   0.0     
emb|CAC19365.1|  lipoxygenase                                          1051   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1051   0.0     
ref|NP_188879.2|  lipoxygenase 5                                       1051   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1050   0.0     
gb|AGI16415.1|  lipoxygenase                                           1050   0.0     
gb|AGI16414.1|  lipoxygenase                                           1050   0.0     
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5              1048   0.0     
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1048   0.0     
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg            1048   0.0     
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1            1047   0.0     
gb|AEZ50136.1|  lipoxygenase                                           1047   0.0     
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1046   0.0     
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1046   0.0     
gb|AHI86055.1|  lipoxygenase                                           1046   0.0     
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1046   0.0     
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like       1045   0.0     
gb|AAD09202.1|  lipoxygenase                                           1045   0.0     Solanum tuberosum [potatoes]
dbj|BAB01777.1|  lipoxygenase                                          1045   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic             1044   0.0     
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg            1044   0.0     
gb|AGI16413.1|  lipoxygenase                                           1044   0.0     
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like         1043   0.0     
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg               1043   0.0     
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                   1042   0.0     
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1041   0.0     
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...   1041   0.0     
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1041   0.0     
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like       1041   0.0     
gb|AAO03558.1|  lipoxygenase 1                                         1040   0.0     Brassica napus [oilseed rape]
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5              1040   0.0     
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1038   0.0     
gb|AGI16416.1|  lipoxygenase                                           1038   0.0     
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like       1037   0.0     
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1037   0.0     
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g            1036   0.0     
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                  1036   0.0     
emb|CDY46325.1|  BnaC01g31590D                                         1035   0.0     
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1035   0.0     
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like       1033   0.0     
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1033   0.0     
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1033   0.0     
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776            1033   0.0     
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1032   0.0     
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1031   0.0     
ref|NP_175900.1|  lipoxygenase 1                                       1031   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1031   0.0     
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g            1031   0.0     
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1029   0.0     
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1            1029   0.0     
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like       1028   0.0     
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1028   0.0     Vitis vinifera
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1028   0.0     
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg            1027   0.0     
ref|XP_003592410.1|  Lipoxygenase                                      1025   0.0     
gb|ADL41189.1|  lipoxygenase                                           1025   0.0     
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg            1023   0.0     
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...   1023   0.0     
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                   1022   0.0     
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                   1022   0.0     
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic             1021   0.0     
emb|CDY64191.1|  BnaA01g36630D                                         1019   0.0     
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...   1019   0.0     
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...   1018   0.0     
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like       1018   0.0     
emb|CAP59449.1|  lipoxygenase                                          1017   0.0     Momordica charantia [balsam pear]
emb|CDY38326.1|  BnaC05g30190D                                         1015   0.0     
gb|AAC61785.1|  lipoxygenase 1                                         1015   0.0     Cucumis sativus [cucumbers]
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1015   0.0     
emb|CAA63483.1|  lipoxygenase                                          1014   0.0     Cucumis sativus [cucumbers]
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1014   0.0     
gb|ACU81176.1|  13S-lipoxygenase                                       1011   0.0     Cucumis melo var. inodorus [casaba melon]
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like       1010   0.0     
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like       1009   0.0     
gb|AAA79186.1|  lipoxygenase                                           1009   0.0     Cucumis sativus [cucumbers]
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg            1008   0.0     
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...   1007   0.0     
gb|ACD43483.1|  lipoxygenase 1                                         1005   0.0     
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic             1004   0.0     
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5   1004   0.0     
gb|ADG03095.1|  lipoxygenase 3                                         1002   0.0     
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                       1001   0.0     
gb|ABX60408.1|  lipoxygenase L-3                                       1001   0.0     Glycine max [soybeans]
ref|XP_007030815.1|  Lipoxygenase 1                                    1001   0.0     
emb|CDY43490.1|  BnaA01g21450D                                         1001   0.0     
ref|XP_002883361.1|  lipoxygenase                                      1000   0.0     
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                  1000   0.0     
gb|AAD09861.1|  lipoxygenase                                            996   0.0     Persea americana
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    996   0.0     
ref|XP_007030813.1|  Lipoxygenase 1                                     996   0.0     
gb|ABB82552.1|  13S-lipoxygenase                                        995   0.0     Cucumis melo var. inodorus [casaba melon]
gb|EPS73035.1|  hypothetical protein M569_01717                         995   0.0     
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             995   0.0     
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         994   0.0     
emb|CAA31664.1|  unnamed protein product                                994   0.0     
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    994   0.0     
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    993   0.0     
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    993   0.0     
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    992   0.0     
prf||1502333A  lipoxygenase 3                                           992   0.0  
ref|XP_007030811.1|  Lipoxygenase 1                                     992   0.0     
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    991   0.0     
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    991   0.0     
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    991   0.0     
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    990   0.0     
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    990   0.0     
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    989   0.0     
gb|AGI37654.1|  lipoxygenase                                            989   0.0     
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        987   0.0     
ref|NP_001050993.1|  Os03g0700400                                       986   0.0     
ref|XP_003597559.1|  Seed lipoxygenase-3                                986   0.0     
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    983   0.0     
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    983   0.0     
ref|XP_006650443.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    983   0.0     
emb|CAA64769.1|  lipoxygenase                                           983   0.0     
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    982   0.0     
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    982   0.0     
ref|NP_001105515.1|  lipoxygenase                                       982   0.0     
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    981   0.0     
gb|AAG61118.1|  lipoxygenase                                            981   0.0     
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    979   0.0     
ref|XP_003627173.1|  Seed lipoxygenase-3                                979   0.0     
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    978   0.0     
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    977   0.0     
ref|XP_003597558.1|  Lipoxygenase                                       977   0.0     
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        976   0.0     
ref|XP_007030814.1|  Lipoxygenase 1                                     975   0.0     
ref|XP_006355846.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    975   0.0     
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    974   0.0     
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    974   0.0     
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    973   0.0     
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    972   0.0     
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    972   0.0     
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    972   0.0     
gb|AEI71780.1|  bacterial-induced lipoxygenase                          972   0.0     
gb|AGS94394.3|  lipoxygenase                                            971   0.0     
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...    971   0.0     
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        969   0.0     
ref|XP_002466614.1|  hypothetical protein SORBIDRAFT_01g011050          969   0.0     
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        968   0.0     
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    967   0.0     
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             967   0.0     
gb|EAY91532.1|  hypothetical protein OsI_13165                          967   0.0     
ref|XP_004982083.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    967   0.0     
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               966   0.0     
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               966   0.0     
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    965   0.0     
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    964   0.0     
ref|NP_001237338.1|  lipoxygenase-10                                    964   0.0     
gb|ABD47523.1|  dual positional specificity lipoxygenase                963   0.0     
gb|ACV84249.1|  LOX1                                                    962   0.0     
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    961   0.0     
gb|ADG03091.1|  lipoxygenase 2                                          957   0.0     
ref|XP_002521992.1|  lipoxygenase, putative                             957   0.0     
gb|AFK32352.1|  lipoxygenase-2                                          955   0.0     
gb|ADG03092.1|  lipoxygenase 2                                          954   0.0     
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        954   0.0     
gb|AAF15296.2|AF204210_1  lipoxygenase                                  954   0.0     
ref|XP_004144826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    953   0.0     
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   953   0.0     
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g             952   0.0     
emb|CAA55318.1|  lipoxygenase                                           951   0.0     
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    949   0.0     
gb|KHN11254.1|  Seed linoleate 9S-lipoxygenase                          949   0.0     
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    949   0.0     
ref|NP_001237323.1|  lipoxygenase-9                                     947   0.0     
ref|XP_003531597.1|  PREDICTED: seed linoleate 9S-lipoxygenase-li...    947   0.0     
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          947   0.0     
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    946   0.0     
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        946   0.0     
dbj|BAJ97226.1|  predicted protein                                      946   0.0     
emb|CAA97845.1|  lipoxygenase                                           946   0.0     
gb|AEU04516.1|  lipoxygenase 1                                          945   0.0     
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             944   0.0     
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        944   0.0     
ref|XP_003560916.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    944   0.0     
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    944   0.0     
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                          943   0.0     
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        943   0.0     
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...    942   0.0     
gb|ABX60409.1|  lipoxygease L-4                                         942   0.0     
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    941   0.0     
gb|ADP02185.1|  putative lipoxygenase                                   941   0.0     
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        941   0.0     
gb|AAY87056.1|  13-lipoxygenase                                         941   0.0     
gb|ADR71856.1|  lipoxygenase-1                                          941   0.0     
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             941   0.0     
gb|ADR71858.1|  lipoxygenase-1                                          941   0.0     
gb|AHG59315.1|  lipoxygenase                                            940   0.0     
ref|XP_004158761.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    940   0.0     
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     939   0.0     
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             938   0.0     
gb|ACS34909.1|  lipoxygenase 1                                          937   0.0     
gb|EAY91797.1|  hypothetical protein OsI_13441                          937   0.0     
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                          937   0.0     
gb|ADZ31265.1|  lipoxygenase 3                                          937   0.0     
ref|XP_003627181.1|  Lipoxygenase                                       937   0.0     
gb|AEO13837.1|  lipoxygenase                                            937   0.0     
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    936   0.0     
gb|ABX60407.1|  lipoxygease L-2                                         936   0.0     
gb|AEB70991.1|  lipoxygenase 4                                          936   0.0     
ref|NP_001238692.1|  lipoxygenase                                       936   0.0     
gb|AAY87057.1|  13-lipoxygenase                                         936   0.0     
ref|XP_010277588.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    935   0.0     
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        935   0.0     
ref|XP_003559938.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        935   0.0     
gb|AEB70990.1|  lipoxygenase 3                                          935   0.0     
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                        934   0.0     
ref|NP_001050990.1|  Os03g0699700                                       934   0.0     
ref|XP_006650442.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        934   0.0     
ref|NP_001051212.1|  Os03g0738600                                       934   0.0     
ref|XP_003627310.1|  Lipoxygenase                                       934   0.0     
ref|NP_001050995.2|  Os03g0700700                                       934   0.0     
gb|EAY91521.1|  hypothetical protein OsI_13155                          934   0.0     
gb|AHG59316.1|  lipoxygenase                                            933   0.0     
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        933   0.0     
gb|ADR71859.1|  lipoxygenase-1                                          932   0.0     
ref|NP_001238203.1|  lipoxygenase L-5                                   932   0.0     
ref|XP_004510412.1|  PREDICTED: linoleate 9S-lipoxygenase-like          932   0.0     
gb|ADR71857.1|  lipoxygenase-1                                          932   0.0     
tpg|DAA56392.1|  TPA: lipoxygenase1                                     931   0.0     
ref|XP_003546741.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like ...    931   0.0     
gb|AEL03787.1|  lipoxygenase                                            931   0.0     
ref|XP_004982081.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    931   0.0     
ref|XP_003560911.1|  PREDICTED: linoleate 9S-lipoxygenase 1             931   0.0     
gb|ACL53478.1|  unknown                                                 930   0.0     
ref|NP_001235189.1|  lipoxygenase                                       930   0.0     
gb|ACG43480.1|  lipoxygenase 2                                          930   0.0     
ref|XP_003627174.1|  Lipoxygenase                                       930   0.0     
gb|KHN32711.1|  Linoleate 9S-lipoxygenase-4                             929   0.0     
ref|NP_001105003.1|  lipoxygenase                                       929   0.0     
ref|XP_004510414.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     929   0.0     
ref|NP_001235250.1|  lipoxygenase                                       929   0.0     
ref|XP_003627201.1|  Seed lipoxygenase                                  929   0.0     
dbj|BAJ91632.1|  predicted protein                                      929   0.0     
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             929   0.0     
gb|AET01658.2|  seed linoleate 9S-lipoxygenase                          928   0.0     
ref|XP_003627185.1|  Lipoxygenase                                       927   0.0     
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like          927   0.0     
gb|AAB60715.1|  lipoxygenase                                            927   0.0     
gb|EMT18292.1|  Putative lipoxygenase 3                                 927   0.0     
ref|XP_003528382.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like ...    926   0.0     
gb|KHN01371.1|  Linoleate 9S-lipoxygenase 1                             926   0.0     
gb|EMT25349.1|  Lipoxygenase 2                                          925   0.0     
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                          925   0.0     
emb|CAG44503.1|  lipoxygenase LOXN3                                     925   0.0     
gb|ABX57825.1|  lipoxygenase-1                                          925   0.0     
gb|AAG42354.1|  lipoxygenase                                            924   0.0     
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    924   0.0     
gb|ACS34908.1|  lipoxygenase 2                                          924   0.0     
dbj|BAD02945.1|  9-lipoxigenase                                         923   0.0     
emb|CAG44501.1|  lipoxygenase LOXN3                                     922   0.0     
gb|ABS72447.1|  lipoxygenase-1                                          922   0.0     
gb|ACE79245.1|  lipoxygenase-1                                          922   0.0     
ref|XP_003612345.1|  Seed lipoxygenase                                  922   0.0     
sp|P38414.1|LOX1_LENCU  RecName: Full=Linoleate 9S-lipoxygenase; ...    920   0.0     
gb|KHN39331.1|  Seed linoleate 9S-lipoxygenase                          919   0.0     
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement             919   0.0     
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                  919   0.0     
dbj|BAJ87153.1|  predicted protein                                      919   0.0     
ref|XP_004982080.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    918   0.0     
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant             918   0.0     
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant     917   0.0     
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant     917   0.0     
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant              917   0.0     
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant              917   0.0     
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant     917   0.0     
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant     917   0.0     
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant     917   0.0     
gb|KEH18417.1|  seed linoleate 9S-lipoxygenase                          917   0.0     
gb|ABQ10187.1|  lipoxygenase                                            917   0.0     
gb|AAB71759.1|  lipoxygenase                                            916   0.0     
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant     916   0.0     
ref|XP_004510411.1|  PREDICTED: linoleate 9S-lipoxygenase-like          916   0.0     
gb|ADG03093.1|  lipoxygenase 1                                          916   0.0     
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant              915   0.0     
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant        915   0.0     
ref|XP_007135514.1|  hypothetical protein PHAVU_010G135700g             914   0.0     
ref|XP_002466613.1|  hypothetical protein SORBIDRAFT_01g011040          914   0.0     
gb|ACN29156.1|  unknown                                                 913   0.0     
ref|NP_001105974.1|  lipoxygenase                                       912   0.0     
gb|ACL53637.1|  unknown                                                 912   0.0     
ref|NP_001105975.1|  lipoxygenase                                       912   0.0     
gb|AAB70865.1|  lipoxygenase 2                                          911   0.0     
emb|CAA75609.1|  lipoxygenase                                           910   0.0     
ref|XP_003627187.1|  Lipoxygenase                                       909   0.0     
gb|KEH35160.1|  seed linoleate 9S-lipoxygenase                          907   0.0     
ref|XP_002458908.1|  hypothetical protein SORBIDRAFT_03g042450          906   0.0     
ref|XP_004512262.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     905   0.0     
emb|CAA53730.1|  lipoxygenase                                           905   0.0     
gb|KFK39529.1|  hypothetical protein AALP_AA3G256200                    904   0.0     
emb|CAC04380.1|  lipoxygenase                                           904   0.0     
ref|XP_003627182.1|  Lipoxygenase                                       903   0.0     
ref|XP_007135512.1|  hypothetical protein PHAVU_010G135500g             903   0.0     
ref|XP_003627196.1|  Lipoxygenase                                       897   0.0     
gb|AHH24969.2|  lipoxygenase                                            895   0.0     
sp|P27481.1|LOXB_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase; ...    894   0.0     
ref|XP_004970879.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        891   0.0     
gb|AET01678.2|  seed linoleate 9S-lipoxygenase                          890   0.0     
tpg|DAA56391.1|  TPA: lipoxygenase1                                     890   0.0     
emb|CAA45738.1|  lipoxygenase                                           889   0.0     
ref|XP_004982082.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    888   0.0     
ref|NP_001105973.1|  lipoxygenase                                       887   0.0     
emb|CBI36801.3|  unnamed protein product                                885   0.0     
gb|KEH35161.1|  seed linoleate 9S-lipoxygenase                          882   0.0     
gb|EAY91529.1|  hypothetical protein OsI_13162                          882   0.0     
gb|ABX60410.1|  lipoxygenase L-5                                        881   0.0     
ref|XP_010470259.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    868   0.0     
ref|XP_010523550.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    864   0.0     
ref|XP_010094673.1|  putative linoleate 9S-lipoxygenase 5               865   0.0     
gb|AES95304.2|  seed linoleate 9S-lipoxygenase                          863   0.0     
gb|EMT01614.1|  Putative lipoxygenase 3                                 864   0.0     
ref|XP_003627202.1|  Seed lipoxygenase                                  897   0.0     
gb|AIL90390.1|  lipoxygenase                                            863   0.0     



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =  1191 bits (3080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/849 (70%), Positives = 695/849 (82%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VVLMKKN LD TD+ AS++D + +F+G++VS +LIS+ + DP     GKRS
Sbjct  14    DDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHVDPANGLQGKRS  73

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWR-ESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             K A+LE+W    T + AGESA+ VTF+W  E  GVPGA I+KN H +EF+LK+LTLED  
Sbjct  74    KAAYLENWLTNKTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYPA+KY   R+FF+NQAYLPS+TP PLR  RE EL  LRGDGTG+ +
Sbjct  134   NHGKVHFVCNSWVYPANKYKSPRIFFANQAYLPSETPEPLRKCRENELVTLRGDGTGKLE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDPD GK   RP+LGG+ EYPYPRRGRTGR+ TK+DP  ESR+PLL
Sbjct  194   EWDRVYDYAYYNDLGDPDKGKELSRPVLGGSSEYPYPRRGRTGREPTKSDPNSESRIPLL  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFDSF+D+  LYEG
Sbjct  254   MSLDIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFQALFDSTPNEFDSFEDVLKLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G LL+ I  N  LEI KE+LRSDGE LFK+PTPQVI   KTAWRTDEEF REML
Sbjct  314   GIKLPQGPLLKAITDNIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV ISRLQ FPP+S LDPK YG+  STITRE I DKLDGLT+++AI +N++FIL+H
Sbjct  374   AGVNPVVISRLQEFPPKSKLDPKTYGNQNSTITREQIEDKLDGLTIDEAIKTNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN +TD K YA+RTLLFLQ +GTL+P+AIELSLPHP GD+FG VS VYTP
Sbjct  434   HDILMPYLRRINTSTDTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGDQFGAVSKVYTP  493

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+QGVEGSIWQLAKAYAA NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPIYKLLH
Sbjct  494   ADQGVEGSIWQLAKAYAAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSTLHPIYKLLH  553

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+INAL RQ+L N  G++EL+  P KY+MEMSAV+YK+WVFP  +LP DLI RG
Sbjct  554   PHFRETMNINALARQILINGGGLLELTVFPAKYSMEMSAVVYKDWVFPEQALPTDLIKRG  613

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHG+RLLI+DYPYAVDGL+IW+AIK+WVTEYCN+YYK+D  V  DTELQAWW
Sbjct  614   VAVEDSSSPHGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNYYYKSDDAVQKDTELQAWW  673

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DKKDEPWWP++ +   LID+CT  IWI+SALHAAVNFGQY YAGY P RPT
Sbjct  674   KELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPT  733

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SRKFMPEPGS  YEELKTNPDK  L+TIT   QTLLGISLIEILSRH+SD +YLGQRE 
Sbjct  734   LSRKFMPEPGSPAYEELKTNPDKVFLETITPQLQTLLGISLIEILSRHSSDTLYLGQRES  793

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKD+E L AF RFGKKL  IE++I++MNGD K KNR+GPV VPYTLLFPT E GL+G
Sbjct  794   PEWTKDQEPLSAFGRFGKKLSDIEDQIMQMNGDEKWKNRSGPVKVPYTLLFPTSEGGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =  1190 bits (3079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/849 (70%), Positives = 694/849 (82%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VVLMKKN LD TD+ AS++D + +F+G++VS +LIS+ + DP     GKRS
Sbjct  14    DDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHADPANGLQGKRS  73

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWR-ESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             K A+LE+W    T + AGESA+ VTF+W  E  GVPGA I+KN H +EF+LK+LTLED  
Sbjct  74    KAAYLENWLTNNTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYPA KY   R+FF+NQAYLPS+TP PLR  RE EL  LRGDGTG+ +
Sbjct  134   NHGKVHFVCNSWVYPAKKYKSPRIFFANQAYLPSETPEPLRKCRENELVTLRGDGTGKLE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDPD GK   RP+LGG+ EYPYPRRGRTGR+ TKTDP  ESR+PLL
Sbjct  194   EWDRVYDYAYYNDLGDPDKGKELSRPVLGGSSEYPYPRRGRTGREPTKTDPNSESRIPLL  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFDSF+D+  LYEG
Sbjct  254   MSLDIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFKALFDSTPNEFDSFEDVLKLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G LL+ I  +  LEI KE+LRSDGE LFK+PTPQVI   KTAWRTDEEF REML
Sbjct  314   GIKLPQGPLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV ISRLQ FPP+S LDPK YG+  STITRE I DKLDGLT+++AI +NR+FIL+H
Sbjct  374   AGVNPVTISRLQEFPPKSKLDPKTYGNQNSTITREQIEDKLDGLTIDEAIKTNRLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN +TD K YA+RTLLFLQ +GTL+P+AIELSLPHP GD+FG +S VYTP
Sbjct  434   HDILMPYLRRINTSTDTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGDQFGAISKVYTP  493

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+ GVEGSIWQLAKAYAA NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPIYKLLH
Sbjct  494   ADHGVEGSIWQLAKAYAAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSALHPIYKLLH  553

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+INAL RQ+L N  G++EL+  P KY+MEMSAV+YK+WVFP  +LP DLI RG
Sbjct  554   PHFRETMNINALARQILINGGGLLELTVFPAKYSMEMSAVVYKDWVFPEQALPTDLIKRG  613

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHG+RLLI+DYPYAVDGL+IW+AIK+WVTEYCN+YYK+D  V  DTELQAWW
Sbjct  614   VAVEDSSSPHGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNYYYKSDDAVQKDTELQAWW  673

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DKKDEPWWP++ +   LID+CT  IWI+SALHAAVNFGQY YAGY P RPT
Sbjct  674   KELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPT  733

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR FMPEPGS +YEELKTNPDK  LKTIT   QTLLGISLIEILSRH+SD +YLGQRE 
Sbjct  734   LSRNFMPEPGSTEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHSSDTLYLGQRES  793

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKD+E L AFERFGKKL  IE++I++MNGD K KNR+GPV VPYTLLFPT E GL+G
Sbjct  794   PEWTKDQEPLSAFERFGKKLSDIEDQIMEMNGDEKWKNRSGPVKVPYTLLFPTSEGGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =  1190 bits (3079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/845 (70%), Positives = 678/845 (80%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKRSKPA  2604
             KKIKG+VVLM+KN LD  D  ASIVD + DF+GQKVS +L+S+   D      GKRSK A
Sbjct  14    KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  73

Query  2603  FLEDWG-KLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +L+ W  K T L +GESA+ + FEW E  GVPGA I+KNNH NEFYLKTLTLED    G 
Sbjct  74    YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPGAFIIKNNHPNEFYLKTLTLEDVPNHGE  133

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V F CFSWVYPA KYNY+R+FFSNQAYLPSQTP  L+ +RE EL NLRG GTGERKEWDR
Sbjct  134   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPDLLKTYREEELLNLRGTGTGERKEWDR  193

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLGDPD G    R ILGGN EYPYPRRGRTG + TK DP  ESR+PLL   +
Sbjct  194   VYDYAYYNDLGDPDRGAEYARTILGGNSEYPYPRRGRTGSEPTKHDPNSESRIPLLISLD  253

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDEKFGHLK +DFL YALKS+GQ ++    S FD+T  EFDSF DM +LYEGG  L
Sbjct  254   IYVPRDEKFGHLKLADFLAYALKSVGQFLLSEFESLFDSTPTEFDSFQDMLNLYEGGIKL  313

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
              +G LL  I  N  LE+ KE++RSDGE LFKFPTPQVI   KTAWRTDEEF REMLAGVN
Sbjct  314   PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQEDKTAWRTDEEFGREMLAGVN  373

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRLQ FPP+S LDPK YGD TSTIT+EHI   LDGLTVE+AI +NR+FIL+HHD +
Sbjct  374   PVVISRLQEFPPKSKLDPKAYGDQTSTITKEHIQQNLDGLTVEEAIANNRLFILNHHDTL  433

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN  T+ KIYA+RTLLFL  DGTL+P+AIELSLPHPLGDKFG  S VYTPAEQG
Sbjct  434   MPYLRRINT-TNNKIYASRTLLFLNTDGTLKPVAIELSLPHPLGDKFGAHSKVYTPAEQG  492

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE  +WQLAKAY A NDSGVHQLISHWLNTHAVIEP ++ATNRQLS LHPI+KLLHPHFR
Sbjct  493   VENGLWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVVATNRQLSVLHPIHKLLHPHFR  552

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM INAL RQ+L NA GV+E +  P KYAMEMSAV+YK+WVFP+ +LP DL+ RG+AV 
Sbjct  553   DTMTINALARQILINAGGVLEKTVFPDKYAMEMSAVVYKDWVFPDQALPTDLVKRGVAVE  612

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSP+GVRLLI+DYP+AVDGLEIW++IKTWV +YC  YYK+D +V  DTELQAWW E+ 
Sbjct  613   DPSSPNGVRLLIQDYPFAVDGLEIWSSIKTWVQDYCKIYYKSDDVVQKDTELQAWWKELR  672

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH D KD+PWWP + +   LID+CT IIWI+SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  673   EQGHGDLKDKPWWPTMQTVQELIDSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTLSRR  732

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ DY+EL+ +PDK  LKTITA  QTLLG+SLIEILSRHASDE+YLG+RE PEWT
Sbjct  733   FMPEPGTDDYKELEADPDKVFLKTITAQLQTLLGVSLIEILSRHASDEVYLGKREFPEWT  792

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D+EAL+AF +FG+ L  IE  I +MN  GKLKNRTGPV VPYTLLFPT E GL+GKGIP
Sbjct  793   NDQEALDAFAQFGRNLSKIEVNIKRMNTVGKLKNRTGPVEVPYTLLFPTSEVGLTGKGIP  852

Query  281   NSISI  267
             NS+SI
Sbjct  853   NSVSI  857



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =  1189 bits (3077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/863 (69%), Positives = 702/863 (81%), Gaps = 12/863 (1%)
 Frame = -1

Query  2822  MILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLIS  2643
             M+L KI  AI+ +  D  KK+KG +VLMKKN LD  DV AS++D + +F+G++VS QLIS
Sbjct  1     MLLEKIVEAISGRSEDNGKKVKGTIVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLIS  60

Query  2642  AENDDPG-----KRSKPAFLEDWGKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHA  2481
               + DPG     KRS PA+LE W    TSLVAGESA+DVTF+W E +GVPGA I+ N H 
Sbjct  61    VVHADPGNSLQGKRSNPAYLEKWLTTGTSLVAGESAFDVTFDWDEDIGVPGAFIINNFHF  120

Query  2480  NEFYLKTLTLEDGGAAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREA  2304
             NEFYLK+LTLED    G V FVC SWVYPA KY  +R+FF+NQAYLP +TP PLR +RE 
Sbjct  121   NEFYLKSLTLEDVPNHGNVHFVCNSWVYPAKKYKSERIFFANQAYLPGETPEPLRNYREK  180

Query  2303  ELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkm  2130
             EL NLRG+G G+ +EWDRVYDY  YNDLGDP+ GK   R ILGG+ EYPYPRRGRTGRK 
Sbjct  181   ELVNLRGNGNGKLEEWDRVYDYALYNDLGDPEKGKQYARTILGGSAEYPYPRRGRTGRKP  240

Query  2129  tkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQN  1950
             TK DPK ESR+PLL   +IYVPRDE+FGH+K SDFL YALKSI Q +IP   + FD+T +
Sbjct  241   TKADPKSESRIPLLMSLDIYVPRDERFGHIKLSDFLTYALKSIVQFLIPEFQALFDSTPD  300

Query  1949  EFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASK  1776
             EFDSF+D+  LYEGG  L +G  L+ +  +  LEI KE++R+DGE  FKFPTPQVI   K
Sbjct  301   EFDSFEDVLKLYEGGIKLPQGPFLKALTDSIPLEILKEIIRTDGEGKFKFPTPQVIQEDK  360

Query  1775  TAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTV  1596
             ++WRTDEEFAREMLAGVNPV ISRLQ FPP+S LD +VYG+  STIT+EHI + LDGLT+
Sbjct  361   SSWRTDEEFAREMLAGVNPVIISRLQEFPPKSQLDSEVYGNQNSTITKEHIENTLDGLTI  420

Query  1595  EQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHP  1416
             + AI +NR++IL+HHD +M Y RRIN  T+ K+YA+RTLLFLQ DGT++P+AIELSLPHP
Sbjct  421   DDAIKTNRLYILNHHDILMPYVRRINT-TNTKLYASRTLLFLQDDGTMKPVAIELSLPHP  479

Query  1415  LGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATN  1236
              GD+ G VS VYTPA+QGVEGSIWQLAKAY A NDSGVHQLISHWLNTHA IEP +IATN
Sbjct  480   DGDELGAVSKVYTPADQGVEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAAIEPFVIATN  539

Query  1235  RQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWV  1056
             RQLS LHPI+KLLHPHFRDTM+INAL RQ+L NA GV+E++  P KYAMEMSAV+YK+WV
Sbjct  540   RQLSVLHPIHKLLHPHFRDTMNINALARQILINAGGVLEMTVFPAKYAMEMSAVVYKSWV  599

Query  1055  FPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKN  876
             FP  +LP DLI RG+AV D SSPHGVRLLI+DYPYAVDGLEIW+AIK+WVTEYCNFYYK+
Sbjct  600   FPEQALPADLIKRGVAVEDSSSPHGVRLLIQDYPYAVDGLEIWSAIKSWVTEYCNFYYKS  659

Query  875   DIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNF  696
             D +V  D ELQAWW E+ ++GH DKKDEPWWP++ +R  L D+CT IIWI+SALHAAVNF
Sbjct  660   DELVLKDNELQAWWKELREEGHGDKKDEPWWPKMQTRQELKDSCTIIIWIASALHAAVNF  719

Query  695   GQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILS  516
             GQY YAGY P RPT+SR+FMPEPG+ +YEELKTNPDKA LKTIT   QTLLGISLIEILS
Sbjct  720   GQYPYAGYLPNRPTLSRRFMPEPGTPEYEELKTNPDKAYLKTITPQLQTLLGISLIEILS  779

Query  515   RHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVP  336
             RHASDEIYLGQR+  EWTKD+E + AFERFGKKL  IE++I++MNGD K KNR+GPVNVP
Sbjct  780   RHASDEIYLGQRDSSEWTKDQEPIAAFERFGKKLSEIEDQIIQMNGDKKWKNRSGPVNVP  839

Query  335   YTLLFPTGEEGLSGKGIPNSISI  267
             YTLLFPT E+GL+GKGIPNS+SI
Sbjct  840   YTLLFPTSEQGLTGKGIPNSVSI  862



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =  1185 bits (3066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/845 (69%), Positives = 691/845 (82%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             KK+KG VVLMKKN LD  DV AS++D + +F+G++VS QLISA + DPG     KRS PA
Sbjct  18    KKVKGTVVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISAVHADPGNTLQGKRSNPA  77

Query  2603  FLEDWGKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LE W    TSLVAGESA+DVTF+W + +GVPGA I+ N H NEFYLK+LTLED    G 
Sbjct  78    YLEKWLTTGTSLVAGESAFDVTFDWDDDIGVPGAFIINNFHFNEFYLKSLTLEDVPNHGS  137

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA +Y  +R+FF+NQAYLP +TP PLR +RE EL NLRGDG G+ +EWDR
Sbjct  138   VHFVCNSWVYPAKRYKSERIFFANQAYLPGETPEPLRNYREKELVNLRGDGNGKLEEWDR  197

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY  YNDLGDP+ GK   R ILGG+ E+PYPRRGRTGRK TK DPK ESR+PLL   +
Sbjct  198   VYDYALYNDLGDPEKGKQYARTILGGSAEFPYPRRGRTGRKPTKADPKSESRIPLLMSLD  257

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGH+K SDFL YALKSI Q +IP   + FD+T +EFDSF+D+  LYEGG  L
Sbjct  258   IYVPRDERFGHIKLSDFLTYALKSIVQFLIPEFQALFDSTPDEFDSFEDVMKLYEGGIKL  317

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
              +G  L+ +  +  LEI KE++R+DGE  FKFPTPQV+   K++WRTDEEFAREMLAGVN
Sbjct  318   PQGPFLKALTDSIPLEILKEIIRTDGEGKFKFPTPQVLQEDKSSWRTDEEFAREMLAGVN  377

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRLQ FPP+S LDP+VYG+  STIT+EHI + LDGLT++ AI +NR++IL+HHD +
Sbjct  378   PVIISRLQEFPPKSELDPEVYGNQNSTITKEHIENTLDGLTIDDAIKTNRLYILNHHDIL  437

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN  T+ K+YA+RTLLFLQ DGT++P+AIELSLPHP GD  G VS VYTPA QG
Sbjct  438   MPYVRRINT-TNTKLYASRTLLFLQDDGTMKPVAIELSLPHPDGDHLGAVSKVYTPANQG  496

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHA IEP +IATNRQLS LHPI+KLLHPHFR
Sbjct  497   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHPHFR  556

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA GV+E++  P KYAMEMSAV+YK+WVFP  +LP DLI RG+AV 
Sbjct  557   DTMNINALARQILINAGGVLEMTVFPAKYAMEMSAVVYKSWVFPEQALPADLIKRGVAVE  616

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPHGVRLLI+DYPYAVDGL+IW+AIK+WVTEYCNFYYK+D  +  D ELQAWW E+ 
Sbjct  617   DSSSPHGVRLLIQDYPYAVDGLQIWSAIKSWVTEYCNFYYKSDESLLKDNELQAWWKELR  676

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++  R  LID+CT IIWI+SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  677   EEGHGDKKDEPWWPKMQIRQELIDSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTLSRR  736

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +YEELKTNPDKA LKTIT   QTLLGISLIEILSRHASDEIYLGQR+  EWT
Sbjct  737   FMPEPGTPEYEELKTNPDKAYLKTITPQLQTLLGISLIEILSRHASDEIYLGQRDSSEWT  796

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KD+E++ AFERFGKKL  IE++I++MNGD + KNR+GPV VPYTLLFPT E+GL+GKGIP
Sbjct  797   KDQESIAAFERFGKKLSEIEDQIIQMNGDEQWKNRSGPVKVPYTLLFPTSEQGLTGKGIP  856

Query  281   NSISI  267
             NS+SI
Sbjct  857   NSVSI  861



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =  1185 bits (3066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/849 (69%), Positives = 693/849 (82%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VVLMKKN LD TD+ AS++D + +F+G++VS +LIS+ N DP     GKRS
Sbjct  14    DDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRS  73

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWR-ESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             K A+LE+W    T + AGESA+ VTF+W  E  GVPGA I+KN H +EF+LK+LTLED  
Sbjct  74    KAAYLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYPA+KY  DR+FF+NQAYLPS+TP  LR +RE EL  LRGDGTG+ +
Sbjct  134   NHGKVHFVCNSWVYPANKYKSDRIFFANQAYLPSETPDTLRKYRENELVTLRGDGTGKLE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGRK TKTDP  ESR+PLL
Sbjct  194   EWDRVYDYAYYNDLGDPDKGQDLSRPVLGGSSEYPYPRRGRTGRKPTKTDPNSESRIPLL  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFDSF+D+  LYEG
Sbjct  254   MSLDIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFKALFDSTHNEFDSFEDVLKLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G LL+ I  +  LEI KE+LRSDGE LFK+PTPQVI   KTAWRTDEEF REML
Sbjct  314   GIKLPQGPLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV ISRLQ FPP+S LDPK+YG+  STITRE I DKLDGLT+++AI +NR+FIL+H
Sbjct  374   AGVNPVIISRLQEFPPKSKLDPKIYGNQNSTITREQIEDKLDGLTIDEAIKTNRLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN +TD K YA+RTLLFLQ +GTL+P AIELSLPHP GD+FG VS VYTP
Sbjct  434   HDILMPYLRRINTSTDTKTYASRTLLFLQDNGTLKPSAIELSLPHPDGDQFGAVSKVYTP  493

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+QGVEGSIWQLAKAYAA NDSGVHQLISHWLNTHA IEP +IATNRQLS LHPIYKLLH
Sbjct  494   ADQGVEGSIWQLAKAYAAVNDSGVHQLISHWLNTHAAIEPFVIATNRQLSALHPIYKLLH  553

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+INAL RQ+L N  G++EL+  P KY+MEMSAV+YK+WVFP  +LP DLI RG
Sbjct  554   PHFRETMNINALARQILINGGGLLELTVFPAKYSMEMSAVVYKDWVFPEQALPTDLIKRG  613

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSP G+RLLI+DYPYAVDGL+IW+AIK+WVTEYCN+YYK+D  V  DTELQAWW
Sbjct  614   VAVEDSSSPLGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNYYYKSDDAVQKDTELQAWW  673

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DKKDEPWWP++ +   LID+CT  IWI+SALHAAVNFGQY YAGY P RPT
Sbjct  674   KELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPT  733

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR FMPEPGS +YEELKTNPDK  LKTIT   QTLLGISLIEILSRH+SD +YLGQRE 
Sbjct  734   LSRNFMPEPGSPEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHSSDTLYLGQRES  793

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKD+E L AF RFGKKL  IE++I++MN D K KNR+GPV VPYTLLFPT E GL+G
Sbjct  794   PEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDEKWKNRSGPVKVPYTLLFPTSEGGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =  1180 bits (3053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/849 (69%), Positives = 691/849 (81%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VVLMKKN LD TD+ AS++D + +F+G++VS +LIS+ N DP     GKRS
Sbjct  14    DDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRS  73

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWR-ESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             K A+LE+W    T + AGESA+ VTF+W  E  GVP A I+KN H +EF+LK+LTLED  
Sbjct  74    KAAYLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPEAFIIKNLHFSEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYPA+KY  DR+FF+NQAYLPS+TP  LR +RE EL  LRGDGTG+ +
Sbjct  134   NHGKVHFVCNSWVYPANKYKSDRIFFANQAYLPSETPETLRKYRENELVTLRGDGTGKLE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGRK TKTDP  ESR+PLL
Sbjct  194   EWDRVYDYAYYNDLGDPDKGQDLSRPVLGGSSEYPYPRRGRTGRKPTKTDPNSESRIPLL  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFD F+D+  LYEG
Sbjct  254   MSLDIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFKALFDSTPNEFDRFEDVLKLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G LL+ I  +  LEI KE+LRSDGE LFK+PTPQVI   KTAWRTDEEF REML
Sbjct  314   GIKLPQGPLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV ISRLQ FPP+S LDPK+YG+  STITRE I DKLDGLT+++AI +NR+FIL+H
Sbjct  374   AGVNPVIISRLQEFPPKSKLDPKIYGNQNSTITREQIEDKLDGLTIDEAIKTNRLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN +TD K YA+RTLLFLQ +GTL+P AIELSLPHP GD+FG VS VYTP
Sbjct  434   HDILMPYLRRINTSTDTKTYASRTLLFLQDNGTLKPSAIELSLPHPDGDQFGAVSKVYTP  493

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+QGVEGSIWQLAKAYAA NDSGVHQLISHWLNTHA IEP +IATNRQLS LHPIYKLLH
Sbjct  494   ADQGVEGSIWQLAKAYAAVNDSGVHQLISHWLNTHAAIEPFVIATNRQLSTLHPIYKLLH  553

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+INAL RQ+L N  G++EL+  P KY+MEMSAV+YK+WVFP  +LP DLI RG
Sbjct  554   PHFRETMNINALARQILINGGGLLELTVFPAKYSMEMSAVVYKDWVFPEQALPTDLIKRG  613

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSP G+RLLI+DYPYAVDGL+IW+AIK+WVTEYCN+YYK+D  V  DTELQAWW
Sbjct  614   VAVEDSSSPLGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNYYYKSDDAVQKDTELQAWW  673

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DKKDEPWWP++ +   LID+CT  IWI+SALHAAVNFGQY YAGY P RPT
Sbjct  674   KELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPT  733

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR FMPEPGS +YEELKTNPDK  LKTIT   QTLLGISLIEILSRH+SD +YLGQRE 
Sbjct  734   LSRNFMPEPGSPEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHSSDTLYLGQRES  793

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKD+E L AF RFGKKL  IE++I++MN D K KNR+GPV VPYTLLFPT E GL+G
Sbjct  794   PEWTKDQEPLSAFARFGKKLSDIEDQIMQMNVDEKWKNRSGPVKVPYTLLFPTSEGGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =  1179 bits (3051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/849 (69%), Positives = 693/849 (82%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA----ENDDPGKRSK  2610
             D+ +K+KGRVVLMKKN LD TDV AS++D + +F+GQ+VSF+LIS     EN   GKRSK
Sbjct  14    DDGEKVKGRVVLMKKNVLDFTDVTASVLDGVLEFLGQRVSFELISTSLHDENGLEGKRSK  73

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
             PA+LE W   +T + AGESA+ VTF+W  E LGVPGA I+KN H +EF+LK+LTLED   
Sbjct  74    PAYLEHWLTNITPIAAGESAFSVTFDWDHEELGVPGAFIIKNLHFSEFFLKSLTLEDVPN  133

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G + FVC SWVYPA KY  DR+FF+NQAYLPS+TP  LR +RE EL  LRGDGTG+ +E
Sbjct  134   HGKIHFVCDSWVYPASKYKSDRIFFANQAYLPSETPEALRKYRENELVTLRGDGTGKLEE  193

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG PDNG+   RP+LGG+ EYPYPRRGRTGR+ TKTDP  ESR+PLL 
Sbjct  194   WDRVYDYAYYNDLGYPDNGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNTESRIPLLM  253

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFDSF D+  LYEGG
Sbjct  254   SLDIYVPRDERFGHVKLSDFLTFALKSIVQLLLPEFKALFDSTPNEFDSFADVLKLYEGG  313

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G LL+ I     LEI +E+L++DGE LFK+PTPQVI   KTAWRTD+EF REMLA
Sbjct  314   IKLPQGPLLKAITDGIPLEILRELLQTDGEGLFKYPTPQVIQEDKTAWRTDDEFGREMLA  373

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV IS+LQ FPP+S LDPK YG+ +STITRE I DKLDGLTV++AI +NR+FIL+HH
Sbjct  374   GLNPVIISKLQEFPPKSKLDPKTYGNQSSTITREQIEDKLDGLTVDEAIKTNRLFILNHH  433

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T+ K YA+RTLLFLQ +GTL+P+AIELSLPHP GD+ G VS V+TP+
Sbjct  434   DTLMPYLRRINTTTNTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGDQLGAVSKVFTPS  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             +QGVEGSIWQLAKAYAA NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL P
Sbjct  494   DQGVEGSIWQLAKAYAAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLLP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L N  GV+EL+  P KY+MEMSAV+YK+W+FP  +LP DLI RG+
Sbjct  554   HFRDTMNINALARQILINGGGVLELTVFPAKYSMEMSAVVYKDWIFPEQALPVDLIKRGV  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SS HG+RLLI+DYPYA DGLEIW+AIK+WVTEYCNFYYK+D  V  D ELQAWW 
Sbjct  614   AVEDSSSKHGIRLLIQDYPYAADGLEIWSAIKSWVTEYCNFYYKSDDAVQKDAELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH DKKDEPWWP++ +R  LID+CT  IWI+SALHAAVNFGQY YAGY P RPT+
Sbjct  674   ELREEGHGDKKDEPWWPKMQTRQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPTL  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR FMPEPGSA+YEELKTNPDK  LKTIT   QTLLGISLIEILSRHASD +YLGQR+ P
Sbjct  734   SRNFMPEPGSAEYEELKTNPDKVFLKTITPQLQTLLGISLIEILSRHASDTLYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDG-KLKNRTGPVNVPYTLLFPTGEEGLSG  294
             EWTKD+E L AFERFG+KL  IE +IL+MNGD  K KNR+GPV VPYTLLFPT EEGL+G
Sbjct  794   EWTKDQEPLSAFERFGQKLSDIEAQILQMNGDHEKWKNRSGPVKVPYTLLFPTSEEGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =  1170 bits (3028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/848 (69%), Positives = 687/848 (81%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VVLMKKN LD  DV AS +D + +F+G++VS QLIS+ + DP     GKRS
Sbjct  15    DDGKKMKGTVVLMKKNALDFNDVNASFLDGVLEFLGKRVSLQLISSVHGDPANGLQGKRS  74

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
             KPA+LE+W    T LVAGESA+DVTF+W E +GVPGA I+ N H NEF+LK+LTLED   
Sbjct  75    KPAYLENWLTTRTPLVAGESAFDVTFDWDEDIGVPGAFIINNLHFNEFFLKSLTLEDVPN  134

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G + FVC SWVYPA +Y  +R+FF+NQAYLP +TP PLR +RE EL  LRGDG G+ +E
Sbjct  135   HGKIHFVCNSWVYPAKRYKSERIFFANQAYLPHETPEPLREYREKELVTLRGDGNGKLEE  194

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY +YNDLGDP+ G+   R ILGG+ E+PYPRRGRTGRK TK DPK ESR+PLL 
Sbjct  195   WDRVYDYAFYNDLGDPERGEAYARTILGGSAEFPYPRRGRTGRKSTKADPKSESRIPLLM  254

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGH+K SDF  YALKSI Q +IP   + FD+T  EFDSF+D+  LYEGG
Sbjct  255   SLDIYVPRDERFGHIKLSDFPTYALKSIVQFLIPEFQALFDSTPGEFDSFEDVLRLYEGG  314

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G  L+ +  +  L I KE++R+DGE  FKFPTPQVI A K++WRTDEEFAREMLA
Sbjct  315   IKLPQGPFLKALTDSIPLSILKEIIRTDGEGKFKFPTPQVIQADKSSWRTDEEFAREMLA  374

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV ISRLQ FPP+S LD +VYG+  STIT+EHI + LDGLT++ AI +NR++IL+HH
Sbjct  375   GVNPVIISRLQEFPPKSKLDTEVYGNQNSTITKEHIENALDGLTIDDAIKTNRLYILNHH  434

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T+ K+YA+RTLLFLQ DGT++PIAIELSLPHP GD+ G VS VYTPA
Sbjct  435   DMLMPYVRRINT-TNTKLYASRTLLFLQDDGTMKPIAIELSLPHPDGDELGAVSKVYTPA  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             ++ VEG+IWQLAKAY A NDSGVHQLISHWLNTHA IEP +IATNRQLS LHPI+KLLHP
Sbjct  494   DRDVEGTIWQLAKAYVAVNDSGVHQLISHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA GV+EL+  P KYAMEMSAV+Y+NWVFP  +LP DL+ RG+
Sbjct  554   HFRDTMNINALARQILINAGGVLELTVFPSKYAMEMSAVVYRNWVFPEQALPVDLVKRGV  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHGVRLLI+DYPYAVDGLEIW+AIK WVTEYCNFYYK+D  V  D ELQAWW 
Sbjct  614   AVEDSSSPHGVRLLIQDYPYAVDGLEIWSAIKIWVTEYCNFYYKSDESVLKDDELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKKDEPWWP++ +R  LID+CT IIWI+SALHAAVNFGQY YAGY P RPT+
Sbjct  674   EVREEGHGDKKDEPWWPKMQTRQELIDSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTL  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+ +YEELKTNPD A LKTIT   QTLLGISLIEILSRH SDE+YLGQR+  
Sbjct  734   SRRFMPEPGTPEYEELKTNPDLAYLKTITPQLQTLLGISLIEILSRHTSDEVYLGQRDSS  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWTKD+E L AFERFGKKL  IE++I++MNGD   KNR+GPV VPYTLLFPT EEGL+GK
Sbjct  794   EWTKDQEPLAAFERFGKKLSEIEDQIVQMNGDENWKNRSGPVKVPYTLLFPTSEEGLTGK  853

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  854   GIPNSVSI  861



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =  1170 bits (3028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/849 (68%), Positives = 689/849 (81%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D+ KK+KG VVLMKKN LD TDV ASIVD + DF+G++VSFQLIS    D     GK SK
Sbjct  14    DDGKKVKGTVVLMKKNVLDFTDVNASIVDGVLDFLGRRVSFQLISNSVHDANGLEGKLSK  73

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWR-ESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
             PA+LE+W   +T +VAGES + VTFEW  E  GVPGA I+KN H +EF+LK+LTLED   
Sbjct  74    PAYLENWITNITPVVAGESTFSVTFEWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPN  133

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G + FVC SWVYPA KY  +R+FF+NQAYLPS+TP  LR +RE EL  LRGDGTG+ +E
Sbjct  134   HGKIHFVCNSWVYPASKYKSNRIFFANQAYLPSETPELLRKYRENELVALRGDGTGKLEE  193

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGRK TKTDP  ESR+PLL 
Sbjct  194   WDRVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGRKPTKTDPNTESRIPLLM  253

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFDSF D+  +YEGG
Sbjct  254   SLDIYVPRDERFGHVKMSDFLTFALKSISQLLLPEFKALFDSTPNEFDSFADVLKIYEGG  313

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G   + I     LEI K++L +DGE L K+PTPQVI   K+AWRTDEEF REMLA
Sbjct  314   IKLPQGTSFKAIVDAIPLEILKQLLSTDGEGLLKYPTPQVIQEDKSAWRTDEEFGREMLA  373

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV ISRLQ FPP+S LDPK+YG+ TSTITRE I DKLDGLTV++AI +NR+FIL+HH
Sbjct  374   GVNPVIISRLQEFPPKSKLDPKIYGNQTSTITREQIEDKLDGLTVDEAIKTNRLFILNHH  433

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T+ K+YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FG VS V+TP+
Sbjct  434   DILMPYVRRINTTTNTKMYASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGAVSKVFTPS  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             +QGVEGSIWQLAKAYAA NDSGVHQL+SHWLNTH VIEP +IATNRQLS +HPI+KLL P
Sbjct  494   DQGVEGSIWQLAKAYAAVNDSGVHQLVSHWLNTHTVIEPFVIATNRQLSVVHPIHKLLLP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFR+TM+INAL RQ+L N  G++E +  P KY+ME+S+V+YK+W+FP  +LP DLI RG+
Sbjct  554   HFRETMNINALARQILINGGGLLEFTVFPAKYSMELSSVIYKDWIFPEQALPADLIKRGV  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHGVRLLI+DYPYAVDGLEIW+AIK+WVTEYCN+YYK+D  V  DTELQAWW 
Sbjct  614   AVEDSSSPHGVRLLIQDYPYAVDGLEIWSAIKSWVTEYCNYYYKSDDAVQKDTELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH DKKDEPWWP++ +   LID+CT  IWI+SALHAAVNFGQY YAGY P RPT+
Sbjct  674   ELREEGHGDKKDEPWWPKMQTVQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPTL  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SRKFMPEPGSA+YEELKTNPD   LKTIT   QTL+GISLIE+LSRH+SD +YLGQ + P
Sbjct  734   SRKFMPEPGSAEYEELKTNPDNVFLKTITPQLQTLVGISLIELLSRHSSDTLYLGQNDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGD-GKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             EWTKD+E L AFERFGKKL  IE+RI++MNGD  K KNR+GPV VPYTLLFPT EEGL+G
Sbjct  794   EWTKDQEPLSAFERFGKKLSDIEDRIMQMNGDPEKWKNRSGPVKVPYTLLFPTSEEGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =  1169 bits (3023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/846 (68%), Positives = 677/846 (80%), Gaps = 13/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD------PGKRSKP  2607
             KKIKG VVLMKKN LD  D  ASI+D++ + +GQKVS QLISA N D       GK  KP
Sbjct  17    KKIKGTVVLMKKNVLDFNDFNASILDRVHELLGQKVSLQLISAVNADLTVKGLKGKLGKP  76

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             A+LEDW   +T L AG+SAYDVTF+W E +GVPGA I++N H +EFYLK+LTL+   G  
Sbjct  77    AYLEDWITTITPLTAGDSAYDVTFDWDEEIGVPGAFIIRNFHHSEFYLKSLTLDHVPGHG  136

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              V FVC SWVYPA  Y  DRVFFSNQ YL S+TPAPL  +R+ EL NLRGDG G+ +EWD
Sbjct  137   RVHFVCNSWVYPAKNYKTDRVFFSNQTYLLSETPAPLIEYRKQELVNLRGDGKGKLEEWD  196

Query  2252  RVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLGDPD G    RPILGG+ EYPYPRRGRTGR  TKTDP+ ESRL LL   
Sbjct  197   RVYDYAYYNDLGDPDKGSKYARPILGGSTEYPYPRRGRTGRPPTKTDPESESRLALLMSF  256

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
              IYVPRDE+FGHLK SDFL YALKS+ Q ++P + +  D T NEFDSF D+  +YEGG  
Sbjct  257   NIYVPRDERFGHLKMSDFLAYALKSVVQFLVPELGALCDKTPNEFDSFQDILKIYEGGIK  316

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L  G LL+ I++N  LE+ KE++R+DGE   KFP PQVI   KTAWRTDEEFAREMLAGV
Sbjct  317   LPEGPLLDKIKENIPLEMLKELVRTDGEGYLKFPMPQVIKEDKTAWRTDEEFAREMLAGV  376

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             +PV ISRLQ FPPRSTLDPK+YG+  S+IT +HI + LDG T+E+AI +NR+FILDHHD 
Sbjct  377   DPVIISRLQEFPPRSTLDPKLYGNQNSSITEDHIKNNLDGFTIEEAIKNNRLFILDHHDA  436

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRINA T  KIYATRTLLFLQKDGTL+P+AIELSLPHP GD+FG +S VYTP+EQ
Sbjct  437   LMPYVRRINA-TSTKIYATRTLLFLQKDGTLKPLAIELSLPHPNGDQFGAISKVYTPSEQ  495

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGS+WQLAKAY A NDSG HQLISHWLNTHA IEP + ATNRQLS LHPI+KLLHPHF
Sbjct  496   GVEGSVWQLAKAYVAVNDSGYHQLISHWLNTHAAIEPFVTATNRQLSVLHPIHKLLHPHF  555

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INA  RQ+L NADG++E +  PGKYAMEMSAV+YKNWVFP  +LP DLI RG+AV
Sbjct  556   RDTMNINAFARQILINADGILEKTVFPGKYAMEMSAVVYKNWVFPEQALPADLIKRGVAV  615

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D ++PHG+RLLI+D PYAVDGL+IW+AI+TWV EYCNFYYKND MV  D ELQ+WW E+
Sbjct  616   KDDNAPHGIRLLIQDCPYAVDGLKIWSAIETWVQEYCNFYYKNDEMVKEDLELQSWWKEL  675

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH DKK EPWWP++ +R  LID+CT +IW++SALHAAVNFGQY YAGY P RPT+SR
Sbjct  676   REEGHGDKKHEPWWPKMQTRRELIDSCTIVIWVASALHAAVNFGQYPYAGYLPNRPTLSR  735

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +YEE K++PDKA LKTITA  QTLLG+SLIEILSRH+SDE+YLGQR+  +W
Sbjct  736   RFMPEPGTPEYEEFKSSPDKAFLKTITAQLQTLLGVSLIEILSRHSSDEVYLGQRDSADW  795

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D E LEAF RFGKKL  IEE I++MN D  L+NR GPV VPYTLLFPT E GL+GKGI
Sbjct  796   TTDDEPLEAFGRFGKKLGEIEEMIIEMNNDENLRNRVGPVKVPYTLLFPTSEGGLTGKGI  855

Query  284   PNSISI  267
             PNS+SI
Sbjct  856   PNSVSI  861



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =  1164 bits (3011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/849 (68%), Positives = 687/849 (81%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D+ +K+KG VVLMKKN LD TDV ASIVD   +F+G++VSFQLIS    D     GK S 
Sbjct  14    DDGEKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHDANGLEGKLSN  73

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRE-SLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
             PA+LE+W   +T +VAGES + VTF+W +   GVPGA I+KN H +EF+LK+LTLE    
Sbjct  74    PAYLENWITNITPVVAGESTFSVTFDWDDDEFGVPGAFIIKNLHFSEFFLKSLTLEHVPN  133

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G V FVC SWVYPA KY  DR+FF+NQAYLPS+TP  LR +RE EL  LRGDGTG+ +E
Sbjct  134   HGKVHFVCNSWVYPASKYKSDRIFFANQAYLPSETPELLRKYRENELVALRGDGTGKLEE  193

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLGDPD G+   RP+LGG+ +YPYPRRGRTGRK TKTDP  ESR+PLL 
Sbjct  194   WDRVYDYAYYNDLGDPDKGQEYARPVLGGSSQYPYPRRGRTGRKPTKTDPNTESRIPLLM  253

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGH+K SDFL +ALKSI Q+++P   + FD+T NEFDSF D+  +YEGG
Sbjct  254   SLDIYVPRDERFGHVKMSDFLTFALKSISQLLLPEFKALFDSTPNEFDSFADVLKIYEGG  313

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G L + I     LEI K++L +DGE L K+PTPQVI   K+AWRTDEEF REMLA
Sbjct  314   IKLPQGPLFKAIVDAIPLEILKQLLSTDGEGLLKYPTPQVIQEDKSAWRTDEEFGREMLA  373

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV ISRLQ FPP+S LDPK+YG+ TSTITRE I DKLDGLTV++A+ +NR+FIL+HH
Sbjct  374   GINPVIISRLQEFPPKSKLDPKIYGNQTSTITREQIEDKLDGLTVDEAVKTNRLFILNHH  433

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T+ K+YATRTLLFLQ DGTL+P+AIELSLPHP GD+FG VS V+TP+
Sbjct  434   DILMPYVRRINTTTNTKMYATRTLLFLQDDGTLKPLAIELSLPHPDGDQFGAVSEVFTPS  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             +QGVEGSIWQLAKAYAA NDSGVHQL+SHWLNTH VIEP +IATNRQLS LHPI+KLL P
Sbjct  494   DQGVEGSIWQLAKAYAAVNDSGVHQLVSHWLNTHTVIEPFVIATNRQLSVLHPIHKLLLP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L N  G++EL+  P KY+ME+S+V+YK+W+FP  +LP DLI RG+
Sbjct  554   HFRDTMNINALARQILINGGGLLELTVFPAKYSMELSSVIYKDWIFPEQALPADLIKRGV  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D +SPHGVRLLI+DYPYAVDGLEIW+AIK+WVTEYCN+YYK+D  V  D ELQAWW 
Sbjct  614   AVEDSNSPHGVRLLIQDYPYAVDGLEIWSAIKSWVTEYCNYYYKSDDAVQKDAELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH DKKDEPWWP++ S   LID+CT  IWI+SALHAAVNFGQY YAGY P RPT+
Sbjct  674   ELREEGHGDKKDEPWWPKMQSVQELIDSCTITIWIASALHAAVNFGQYPYAGYLPNRPTL  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SRKFMPEPGSA+YEELK NPD   LKTIT   QTL+GISLIE+LSRHASD +YLGQR+ P
Sbjct  734   SRKFMPEPGSAEYEELKRNPDNVFLKTITPQLQTLVGISLIELLSRHASDTLYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDG-KLKNRTGPVNVPYTLLFPTGEEGLSG  294
             EWTKD+E L AFERFGKKL  IE+RI++MNGD  K KNR+GPV VPYTLLFPT EEGL+G
Sbjct  794   EWTKDQEPLSAFERFGKKLGEIEDRIIQMNGDNQKWKNRSGPVKVPYTLLFPTSEEGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =  1163 bits (3008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/844 (68%), Positives = 672/844 (80%), Gaps = 11/844 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD----PGKRSKPAF  2601
             KKIKG VVLMKKN LDL D  AS +D I + +GQKVS QLISA N D     GK  K A+
Sbjct  14    KKIKGTVVLMKKNVLDLNDFNASFLDGIHELLGQKVSLQLISAVNVDQGTLKGKLGKAAY  73

Query  2600  LEDWGKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LEDW    T L AGE+A D+TF+W E  G+PGA I+KNNH  +FYLKTLTLE+  G   V
Sbjct  74    LEDWITTNTFLAAGETAADITFDWDEDQGIPGAFIIKNNHPTQFYLKTLTLEEVPGHGRV  133

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA KY  DRVFFSNQAYLPS TP PLR +R  EL NLRGDGTGE KEWDRV
Sbjct  134   HFVCNSWVYPAAKYKKDRVFFSNQAYLPSDTPEPLRQYRAEELVNLRGDGTGELKEWDRV  193

Query  2246  YDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD GK   R  LGG+ E+PYPRRGRTGR  +KTDP  ESRLPLL   +I
Sbjct  194   YDYAYYNDLGDPDKGKEYARQNLGGSQEFPYPRRGRTGRPPSKTDPTVESRLPLLTSLDI  253

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFLGY LKS+ Q++ P + S FD+T NEFDS +D+  LYEGG  L 
Sbjct  254   YVPRDERFGHLKMSDFLGYGLKSVAQILYPALKSLFDSTPNEFDSLEDVLKLYEGGIKLP  313

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
             +G LL+ I  N   E+ KE+LR+DGE + KFPTPQ+I   K+AWRTDEEF REMLAG+NP
Sbjct  314   KGPLLQSITDNIPFELLKEILRTDGEAILKFPTPQIIQEDKSAWRTDEEFGREMLAGLNP  373

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V IS LQ FPP+S LDPKVYG   STIT+E I DKLDGLTV+QA+ +N++FIL+HHD +M
Sbjct  374   VIISLLQEFPPKSKLDPKVYGSQDSTITKEQIEDKLDGLTVDQALKANQLFILNHHDTLM  433

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  T  K+YA+RTLLFLQKDGTL+P+AIELSLPHP  DK G VS VY P+EQGV
Sbjct  434   PYVRRINT-TSTKLYASRTLLFLQKDGTLKPLAIELSLPHPDDDKLGAVSKVYLPSEQGV  492

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EG++WQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL PH+RD
Sbjct  493   EGALWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLQPHYRD  552

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM INAL RQ+L +A G++E +  PGK+AMEMSAV+Y+NWVFP  +LP DL+ RG+AV D
Sbjct  553   TMTINALARQILISAGGILESTVFPGKFAMEMSAVIYQNWVFPEQALPADLVKRGIAVED  612

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              ++PHG+RLLI DYP+AVDGLEIW AIK WV EYCN YYK D  +  D+ELQAWW E+ +
Sbjct  613   SNAPHGLRLLIPDYPFAVDGLEIWFAIKAWVEEYCNLYYKTDESIQKDSELQAWWKELRE  672

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KD+PWWP++ +R  LI++CTTIIW++SALHA+VNFGQY YAGY P RPTVSR+F
Sbjct  673   EGHGDLKDKPWWPKMQTREELIESCTTIIWVASALHASVNFGQYPYAGYLPNRPTVSRRF  732

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPGS +YEELKTNPDKA LKTITA  QTLLG+SLIEILSRHASDE+YLGQR+ PEWT 
Sbjct  733   MPEPGSPEYEELKTNPDKAFLKTITAQLQTLLGVSLIEILSRHASDEVYLGQRDTPEWTI  792

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAF++FG KL  IE RI++ N D K +NRTGPV +PYTLLFPTG+ GL+GKGIPN
Sbjct  793   DGNALEAFKKFGSKLAEIEGRIIQSNTDPKYRNRTGPVKLPYTLLFPTGDPGLTGKGIPN  852

Query  278   SISI  267
             S+SI
Sbjct  853   SVSI  856



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =  1156 bits (2991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/848 (67%), Positives = 682/848 (80%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KK+KG VV+MKKN LD TD+  S+VD + +F+GQKVS QLIS+ + DP     GK S
Sbjct  15    NDSKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHS  74

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
              PA+LE+W   +T L AGESAY VTF+W E  G+PGA I+KN H  EF+LK++TLED   
Sbjct  75    NPAYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPN  134

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G V FVC SWVYPA+KY  DR+FF+N+ YLPS+TPAPLR +RE EL  LRGDGTG+ + 
Sbjct  135   HGKVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLRKYRENELLTLRGDGTGKLEA  194

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY +YNDLGDPD G    RPILGG+ +YPYPRRGRTGR  T+TDP+ ESR+PLL 
Sbjct  195   WDRVYDYAFYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRPPTRTDPESESRIPLLL  254

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGHLK SDFL YALKS+ Q ++P + + FD+T NEFDSF+D+  LYEGG
Sbjct  255   SLDIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGG  314

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G L + +  +  LE+ KE+LR+DGE + KFPTP VI   KTAWRTDEEF REMLA
Sbjct  315   IKLPQGPLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLA  374

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I  LQ FPP+S LDP+VYG+  STIT +HI D+LDGLT+++AI SNR+FIL+HH
Sbjct  375   GVNPVIIRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDGLTIDEAIKSNRLFILNHH  434

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D IM Y RRINA T  K YA+RTLLF Q +G+L+P+AIELSLPHP GD+FG +S VYTPA
Sbjct  435   DTIMPYLRRINATT-TKTYASRTLLFFQDNGSLKPLAIELSLPHPDGDQFGAISKVYTPA  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
              +GVEGSIW+LAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLLHP
Sbjct  494   GEGVEGSIWELAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INA+ RQ+L NA GV+E +  P KYAMEMSAV+YKNW+FP+ +LP DL+ RGM
Sbjct  554   HFRDTMNINAMARQILINAGGVLESTVFPSKYAMEMSAVVYKNWIFPDQALPTDLVKRGM  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHG+RLLI+DYPYAVDGLEIW+AIK+WVTEYC+FYYK+D  +  D ELQAWW 
Sbjct  614   AVEDSSSPHGIRLLIQDYPYAVDGLEIWSAIKSWVTEYCSFYYKSDDSILKDNELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH D KDEPWWP++ +   LID+CT IIW SSALHAAVNFGQY YAGY P RPTV
Sbjct  674   ELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTSSALHAAVNFGQYPYAGYLPNRPTV  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+++YE LKTNPDKA L+TITA  QTLLG+SLIEILSRH SDEIYLGQR+ P
Sbjct  734   SRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHTSDEIYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             +WT D+  L AFERFG KL  IE RI++MNGD   +NR+GP+  PYTLLFPT E GL+GK
Sbjct  794   KWTNDEVPLAAFERFGNKLSDIENRIIEMNGDQIWRNRSGPIKAPYTLLFPTSEGGLTGK  853

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  854   GIPNSVSI  861



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =  1156 bits (2990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/846 (67%), Positives = 668/846 (79%), Gaps = 13/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GKRSKP  2607
             KKIKG VVLMKKN LD  D  AS++D++ +F+GQ+VS QL+SA N DP      GK  +P
Sbjct  22    KKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQRVSLQLVSAVNSDPSENDLKGKLGEP  81

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             A+LE+W   +TSL AGESA+ VTF+W E +GVPGA +++NNH +EFYLKT+TLED  G  
Sbjct  82    AYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQG  141

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              V FVC SW+YP  +YNYDRVFF+NQ YLP +TPAPLR +RE EL  LRGDG GE KEWD
Sbjct  142   RVHFVCNSWIYPTTRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEWD  201

Query  2252  RVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR   K+DP  ESR PLL   
Sbjct  202   RVYDYAYYNDLGDPDKGAKYARPVLGGSSEYPYPRRGRTGRAPAKSDPNTESRQPLLMSL  261

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
              IYVPRDE+FGHLK SDFL YALKS+ Q + P + +  D+T NEFDSFDD+  LYEGG  
Sbjct  262   NIYVPRDERFGHLKMSDFLAYALKSVAQFIRPELEALCDSTPNEFDSFDDVLDLYEGGFK  321

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L  G LLE++ KN  +E+ KE++ +DGE LF+FP PQVI  S +AWRTDEEF REML+GV
Sbjct  322   LPDGPLLENLTKNIPVEMLKEIIPTDGEGLFRFPKPQVIQESNSAWRTDEEFGREMLSGV  381

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RL+ FPP+S LD K+YGD  STIT EHI D LDGL++++AI  NR+FILDHHD 
Sbjct  382   NPVIIRRLEEFPPKSKLDSKLYGDQNSTITEEHIKDSLDGLSIDEAIEKNRMFILDHHDA  441

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPH  GD+FG +S VYTPAE 
Sbjct  442   LMPYLRRINTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHEEGDEFGAISKVYTPAEH  500

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGSIW LAKAY A NDSG HQLISH+LNTHAV EP +IATNRQLS LHPIYKLL PHF
Sbjct  501   GVEGSIWDLAKAYVAVNDSGYHQLISHFLNTHAVSEPFVIATNRQLSVLHPIYKLLEPHF  560

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ L NA G++E +  P KYAMEMS+V+Y+NW F   +LP DL  RG+AV
Sbjct  561   RDTMNINALARQTLINAGGILESTVYPAKYAMEMSSVIYRNWNFTEQALPEDLKKRGVAV  620

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D  SPHGVRLLIEDYPYAVDGLEIW+AIK WV +YC+FYYKND M+  D+ELQ+WW EV
Sbjct  621   EDPKSPHGVRLLIEDYPYAVDGLEIWSAIKEWVRDYCSFYYKNDEMIQKDSELQSWWKEV  680

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH D KD PWWP++++R  LID+CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  681   REEGHGDLKDAPWWPKMLTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  740

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE GS +YEELK+NPDKA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+  EW
Sbjct  741   RFMPEEGSPEYEELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTHEW  800

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T DK+ LEAFE+FGKKL  IE+++L MN  GK KNR GPV VPYTLL PT E GL+G+GI
Sbjct  801   TADKKPLEAFEKFGKKLAEIEDKMLDMNKAGKWKNRVGPVEVPYTLLVPTSEGGLTGRGI  860

Query  284   PNSISI  267
             PNS+S+
Sbjct  861   PNSVSL  866



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/843 (67%), Positives = 672/843 (80%), Gaps = 11/843 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRSKPAFLEDW  2589
             KKIKGRVVL+KKNFLD  D+ AS++D++ +  G+ VS QLIS+EN   GK  KPA+LEDW
Sbjct  112   KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISSENGLKGKLGKPAYLEDW  171

Query  2588  -GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVC  2415
                +TSL  GESA++VTF+  E +GVPGA+++KNNH +EF+LKT+TLE+  G   V FVC
Sbjct  172   ITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDRVHFVC  231

Query  2414  FSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGD---GTGERKEWDRVY  2244
              SWVYP +KY  DRVFF+N+ YLPS+TP PLR +RE EL +LRGD   G GE +EWDRVY
Sbjct  232   NSWVYPTEKYTKDRVFFTNKTYLPSETPLPLRKYREEELVHLRGDDEKGKGELQEWDRVY  291

Query  2243  DYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             DYD YNDLG+PD G    RPILGG+ EYPYPRRGRTGR+ TKTD K ESRLPL     IY
Sbjct  292   DYDCYNDLGNPDKGAKYVRPILGGSSEYPYPRRGRTGRQKTKTDEKSESRLPLAESLNIY  351

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSR  1896
             VPRDE+FGHLK SDFL YALKSI Q + P + S  D T NEFDSF+D+  LYEGG  L  
Sbjct  352   VPRDERFGHLKLSDFLVYALKSIAQFIKPELESLLDQTPNEFDSFEDVRKLYEGGIPLPE  411

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
             GLL +HI  +   E+ KE+ R+D   L KFP PQVI   K+AWRTDEEFAREMLAGVNPV
Sbjct  412   GLL-QHIGDSIPSEMFKEIFRTDDAKLLKFPMPQVIKEDKSAWRTDEEFAREMLAGVNPV  470

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I RLQ FPP S LDPKVYGD TSTIT EHI + LDGL+V++A+ +N++FILDHHD +M 
Sbjct  471   NIRRLQEFPPASKLDPKVYGDQTSTITEEHIKNNLDGLSVDEALKNNKLFILDHHDSLMP  530

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y RRIN+ T  KIY +RTLLFLQ DGTL+P+ IELSLPHP GD+FGC+SNVY+PAEQGVE
Sbjct  531   YLRRINS-TSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPNGDQFGCISNVYSPAEQGVE  589

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
             GSIWQLAKAY A NDSG HQLISHWLNTHA  EP++IATNRQLS +HPIYKLLHPHFRDT
Sbjct  590   GSIWQLAKAYVAVNDSGYHQLISHWLNTHAASEPVVIATNRQLSVVHPIYKLLHPHFRDT  649

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDL  996
             M+INA  RQ+L NA G++E +  P +YAME+S+V+YK+W F   +LP DLI RG+AV D 
Sbjct  650   MNINAFARQILINAGGILETTVFPARYAMELSSVVYKDWNFTEQALPADLIKRGVAVKDA  709

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
             +SPHG+RLLIEDYPYAVDG+EIW AI+TWV +YC+FYYK D ++  DTELQ+WW E+V++
Sbjct  710   NSPHGLRLLIEDYPYAVDGIEIWFAIRTWVADYCSFYYKTDDIIQKDTELQSWWKELVEE  769

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH DKKDEPWWP++ +   L++ CTTIIW +SALHAAVNFGQY YAGY P RPT+SRKFM
Sbjct  770   GHGDKKDEPWWPKMQTLEELVEICTTIIWTASALHAAVNFGQYPYAGYLPNRPTISRKFM  829

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             PE G+ +YEEL++NPDK  LKTITA  QTLLGISLIEILSRH++DE+YLGQR+ PEWT D
Sbjct  830   PEKGTPEYEELESNPDKVFLKTITAQLQTLLGISLIEILSRHSTDEVYLGQRDTPEWTVD  889

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNS  276
                LEAF++FGKKL  IE+RI  MN D KLKNR GPV VPYTLLFPT   GL+GKGIPNS
Sbjct  890   AAQLEAFDKFGKKLAEIEDRITSMNNDAKLKNRVGPVKVPYTLLFPTSGGGLTGKGIPNS  949

Query  275   ISI  267
             +SI
Sbjct  950   VSI  952



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/850 (68%), Positives = 677/850 (80%), Gaps = 12/850 (1%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
             H D  KK+KG VV+MKKN LD TD+  S+ DK+ + +GQKVS QLIS+   DP     GK
Sbjct  11    HHDSSKKVKGTVVMMKKNALDFTDLAGSLTDKLFEALGQKVSLQLISSVQGDPANGLQGK  70

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDG  2442
              S PA+LE++    T L AGESA+ VTF+W E  GVPGA  +KN+H NEF+LK+L LED 
Sbjct  71    HSNPAYLENFLFTPTRLTAGESAFGVTFDWNEEFGVPGAFTIKNSHINEFFLKSLILEDV  130

Query  2441  GAAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
                G V FVC SWVYP+ +Y  DR+FF+NQ YLPS+TP PLR +RE+ELK LRGDGTG+ 
Sbjct  131   PNHGKVHFVCNSWVYPSFRYKTDRIFFANQPYLPSETPEPLRKYRESELKTLRGDGTGKL  190

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             + W+RVYDYD YNDLG+PD G    R  LGG+ +YPYPRRGRT R  T+TDPK ESR+PL
Sbjct  191   EAWNRVYDYDVYNDLGNPDQGPEHVRTTLGGSADYPYPRRGRTSRPPTRTDPKSESRIPL  250

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L   +IYVPRDE+FGHLK SDFL YALKS+ Q ++P + + FD T NEFDSF+D+  LYE
Sbjct  251   LLSLDIYVPRDERFGHLKLSDFLTYALKSLVQFILPELHALFDGTPNEFDSFEDVLRLYE  310

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SK+AWRTDEEFAREM
Sbjct  311   GGIKLPQGPLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIKDSKSAWRTDEEFAREM  370

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV ISRLQ FPP+S LDP VYG+  STIT EHI DKLDGLT++QAI +N++FIL+
Sbjct  371   LAGVNPVIISRLQEFPPKSKLDPNVYGNQDSTITAEHIQDKLDGLTIDQAINNNKLFILN  430

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +  Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG +S VYT
Sbjct  431   HHDILTPYLRRINTTT-TKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVISKVYT  489

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P++QGVE SIWQLAKAYAA NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL
Sbjct  490   PSDQGVESSIWQLAKAYAAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLL  549

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             +PHFRDTM+INAL RQ+L NA GV+E +  P KYAMEMSAV+YK+WVFP+ +LP DLI R
Sbjct  550   YPHFRDTMNINALARQILINAGGVLESTVFPSKYAMEMSAVVYKDWVFPDQALPADLIKR  609

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D SSPHGVRLLI+DYPYAVDGLEIW+AIK+WVTEYCN YYK++  +  D ELQ W
Sbjct  610   GIAVEDSSSPHGVRLLIQDYPYAVDGLEIWSAIKSWVTEYCNVYYKSNEDILKDNELQEW  669

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ + GH DKKD PWWP + S   LI++CT IIWI+SALHAAVNFGQY YAGY P RP
Sbjct  670   WKELREVGHGDKKDAPWWPEMESPEDLIESCTIIIWIASALHAAVNFGQYPYAGYLPNRP  729

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +YEELKTNPDKA LKTITA  QTLLG+SLIEILSRH SDEIYLGQRE
Sbjct  730   TVSRRFMPEPGTPEYEELKTNPDKAFLKTITAQFQTLLGVSLIEILSRHTSDEIYLGQRE  789

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWTKDKE L AF+RFGKKL  IE  I++ NGD  LKNR+GPVN PYTLLFPT E GL+
Sbjct  790   SPEWTKDKEPLAAFDRFGKKLTEIENHIIQRNGDQILKNRSGPVNAPYTLLFPTSEGGLT  849

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  850   GKGIPNSVSI  859



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/845 (67%), Positives = 681/845 (81%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK+KG VV+MKKN LD TD+  S+ DKI + +GQKVSFQLIS+   DP     GK S PA
Sbjct  14    KKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNPA  73

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LE++   LT L AGE+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED    G 
Sbjct  74    YLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNHGK  133

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP+ +Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+ WDR
Sbjct  134   VHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAWDR  193

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDLG+PD G+   R  LGG+ +YPYPRRGRTGR  T+TDPK ESR+PL+   +
Sbjct  194   IYDYDVYNDLGNPDQGEQNVRTTLGGSADYPYPRRGRTGRPPTRTDPKSESRIPLILSLD  253

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEGG  L
Sbjct  254   IYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIKL  313

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
              +G L + +     LE+ KE+LR+DGE + +FPTP VI  SKTAWRTDEEFAREMLAGVN
Sbjct  314   PQGPLFKALTAAIPLEMMKELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVN  373

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             P+ ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+HHD +
Sbjct  374   PIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVL  433

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG +S VYTP++QG
Sbjct  434   IPYLRRINTTT-TKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVISKVYTPSDQG  492

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+PHFR
Sbjct  493   VESSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFR  552

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA+ RQ+L NA GV+E +  P K+AMEMSAV+YK+WVFP+ +LP DL+ RG+AV 
Sbjct  553   DTMNINAMARQILINAGGVLESTVFPSKFAMEMSAVVYKDWVFPDQALPADLVKRGVAVE  612

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW E+ 
Sbjct  613   DSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWWKELR  672

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPTVSR+
Sbjct  673   EVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPTVSRR  732

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SLIEILSRH +DEIYLGQRE PEWT
Sbjct  733   FMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHTTDEIYLGQRESPEWT  792

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KDKE L AF++FGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+GKGIP
Sbjct  793   KDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTGKGIP  852

Query  281   NSISI  267
             NS+SI
Sbjct  853   NSVSI  857



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =  1152 bits (2980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/847 (67%), Positives = 678/847 (80%), Gaps = 14/847 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKIKG+VVLMKKN LD  D G S++D++ + +GQKVS QLIS+ N DP     GK  + A
Sbjct  19    KKIKGKVVLMKKNVLDFNDFGGSVLDRVHELLGQKVSLQLISSINGDPENKLKGKLGRAA  78

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRES-LGVPGAVIVKNNHANEFYLKTLTLED--GGA  2436
             +LEDW    TSL  G+SA+ VTF+W E  +G+PGA I++N H  EFYLKTLTLED  G  
Sbjct  79    YLEDWITTFTSLTPGDSAFHVTFDWEEEEIGIPGAFIIQNFHHTEFYLKTLTLEDVPGHH  138

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               + FVC SWVYPA+KY  DRVFF+N+ YLPS+TP PL  +RE EL NLRG+G+G+ +EW
Sbjct  139   GPIHFVCNSWVYPAEKYKTDRVFFTNKTYLPSETPEPLVKYREEELVNLRGNGSGQLEEW  198

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ESR+PLL  
Sbjct  199   DRVYDYAYYNDLGDPDKGSDYARPVLGGSVEYPYPRRGRTGRPPTKTDPNSESRIPLLTS  258

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IY+PRDE+FGHLK SDFL YALKS+ Q ++P      D+  NEFDSF+D+  +YEGG 
Sbjct  259   LDIYIPRDERFGHLKMSDFLAYALKSVVQFLLPEFEDLCDSIHNEFDSFEDILQIYEGGF  318

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G LL++I +N   E+ K +LRSDGE LFKFP PQVI   K+AWRTDEEFAREMLAG
Sbjct  319   KLPEGPLLKNIFENIPFEMLKVLLRSDGEGLFKFPLPQVIKDDKSAWRTDEEFAREMLAG  378

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV ISRLQ FPP S LDP +YGD TSTI+  HI +KLDGLT+++AI +N++FIL+HHD
Sbjct  379   VNPVIISRLQEFPPTSKLDPNLYGDQTSTISGGHIENKLDGLTIDEAIRTNKLFILNHHD  438

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y +RIN+ T  K YA+RTLLFLQKDG+L+P+AIELSLPHP G +FG +S VY PAE
Sbjct  439   ALMPYLKRINSTT-TKTYASRTLLFLQKDGSLKPLAIELSLPHPDGYQFGAISKVYLPAE  497

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              G++ SIWQLAKAY A NDSGVHQLISHWLNTHA IEP +IATNRQLS L+PI+KLLHPH
Sbjct  498   HGIDSSIWQLAKAYVAINDSGVHQLISHWLNTHASIEPFVIATNRQLSVLYPIHKLLHPH  557

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INA+GRQ+L NA G++E +  P KY+MEMSAV+YK+WVF    LP DL+ RGMA
Sbjct  558   FRDTMNINAVGRQILINAGGILEATVFPAKYSMEMSAVIYKDWVFTEQGLPADLLKRGMA  617

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D +SPHG+RLLIEDYPYAVDGLEIW+AIKTWV +YCNFYY +DI+V  D ELQ+WWTE
Sbjct  618   VDDSNSPHGLRLLIEDYPYAVDGLEIWSAIKTWVQDYCNFYYTSDILVQKDAELQSWWTE  677

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             V +KGH DKK+EPWWP++ +R  L+D+CTTIIW++SALHAAVNFGQY YAGY P RPT+S
Sbjct  678   VREKGHGDKKNEPWWPKMQTRGELVDSCTTIIWMASALHAAVNFGQYPYAGYLPVRPTLS  737

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPEPG  +Y+ELKTNPDK  LKTITA  QTLLGISLIEILS H+SDE+YLGQR+  E
Sbjct  738   RRFMPEPGKPEYDELKTNPDKVFLKTITARLQTLLGISLIEILSSHSSDEVYLGQRDALE  797

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WTKD E LEAF+RFG KL  +EERI +MN D K +NR GPVNVPYTLL+PT EEGL+GKG
Sbjct  798   WTKDVEPLEAFDRFGTKLREVEERIKQMNNDKKWRNRVGPVNVPYTLLYPTSEEGLTGKG  857

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  858   IPNSVSI  864



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =  1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/848 (67%), Positives = 676/848 (80%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KK+KG VV+MKKN LD TD+  S+VD + +F+GQKVS QLIS+ + DP     GK S
Sbjct  15    NDSKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHS  74

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
              PA+LE W   +T L AGESAY VTF+W E  GVPGA I+KN H  EF+LK++TLED   
Sbjct  75    NPAYLEKWLTTITPLTAGESAYSVTFDWEEEFGVPGAFIIKNLHFTEFFLKSVTLEDVPN  134

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G V FVC SWVYPA KY  DR+FF N+ YLPS+TPAPLR +RE EL  LRG GTG+ + 
Sbjct  135   HGKVHFVCNSWVYPASKYKSDRIFFVNKTYLPSETPAPLRKYRENELLTLRGGGTGKLEA  194

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY +YNDLGDPD G    RPILGG+ +YPYPRRGRTGR  T+TDP+ ESR+PLL 
Sbjct  195   WDRVYDYAFYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRAPTRTDPESESRIPLLL  254

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGHLK SDFL YALKS+ Q ++P + + FD+T NEFDSF+D+  LYEGG
Sbjct  255   SLDIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGG  314

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G L + +     LE+ KE+LR+DGE + KFPTP VI   KTAWRTDEEF REMLA
Sbjct  315   IKLPQGPLFKALISAIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLA  374

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I  LQ FPP+S LDP+VYG+  STIT +HI D+LD LT+++AI +NR+FIL+HH
Sbjct  375   GVNPVIIRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDRLTIDEAIKTNRLFILNHH  434

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG +S VYTPA
Sbjct  435   DMVMPYLRRINTTT-TKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVISKVYTPA  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             +QGVEGSIW+LAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLLHP
Sbjct  494   DQGVEGSIWELAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INA+ RQ+L NA GV+E +  P KYAMEMSAV+YKNW+FP+ +LP DL+ RGM
Sbjct  554   HFRDTMNINAMARQILINAGGVLESTVFPSKYAMEMSAVVYKNWIFPDQALPTDLVKRGM  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHG+RLLI+DYPYAVDGLEIW+AIK+WVTEYCNFYYK+D  +  D ELQAWW 
Sbjct  614   AVEDSSSPHGIRLLIQDYPYAVDGLEIWSAIKSWVTEYCNFYYKSDDSIVKDNELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH D KDEPWWP++ +   LID+CT IIW +SALHAAVNFGQY YAGY P RPTV
Sbjct  674   ELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTV  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+++YE LKTNPDKA L+TITA  QTLLG+SLIEILSRH SDEIYLGQR+ P
Sbjct  734   SRRFMPEPGTSEYEVLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHTSDEIYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             +WT D+E L AFERFG KL  IE RI++MNGD   +NR GP+  PYTLLFPT + GL+ K
Sbjct  794   KWTNDEEPLAAFERFGNKLSDIENRIIEMNGDQIWRNRLGPIKAPYTLLFPTSQGGLTAK  853

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  854   GIPNSVSI  861



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =  1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/846 (67%), Positives = 668/846 (79%), Gaps = 13/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GKRSKP  2607
             KKIKG VVLMKKN LD  D  AS++D++ +F+GQ VS QL+SA N DP      GK  +P
Sbjct  3     KKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQGVSLQLVSAVNSDPSENDLKGKLGEP  62

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             A+LE+W   +TSL AGESA+ VTF+W E +GVPGA +++NNH +EFYLKT+TLED  G  
Sbjct  63    AYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQG  122

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              V FVC SW+YP  +YNYDRVFF+NQ YLP +TPAPLR +RE EL  LRGDG GE KEWD
Sbjct  123   RVHFVCNSWIYPTKRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEWD  182

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR+  K+DP  ESRLPLL   
Sbjct  183   RVYDYAYYNDLGDPDKGAKYVRPVLGGSSEYPYPRRGRTGREPAKSDPNTESRLPLLMSL  242

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
              IYVPRDE+FGHLK +DFL YALKS+ Q + P + +  D+T NEFDSF  +  LYEGG  
Sbjct  243   NIYVPRDERFGHLKLADFLAYALKSVAQFIKPELEALRDSTPNEFDSFAAVLDLYEGGFK  302

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L  G LLE+++KN  +E+ KE++R+DGE LF+FP PQVI  S +AWRTDEEF REML+GV
Sbjct  303   LPDGPLLENLKKNIPVEMLKEIIRTDGEGLFRFPKPQVIQESNSAWRTDEEFGREMLSGV  362

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RL+ FPP+S LD K+YGD  STIT EHI D LDGL++++AI  NR+FILDHHD 
Sbjct  363   NPVIIRRLEEFPPKSKLDSKLYGDQNSTITEEHIKDSLDGLSIDEAIEKNRMFILDHHDA  422

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPH  GD+FG +S VYTPAE 
Sbjct  423   LMPYLRRINTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHEEGDEFGAISKVYTPAEH  481

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGSIW LAKAY A NDSG HQLISH+LNTHAV EP +IATNRQLS LHPIYKLL PHF
Sbjct  482   GVEGSIWDLAKAYVAVNDSGYHQLISHFLNTHAVSEPFVIATNRQLSVLHPIYKLLEPHF  541

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ L NA G++E +  P KYAMEMS+V+YKNW F   +LP DL  RG+AV
Sbjct  542   RDTMNINALARQTLINAGGILESTVYPAKYAMEMSSVIYKNWNFTEQALPEDLKKRGVAV  601

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D  SPHGVRLLIEDYPYAVDGLEIW+AIK WV +YC FYYKND M+  D+ELQ+WW EV
Sbjct  602   EDPKSPHGVRLLIEDYPYAVDGLEIWSAIKEWVRDYCFFYYKNDEMIQKDSELQSWWKEV  661

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH D KD PWWP++++R  LID+CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  662   REEGHGDLKDAPWWPKMLTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  721

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE GS DY+ELK+NPDKA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+  EW
Sbjct  722   RFMPEEGSPDYKELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTHEW  781

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T DK+ LEAFE+FGKKL  IE+++L MN  GK KNR GPV VPYTLL PT E GL+G+GI
Sbjct  782   TADKKPLEAFEKFGKKLAEIEDKMLYMNKAGKWKNRVGPVEVPYTLLVPTSEGGLTGRGI  841

Query  284   PNSISI  267
             PNS+SI
Sbjct  842   PNSVSI  847



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =  1151 bits (2977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/846 (67%), Positives = 666/846 (79%), Gaps = 13/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GKRSKP  2607
             KKIKG VVLMKKN LD  D  AS++D++ + +G  VS QL+SA N DP      GK  +P
Sbjct  22    KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGHGVSLQLVSAVNSDPSENDLKGKLGEP  81

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             A+LE+W   +TSL AGESA+ VTF+W E +GVPGA +++NNH +EFYLKT+TLED  G  
Sbjct  82    AYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQG  141

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              V FVC SWVYP  +YNYDRVFF+NQ YLP +TPAPLR +RE EL  LRGDG GE KEWD
Sbjct  142   RVHFVCNSWVYPTKRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEWD  201

Query  2252  RVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  TK+DP  ESR PLL   
Sbjct  202   RVYDYAYYNDLGDPDKGAKYARPVLGGSSEYPYPRRGRTGRAPTKSDPNTESRQPLLMSL  261

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
             +IYVPRDE+FGHLK +DFL YALKS+ Q + P + +  D+T NEFDSFDD+  LYEGG  
Sbjct  262   DIYVPRDERFGHLKMADFLAYALKSVAQFIRPELEALCDSTPNEFDSFDDVLDLYEGGIK  321

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L  G LLE+++KN  +E+ KE++R+DGE LF+FP PQVI  S +AWRTDEEF REML+GV
Sbjct  322   LPDGPLLENLKKNIPVEMLKEIIRTDGEGLFRFPKPQVIQESNSAWRTDEEFGREMLSGV  381

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RL+ FPP+S LD K+YGD  STIT EHI D LDGL++++AI  NR+FILDHHD 
Sbjct  382   NPVIIRRLEEFPPKSKLDSKLYGDQNSTITEEHIKDSLDGLSIDEAIKKNRMFILDHHDA  441

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPH  GD+FG +S VYTPAE 
Sbjct  442   LMPYLRRINTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHEEGDEFGAISKVYTPAEH  500

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGSIW+LAKAY A NDSG HQLISH+LNTHAV EP +IATNRQLS LHPIYKLL PHF
Sbjct  501   GVEGSIWELAKAYVAVNDSGYHQLISHFLNTHAVSEPFVIATNRQLSVLHPIYKLLEPHF  560

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ L NA G++E +  P KYAMEMS+V+YKNW F   +LP DL  RG+AV
Sbjct  561   RDTMNINALARQTLINAGGILESTVYPAKYAMEMSSVIYKNWNFTEQALPEDLKKRGVAV  620

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D  SPHGVRLLIEDYPYAVDGLEIW+AIK WV +YC+FYYKND M+  D+ELQ+WW EV
Sbjct  621   EDPKSPHGVRLLIEDYPYAVDGLEIWSAIKEWVRDYCSFYYKNDEMIQKDSELQSWWKEV  680

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH D KD  WWP++ +R  LID+CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  681   REEGHGDLKDATWWPKMQTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  740

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE GS +YEELK+NPDK  LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+  EW
Sbjct  741   RFMPEEGSPEYEELKSNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTHEW  800

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T DK+ LEAFERFGKKL  IE+++  MN  GK KNR GPV VPYTLL PT E GL+G+GI
Sbjct  801   TADKKPLEAFERFGKKLAEIEDKMFDMNKAGKWKNRVGPVEVPYTLLVPTSEGGLTGRGI  860

Query  284   PNSISI  267
             PNS+SI
Sbjct  861   PNSVSI  866



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/848 (67%), Positives = 680/848 (80%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KK+KG VV+MKKN LD TD+  ++VD + +FVGQKVS QLIS+ + DP     GK S
Sbjct  15    NDSKKVKGIVVMMKKNALDFTDIAGAVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHS  74

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
              PA+LE+W   +T L AGESAY VTF+W E  G+PGA I+KN H  EF+LK++TLED   
Sbjct  75    NPAYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPN  134

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G V FVC SWVYPA+KY  DR+FF+N+ YLPS+TPAPL  +RE EL  LRGDGTG+ + 
Sbjct  135   HGTVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLLKYRENELLTLRGDGTGKLEA  194

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY  YNDLGDPD G    RPILGG+ +YPYPRRGRTGR  T+TDP+ ESR+PLL 
Sbjct  195   WDRVYDYALYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRAPTRTDPESESRIPLLL  254

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGHLK SDFL YALKS+ Q ++P + + FD+T NEFDSF+D+  LYEGG
Sbjct  255   SLDIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGG  314

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G L + +  +  LE+ KE+LR+DGE + KFPTP VI   KTAWRTDEEF REMLA
Sbjct  315   IKLPQGPLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLA  374

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I  LQ FPP+S LDP+VYG+  STIT +HI D+LDGLT+++AI SNR+FIL+HH
Sbjct  375   GVNPVIIRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDGLTIDEAIKSNRLFILNHH  434

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D IM Y RRIN  T  K YA+RTLLFLQ +G L+P+AIELSLPHP GD+FG +S VYTP 
Sbjct  435   DTIMPYLRRINTTT-TKTYASRTLLFLQDNGCLKPLAIELSLPHPDGDQFGAISKVYTPT  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             ++GVEGSIW+LAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLLHP
Sbjct  494   DEGVEGSIWELAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INA+ RQ+L NA GV+E +  P KYAMEMSAV+YKNW+FP+ +LP DL+ RGM
Sbjct  554   HFRDTMNINAMARQILINAGGVLESTVFPSKYAMEMSAVVYKNWIFPDQALPTDLVKRGM  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHG+RLLI+DYPYAVDGLEIW+AIK+WVTEYC+FYYK+D  +  D ELQAWW 
Sbjct  614   AVEDSSSPHGIRLLIQDYPYAVDGLEIWSAIKSWVTEYCSFYYKSDDSILKDNELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH D KDEPWWP++ +   LID+CT IIW +SALHAAVNFGQY YAGY P RPTV
Sbjct  674   ELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTV  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+++YE LKTNPDKA L+TITA  QTLLG+SLIEILSRH SDEIYLGQR+ P
Sbjct  734   SRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHTSDEIYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             +WT D+E L AF+RFG KL  IE RI++MNGD   +NR+GPV  PYTLLFPT E GL+GK
Sbjct  794   KWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQIWRNRSGPVKAPYTLLFPTSEGGLTGK  853

Query  290   GIPNSISI  267
             G+PNS+SI
Sbjct  854   GVPNSVSI  861



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =  1150 bits (2974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/845 (67%), Positives = 680/845 (80%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK+KG VV+MKKN LD TD+  S+ DKI + +GQKVSFQLIS+   DP     GK S PA
Sbjct  17    KKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNPA  76

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LE++   LT L AGE+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED    G 
Sbjct  77    YLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNHGK  136

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP+ +Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+ WDR
Sbjct  137   VHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAWDR  196

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDLG+PD GK   R  LGG+ +YPYPRRGRTGR  T+TDPK ESR+PL+   +
Sbjct  197   IYDYDVYNDLGNPDQGKENVRTTLGGSADYPYPRRGRTGRPPTRTDPKSESRIPLILSLD  256

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEGG  L
Sbjct  257   IYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIRL  316

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
              +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREMLAGVN
Sbjct  317   PQGPLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVN  376

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             P+ ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+HHD +
Sbjct  377   PIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVL  436

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP++QG
Sbjct  437   IPYLRRINTTT-TKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTPSDQG  495

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+PHFR
Sbjct  496   VESSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFR  555

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA+ RQ+L NA GV+E +  P K+AMEMSAV+YK+WVFP+ +LP DL+ RG+AV 
Sbjct  556   DTMNINAMARQILINAGGVLESTVFPSKFAMEMSAVVYKDWVFPDQALPADLVKRGVAVE  615

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW E+ 
Sbjct  616   DSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWWKELR  675

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPTVSR+
Sbjct  676   EVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPTVSRR  735

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SLIEILSRH +DEIYLGQRE PEWT
Sbjct  736   FMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHTTDEIYLGQRESPEWT  795

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KDKE L AF++FGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+GKGIP
Sbjct  796   KDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILINRSGPVNAPYTLLFPTSEGGLTGKGIP  855

Query  281   NSISI  267
             NS+SI
Sbjct  856   NSVSI  860



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/845 (67%), Positives = 668/845 (79%), Gaps = 14/845 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA------ENDDPGKRSKPA  2604
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA      EN   GK  KPA
Sbjct  20    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVRADDSENGLKGKLGKPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW   +T L AGESA+ VTF++ E +GVPGA ++KNNH +EF+LKT+TLE+  G   
Sbjct  80    YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGH  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP +KY  DRVFF N+ YLPS+TP PL+ +RE EL +LRGDG GE +EW+R
Sbjct  140   VHFVCNSWVYPTEKYTKDRVFFVNKTYLPSETPLPLQKYREEELVHLRGDGKGELQEWER  199

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG PD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ES LPL+   +
Sbjct  200   VYDYAYYNDLGKPDKGAKYVRPVLGGSSEYPYPRRGRTGRPPTKTDPNSESSLPLIQSLD  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q + P + S FD T +EFDSF+D+  LYEGG  L
Sbjct  260   IYVPRDERFGHLKLSDFLIYALKSIAQFIKPELESLFDQTPSEFDSFEDVLKLYEGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L KFPTPQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLKFPTPQVIKEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I+RLQVFPP S LDPKVYGD  STIT EHI + LDGLTV++A+  N++FILDHHD +
Sbjct  379   PVNIARLQVFPPASKLDPKVYGDQNSTITEEHIKNNLDGLTVDEALKKNKLFILDHHDSL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIY +RTLLFLQ DGTL+P+ IELSLPHP GD+FGC+SNVYTPAEQG
Sbjct  439   MPYLRRINS-TSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPDGDQFGCISNVYTPAEQG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVSEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L NA G++E +  P +YAME+S+V+YK+W F   +LP DLI RG+AV 
Sbjct  558   DTMNINAFARQILINAGGILETTVFPARYAMELSSVVYKDWNFTEQALPADLIKRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+ LLIEDYPYAVDG+EIW AI+TWV +YC+FYYK D ++  D ELQ+WW E+V
Sbjct  618   DKNSPHGLHLLIEDYPYAVDGIEIWFAIRTWVADYCSFYYKTDDIIQKDAELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +   L++ CTTIIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKLQTLEELVEICTTIIWTASALHAAVNFGQYPYAGYLPNRPTISRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMP  G+A+YEELK+NPDK  LKTITA  QTLLGISLIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPVKGTAEYEELKSNPDKVFLKTITAQLQTLLGISLIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D   LEAF++FGKKL  IEERI  MN D KLKNR GPV VPYTLLFPT   GL+GKGIP
Sbjct  798   ADAAPLEAFDKFGKKLEEIEERITSMNNDEKLKNRVGPVKVPYTLLFPTSGGGLTGKGIP  857

Query  281   NSISI  267
             NS+SI
Sbjct  858   NSVSI  862



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =  1149 bits (2971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/848 (67%), Positives = 671/848 (79%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KKIKG VVLMKKN LD  D  AS++D++ + +GQ VS QL+SA + DP     GK  
Sbjct  13    NDKKKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLG  72

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA+LEDW   +TSL AGESA+ VTF+W E +G PGA I++NNH +EFYL+TLTLED  G
Sbjct  73    KPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPG  132

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWVYPA  Y  DRVFF+NQ YLPS+TP PLR +R+ EL NLRGDGTGE KE
Sbjct  133   RGRIHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKE  192

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG PD      RP+LGG+ EYPYPRRGRTGR  ++ DPK ESRLPL+ 
Sbjct  193   WDRVYDYAYYNDLGKPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPKTESRLPLVM  252

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK SDFL YALKSI Q ++P   +  D T NEFDSF D+  LYEGG
Sbjct  253   SLNIYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGG  312

Query  1904  LS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             +    G LL+ I+ N  LE+ KE++R+DGE+LFKFP PQVI   K+AWRTDEEFAREMLA
Sbjct  313   IKVPEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLA  372

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP+S LDP+VYG+  S+IT+EHI + LD LT+ +A+   R+FILDHH
Sbjct  373   GLNPVVIRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHH  432

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GDKFG V+ VYTPA
Sbjct  433   DVFMPYLRRINT-TSTKTYASRTLLFLKDDGTLKPLAIELSLPHPNGDKFGAVNKVYTPA  491

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEGSIWQLAKAYAA NDSG HQL+SHWLNTHA IEP +IATNRQLS LHPI+KLLHP
Sbjct  492   EDGVEGSIWQLAKAYAAVNDSGYHQLLSHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHP  551

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA GV+E +  P KYAMEMS+V+YK+WV    +LP DLI RGM
Sbjct  552   HFRDTMNINALARQILINAGGVVESTVFPSKYAMEMSSVVYKDWVLTEQALPADLIKRGM  611

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHG+RLLI+DYPYAVDGLEIW+AI+TWV EYC+FYYK D MV  D+ELQ+WW 
Sbjct  612   AVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQSWWK  671

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKKDEPWWP++ +   LI+TCT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  672   EVREEGHGDKKDEPWWPKMRTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  731

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+F+PE G+ +YEELK+NPDKA LKTITA  QTLLGISLIE+LSRH+SDE+YLGQR+ P
Sbjct  732   SRRFIPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVYLGQRDTP  791

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D   L+AFE+FG+KL  IEE I++ NGD + KNR GP+ +PYTLL+PT E GL+GK
Sbjct  792   EWTLDTTPLKAFEKFGRKLADIEEMIIERNGDERFKNRVGPLKIPYTLLYPTSEGGLTGK  851

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  852   GIPNSVSI  859



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =  1148 bits (2969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/845 (67%), Positives = 679/845 (80%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK+KG VV+MKKN LD TD+  S+ DKI + +GQKVSFQLIS+   DP     GK S PA
Sbjct  17    KKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPANGLQGKHSNPA  76

Query  2603  FLEDWG-KLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LE++   LT L AGE+A+ VTF+W E  GVPGA ++KN H NEF+LK+LTLED    G 
Sbjct  77    YLENFLLTLTPLAAGETAFGVTFDWNEEFGVPGAFVIKNMHINEFFLKSLTLEDVPNHGK  136

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP+ +Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+ WDR
Sbjct  137   VHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELVTLRGDGTGKREAWDR  196

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDLG+PD GK   R  LGG+ +YPYPRRGRTGR  T+TDPK ESR+PL+   +
Sbjct  197   IYDYDVYNDLGNPDQGKENVRTTLGGSADYPYPRRGRTGRPPTRTDPKSESRIPLILSLD  256

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEGG  L
Sbjct  257   IYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIKL  316

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
              +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREMLAGVN
Sbjct  317   PQGPLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVN  376

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRL+ FPP+S LDP++YG+  STIT EHI  KLDGLT+++AI SN++FIL+HHD +
Sbjct  377   PVIISRLEEFPPKSKLDPELYGNQNSTITAEHIEGKLDGLTIDEAINSNKLFILNHHDVL  436

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP++QG
Sbjct  437   IPYLRRINTTT-TKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTPSDQG  495

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+PHFR
Sbjct  496   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFR  555

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA GV+E +  P K+AMEMSAV+YK+WVFP+ +LP DL+ RG+AV 
Sbjct  556   DTMNINALARQILINAGGVLESTVFPSKFAMEMSAVVYKDWVFPDQALPADLVKRGVAVE  615

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPHGVRLLI+DYPYAVDGLEIW+AIK+WVT+YC+FYY ++  +  D ELQAWW EV 
Sbjct  616   DSSSPHGVRLLIDDYPYAVDGLEIWSAIKSWVTDYCSFYYGSNEEILKDNELQAWWKEVR  675

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKK+EPWW  + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPTVSRK
Sbjct  676   EVGHGDKKNEPWWAEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPTVSRK  735

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SLIEILSRH +DEIYLGQRE PEWT
Sbjct  736   FMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHTTDEIYLGQRESPEWT  795

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KDKE L AFERFG KL  IE++I++ NG+  L NRTGPVN PYTLLFPT E GL+GKGIP
Sbjct  796   KDKEPLAAFERFGNKLTDIEKQIMQRNGNNILTNRTGPVNAPYTLLFPTSEGGLTGKGIP  855

Query  281   NSISI  267
             NS+SI
Sbjct  856   NSVSI  860



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =  1148 bits (2969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/848 (67%), Positives = 679/848 (80%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KK+KG VV+MKKN LD TD+  S+VD + +FVGQKVS QLIS+ + DP     GK S
Sbjct  15    NDSKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHS  74

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
               A+LE+W   +T L AGESAY VTF+W E  G+PGA I+KN H  EF+LK++TLED   
Sbjct  75    NLAYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPN  134

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G V FVC SWVYPA+KY  DR+FF+N+ YLPS+TPAPL  +RE EL  LRGDGTG+ + 
Sbjct  135   HGTVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLLKYRENELLTLRGDGTGKLEA  194

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY  YNDLGDPD G    RPILGG+ +YPYPRRGRTGR  T+TDP+ ESR+PLL 
Sbjct  195   WDRVYDYALYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRAPTRTDPESESRIPLLL  254

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGHLK SDFL YALKS+ Q ++P + + FD+T NEFDSF+D+  LYEGG
Sbjct  255   SLDIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGG  314

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L +G L + +  +  LE+ KE+LR+DGE + KFPTP VI   KTAWRTDEEF REMLA
Sbjct  315   IKLPQGPLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLA  374

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I  LQ FPP+S LDP+VYG+  STIT +HI D+LDGLT+++AI SNR+FIL+HH
Sbjct  375   GVNPVIIRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDGLTIDEAIKSNRLFILNHH  434

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D IM Y RRIN  T  K YA+RTLLFLQ +G L+P+AIELSLPHP GD+FG +S VYTP 
Sbjct  435   DTIMPYLRRINTTT-TKTYASRTLLFLQDNGCLKPLAIELSLPHPDGDQFGAISKVYTPT  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             ++GVEGSIW+LAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLLHP
Sbjct  494   DEGVEGSIWELAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INA+ RQ+L NA GV+E +  P KYAMEMSAV+YKNW+FP+ +LP DL+ RGM
Sbjct  554   HFRDTMNINAMARQILINAGGVLESTVFPSKYAMEMSAVVYKNWIFPDQALPTDLVKRGM  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHG+RLLI+DYPYAVDGLEIW+AIK+WVTEYC+FYYK+D  +  D ELQAWW 
Sbjct  614   AVEDSSSPHGIRLLIQDYPYAVDGLEIWSAIKSWVTEYCSFYYKSDDSILKDNELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH D KDEPWWP++ +   LID+CT IIW +SALHAAVNFGQY YAGY P RPTV
Sbjct  674   ELREEGHGDLKDEPWWPKMENCQELIDSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTV  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+++YE LKTNPDKA L+TITA  QTLLG+SLIEILSRH SDEIYLGQR+ P
Sbjct  734   SRRFMPEPGTSEYELLKTNPDKAFLRTITAQLQTLLGVSLIEILSRHTSDEIYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             +WT D+E L AF+RFG KL  IE RI++MNGD   +NR+GPV  PYTLLFPT E GL+GK
Sbjct  794   KWTYDEEPLAAFDRFGNKLSDIENRIIEMNGDQIWRNRSGPVKAPYTLLFPTSEGGLTGK  853

Query  290   GIPNSISI  267
             G+PNS+SI
Sbjct  854   GVPNSVSI  861



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Fragaria 
vesca subsp. vesca]
Length=863

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/845 (66%), Positives = 669/845 (79%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             K+I G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA N D      GK  KPA
Sbjct  20    KQITGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVNADSDNGLKGKLGKPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW   +T L AG+SAY VTF+W + +GVPGA+++KNNH ++FYLKT+TLE+  G   
Sbjct  80    YLEDWISTITPLTAGDSAYKVTFDWDDEIGVPGAILIKNNHHSQFYLKTITLENVPGEGT  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+K   DR+FF N+ YL S TP PL+ +R+ EL +LRGDG GE +E+DR
Sbjct  140   VHFVCNSWVYPAEKNTKDRIFFVNKTYLLSDTPLPLQQYRKEELVHLRGDGKGELQEYDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    R  LGG  EYPYPRRGRTGR  T++DP  ESR+PLL   +
Sbjct  200   VYDYAYYNDLGNPDKGSDYARQTLGGTSEYPYPRRGRTGRAPTESDPSSESRIPLLMSLD  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS-  1899
             IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDSF+D+  LYEGG+  
Sbjct  260   IYVPRDERFGHLKMSDFLAYALKSIAQFIRPELEALFDPTPNEFDSFEDVLKLYEGGIEV  319

Query  1898  -RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G L + I  N  LE+ KE+ R+DG    KFPTPQVI  ++ AWRTDEEFAREMLAGVN
Sbjct  320   PEGFL-KDIGDNIPLEMIKEIFRTDGAQFLKFPTPQVIKENRLAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP STLD  VYGD +STIT EHI + LDGLTVE+A+ SN++FILDHHD +
Sbjct  379   PVNISLLQAFPPVSTLDQNVYGDQSSTITEEHIKNNLDGLTVEKALKSNKLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+NT  KIYA+RTLLFL+ DGTL+P+ IELSLPHP GD+ G +S+V+TPAE+G
Sbjct  439   MPYVRRINSNTSSKIYASRTLLFLKSDGTLKPLVIELSLPHPDGDEHGRISSVFTPAEEG  498

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A NDSGVHQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  499   VESSIWQLAKAYVAVNDSGVHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  558

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA G++E +  PG+YAMEMS+V+YK WVFP  +LP DLI RGMAV 
Sbjct  559   DTMNINALARQILINAGGILETTVFPGRYAMEMSSVVYKKWVFPEQALPADLIKRGMAVK  618

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D S+PHG+RL+IEDYPY  DGLEIW AI+ WV +YC+FYYK+D +V  DTELQ+WW E+V
Sbjct  619   DESAPHGLRLVIEDYPYGADGLEIWFAIRNWVEDYCSFYYKSDNIVQKDTELQSWWKELV  678

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  LI+ CT IIW SSALHAAVNFGQY YAGY PCRPTVSR+
Sbjct  679   EEGHGDKKDEPWWPKMQTREELIEACTIIIWTSSALHAAVNFGQYPYAGYLPCRPTVSRR  738

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL++NPDKA LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ P WT
Sbjct  739   FMPEKGTPEYDELESNPDKAFLKTITAQFQTVLGIALIEILSRHSTDEVYLGQRDTPNWT  798

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D EAL+AF RFGKKL  IEE+I  MN D  LKNR G V VPYTLL+PTGE G++GKGIP
Sbjct  799   ADAEALQAFNRFGKKLAEIEEKITNMNNDENLKNRVGKVEVPYTLLYPTGESGIAGKGIP  858

Query  281   NSISI  267
             NS+SI
Sbjct  859   NSVSI  863



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =  1147 bits (2966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/848 (66%), Positives = 671/848 (79%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KKIKG VVLMKKN LD  D  AS++D++ + +GQ VS QL+SA + DP     GK  
Sbjct  13    NDKKKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLG  72

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA+LEDW   +TSL AGESA+ VTF+W E +G PGA I++NNH +EFYL+TLTLED  G
Sbjct  73    KPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPG  132

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWVYPA  Y  DRVFF+NQ YLPS+TP PLR +R+ EL NLRGDGTGE KE
Sbjct  133   CGRIHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKE  192

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG+PD      RP+LGG+ EYPYPRRGRTGR  ++ DPK ESRLPL+ 
Sbjct  193   WDRVYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPKTESRLPLVM  252

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK SDFL YALKSI Q ++P   +  D T NEFDSF D+  LYEGG
Sbjct  253   SLNIYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGG  312

Query  1904  LS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             +    G LL+ I+ N  LE+ KE++R+DGE+LFKFP PQVI   K+AWRTDEEFAREMLA
Sbjct  313   IKVPEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLA  372

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP+S LDP+VYG+  S+IT+EHI + LD LT+ +A+   R+FILDHH
Sbjct  373   GLNPVVIRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHH  432

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GDKFG V+ VYTPA
Sbjct  433   DVFMPYLRRINT-TSTKTYASRTLLFLKDDGTLKPLAIELSLPHPSGDKFGAVNKVYTPA  491

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEGSIWQLAKAYAA NDSG HQL+SHWLNTHA IEP +IATNRQLS LHPI+KLLHP
Sbjct  492   EDGVEGSIWQLAKAYAAVNDSGYHQLLSHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHP  551

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA GV+E +  P K+AMEMS+V+YK+WV    +LP DLI RGM
Sbjct  552   HFRDTMNINALARQILINAGGVVESTVFPSKHAMEMSSVVYKDWVLTEQALPADLIKRGM  611

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHG+RLLI+DYPYAVDGLEIW+AI+TWV EYC+FYYK D MV  D+ELQ+WW 
Sbjct  612   AVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQSWWK  671

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKK+EPWWP++ +   LI+TCT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  672   EVREEGHGDKKNEPWWPKMRTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  731

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPE G+ +YEELK+NPDKA LKTITA  QTLLGISLIE+LSRH+SDE+YLGQR+ P
Sbjct  732   SRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVYLGQRDTP  791

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D   L+AFE+FG+KL  IEE I+  NG+ + KNR GPV +PYTLL+PT E GL+GK
Sbjct  792   EWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGLTGK  851

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  852   GIPNSVSI  859



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/848 (67%), Positives = 680/848 (80%), Gaps = 14/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-NDDP-----GKRSKP  2607
             K +KGR++LMKK FLD TD+ AS+ D++ DF+G+KVS QLIS   +DDP     GKRS P
Sbjct  17    KNVKGRIILMKKIFLDFTDINASVGDEVVDFLGEKVSIQLISGSIHDDPENGVEGKRSNP  76

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
             A+LEDW   +T ++AGES + VTF+W  +  GVPGA I+ N H NEF+LK+LTLED    
Sbjct  77    AYLEDWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIINNFHLNEFFLKSLTLEDVPNR  136

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL  LRGDGTG+ +EW
Sbjct  137   GNIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPEPLRKYRENELVTLRGDGTGKLEEW  196

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLGDPD G+   RPILGG+ EYPYPRRGRTGRK TKTDP  E+R+PLL  
Sbjct  197   DRVYDYAYYNDLGDPDKGEEYARPILGGSSEYPYPRRGRTGRKPTKTDPNSENRIPLLMS  256

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGHLK SDFL ++LK   Q + P   + FD T NEFDSF+D+  LYEGG 
Sbjct  257   LDIYVPRDERFGHLKMSDFLTFSLKFTVQSLFPAFKALFDNTPNEFDSFEDVLELYEGGI  316

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L +G LL+ +  +  LEI K+V  SDGE LFKFPTPQVI   KTAWRTDEEF REMLAG
Sbjct  317   KLPQGPLLKALIDSIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRTDEEFGREMLAG  376

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV ISRLQ FPP+S LDPK+YG+  STITRE I DKLDGLTV++AI +N +FIL+HHD
Sbjct  377   INPVLISRLQEFPPKSNLDPKIYGNQNSTITREQIGDKLDGLTVDEAIKANMLFILNHHD  436

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y RRINA T+ K YA+RTLLFLQ +GTL+P+AIELSLPHP GD+FG VS VYTP++
Sbjct  437   IVMPYLRRINATTNTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGDQFGTVSKVYTPSD  496

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             QGVE SIWQLAKAYA  NDSG+H+L+SHWLNTHAVIEP +IATNRQLS LHPI+KLL PH
Sbjct  497   QGVESSIWQLAKAYAVVNDSGIHELVSHWLNTHAVIEPFVIATNRQLSVLHPIHKLLLPH  556

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INAL RQLL N+DGVIEL+  P KY+MEMSAV+YK+W+FP  +LP DLI RG+A
Sbjct  557   FRDTMNINALARQLLINSDGVIELTFFPSKYSMEMSAVVYKDWIFPEQALPADLIKRGVA  616

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V DL+SPHG+ LLI+DYPYAVDGL++W+AIK+WVTEYCNFYYK+D  V  D+ELQAWW E
Sbjct  617   VEDLNSPHGIHLLIQDYPYAVDGLKVWSAIKSWVTEYCNFYYKSDDTVQKDSELQAWWKE  676

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDEPWWP++ +R  LI++CT  IWI+SALHAAVNFGQY YAGY   RP++S
Sbjct  677   LREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPYAGYLVNRPSLS  736

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R FMPEPGS +YEELK NPDK  LKT     QTLL IS++E+LS HASD +YLGQR+ PE
Sbjct  737   RMFMPEPGSPEYEELKKNPDKVFLKTTVPPLQTLLEISVLEVLSTHASDTLYLGQRDSPE  796

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGD-GKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             WTKD+E + AFER GKKL  IE++I++MN D  K KNR+GP  VPYTLLFPT EEGL+GK
Sbjct  797   WTKDQEPILAFERVGKKLSDIEDQIMQMNSDHQKWKNRSGPAKVPYTLLFPTSEEGLTGK  856

Query  290   GIPNSISI  267
             GIPNSI+I
Sbjct  857   GIPNSINI  864



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =  1145 bits (2961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/848 (66%), Positives = 668/848 (79%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KKI+G +VLMKKN LD  D  A + D++ +  GQ VS QL+SA + DP     GK  
Sbjct  54    NDKKKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIG  113

Query  2612  KPAFLEDWG-KLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA+LEDW   +TSL AGESA+ VTF+W E +G PGA I++NNH +EFYL+TLTLED  G
Sbjct  114   KPAYLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPG  173

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWVYPA  Y  DRVFF+NQ YLPS+TP PLR +RE EL NLRGDGTG+ KE
Sbjct  174   RGRIHFVCNSWVYPAQHYKTDRVFFTNQTYLPSETPGPLRKYREGELVNLRGDGTGKLKE  233

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG+PD      RP+LGG+ EYPYPRRGRTGR  ++ DP  ESRLPL+ 
Sbjct  234   WDRVYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPNTESRLPLVM  293

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                +YVPRDE+FGHLK SDFL YALKSI Q ++P   +  D T NEFDSF D+  LYEGG
Sbjct  294   SLNMYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITHNEFDSFQDVLDLYEGG  353

Query  1904  LS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             +    G LL+ I+ N  LE+ KE++R+DGE+LFKFP PQVI   K+AWRTDEEFAREMLA
Sbjct  354   IKVPEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLA  413

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP+S LDP++YG+  S+IT+EHI + LD LT+ +A+   R+FILDHH
Sbjct  414   GLNPVVIRLLQEFPPKSKLDPEIYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHH  473

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GDKFG V+ VYTPA
Sbjct  474   DVFMQYLRRINT-TSTKTYASRTLLFLKDDGTLKPLAIELSLPHPSGDKFGAVNKVYTPA  532

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEGSIWQLAKAYAA NDSG HQL+SHWLNTHA IEP +IATNRQLS LHPI+KLLHP
Sbjct  533   ENGVEGSIWQLAKAYAAVNDSGYHQLLSHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHP  592

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA GV+E +  P KYAMEMS+V+YK+WV    +LP DLI RGM
Sbjct  593   HFRDTMNINALARQILINAGGVVESTVFPSKYAMEMSSVVYKDWVLTEQALPADLIKRGM  652

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHG+RLLI+DYPYAVDGLEIW+AI+TWV EYC+FYYK D MV  D+ELQ+WW 
Sbjct  653   AVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQSWWK  712

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKKDEPWWP++ +   LI+TCT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  713   EVREEGHGDKKDEPWWPKMHTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  772

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPE G+ +YEELK+NPDKA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+ P
Sbjct  773   SRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTP  832

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D   L+AFE+FG+KL  IEERI+  NG+ + KNR GPV +PYTLL+PT E GL+GK
Sbjct  833   EWTLDTTPLKAFEKFGRKLADIEERIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGLTGK  892

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  893   GIPNSVSI  900



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =  1144 bits (2958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/845 (66%), Positives = 670/845 (79%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKIKG VVLMKKN LD TD  ASI D++ + +G+KVS QL+S+ N DP     GK   PA
Sbjct  14    KKIKGTVVLMKKNVLDFTDFNASIADEVHELLGKKVSLQLVSSVNGDPEKGQQGKLGSPA  73

Query  2603  FLEDWGKLT-SLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LE W      L  GES +++TF+W E + VPGA I+KN+H +EF+LKT+TLED  G   
Sbjct  74    YLEGWITTNHRLTVGESVFNITFDWEEEVEVPGAFIIKNHHHSEFFLKTVTLEDVPGHGR  133

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA KYN +R+FFSNQAYLPS TP PLR +RE EL  LRGDGTGE +EWDR
Sbjct  134   IHFVCNSWVYPAKKYNQNRIFFSNQAYLPSDTPEPLRRYREEELLTLRGDGTGELQEWDR  193

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDL DPD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ESRLP+L    
Sbjct  194   VYDYAYYNDLADPDKGSDYERPVLGGSTEYPYPRRGRTGRPPTKTDPNAESRLPILSSLN  253

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL +ALKSI Q+++P   +  D T +EFDS +D   LYEGG  L
Sbjct  254   IYVPRDERFGHLKMSDFLAFALKSIVQLLVPEFEALCDRTPDEFDSIEDTLKLYEGGIKL  313

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G LL++I  N  LE+ K++L+SDGE   K+PTPQVI   K+AWRTDEEF REMLAGVN
Sbjct  314   PDGPLLKNIVDNIPLELLKQLLQSDGEEFLKYPTPQVIKDDKSAWRTDEEFTREMLAGVN  373

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRLQ FPPRS L+  VYG+  STITR+ I  +LDGLT+++A+  N +FILDHHD I
Sbjct  374   PVIISRLQEFPPRSKLNSAVYGNQNSTITRQQIEQRLDGLTIDEALKMNSLFILDHHDAI  433

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN  T  K YATRTLLFLQKDGTL+P+AIELSLPHP GD+FG +S VYTPAE G
Sbjct  434   MPYLRRINT-TSTKTYATRTLLFLQKDGTLKPLAIELSLPHPNGDEFGAISKVYTPAELG  492

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             V+GS+WQLAKAY A  DSG+HQLISHWLNTHA IEP +IATNRQLS +HPI+KLLHPHFR
Sbjct  493   VDGSLWQLAKAYVAVIDSGIHQLISHWLNTHATIEPFVIATNRQLSVVHPIHKLLHPHFR  552

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L NA G++E++  P KYAMEMS+V+YK+W+FP  +LP DLI R MAV 
Sbjct  553   DTMNINAFARQILINAGGIVEITVFPAKYAMEMSSVVYKDWIFPEQALPADLIKRKMAVE  612

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SP+G+RLLIEDYP+AVDGL+IW+AIKTWVT+YC+FYYK+D MV  DTELQ+WW EV 
Sbjct  613   DSTSPYGLRLLIEDYPFAVDGLKIWSAIKTWVTDYCSFYYKSDQMVQEDTELQSWWKEVR  672

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             +KGH DKKDEPWWPR+ +   LID+CT IIW+SSALHA+ NFGQ+ YAGY P RPT+SR+
Sbjct  673   EKGHADKKDEPWWPRMKTLTELIDSCTIIIWVSSALHASTNFGQWPYAGYAPNRPTISRR  732

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +YEELK+NPDKA LKTIT   QTLLG+S IEILSRH +DE+YLGQRE+P+WT
Sbjct  733   FMPEPGTPEYEELKSNPDKAFLKTITPQFQTLLGLSTIEILSRHTTDEVYLGQRENPQWT  792

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KD E LEAF+RFG+ L  IE++IL+MNGD K +NR GP N+PYTLLFPT + G++G+GIP
Sbjct  793   KDTEPLEAFKRFGQTLSEIEDQILQMNGDPKWRNRVGPANIPYTLLFPTSDSGITGRGIP  852

Query  281   NSISI  267
             NSI+I
Sbjct  853   NSIAI  857



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =  1144 bits (2958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/845 (67%), Positives = 666/845 (79%), Gaps = 14/845 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA------ENDDPGKRSKPA  2604
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA      EN   GK  +PA
Sbjct  20    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHADDSENGLKGKLGQPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW   +T L AGESA+ VTF++ E +GVPGA ++KNNH +EF+LKT+TLE+  G   
Sbjct  80    YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP +KY  DRVFF N+ YLPS+TP PLR + E EL +LRGDG GE +EW+R
Sbjct  140   VHFVCNSWVYPTEKYTKDRVFFVNKTYLPSETPLPLRKYIEEELVHLRGDGKGELQEWER  199

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGR  TKTDP  ES LPL+    
Sbjct  200   VYDYAYYNDLGKPDKGAKYVRPILGGSSEYPYPRRGRTGRPPTKTDPNSESSLPLIQSLN  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q + P + S FD T +EFDSF+D+  LYEGG  L
Sbjct  260   IYVPRDERFGHLKLSDFLIYALKSIAQFIKPELESLFDQTPSEFDSFEDVFKLYEGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L KFPTPQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLKFPTPQVIKEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I+RLQ FPP S LDPKVYGD  STIT EHI + LDGLTV++A+  N++FILDHHD +
Sbjct  379   PVNIARLQEFPPASKLDPKVYGDQNSTITEEHIKNNLDGLTVDEALKENKLFILDHHDSL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIY +RTLLFLQ DGTL+P+ IELSLPHP GD+FGC+SNVYTPAEQG
Sbjct  439   MPYLRRINS-TSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPDGDQFGCISNVYTPAEQG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVSEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L NA G++E +  P +YAME+S+V+YK+W F   +LP DLI RG+AV 
Sbjct  558   DTMNINAFARQILINAGGILETTVFPARYAMELSSVVYKDWNFTEQALPADLIKRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDG+EIW AI+TWV +YC+FYYK D ++  D ELQ+WW E+V
Sbjct  618   DKNSPHGLRLLIEDYPYAVDGIEIWFAIRTWVADYCSFYYKTDDIIQKDAELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +  +L++ CTTIIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKLQTLEVLVEICTTIIWTASALHAAVNFGQYPYAGYLPNRPTISRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMP  G+A+YEELK+NPDK  LKTITA  QTLLGISLIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPVKGTAEYEELKSNPDKVFLKTITAQLQTLLGISLIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D   LEAF++FGKKL  IEERI  MN   KLKNR GPV VPYTLLFPT   GL+GKGIP
Sbjct  798   ADTAPLEAFDKFGKKLEEIEERITSMNNGEKLKNRVGPVKVPYTLLFPTSGGGLTGKGIP  857

Query  281   NSISI  267
             NS+SI
Sbjct  858   NSVSI  862



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/848 (66%), Positives = 668/848 (79%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KKI+G +VLMKKN LD  D  A + D++ +  GQ VS QL+SA + DP     GK  
Sbjct  29    NDKKKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIG  88

Query  2612  KPAFLEDWG-KLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA+LEDW   +TSL AGESA+ VTF+W E +G PGA I++NNH +EFYL+TLTLED  G
Sbjct  89    KPAYLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPG  148

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWVYPA  Y  DRVFF+NQ YLPS+TP PLR +RE EL NLRGDGTG+ KE
Sbjct  149   RGRIHFVCNSWVYPAQHYKTDRVFFTNQTYLPSETPGPLRKYREGELVNLRGDGTGKLKE  208

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG+PD      RP+LGG+ EYPYPRRGRTGR  ++ DP  ESRLPL+ 
Sbjct  209   WDRVYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPNTESRLPLVM  268

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                +YVPRDE+FGHLK SDFL YALKSI Q ++P   +  D T NEFDSF D+  LYEGG
Sbjct  269   SLNMYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITHNEFDSFQDVLDLYEGG  328

Query  1904  LS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             +    G LL+ I+ N  LE+ KE++R+DGE+LFKFP PQVI   K+AWRTDEEFAREMLA
Sbjct  329   IKVPEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLA  388

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP+S LDP++YG+  S+IT+EHI + LD LT+ +A+   R+FILDHH
Sbjct  389   GLNPVVIRLLQEFPPKSKLDPEIYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHH  448

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GDKFG V+ VYTPA
Sbjct  449   DVFMQYLRRINT-TSTKTYASRTLLFLKDDGTLKPLAIELSLPHPSGDKFGAVNKVYTPA  507

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEGSIWQLAKAYAA NDSG HQL+SHWLNTHA IEP +IATNRQLS LHPI+KLLHP
Sbjct  508   ENGVEGSIWQLAKAYAAVNDSGYHQLLSHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHP  567

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA GV+E +  P KYAMEMS+V+YK+WV    +LP DLI RGM
Sbjct  568   HFRDTMNINALARQILINAGGVVESTVFPSKYAMEMSSVVYKDWVLTEQALPADLIKRGM  627

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHG+RLLI+DYPYAVDGLEIW+AI+TWV EYC+FYYK D MV  D+ELQ+WW 
Sbjct  628   AVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQSWWK  687

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKKDEPWWP++ +   LI+TCT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  688   EVREEGHGDKKDEPWWPKMHTVKELIETCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  747

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPE G+ +YEELK+NPDKA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+ P
Sbjct  748   SRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTP  807

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D   L+AFE+FG+KL  IEERI+  NG+ + KNR GPV +PYTLL+PT E G++GK
Sbjct  808   EWTLDTTPLKAFEKFGRKLADIEERIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGITGK  867

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  868   GIPNSVSI  875



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =  1142 bits (2954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/849 (67%), Positives = 676/849 (80%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+M KN LD TD+  S+  KI D +GQKVSFQLIS+   DP     GK S
Sbjct  14    DDSKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHS  73

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED  
Sbjct  74    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYP+  Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+
Sbjct  134   NHGKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKRE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PL+
Sbjct  194   AWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLI  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  254   LSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  314   GIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNP+ ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  374   AGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD I+ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP
Sbjct  434   HDVIIPYLRRINT-TITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTP  492

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             ++QGVE SIWQLAKAY A ND+GVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  493   SDQGVESSIWQLAKAYVAVNDTGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  552

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA  RQ+L NA GV+E +    K+AMEMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  553   PHFRDTMNINASARQILVNAGGVLESTVFQSKFAMEMSAVVYKDWVFPDQALPADLVKRG  612

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW
Sbjct  613   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWW  672

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  673   KELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPT  732

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ DYEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE 
Sbjct  733   VSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES  792

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF+RFGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  793   PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  852

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  853   KGIPNSVSI  861



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =  1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/848 (66%), Positives = 667/848 (79%), Gaps = 12/848 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             ++ KKIKG VVLMKKN LD  D  AS++D++ + +GQ VS QL+SA + DP     GK  
Sbjct  13    NDKKKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLG  72

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA+LEDW   +TSL AGESA+ VTF+W E +G PGA I++NNH +EFYL+TLTLED  G
Sbjct  73    KPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPG  132

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWVYPA  Y  DRVFF+NQ YLPS+TP PLR +R+ EL NLRGDGTGE KE
Sbjct  133   CGRIHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKE  192

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG+PD      RP+LGG+ EYPYPRRGRTGR  ++ DP  ESRLPL+ 
Sbjct  193   WDRVYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPNTESRLPLVM  252

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK SDFL YALKSI Q ++P   +  D T NEFDSF D+  LYEGG
Sbjct  253   SLNIYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGG  312

Query  1904  LS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             +    G LL+ I+ N  LE+ KE++R+DGE+LFKFP PQVI   K+AWRTDEEFAREMLA
Sbjct  313   IKVPEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLA  372

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP+S LDP+VYG+  S+IT+EHI + LD LT+ +A+   R+FILDHH
Sbjct  373   GLNPVVIRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHH  432

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GDKFG V+ VYTPA
Sbjct  433   DVFMPYLRRINT-TSTKTYASRTLLFLKDDGTLKPLAIELSLPHPNGDKFGAVNKVYTPA  491

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEGSIWQLAKAYAA NDSG HQL+SHWLNTHA IEP +IATNRQLS LHPI+KLLHP
Sbjct  492   EDGVEGSIWQLAKAYAAVNDSGYHQLLSHWLNTHAAIEPFVIATNRQLSVLHPIHKLLHP  551

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA GV+E +  P KYAMEMS+V+YK+WV    +L  DLI RGM
Sbjct  552   HFRDTMNINALARQILINAGGVVESTVFPSKYAMEMSSVVYKDWVLTEQALLADLIKRGM  611

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHG+RLLI+DYPYAVDGLEIW+AI+TWV EYC+FYYK D MV  D+ELQ WW 
Sbjct  612   AVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQFWWK  671

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKKDEPWWP++ +   L+ TCT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  672   EVREEGHGDKKDEPWWPKMRTVKELMQTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  731

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPE G+ +YEELK+NPDKA LKTITA  QTLLGISLIE+LSRH+SDE+YLGQR+ P
Sbjct  732   SRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVYLGQRDTP  791

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D   L+AFE+FG+KL  IEE I+  NG+ + KNR GPV +PYTLL+PT E GL+GK
Sbjct  792   EWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGLTGK  851

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  852   GIPNSVSI  859



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/850 (65%), Positives = 673/850 (79%), Gaps = 14/850 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GK  2619
             A++ +KI+G VVLMKKN LD  D  AS++D++ + +GQKVS QLISA N DP      GK
Sbjct  26    AEKCRKIEGSVVLMKKNVLDFNDFNASVLDRVHELLGQKVSLQLISAVNADPSANGLQGK  85

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
                 A+LE W   +T L+AGESA+ VTF+W E + +PGA +++NNH +EFYLK+LTLED 
Sbjct  86    LGNLAYLEHWISTITPLIAGESAFKVTFDWDEDIAIPGAFLIRNNHHSEFYLKSLTLEDV  145

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   + FVC SWVYPAD+Y  DRVFFSN+ +LP++TP PL  +RE EL NLRGDGTGE 
Sbjct  146   PGQGRIHFVCNSWVYPADQYKKDRVFFSNKTFLPNETPGPLLKYREEELVNLRGDGTGEL  205

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRGRTGR  ++TDP  ESR+ L
Sbjct  206   QEWDRVYDYAYYNDLGNPDKGPKYVRPVLGGSSEYPYPRRGRTGRPPSETDPNSESRMKL  265

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L    IYVPRDE+FGHLK SDFL YALK++ Q + P + S FD+T +EFDS  D+  LYE
Sbjct  266   LKSLNIYVPRDERFGHLKMSDFLAYALKAVAQFLKPELESLFDSTPSEFDSIQDVLKLYE  325

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  GLL ++I+++   E+ KE+  ++GE L K+P PQVI   K+AWRTDEEF REM
Sbjct  326   GGVKLPDGLL-QNIREDIPAEMLKEIFPTEGEGLLKYPMPQVIKEDKSAWRTDEEFGREM  384

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I RLQ FPP S LDPKVYGD  STIT+EHI + +DGL++++AI   ++FILD
Sbjct  385   LAGVNPVNIRRLQEFPPASKLDPKVYGDQASTITKEHIENNIDGLSIDEAINKKKLFILD  444

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD IM Y RRIN+ T  K YA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S V+T
Sbjct  445   HHDAIMPYLRRINS-TSTKTYASRTILFLKNDGTLKPLVIELSLPHPEGDQFGAISKVFT  503

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE+GVE SIWQLAKAY A NDSG HQLISHWLNTHA IEP +IATNRQLS LHPI+KLL
Sbjct  504   PAEEGVESSIWQLAKAYVAVNDSGYHQLISHWLNTHAAIEPFVIATNRQLSVLHPIHKLL  563

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INA  RQ+L NA GV+E +  P KY+MEMS+V+YKNWVFP  +LP DLI R
Sbjct  564   HPHFRDTMNINAFARQILINAGGVLEATVFPAKYSMEMSSVVYKNWVFPEQALPADLIKR  623

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D +SPHG+RLLIEDYPYAVDGLEIW+AIKTWV +YC+FYYK+D  V  D+ELQ+W
Sbjct  624   GMAVKDSNSPHGLRLLIEDYPYAVDGLEIWSAIKTWVEDYCSFYYKSDDRVQNDSELQSW  683

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ + GH DKKDEPWWP++ +R  L++TCT IIWI+SALHAAVNFGQY YAGY P RP
Sbjct  684   WKELREVGHGDKKDEPWWPKMQTREELVETCTIIIWIASALHAAVNFGQYPYAGYLPNRP  743

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             T SR+FMPE G+ +Y+ELK++PDK  LKTITA  QTLLG+SLIEILS H+SDE+YLGQR+
Sbjct  744   TFSRRFMPEKGTPEYDELKSDPDKVFLKTITAQLQTLLGVSLIEILSTHSSDEVYLGQRD  803

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D EALEAFERFG+KL  IE+RI+KMN D K KNR GPV VPYTLL+PT E G++
Sbjct  804   TPEWTLDAEALEAFERFGQKLAGIEDRIIKMNNDKKWKNRVGPVKVPYTLLYPTSEGGIT  863

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  864   GKGIPNSVSI  873



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/849 (67%), Positives = 676/849 (80%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+M KN LD TD+  S+ DK  +F+GQ VSFQLIS+   DP     GK S
Sbjct  14    DDSKKLKGTVVMMNKNALDFTDLAGSLTDKAFEFLGQTVSFQLISSVQGDPTNGLQGKHS  73

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED  
Sbjct  74    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYP+ +Y  DR+FF NQ YLPS+TP  LR +RE EL  LRGDGTG+R+
Sbjct  134   NHGKVHFVCNSWVYPSFRYKSDRIFFVNQPYLPSKTPELLRKYRENELLTLRGDGTGKRE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PL+
Sbjct  194   AWDRIYDYDIYNDLGNPDEGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLI  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  254   LSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  314   GIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  374   AGVNPVIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD ++ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP
Sbjct  434   HDVLIPYLRRINTTT-TKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTP  492

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             ++QGVE SIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  493   SDQGVESSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  552

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA+ RQ+L NA GV+E +    K+AMEMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  553   PHFRDTMNINAMARQILINAGGVLESTVFQSKFAMEMSAVVYKDWVFPDQALPADLVKRG  612

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WV++YC+FYY +D  +  D ELQAWW
Sbjct  613   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVSDYCSFYYGSDEEILKDNELQAWW  672

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP +     LID+CTTIIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  673   KELREVGHGDKKNEPWWPEMERPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPT  732

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SLIEILSRH +DEIYLGQRE 
Sbjct  733   VSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLIEILSRHTTDEIYLGQRES  792

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF++FGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  793   PEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  852

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  853   KGIPNSVSI  861



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/852 (66%), Positives = 677/852 (79%), Gaps = 16/852 (2%)
 Frame = -1

Query  2777  DEPKK---IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----G  2622
             DE +K   IKGRVVLMKKN LD  D+ AS++D+  + VG KVS QLIS+ N D      G
Sbjct  17    DEQQKKRIIKGRVVLMKKNVLDFNDLAASVLDRFHELVGHKVSLQLISSVNTDSENRVKG  76

Query  2621  KRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED  2445
             K  K A+LE W    TSL  G+SA+DV+F+W E +GVPGA I+ N H +EFYLKTLTLE 
Sbjct  77    KVGKAAYLEKWITTFTSLTPGDSAFDVSFDWEEEVGVPGAFIINNLHHSEFYLKTLTLEH  136

Query  2444  --GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG  2271
               G +  + FVC SW+YPADKY   RVFF+N++YLPS+TPAPL P+RE EL NLRGDG+G
Sbjct  137   VPGHSGPLHFVCNSWIYPADKYKTHRVFFTNKSYLPSETPAPLLPYREEELVNLRGDGSG  196

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             + +EWDRVYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGR  TKTDP  ESR+
Sbjct  197   QLEEWDRVYDYAYYNDLGDPDKGQDLARPVLGGSSEYPYPRRGRTGRPPTKTDPNSESRI  256

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
             PLL    IYVPRDE+FGHLK SDFLGY LKSI Q ++P      ++  NEFDSF+D   +
Sbjct  257   PLLMSLNIYVPRDERFGHLKMSDFLGYGLKSIFQFLLPEFKDLCESISNEFDSFEDACGI  316

Query  1916  YEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAR  1743
             YEGG  L  G LL+ I  N  LE+ K++L SDGE LFKFP P+VI   K+AWRTDEEFAR
Sbjct  317   YEGGFKLPDGPLLKSIYDNIPLELLKQLLPSDGEGLFKFPMPKVIQEDKSAWRTDEEFAR  376

Query  1742  EMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFI  1563
             EM+AG+NP+ ISRLQ FPP S LDP++YG+ TSTI   HI ++LDGLT+++AI +NR++I
Sbjct  377   EMVAGLNPMIISRLQEFPPTSNLDPELYGNQTSTIAPHHIQNQLDGLTIDEAIKTNRLYI  436

Query  1562  LDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNV  1383
             L+HHD +M Y RRIN  T  K YA+RTLLFLQ DG LRP+AIELS PHP GD FG VS V
Sbjct  437   LNHHDSLMPYLRRINTTT-TKTYASRTLLFLQNDGRLRPLAIELSQPHPDGDHFGAVSKV  495

Query  1382  YTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYK  1203
             YTP+E G+EGS+WQLAKAYAA NDSGVHQLISHWL+THAVIEP++IATNRQLS +HPIYK
Sbjct  496   YTPSEDGIEGSVWQLAKAYAAVNDSGVHQLISHWLHTHAVIEPVVIATNRQLSVMHPIYK  555

Query  1202  LLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLI  1023
             LLHPHFRDTM+INA+ RQ+L NA G++E +  P KY+ME+SAV+YK+W FP+ +LP DL+
Sbjct  556   LLHPHFRDTMNINAVARQVLINAGGILEATVFPAKYSMELSAVIYKDWAFPDQALPVDLV  615

Query  1022  NRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQ  843
              RG+AV D +SPHG+RLLIEDYPYAVDGLEIW+AIK+WV +YC+FYY +D MV  D ELQ
Sbjct  616   KRGIAVQDSNSPHGLRLLIEDYPYAVDGLEIWSAIKSWVEDYCSFYYASDDMVQNDRELQ  675

Query  842   AWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPC  663
             +WW E+ +KGH DKK+E WWP++ +   LID+CT IIW++SALHAAVNFGQY YAGY P 
Sbjct  676   SWWKELREKGHADKKNESWWPKMQTLKELIDSCTIIIWVASALHAAVNFGQYHYAGYMPN  735

Query  662   RPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQ  483
             RPT+SR+FMPEPG+ +Y+EL+TNPDK  L+TITA  QTL+GI+LIEILSRH+SDEIYLGQ
Sbjct  736   RPTISRRFMPEPGTKEYDELRTNPDKVFLRTITARLQTLVGIALIEILSRHSSDEIYLGQ  795

Query  482   REHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEG  303
             R+ PEWT D + LEAF++FGKKL  IEE I+KMN DGK KNR G V VPYTLL+PT E+G
Sbjct  796   RDTPEWTADAQVLEAFDKFGKKLGEIEEGIVKMNNDGKWKNRVGAVKVPYTLLYPTSEDG  855

Query  302   LSGKGIPNSISI  267
             L+GKGIPNS+SI
Sbjct  856   LTGKGIPNSVSI  867



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/849 (67%), Positives = 675/849 (80%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+M KN LD TD+  S+  KI D +GQKVSFQLIS+   DP     GK S
Sbjct  14    DDSKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHS  73

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED  
Sbjct  74    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYP+  Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+
Sbjct  134   NHGKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKRE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PL+
Sbjct  194   AWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLI  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  254   LSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  313

Query  1907  --GLSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
                L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  314   RDQLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNP+ ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  374   AGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD I+ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP
Sbjct  434   HDVIIPYLRRINT-TITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTP  492

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             ++QGVE SIWQLAKAY A ND+GVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  493   SDQGVESSIWQLAKAYVAVNDTGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  552

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA  RQ+L NA GV+E +    K+AMEMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  553   PHFRDTMNINASARQILVNAGGVLESTVFQSKFAMEMSAVVYKDWVFPDQALPADLVKRG  612

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW
Sbjct  613   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWW  672

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  673   KELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPT  732

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ DYEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE 
Sbjct  733   VSRRFMPEPGTPDYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES  792

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF+RFGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  793   PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  852

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  853   KGIPNSVSI  861



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =  1139 bits (2945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/849 (67%), Positives = 674/849 (79%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+M KN LD TD+  S+  KI D +GQKVSFQLIS+   DP     GK S
Sbjct  14    DDSKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHS  73

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED  
Sbjct  74    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYP+  Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+
Sbjct  134   NHGKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKRE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PL+
Sbjct  194   AWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLI  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  254   LSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  314   GIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  374   AGVNPVIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD I+ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELS PHP GD+FG  S VYTP
Sbjct  434   HDVIIPYLRRINT-TITKAYASRTLLFLQDNGSLKPLAIELSFPHPDGDQFGVTSKVYTP  492

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             ++QGVE SIWQLAKAY A ND GVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  493   SDQGVESSIWQLAKAYVAVNDVGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  552

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA  RQLL NA GV+E +    K+AMEMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  553   PHFRDTMNINASARQLLVNAGGVLESTVFQSKFAMEMSAVVYKDWVFPDQALPADLVKRG  612

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW
Sbjct  613   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWW  672

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  673   KELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPT  732

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE 
Sbjct  733   VSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES  792

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF+RFGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  793   PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  852

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  853   KGIPNSVSI  861



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/848 (66%), Positives = 666/848 (79%), Gaps = 13/848 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA------ENDDPGKRS  2613
             E KKIKG VVLMKKN L   D  ASI+D++ + +GQ+VS QLISA      END  GK  
Sbjct  25    ECKKIKGTVVLMKKNVLSFNDFHASILDRVHELLGQRVSLQLISAVNSDRSENDLKGKLG  84

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             +PA+LE+W   +T L AGE+A+ VTF+W E +GVPGA +++NNH NEFYL+T+TLE   G
Sbjct  85    EPAYLEEWVTTVTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLNEFYLRTVTLEGVPG  144

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SW+YPA +YN DRVFF+NQ +LP +TPAPLR +RE EL +LRG+G GE KE
Sbjct  145   HGRVHFVCNSWIYPAKRYNKDRVFFTNQTFLPHETPAPLRKYREEELVHLRGNGEGELKE  204

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  T++DP  ESR PLL 
Sbjct  205   WDRVYDYAYYNDLGDPDKGPEYVRPVLGGSSEYPYPRRGRTGRAATESDPNTESRQPLLM  264

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK +DFL YALKSI Q V P + +  D+T NEFDSFDD+  LYEGG
Sbjct  265   SLNIYVPRDERFGHLKMADFLAYALKSIAQFVKPELEALCDSTPNEFDSFDDVLKLYEGG  324

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L  G LL++++KN  LE+ KE+ R+DGENLF+FP PQVI  + +AWRTDEEF REMLA
Sbjct  325   FELPEGPLLDNLRKNIPLEMLKEIFRTDGENLFQFPKPQVIQDNHSAWRTDEEFGREMLA  384

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I RL+ FPP+S L+ K YGD  S+IT EHI D LDGLT+++AI +NR+FILDHH
Sbjct  385   GVNPVIIRRLEKFPPKSKLNSKQYGDQNSSITEEHIKDNLDGLTIDEAIKNNRMFILDHH  444

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPH  GD+FG +S VYTPA
Sbjct  445   DELMPYLRRINTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHDKGDEFGAISKVYTPA  503

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEG+IWQLAKAY   NDSG HQLISH+LNTHAV EP +IATNRQLS LHPIYKLL P
Sbjct  504   EDGVEGTIWQLAKAYVGVNDSGYHQLISHFLNTHAVSEPFVIATNRQLSVLHPIYKLLEP  563

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NA G++E +  P KYAMEMS+V+YKNW F   +LP DL  RG+
Sbjct  564   HFRDTMNINALARQILINAGGILESTVYPAKYAMEMSSVIYKNWNFTEQALPEDLKKRGV  623

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHGVRLLI+DYPYAVDGLEIW AIK WV +YC FYYK+D M+  D+ELQ+WW 
Sbjct  624   AVEDPKAPHGVRLLIKDYPYAVDGLEIWFAIKEWVKDYCLFYYKDDDMIQKDSELQSWWK  683

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH D KD PWWP++ +R  LID+CT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  684   EVREEGHGDLKDAPWWPKMKTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  743

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPE GS DYEELK+NP+KA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+ P
Sbjct  744   SRRFMPEEGSPDYEELKSNPEKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTP  803

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT DKE LEAFE+FGKKL  IE+R+  MN D  LKNR G V VPYTLL PT E GL+G+
Sbjct  804   EWTADKEPLEAFEKFGKKLAVIEDRMFDMNKDVNLKNRVGSVKVPYTLLVPTSEGGLTGR  863

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  864   GIPNSVSI  871



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/849 (67%), Positives = 675/849 (80%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+M KN LD TD+ +S+  KI D +GQKVSFQLIS+   DP     GK S
Sbjct  14    DDSKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHS  73

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H  EF+LK+LTLED  
Sbjct  74    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYP+  Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+
Sbjct  134   NHGKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKRE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK +SR+PL+
Sbjct  194   AWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKVKSRIPLI  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  254   LSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  314   GIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNP+ ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  374   AGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD I+ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP
Sbjct  434   HDVIIPYLRRINT-TITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTP  492

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
              +QGVE SIWQLAKAY A ND+GVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  493   TDQGVESSIWQLAKAYVAVNDTGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  552

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA  RQ+L NA GV+E +    K+AMEMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  553   PHFRDTMNINASARQILVNAGGVLESTVFQSKFAMEMSAVVYKDWVFPDQALPADLVKRG  612

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW
Sbjct  613   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWW  672

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  673   KELREVGHGDKKNEPWWPEMKTPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPT  732

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE 
Sbjct  733   VSRRFMPEPGTPEYEELKRNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES  792

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF+RFGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  793   PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  852

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  853   KGIPNSVSI  861



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/849 (67%), Positives = 676/849 (80%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+MKKN LD TD+  S+ D   D +GQKVSFQLIS+   DP     GK S
Sbjct  17    DDSKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLISSVQGDPTNGLQGKHS  76

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H NEF+LK+LTLED  
Sbjct  77    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVP  136

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V F C SWVYP+ +Y  DR+FF+NQ YLPS+TP  LR +RE EL  LRGDGTG+R+
Sbjct  137   NHGKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYRENELLTLRGDGTGKRE  196

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PLL
Sbjct  197   AWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLL  256

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  257   LSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  316

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G L + +     LE+ KE+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  317   GIKLPQGPLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  376

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNP+ ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  377   AGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  436

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD ++ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP
Sbjct  437   HDLLIPYLRRINT-TITKSYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTP  495

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             ++QGVE SIWQLAKAY A ND+GVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  496   SDQGVESSIWQLAKAYVAVNDAGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  555

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA  RQ+L NA GV+E +    K+A+EMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  556   PHFRDTMNINASARQILINAGGVLESTVFQSKFALEMSAVVYKDWVFPDQALPADLVKRG  615

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW
Sbjct  616   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWW  675

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  676   KELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRPT  735

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE 
Sbjct  736   VSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES  795

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF++FGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  796   PEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  855

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  856   KGIPNSVSI  864



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/849 (67%), Positives = 673/849 (79%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KK+KG VV+M KN LD TD+ +S+  KI D +GQKVSFQLIS+   DP     GK S
Sbjct  14    DDSKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHS  73

Query  2612  KPAFLED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
              PA+LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H  EF+LK+LTLED  
Sbjct  74    NPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVP  133

Query  2438  AAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
               G V FVC SWVYP+  Y  DR+FF+NQ YLPS TP  LR +RE EL  LRGDGTG+R+
Sbjct  134   NHGKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSDTPELLRKYRENELLTLRGDGTGKRE  193

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
              WDR+YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PL+
Sbjct  194   AWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLI  253

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                +IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEG
Sbjct  254   LSTDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEG  313

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREML
Sbjct  314   GIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREML  373

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AG NPV ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+H
Sbjct  374   AGTNPVIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNH  433

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD ++ Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP
Sbjct  434   HDLLIPYLRRINT-TITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTP  492

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             ++QGVE SIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+
Sbjct  493   SDQGVESSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLY  552

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INAL RQ+L NA GV E +    K+A+EMSAV+YK+WVFP+ +LP DL+ RG
Sbjct  553   PHFRDTMNINALARQILINAAGVFESTVFQSKFALEMSAVVYKDWVFPDQALPADLVKRG  612

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW
Sbjct  613   VAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWW  672

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P R T
Sbjct  673   KELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRAT  732

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE 
Sbjct  733   VSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRES  792

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWTKDKE L AF+RFGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+G
Sbjct  793   PEWTKDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTG  852

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  853   KGIPNSVSI  861



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =  1133 bits (2931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/844 (66%), Positives = 669/844 (79%), Gaps = 11/844 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK+KG VVLMKKN LD  D  AS++D++ +  GQK+S QL+SA + DP     GK  KPA
Sbjct  22    KKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKPA  81

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW   +T L AG+SA+ VTF+W E +GVPGA+IV+N H ++FYLKT+TLED  G   
Sbjct  82    YLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEGQ  141

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPAD+Y  +RVFFSN+ YLP QTPAPL  +RE EL NLRGDGTGE +EWDR
Sbjct  142   VHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWDR  201

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD      RP+LGG+ EYPYPRRGRTGR  TKTDP  ESR+P+L   +
Sbjct  202   VYDYAYYNDLGNPDKDPKYARPVLGGSAEYPYPRRGRTGRPPTKTDPNTESRVPVLMSLD  261

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+FGHLK SDFL YALK++ Q++ P + S +D+T  EFDSF D+  LYEGG+  
Sbjct  262   IYVPRDERFGHLKMSDFLAYALKAVAQLLKPELESLYDSTPTEFDSFKDVLKLYEGGIKL  321

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                LLE ++++  LE+ KE++R+DGE L ++P PQVI  ++TAWRTD EF REMLAGVNP
Sbjct  322   PSPLLESLEESIPLEMIKELVRTDGEGLLEYPIPQVIKENETAWRTDVEFGREMLAGVNP  381

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I RL+ FPP S LDPK+YG+  STI  E I  +L+GLTV+QAI  N++FILDHHD IM
Sbjct  382   VLIRRLEEFPPASKLDPKIYGNQNSTIREELIQKQLNGLTVKQAIKMNKLFILDHHDAIM  441

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  T+ K YATRTLLFL+ DGTL+P+AIELSLPHP GDKFG +S VY PA+QGV
Sbjct  442   PYLRRIN-TTNTKTYATRTLLFLKDDGTLKPLAIELSLPHPEGDKFGAISKVYMPADQGV  500

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EGSIWQLAKAYAA NDSG HQL+SHWLNTHA IEP +IATNRQLS LHPIYKLLHPHFRD
Sbjct  501   EGSIWQLAKAYAAVNDSGYHQLVSHWLNTHAAIEPFVIATNRQLSALHPIYKLLHPHFRD  560

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA  RQ+L NA G++E +  P KYAMEMS+ +YKNW+FP  +LP DLI RG+AV D
Sbjct  561   TMNINAFARQILINAGGILEATVFPAKYAMEMSSAVYKNWIFPEQALPADLIKRGVAVED  620

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDGLEIW+AIKTWV +YC+FYYK+D  V  D ELQ+WW E+V+
Sbjct  621   ANSPHGLRLLIEDYPYAVDGLEIWSAIKTWVEDYCSFYYKSDETVQKDEELQSWWKELVE  680

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKKDEPWWP++ +   L +TCT  IWI+SALHAAVNFGQY YAGY P RPT+SR++
Sbjct  681   EGHGDKKDEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPYAGYLPNRPTLSRRY  740

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ ++EEL+ NPDKA LKTITA  QTLLGIS+IEILS H++DE+YLGQR+  EWT 
Sbjct  741   MPEEGTPEFEELRQNPDKAFLKTITAQLQTLLGISIIEILSMHSTDEVYLGQRDTREWTA  800

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D E LEAFERFGKKL  +EE I++MNGD + +NR GPV +PY LL+PT E G++ KGIPN
Sbjct  801   DAEPLEAFERFGKKLGEVEETIIRMNGDKRWRNRVGPVEIPYMLLYPTSEGGVTAKGIPN  860

Query  278   SISI  267
             S+SI
Sbjct  861   SVSI  864



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/846 (67%), Positives = 671/846 (79%), Gaps = 9/846 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAEN-DDPGKRSKPAF  2601
             D+ K++KG+VVLMKKN LD T + A++VD + + +G+KVSFQLIS+   DD GK S PA+
Sbjct  8     DDGKRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFDDRGKLSNPAY  67

Query  2600  LEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             LE+W   +T ++AGES + VTF+W R   GVPGA I+KN H NEF+LK+LTLED    G 
Sbjct  68    LENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHGK  127

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL+ LRGDGTG+ +EWDR
Sbjct  128   IHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWDR  187

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGR+ TKTDP  ESR+PL   ++
Sbjct  188   VYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNCESRIPLFMGSD  247

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL   LKSI Q  +P   + FD T NEFDSF+D+  LYEGG  L
Sbjct  248   IYVPRDERFGHLKMSDFLTVYLKSIAQSFLPAFKALFDNTPNEFDSFEDVLKLYEGGVKL  307

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G LL+ I     LEI K+V  SDGE LFKFPTPQVI   KTAWR DEEF RE+LAG+N
Sbjct  308   PEGPLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRMDEEFGREILAGIN  367

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I+RLQ FPP+S LDP +YG+  STITRE I DKLDGLTV++AI +N +FIL+ HD I
Sbjct  368   PVLITRLQEFPPKSNLDPNIYGNQNSTITREQIEDKLDGLTVDEAIKANMLFILNLHDII  427

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y R+IN  T+ + YA+RTLL LQ +GTL+PIAIELSLPHP GD+FG VS VYTP++QG
Sbjct  428   MPYLRKINTTTNTETYASRTLLLLQDNGTLKPIAIELSLPHPDGDQFGTVSKVYTPSDQG  487

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAYA  NDSG+H+LISHWLNTHAVIEP +IATNRQLS LHPI+KLLHPHFR
Sbjct  488   VEGSIWQLAKAYAVVNDSGIHELISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHPHFR  547

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INALGR +L N+ G IEL+   GKY+MEMSA++YK+W+FP   LP DLI RG+AV 
Sbjct  548   DTMNINALGRHMLINSAGTIELTFFTGKYSMEMSAIVYKDWIFPEQGLPADLIKRGVAVE  607

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPHG+RLLI+DYPYAVDGL+IW+AIK+WVTEYCNFYYK+D  V  D+ELQAWW E+ 
Sbjct  608   DSSSPHGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNFYYKSDDTVKKDSELQAWWKELR  667

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  LI++CT  IWI+SALHAAVNFGQY YAGY   RP++SR 
Sbjct  668   EEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPYAGYLVNRPSLSRM  727

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
              MPEPGS +YEELKTNPDK  LKT     QTLL IS+++ILSRH SD +YLGQR+ PEWT
Sbjct  728   LMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKILSRHGSDTLYLGQRDSPEWT  787

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDG-KLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             KD+E L AFERFGKKL  I  +IL+MNGD  K KNR GPV VPY  LFPT  EGL+GKGI
Sbjct  788   KDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPVKVPYISLFPTSGEGLTGKGI  847

Query  284   PNSISI  267
             PNS+SI
Sbjct  848   PNSVSI  853



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/845 (67%), Positives = 670/845 (79%), Gaps = 13/845 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             K+KG VV+M KN LD TD+ +S+  KI D +GQKVSFQLIS+   DP     GK S PA+
Sbjct  1     KVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNPAY  60

Query  2600  LED-WGKLTSLVAG-ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             LE+    LT L AG E+A+ VTF+W E  GVPGA I+KN H  EF+LK+LTLED    G 
Sbjct  61    LENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNHGK  120

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP+  Y  DR+FF+NQ YLPS TP  LR +RE EL  LRGDGTG+R+ WDR
Sbjct  121   VHFVCNSWVYPSLNYKSDRIFFANQPYLPSDTPELLRKYRENELLTLRGDGTGKREAWDR  180

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDLG+PD GK   R  LGG+ EYPYPRRGRTGR  T+TDPK ESR+PL+   +
Sbjct  181   IYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILSTD  240

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q ++P + + FD T NEFDSF+D+  LYEGG  L
Sbjct  241   IYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIKL  300

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
              +G L + +     LE+ +E+LR+DGE + +FPTP VI  SKTAWRTDEEFAREMLAG N
Sbjct  301   PQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGTN  360

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRLQ FPP+S LDP+ YG+  STIT EHI DKLDGLTV++A+ +N++FIL+HHD +
Sbjct  361   PVIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDLL  420

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y RRIN  T  K YA+RTLLFLQ +G+L+P+AIELSLPHP GD+FG  S VYTP++QG
Sbjct  421   IPYLRRINT-TITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGDQFGVTSKVYTPSDQG  479

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+PHFR
Sbjct  480   VESSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPHFR  539

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA GV E +    K+A+EMSAV+YK+WVFP+ +LP DL+ RG+AV 
Sbjct  540   DTMNINALARQILINAAGVFESTVFQSKFALEMSAVVYKDWVFPDQALPADLVKRGVAVE  599

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPHGVRLLIEDYPYAVDGLEIW+AIK+WVT+YC+FYY +D  +  D ELQAWW E+ 
Sbjct  600   DSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYGSDEEILKDNELQAWWKELR  659

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKK+EPWWP + +   LID+CTTIIWI+SALHAAVNFGQY YAGY P R TVSR+
Sbjct  660   EVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVNFGQYPYAGYLPNRATVSRR  719

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +YEELK NPDKA LKTITA  QTLLG+SL+EILSRH +DEIYLGQRE PEWT
Sbjct  720   FMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEILSRHTTDEIYLGQRESPEWT  779

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KDKE L AF+RFGKKL  IE++I++ NGD  L NR+GPVN PYTLLFPT E GL+GKGIP
Sbjct  780   KDKEPLAAFDRFGKKLTDIEKQIIQRNGDNILTNRSGPVNAPYTLLFPTSEGGLTGKGIP  839

Query  281   NSISI  267
             NS+SI
Sbjct  840   NSVSI  844



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/847 (66%), Positives = 671/847 (79%), Gaps = 10/847 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE--NDDPGKRSKPA  2604
             D+ K++KG+VVLMKKN LD T + A++VD + + +G+KVSFQLIS+   +D  GK S PA
Sbjct  8     DDGKRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFDDREGKLSNPA  67

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG  2430
             +LE+W   +T ++AGES + VTF+W R   GVPGA I+KN H NEF+LK+LTLED    G
Sbjct  68    YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  127

Query  2429  -VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL+ LRGDGTG+ +EWD
Sbjct  128   KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  187

Query  2252  RVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGR+ TKTDP  ESR+PL   +
Sbjct  188   RVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNCESRIPLFMGS  247

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
             +IYVPRDE+FGHLK SDFL   LKSI Q  +P   + FD T NEFDSF+D+  LYEGG  
Sbjct  248   DIYVPRDERFGHLKMSDFLTVYLKSIAQSFLPAFKALFDNTPNEFDSFEDVLKLYEGGVK  307

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L  G LL+ I     LEI K+V  SDGE LFKFPTPQVI   KTAWR DEEF RE+LAG+
Sbjct  308   LPEGPLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRMDEEFGREILAGI  367

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I+RLQ FPP+S LDP +YG+  STITRE I DKLDGLTV++AI +N +FIL+ HD 
Sbjct  368   NPVLITRLQEFPPKSNLDPNIYGNQNSTITREQIEDKLDGLTVDEAIKANMLFILNLHDI  427

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             IM Y R+IN  T+ + YA+RTLL LQ +GTL+PIAIELSLPHP GD+FG VS VYTP++Q
Sbjct  428   IMPYLRKINTTTNTETYASRTLLLLQDNGTLKPIAIELSLPHPDGDQFGTVSKVYTPSDQ  487

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGSIWQLAKAYA  NDSG+H+LISHWLNTHAVIEP +IATNRQLS LHPI+KLLHPHF
Sbjct  488   GVEGSIWQLAKAYAVVNDSGIHELISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHPHF  547

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INALGR +L N+ G IEL+   GKY+MEMSA++YK+W+FP   LP DLI RG+AV
Sbjct  548   RDTMNINALGRHMLINSAGTIELTFFTGKYSMEMSAIVYKDWIFPEQGLPADLIKRGVAV  607

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D SSPHG+RLLI+DYPYAVDGL+IW+AIK+WVTEYCNFYYK+D  V  D+ELQAWW E+
Sbjct  608   EDSSSPHGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNFYYKSDDTVKKDSELQAWWKEL  667

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH DKKDEPWWP++ +R  LI++CT  IWI+SALHAAVNFGQY YAGY   RP++SR
Sbjct  668   REEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPYAGYLVNRPSLSR  727

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
               MPEPGS +YEELKTNPDK  LKT     QTLL IS+++ILSRH SD +YLGQR+ PEW
Sbjct  728   MLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKILSRHGSDTLYLGQRDSPEW  787

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDG-KLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             TKD+E L AFERFGKKL  I  +IL+MNGD  K KNR GPV VPY  LFPT  EGL+GKG
Sbjct  788   TKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPVKVPYISLFPTSGEGLTGKG  847

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  848   IPNSVSI  854



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/849 (67%), Positives = 669/849 (79%), Gaps = 12/849 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D+ +K+KG VVLMKKN LD TDV ASIVD   +F+G++VSFQLIS    D     GK S 
Sbjct  14    DDGEKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHDANGLEGKLSN  73

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGA  2436
             PA+LE+W   +T ++AGES + VTF+W R   GVPGA I+KN H NEF+LK+LTLED   
Sbjct  74    PAYLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPN  133

Query  2435  AG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
              G + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL+ LRGDGTG+ +E
Sbjct  134   HGKIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEE  193

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLGDPD G+   RP+LGG+ EYPYPRRGRTGR+ TKTDP  ESR+PL  
Sbjct  194   WDRVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNCESRIPLFM  253

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
              ++IYVPRDE+FGHLK SDFL   LKSI Q  +P   + FD T NEFDSF+D+  LYEGG
Sbjct  254   GSDIYVPRDERFGHLKMSDFLTVYLKSIAQSFLPAFKALFDNTPNEFDSFEDVLKLYEGG  313

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L  G LL+ I     LEI K+V  SDGE LFKFPTPQVI   KTAWR DEEF RE+LA
Sbjct  314   VKLPEGPLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRMDEEFGREILA  373

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I+RLQ FPP+S LDP +YG+  STITRE I DKLDGLTV++AI +N +FIL+ H
Sbjct  374   GINPVLITRLQEFPPKSNLDPNIYGNQNSTITREQIEDKLDGLTVDEAIKANMLFILNLH  433

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D IM Y R+IN  T+ + YA+RTLL LQ +GTL+PIAIELSLPHP GD+FG VS VYTP+
Sbjct  434   DIIMPYLRKINTTTNTETYASRTLLLLQDNGTLKPIAIELSLPHPDGDQFGTVSKVYTPS  493

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             +QGVEGSIWQLAKAYA  NDSG+H+LISHWLNTHAVIEP +IATNRQLS LHPI+KLLHP
Sbjct  494   DQGVEGSIWQLAKAYAVVNDSGIHELISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLHP  553

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INALGR +L N+ G IEL+   GKY+MEMSA++YK+W+FP   LP DLI RG+
Sbjct  554   HFRDTMNINALGRHMLINSAGTIELTFFTGKYSMEMSAIVYKDWIFPEQGLPADLIKRGV  613

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D SSPHG+RLLI+DYPYAVDGL+IW+AIK+WVTEYCNFYYK+D  V  D+ELQAWW 
Sbjct  614   AVEDSSSPHGIRLLIQDYPYAVDGLKIWSAIKSWVTEYCNFYYKSDDTVKKDSELQAWWK  673

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH DKKDEPWWP++ +R  LI++CT  IWI+SALHAAVNFGQY YAGY   RP++
Sbjct  674   ELREEGHGDKKDEPWWPKMQTRQELIESCTITIWIASALHAAVNFGQYPYAGYLVNRPSL  733

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR  MPEPGS +YEELKTNPDK  LKT     QTLL IS+++ILSRH SD +YLGQR+ P
Sbjct  734   SRMLMPEPGSPEYEELKTNPDKVFLKTTVPPLQTLLEISVLKILSRHGSDTLYLGQRDSP  793

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDG-KLKNRTGPVNVPYTLLFPTGEEGLSG  294
             EWTKD+E L AFERFGKKL  I  +IL+MNGD  K KNR GPV VPY  LFPT  EGL+G
Sbjct  794   EWTKDQEPLLAFERFGKKLSDIGNQILQMNGDHEKWKNRLGPVKVPYISLFPTSGEGLTG  853

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  854   KGIPNSVSI  862



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/847 (65%), Positives = 665/847 (79%), Gaps = 13/847 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E KKIKGRVVLMKKN LDL D  AS++D++ + +G+ VS +LIS+   +P     GK  K
Sbjct  103   EGKKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGEPEKGFQGKLGK  162

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LEDW   +T L AGESA+ VTF+W + +GVPGA ++ NNH  EF+LKT+TLED  G 
Sbjct  163   PAYLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGE  222

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PL+ +RE EL +LRGDG GE +EW
Sbjct  223   GRVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEW  282

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG+PD G    RP+LGG+ +YPYPRRGRTGR  T+TD   ESRLPLL  
Sbjct  283   DRVYDYAYYNDLGNPDKGPKYARPMLGGSSKYPYPRRGRTGRPATETDSNSESRLPLLMS  342

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDSF+D+  LYEGG 
Sbjct  343   LNIYVPRDERFGHLKLSDFLAYALKSISQFIRPELEALFDKTPNEFDSFEDVLKLYEGGI  402

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  GLL + I  N   E+ KE+ R+D   L  FP PQVI   K+AWRTDEEFAREMLAG
Sbjct  403   PLPEGLL-KDIGDNIPAEMLKEIFRTDSAQLLSFPMPQVIKEDKSAWRTDEEFAREMLAG  461

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I RLQ FPP S LDPKVYGD TSTIT + + + +DGL V++A   N++FILDHHD
Sbjct  462   VNPVNIRRLQEFPPASKLDPKVYGDQTSTITEQDLGNTMDGLLVDEAFKQNKLFILDHHD  521

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE
Sbjct  522   ALMPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDRFGRISKVYTPAE  580

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             +GVEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPH
Sbjct  581   EGVEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPH  640

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INA  RQ+L NA GV+E +  P +YAMEMS+V+YK+WVF   + P DLI RG+A
Sbjct  641   FRDTMNINAFARQILINAGGVLETTVFPARYAMEMSSVVYKDWVFTEQAFPEDLIKRGVA  700

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC+FYYK D ++  DTELQ+WW E
Sbjct  701   VKDENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQKDTELQSWWKE  760

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             +V++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQY YAGY P RPT+S
Sbjct  761   LVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLPNRPTIS  820

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             RKFMPE G+ +Y+EL+++PD   LKTITA  Q +LGI+LIEILSRH++DE+YLGQR+ PE
Sbjct  821   RKFMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEILSRHSTDEVYLGQRDTPE  880

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D E L+AF++FGKKL  IE+RI  MN D KLKNR GPV VPYTLLFPT E GL+G+G
Sbjct  881   WTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVKVPYTLLFPTSEGGLTGRG  940

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  941   IPNSVSI  947



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/866 (65%), Positives = 670/866 (77%), Gaps = 30/866 (3%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKRS  2613
             D+ K IKG VVLMKKN LD  D  ASI+D++ + +GQ+VS QLISA N D      G   
Sbjct  18    DKKKIIKGSVVLMKKNVLDFNDFHASILDRVHELLGQRVSLQLISAVNADRANGLKGMLG  77

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K A+LEDW   +  L  G+SA+ V+FEW + +GVPGA +++NNH +EFYLKTLTLED  G
Sbjct  78    KAAYLEDWITTIAPLTPGDSAFKVSFEWEDEIGVPGAFLIRNNHHSEFYLKTLTLEDVPG  137

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SWVYPA KY  DRVFFSN+ Y PS+TP+ L  +RE EL+ LRG+G GE KE
Sbjct  138   EGRVHFVCNSWVYPASKYQTDRVFFSNKTYFPSETPSSLIKYREEELEILRGNGKGELKE  197

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG+PD+G+   RP+LGG+ EYPYPRRGRTGR  TKTDPK ESRL +L 
Sbjct  198   WDRVYDYAYYNDLGNPDDGQEYARPVLGGSTEYPYPRRGRTGRPPTKTDPKTESRLGILM  257

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK SDFL +ALKS+ QV+ P + S FD T +EFDSF D+  +YEGG
Sbjct  258   SLNIYVPRDERFGHLKLSDFLAFALKSVAQVITPELESVFDKTPSEFDSFQDVMDIYEGG  317

Query  1904  LSRGL-LLEHIQKNTNLEITKEVLR-------------------SDGENLFKFPTPQVIG  1785
             +     LL+HI++    E+ KE+ R                   SDG  L K+P PQV+ 
Sbjct  318   IKLPEDLLKHIREKIPAELLKEIFRTDGAQLLKYPLPQVVKGIISDGAQLLKYPLPQVVK  377

Query  1784  ASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDG  1605
               ++AWRTDEEFAREML+GVNPV ISRLQ FPPRS LD +VYGDHTSTIT +HI + LDG
Sbjct  378   EDRSAWRTDEEFAREMLSGVNPVIISRLQEFPPRSKLDQEVYGDHTSTITEQHIENNLDG  437

Query  1604  LTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSL  1425
             LTV +AI  N++FILDHHD +  Y RRIN+ T  K YA+RTLLFL+ DGTL+P+ IELSL
Sbjct  438   LTVTEAIEKNKLFILDHHDTLFPYLRRINS-TSTKTYASRTLLFLKNDGTLKPLVIELSL  496

Query  1424  PHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIII  1245
             PHP GD+FG +S VYTPAE+GVEGSIWQLAKAY A NDSGVHQLISHWLNTHA IEP +I
Sbjct  497   PHPDGDQFGGISKVYTPAEEGVEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAAIEPFVI  556

Query  1244  ATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYK  1065
             ATNRQLS LHPI+KLLHPHFRDTM+INA  RQ+L NA G++E +  P KYAMEMS+V+YK
Sbjct  557   ATNRQLSVLHPIHKLLHPHFRDTMNINAFARQILINAGGILEFTVFPAKYAMEMSSVVYK  616

Query  1064  NWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFY  885
             NWVFP  +LP DLI R +   D +SPHG+RLLIEDYPYA DGLEIW AIKTWV +YC++Y
Sbjct  617   NWVFPEQALPADLIKRQVLFRDSNSPHGLRLLIEDYPYAADGLEIWYAIKTWVEDYCSYY  676

Query  884   YKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAA  705
             YK+D MV  D+ELQ+WW E+ ++GH DKK+EPWWP++ +R  LID+CT IIWI+SALHAA
Sbjct  677   YKSDEMVQKDSELQSWWKELREEGHGDKKNEPWWPKMQTREELIDSCTIIIWIASALHAA  736

Query  704   VNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIE  525
             VNFGQY YAGY P RPTVSR+FMPE G+ +YEEL+++PDKA LKTITA  QTL+GIS+IE
Sbjct  737   VNFGQYPYAGYLPNRPTVSRRFMPEKGTPEYEELQSDPDKAFLKTITAQLQTLIGISIIE  796

Query  524   ILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPV  345
             +LSRHASDE+YLGQR+ PEWT D   LEAFERFGKKL  IE++I+ MN D +LKNR GPV
Sbjct  797   LLSRHASDEVYLGQRDTPEWTTDTNPLEAFERFGKKLGEIEDKIISMNNDERLKNRVGPV  856

Query  344   NVPYTLLFPTGEEGLSGKGIPNSISI  267
              +PYTLLFPT E GL+GKGIPNS+SI
Sbjct  857   KMPYTLLFPTSEGGLTGKGIPNSVSI  882



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =  1126 bits (2912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/845 (65%), Positives = 667/845 (79%), Gaps = 13/845 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKG VVLMKKN LD  D  AS++D++ + +GQ VS QLISA++ D      GK  +PA
Sbjct  20    RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LEDW   +T L  G+SAY VTF+W E +GVPGA+++KNNH +EF+LKT+TLED    G 
Sbjct  80    YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PLR +RE EL +LRGDG GE +EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP LGG+ EYPYPRRGRTGR  TKTD   ESR+PLL    
Sbjct  200   VYDYAYYNDLGNPDKGPKYARPTLGGSSEYPYPRRGRTGRPPTKTDSNSESRIPLLMSLN  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDS +D+  LYEGG  L
Sbjct  260   IYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSLEDVLKLYEGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L +FP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP S LDPKVYGD TS IT + I + LDGLTV +A+  N++FILDHHD +
Sbjct  379   PVNISLLQEFPPASKLDPKVYGDQTSRITEQDIGNNLDGLTVHEALKQNKLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE+G
Sbjct  439   MPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDQFGRISKVYTPAEEG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L NA G++E +  P +YAMEMS+V+YK+WVF   +LP DLI RG+AV 
Sbjct  558   DTMNINAFARQILINAGGILETTVFPARYAMEMSSVVYKDWVFTEQALPADLIKRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLI+DYPYAVDG+EIW AIKTWV +YC+FYYK D ++  D ELQ+WW E+V
Sbjct  618   DANSPHGLRLLIDDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQKDIELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLPNRPTISRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL+++PD   LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D E L+AF++FG+KL  IE+RI +MN D KLKNR GPV +PYTLLFPT E GL+G+GIP
Sbjct  798   ADTEPLKAFDKFGRKLAEIEDRITRMNNDEKLKNRVGPVKMPYTLLFPTSEGGLTGRGIP  857

Query  281   NSISI  267
             NS+SI
Sbjct  858   NSVSI  862



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/845 (66%), Positives = 667/845 (79%), Gaps = 13/845 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKG VVLMKKN LD  D  AS++D++ + +GQ VS QLISA++ D      GK  +PA
Sbjct  20    RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LEDW   +T L  G+SAY VTF+W E +GVPGA+++KNNH +EF+LKT+TLED    G 
Sbjct  80    YLEDWITTITPLTIGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PLR +RE EL +LRGDG GE +EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP LGG+ EYPYPRRGRTGR  TKTD   ESR+PLL    
Sbjct  200   VYDYAYYNDLGNPDKGPKYARPTLGGSSEYPYPRRGRTGRPPTKTDSNSESRIPLLMSLN  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDS +D+  LY+GG  L
Sbjct  260   IYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSLEDVLKLYKGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L +FP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP S LDPKVYGD TS IT + I +KLDGLTV +A+  N++FILDHHD +
Sbjct  379   PVNISLLQEFPPASKLDPKVYGDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE+G
Sbjct  439   MPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDQFGRISKVYTPAEEG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L NA G++E +  P +YAMEMS+V+YK+WVF   +LP DLINRG+AV 
Sbjct  558   DTMNINAFARQILINAGGILETTVFPARYAMEMSSVVYKDWVFTEQALPADLINRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLI+DYPYAVDG+EIW AIKTWV +YC+FYYK D ++  D ELQ+WW E+V
Sbjct  618   DANSPHGLRLLIDDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQKDIELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKMQTRKDLVETCTIIIWTASALHAAVNFGQYPYAGYLPNRPTISRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL+++PD   LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D E L+AF +FG KL  IE+RI +MN D KLKNR GPV +PYTLLFPT E GL+G+GIP
Sbjct  798   ADTEPLKAFAKFGSKLAEIEDRITRMNNDEKLKNRVGPVKMPYTLLFPTSEGGLTGRGIP  857

Query  281   NSISI  267
             NS+SI
Sbjct  858   NSVSI  862



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/847 (65%), Positives = 665/847 (79%), Gaps = 14/847 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E KKIKGRVVLMKKN LDL D  AS++D++ + +G+ VS +LIS+   DP     GK   
Sbjct  13    EGKKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGDPEKGFQGKLGN  72

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LEDW   +T L AGESA+ VTF+W + +GVPGA ++ NNH  EF+LKT+TLED  G 
Sbjct  73    PAYLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGE  132

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PL+ +RE EL +LRGDG GE +EW
Sbjct  133   GRVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEW  192

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG+PD G    RP LGG+ +YPYPRRGRTGR  T+TD   ESRLPLL  
Sbjct  193   DRVYDYAYYNDLGNPDKGPKYARPTLGGSSKYPYPRRGRTGRPATETDSNSESRLPLLMS  252

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDSF+D+  LYEGG 
Sbjct  253   LNIYVPRDERFGHLKLSDFLAYALKSIAQFIRPELEALFDKTPNEFDSFEDVLKLYEGGI  312

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  GLL + I  N   E+ KE+ R+D   L +FP PQVI   K+AWRTDEEFAREMLAG
Sbjct  313   PLPEGLL-KDIGDNIPAEMLKEIFRTDSAQLLRFPMPQVIKEDKSAWRTDEEFAREMLAG  371

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I RLQ FPP S LDPKVYGD TSTIT + I + +DGLTV++A   N++FILDHHD
Sbjct  372   VNPVNIRRLQEFPPASKLDPKVYGDQTSTITEQDIGNTMDGLTVDEAFKQNKLFILDHHD  431

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTP+E
Sbjct  432   ALMPYLRRINS-TSNKIYASRTILFLKSDGTLKPLVIELSLPHPDGDRFGRISKVYTPSE  490

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             +GVEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPH
Sbjct  491   EGVEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPH  550

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INA  RQ+L NA GV+E +  P +YAMEMS+V+YK+WVF   + P DLI RG+A
Sbjct  551   FRDTMNINAFARQILINAGGVLETTVFPARYAMEMSSVVYKDWVFTEQAFPEDLIKRGVA  610

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             + D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV + C+FYYK D ++  DTELQ+WW E
Sbjct  611   IKDANSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDCCSFYYKTDDIIQKDTELQSWWKE  670

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             +V++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQY YAGY P RPT+S
Sbjct  671   LVEEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLPNRPTIS  730

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             RKFMPE G+ +Y+EL+++PD   LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ PE
Sbjct  731   RKFMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPE  790

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D E L+AF++FGKKL  IE+RI  MN D KLKNR GPV VPYTLLFPT  EGL+G+G
Sbjct  791   WTADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVKVPYTLLFPTS-EGLTGRG  849

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  850   IPNSVSI  856



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =  1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/845 (65%), Positives = 665/845 (79%), Gaps = 12/845 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK+ G VVLMKK  LD  D  AS++D I + +G+KVS +L+SA + DP     GK  KPA
Sbjct  28    KKVIGTVVLMKKYVLDFNDFNASVLDTIHELLGEKVSLRLVSAVHSDPENGLQGKLGKPA  87

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LE W   +T L AG+SA+ VTF+W + +GVPGA+IV+NNH ++FYLKT+TLED  G   
Sbjct  88    YLEKWITTITPLTAGDSAFKVTFDWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEGR  147

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPAD+Y  DRVFFSN+ YLP +TPAPL  +RE EL NLRGDGTGE +EWDR
Sbjct  148   VHFVCNSWVYPADRYKKDRVFFSNKTYLPRETPAPLVKYREEELVNLRGDGTGELQEWDR  207

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  ++TDP  ESRLPLL    
Sbjct  208   VYDYAYYNDLGDPDKGTKYARPVLGGSAEYPYPRRGRTGRPPSETDPNTESRLPLLMSLN  267

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
              YVPRDE+FGHLK SDFL YA+K++GQ + P + S  D+T NEFD F D+ +LYEGG  L
Sbjct  268   TYVPRDERFGHLKMSDFLAYAVKAVGQFLKPELESICDSTPNEFDYFQDVLNLYEGGIKL  327

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G LLE ++++  LE+ KE++R+DGE L ++P PQVI   KTAWRTD EF REMLAGVN
Sbjct  328   PDGPLLESLKEHIPLEMLKELVRTDGEGLLEYPMPQVIKEDKTAWRTDLEFGREMLAGVN  387

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I RL+ FPP S LDPK+YG+  S++  E I  +L+GLTVEQAI  NR+FILDHHD I
Sbjct  388   PVVIRRLEEFPPASKLDPKIYGNQRSSLREELIQKQLNGLTVEQAIKMNRLFILDHHDTI  447

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN  T  K+YATRTLLFL+ DGTL+P+AIELS+PHP GD+FG +S VYTPA+QG
Sbjct  448   MPYLRRINM-TATKMYATRTLLFLKDDGTLKPLAIELSMPHPEGDEFGAISKVYTPADQG  506

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A ND+G HQL SHWLNTHA IEP +IATNRQLS LHPIYKLLHPHFR
Sbjct  507   VEGSIWQLAKAYVAVNDAGYHQLSSHWLNTHAAIEPFVIATNRQLSVLHPIYKLLHPHFR  566

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM INA+ RQ++ NA G++E +  P KY+MEMS+ +YK+W+FP  +LP DLI RG+AV 
Sbjct  567   DTMEINAIARQIVINAGGILETTVFPAKYSMEMSSAIYKDWIFPEQALPTDLIKRGVAVE  626

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDGLEIW+AIKTWV +YC+FYYK+D  V  D ELQ+WW E+V
Sbjct  627   DANSPHGLRLLIEDYPYAVDGLEIWSAIKTWVEDYCSFYYKSDQTVQEDEELQSWWRELV  686

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKK EPWWP++ +   L + CT  IWI+SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  687   EEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAVNFGQYPYAGYLPNRPTLSRR  746

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             +MPE G+ ++EEL+ NPDKA LKTITA  QTLLGISLIEILS H++DE+YLGQR+ PEWT
Sbjct  747   YMPEEGTPEFEELRQNPDKAFLKTITAQLQTLLGISLIEILSTHSTDEVYLGQRDTPEWT  806

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D E LEAFERFGKKL  +EERI++MNGD + +NR GPV VPY LL+PT E G++ KGIP
Sbjct  807   ADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVEVPYMLLYPTSEGGVTAKGIP  866

Query  281   NSISI  267
             NS+SI
Sbjct  867   NSVSI  871



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/845 (65%), Positives = 667/845 (79%), Gaps = 13/845 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKG VVLMKKN LD  D  AS++D++ + +GQ VS QLISA++ D      GK  +PA
Sbjct  20    RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENRFKGKLGEPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LEDW   +T L  G+SAY VTF+W E +GVPGA+++KNNH +EF+LKT+TLED    G 
Sbjct  80    YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PLR +RE EL +LRG+G GE +EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGNGKGELQEWDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP LGG+ EYPYPRRGRTGR  TKTDP  ESR+PL+    
Sbjct  200   VYDYAYYNDLGNPDKGSKYARPTLGGSSEYPYPRRGRTGRPPTKTDPNSESRIPLIMSLN  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             +YVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDSF+D+  LY GG  L
Sbjct  260   VYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L +FP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP S LDPKVYGD TS IT + I +KLDGLTV +A+  N++FILDHHD +
Sbjct  379   PVNISLLQEFPPASKLDPKVYGDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE+G
Sbjct  439   MPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDQFGRISKVYTPAEEG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ++ NA G++E +  P +YAMEMS+V+YK+WVF   +LP DLI RG+AV 
Sbjct  558   DTMNINAFARQIVINAGGILETTVFPSRYAMEMSSVVYKDWVFTEQALPADLIKRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC+FYYK D ++  DTELQ+WW E+V
Sbjct  618   DANSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQKDTELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLPNRPTLSRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL+++PD   LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D E L+ F++FG+KL  IE+RI  MN D KLKNR GPV +PYTLLFPT   GL+G+GIP
Sbjct  798   ADTEPLKVFDKFGRKLAEIEDRIESMNNDEKLKNRVGPVKMPYTLLFPTSGGGLTGRGIP  857

Query  281   NSISI  267
             NS+SI
Sbjct  858   NSVSI  862



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Fragaria 
vesca subsp. vesca]
Length=860

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/844 (66%), Positives = 659/844 (78%), Gaps = 12/844 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAEND--DPGKRSKPAFLE  2595
             KKIKG VVLMK N LD  D  AS++D++ +F+GQ VS QLIS ++     GK  K A+LE
Sbjct  19    KKIKGTVVLMKNNVLDFNDFHASVLDRVHEFLGQGVSLQLISGDSSTGSQGKLGKVAYLE  78

Query  2594  DW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-VQF  2421
             +W G L  + AGE+ + VTF+    +GVPGA +++NNH ++F+LKT+TLED  +AG + F
Sbjct  79    NWIGTLGPVTAGETTFKVTFDVEGDIGVPGAFVIRNNHHSQFFLKTVTLEDVPSAGHILF  138

Query  2420  VCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYD  2241
             VC SWVYPA KY  DRVFF+N+ YLPS TP PLR +R+ EL+ LRG+GTGE +EWDRVYD
Sbjct  139   VCNSWVYPASKYKKDRVFFANKTYLPSDTPLPLRKYRQQELEQLRGNGTGELEEWDRVYD  198

Query  2240  YDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA--EI  2073
             Y  YNDLGDPD G    R  LGG+ EYPYPRRGRTGR  T+TDP  ES++PL+ +   +I
Sbjct  199   YACYNDLGDPDKGSKYVRQTLGGSSEYPYPRRGRTGRSPTRTDPNCESKIPLVDLLRLDI  258

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDF+ Y LKS+ Q V P + S+FD T NEFDSF D+ +LY+GG  + 
Sbjct  259   YVPRDERFGHLKMSDFIAYGLKSLAQSVKPALQSKFDKTPNEFDSFQDVLNLYDGGFPMP  318

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  + +     L + KE+ R+DGE   KFP PQVI   +TAWRTD EF REMLAGVNP
Sbjct  319   EGLF-KDVGDKIPLTMFKEIFRTDGERFLKFPVPQVIKEDRTAWRTDAEFTREMLAGVNP  377

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I RLQ FPP S LDPKV+GDH ST+  EHI + LDGLTV QA+  NR+FILDHHD  M
Sbjct  378   VTIRRLQEFPPASKLDPKVFGDHRSTVREEHIKNNLDGLTVHQALKDNRLFILDHHDHFM  437

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  TD +IYA+RTLLFLQ DGTL+P+ IELSLPHP  D  GC S VYTPAE GV
Sbjct  438   PYLRRIN-ETDNRIYASRTLLFLQSDGTLKPLVIELSLPHPEKDHLGCTSKVYTPAEHGV  496

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP +IATNRQLS LHP++KLLHPHFRD
Sbjct  497   ESSIWQLAKAYVAVNDSGFHQLISHWLNTHAVIEPFVIATNRQLSVLHPVHKLLHPHFRD  556

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA  RQ+L NA G++E +  PGKYAME+SAV+YKNWVFP+ +LP DL+ RG+AV D
Sbjct  557   TMNINAQARQILINAGGILESTVFPGKYAMELSAVVYKNWVFPDQALPTDLLKRGVAVKD  616

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHGVRLLIEDYP+AVDGL IW+AI+TWV +YC+FYYK D MV  D ELQ+WW E+V+
Sbjct  617   ANSPHGVRLLIEDYPFAVDGLNIWSAIQTWVRDYCSFYYKTDYMVQQDIELQSWWKELVE  676

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             KGH DKK+EPWWP++ +   LI++CT IIW SSALHAAVNFGQY +AGY P RPTVSR+F
Sbjct  677   KGHGDKKNEPWWPKMQTLDELIESCTIIIWTSSALHAAVNFGQYPFAGYLPNRPTVSRRF  736

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEELKTNPD A LKTITA  QT++G+SLIEILSRHASDE+YLGQR+ P WT 
Sbjct  737   MPEIGTPEYEELKTNPDLAFLKTITAQLQTVIGVSLIEILSRHASDEVYLGQRDTPGWTS  796

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D + LEAFERFGK+L  IE+ I+ MN DGKLKNR GPV +PYTLL+PTGE GLSGKGIPN
Sbjct  797   DTKVLEAFERFGKRLAEIEDSIICMNNDGKLKNRVGPVKMPYTLLYPTGEAGLSGKGIPN  856

Query  278   SISI  267
             SISI
Sbjct  857   SISI  860



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/845 (65%), Positives = 668/845 (79%), Gaps = 13/845 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKG VVL+KKN LD  D+ AS++D++ + +GQ+VS QLISA++ D      GK  +PA
Sbjct  73    RKIKGTVVLIKKNVLDFNDINASVLDRVHELLGQRVSLQLISADHGDSENGFKGKLGEPA  132

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LEDW   +T L  G+SAY VTF+W E +GVPGA+++KNNH +EF+LKT+TLED    G 
Sbjct  133   YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  192

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PL+ +RE EL +LRGDG GE +EWDR
Sbjct  193   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWDR  252

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP LGG+ EYPYPRRGRTGR  TKTDP  ESR+PLL    
Sbjct  253   VYDYAYYNDLGNPDKGSKYARPSLGGSSEYPYPRRGRTGRPPTKTDPNTESRIPLLMSLN  312

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDSF+D+  LY GG  L
Sbjct  313   IYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIPL  372

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L +FP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  373   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVN  431

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP S LDPKVYGD TS IT + I + LDGLTV +A+  N++FILDHHD +
Sbjct  432   PVNISLLQEFPPASKLDPKVYGDQTSGITEQDIGNNLDGLTVHEALKQNKLFILDHHDAL  491

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE+G
Sbjct  492   MPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDQFGRISKVYTPAEEG  550

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  551   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  610

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ++ NA G++E +  P +YAMEMS+V+YK+WVF   +LP DLI RG+AV 
Sbjct  611   DTMNINAFARQIVINAGGILETTVFPARYAMEMSSVVYKDWVFTEQALPADLIKRGVAVK  670

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC+FYYK D ++  DTELQ+WW E+V
Sbjct  671   DANSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQKDTELQSWWKELV  730

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP + +R  L++TCT IIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  731   EEGHGDKKDEPWWPNMQTREDLVETCTIIIWTASALHAAVNFGQYPYAGYLPNRPTLSRK  790

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL+++PD   LKTITA  Q +LGI+LIEILSRH++DE+YLG+R+ PEWT
Sbjct  791   FMPEKGTPEYKELESSPDTVFLKTITAQLQIVLGIALIEILSRHSTDEVYLGKRDTPEWT  850

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D+E L+AF++FG+KL  IE+RI  MN D KLKNR GPV +PYTLLFPT   GL+G+GIP
Sbjct  851   ADREPLKAFDKFGRKLAEIEDRITSMNNDEKLKNRVGPVKMPYTLLFPTSGGGLTGRGIP  910

Query  281   NSISI  267
             NS+SI
Sbjct  911   NSVSI  915



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/848 (66%), Positives = 665/848 (78%), Gaps = 17/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRS  2613
             KKIKGRVVL +K+ LD      SI+D + + +GQKVS QLISA N DP        GK  
Sbjct  28    KKIKGRVVLTRKSELDF--FSDSILDNVHELLGQKVSLQLISAVNGDPPAAGKGLRGKLG  85

Query  2612  KPAFLEDWGKLTSLVA-GESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K A+LEDW    +L   G+SA+DV F+W + +G+PGA +++N H  EFYLKTLTL D  G
Sbjct  86    KAAYLEDWITTITLPGHGDSAFDVAFDWEDEVGLPGAFLIRNLHHTEFYLKTLTLHDVPG  145

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWVYPA +Y  DRVFF+NQ YLP +TPAPL P+RE EL +LRGDG+GE +E
Sbjct  146   HGRLHFVCNSWVYPAHRYKTDRVFFANQTYLPLETPAPLIPYREEELVSLRGDGSGELEE  205

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLGDPD G    RP+LGG+ E+PYPRRGRTGR +TK+DP+ ESRLPLL 
Sbjct  206   WDRVYDYAYYNDLGDPDKGSNYARPVLGGSDEFPYPRRGRTGRPLTKSDPESESRLPLLM  265

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK SDFL YALKS+ Q ++P   +  D T NEFDS  D   +YEGG
Sbjct  266   SLNIYVPRDERFGHLKMSDFLAYALKSLAQFLVPEFEALCDITPNEFDSIQDTLKIYEGG  325

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L  G LL+ I+KN   E+ K++LR+DGE  F FP PQVI   K+AWRTDEEFAREMLA
Sbjct  326   IKLPEGPLLDSIRKNIPSELLKQLLRTDGEGYFSFPMPQVIKEDKSAWRTDEEFAREMLA  385

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NP+ I  L+ FPP S+LDP+ YG+ +S+ITR+HI + LDGLTVE+AI S+R+FILDHH
Sbjct  386   GLNPLVIRCLKEFPPASSLDPEAYGNQSSSITRDHIKNNLDGLTVEEAIESSRLFILDHH  445

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y RRIN+ T  K YATRTLLFLQKDGTL+P+AIELSLPHP GD+FG ++ VYTPA
Sbjct  446   DAFMPYLRRINS-TSTKTYATRTLLFLQKDGTLKPLAIELSLPHPEGDRFGAINKVYTPA  504

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E G+EGSIWQLAKAYAA NDSG HQLISHWL+THAVIEP +IATNRQLS LHPI+KLLHP
Sbjct  505   EHGIEGSIWQLAKAYAAVNDSGFHQLISHWLHTHAVIEPFVIATNRQLSVLHPIHKLLHP  564

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INA  RQ L NA G++E +  P KYAMEMSAV+YKNW  P+ +LP DL+ RGM
Sbjct  565   HFRDTMNINAFARQTLINAGGILERTVFPAKYAMEMSAVIYKNWALPDQALPADLLKRGM  624

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D ++ HG+RL+I+DYPYAVDGL+IW+AI TWV EYCNFYYKND MV  D+ELQ+WW 
Sbjct  625   AVKDANAQHGLRLVIQDYPYAVDGLKIWSAIDTWVDEYCNFYYKNDNMVQEDSELQSWWN  684

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ + GH DKKDEPWWP++ +R  LI +CTTIIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  685   ELREVGHGDKKDEPWWPKMQTRKELIYSCTTIIWVASALHAAVNFGQYPYAGYLPNRPTI  744

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+F+PE GS +YEELK+ P+KA LKTITA  QTLLGISLIE+LS H++DE+YLGQR+  
Sbjct  745   SRRFIPELGSPEYEELKSYPEKAFLKTITAQLQTLLGISLIEVLSAHSTDEVYLGQRDTA  804

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D E LEAF+RFGKKL  IEE I+ MN D KLKNR GPV VPYTLLFPT E G++GK
Sbjct  805   EWTTDIEPLEAFQRFGKKLGEIEENIIDMNNDEKLKNRVGPVKVPYTLLFPTSEGGVTGK  864

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  865   GIPNSVSI  872



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/848 (66%), Positives = 661/848 (78%), Gaps = 15/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD--------PGKRS  2613
             KKIKGRVVLMKKN LD  D  A+I+D + +  GQKVS QL++A + D         G+  
Sbjct  17    KKIKGRVVLMKKNVLDFNDFHANILDGVHELFGQKVSLQLVTAVHGDGHHPDKGLEGRLG  76

Query  2612  KPAFLEDWGKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
              PA+LEDW +  T L AGESA+DV F+W E LGVPGA IVKN H +EFYLKTLT+E   G
Sbjct  77    NPAYLEDWVRTGTILDAGESAFDVEFDWDEELGVPGAFIVKNFHHSEFYLKTLTIEHVPG  136

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V F+C SWVYP DKY  DRVFF NQ YLPS+TP  LR +RE EL  LRGDG GE KE
Sbjct  137   HGRVHFICNSWVYPTDKYKKDRVFFVNQTYLPSETPTALRKYREEELVELRGDGNGELKE  196

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY  YNDLG PD G    RP+LGG+ ++PYPRRGRTGR+ T++DP  ESRLPL+ 
Sbjct  197   WDRVYDYALYNDLGVPDLGSHFARPVLGGSTKFPYPRRGRTGRRPTRSDPNTESRLPLVT  256

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+FGHLK SDFLGYALKS+ QV++P   +  D+T NEFD+ +D   LYE G
Sbjct  257   SLNIYVPRDERFGHLKLSDFLGYALKSVVQVLLPEFQALHDSTPNEFDTMEDFLKLYEKG  316

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L  G L++    N  LE+ +E+ RSDGE   KFPTP +I   K+AWRTDEEFAREMLA
Sbjct  317   IQLPGGDLVKDFTDNLPLELIREIFRSDGEGFLKFPTPAIIKEDKSAWRTDEEFAREMLA  376

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GV+P+ ISRLQ FPP+S LDPK+YG+ TSTIT + + +K DGLT+++AI +NR+++LDHH
Sbjct  377   GVDPIIISRLQEFPPKSKLDPKLYGNQTSTITIDQVENKPDGLTIDEAIKTNRLYVLDHH  436

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T  KIYA+RTLLFLQKDGTL+P+AIELSLPHP GD  G VS VY PA
Sbjct  437   DMLMPYVRRINT-TSTKIYASRTLLFLQKDGTLKPLAIELSLPHPNGDALGVVSKVYLPA  495

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
              +GVEGS+WQLAKA  A NDSGVHQLISHWL THAVIEP IIATNRQLS LHPIYKLL P
Sbjct  496   HEGVEGSLWQLAKASVAVNDSGVHQLISHWLRTHAVIEPFIIATNRQLSVLHPIYKLLQP  555

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L N  G++E +  P KYAMEMSAV+YK+WVFP  +LP DL+ RG+
Sbjct  556   HFRDTMNINALARQVLINGGGILESTVFPSKYAMEMSAVVYKDWVFPEQALPADLLKRGL  615

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  SPHG+RLLI+DYPYAVDGLEIW+AI+TWV +YC +YYK+D MV  D+ELQAWW 
Sbjct  616   AVKDPKSPHGLRLLIKDYPYAVDGLEIWSAIETWVEDYCKYYYKSDEMVQQDSELQAWWK  675

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH DKKDEPWWP++ SR  LID+CT IIWI+SALHAAVNFGQY YAGY P RPT+
Sbjct  676   ELREEGHGDKKDEPWWPKMHSREELIDSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTI  735

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+ +Y+ELKTNPD+  L+TITA  QTLLG+SLIEILSRHASDE+YLGQR+ P
Sbjct  736   SRRFMPEPGTPEYDELKTNPDRVFLRTITAQLQTLLGVSLIEILSRHASDEVYLGQRDTP  795

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWTKD E L+AFE+FGK L  IE RI++MN D + KNR GP   PYTLL+PT E GL+ K
Sbjct  796   EWTKDSEPLKAFEKFGKNLAEIEARIVQMNNDSEWKNRLGPAQFPYTLLYPTSEPGLTAK  855

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  856   GIPNSVSI  863



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =  1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/845 (66%), Positives = 655/845 (78%), Gaps = 14/845 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD------PGKRSKPA  2604
             KI G VVLMKKN LD  D+ AS++D + + VGQ VS QLISA + D       GK  +PA
Sbjct  121   KINGTVVLMKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPA  180

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW   +T L  GESA+ VTF++ E +GVPGA ++KNNH +EF+LKT+TLE+  G   
Sbjct  181   YLEDWITTITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  240

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V  VC SWVYP +KY  DRVFF N+ YLPS+TP PLR +RE EL +LRG+G GE +EWDR
Sbjct  241   VHIVCNSWVYPTEKYTTDRVFFVNKTYLPSETPLPLRKYREEELVHLRGNGKGELQEWDR  300

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG PD G    RP+LGG+ EYPYPRRGRTGR  T+TDP  ES LPL+    
Sbjct  301   VYDYAYYNDLGKPDEGAKYVRPVLGGSSEYPYPRRGRTGRPPTRTDPNSESNLPLIQSLN  360

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKS  Q + P + S FD T +EFDSF+D+  LYEGG  L
Sbjct  361   IYVPRDERFGHLKLSDFLVYALKSTAQFITPELESLFDQTPSEFDSFEDVLKLYEGGIPL  420

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I      E+ KE+ R+DG  L KFP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  421   PEGLL-KDIGDKIPAEMLKEIFRTDGAQLLKFPKPQVIKEDKSAWRTDEEFAREMLAGVN  479

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I+RLQ FPP S LDPKVYGD  STIT+EHI + LDGLTV++A+  N++FILDHHD +
Sbjct  480   PVNIARLQEFPPASKLDPKVYGDQNSTITKEHIKNNLDGLTVDEALKKNKLFILDHHDSL  539

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIY +RTLLFLQ DGTL+P+ IELSLPHP GD+FGC+SNVYTPAEQG
Sbjct  540   MPYLRRINS-TSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPEGDQFGCISNVYTPAEQG  598

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  599   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVSEPVVIATNRQLSVVHPIYKLLHPHFR  658

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L NA G++E +  P +YAME S+V+YK+W F   +LP DLI RG+ V 
Sbjct  659   DTMNINAFARQILINAGGILETTVFPARYAMEXSSVVYKDWNFXEQALPADLIKRGVVVK  718

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D + PHG+ LLIEDYPYAVDG+EIW AI+TWV +YC+FYYK D ++  D ELQ+WW E+V
Sbjct  719   DKNYPHGLCLLIEDYPYAVDGIEIWFAIRTWVADYCSFYYKTDDIIQKDAELQSWWKELV  778

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +   L++ CT IIW +SALHAAVNFGQY YAGY P RPT+SRK
Sbjct  779   EEGHGDKKDEPWWPKLQTXEXLVEICTXIIWTASALHAAVNFGQYPYAGYLPNRPTISRK  838

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMP  G+A+YEELK+NPDK  LKT TA  QTLLGISLIEILSRH++DE+YLG+R+ PEWT
Sbjct  839   FMPVKGTAEYEELKSNPDKVFLKTXTAQLQTLLGISLIEILSRHSTDEVYLGKRDTPEWT  898

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D   LEAF +FGKKL  IEERI+ MN D KLKNR G V VPYTLLFPT   GL+GKGIP
Sbjct  899   ADAAPLEAFNKFGKKLEEIEERIISMNNDEKLKNRVGLVKVPYTLLFPTSGGGLTGKGIP  958

Query  281   NSISI  267
             NS+SI
Sbjct  959   NSVSI  963



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/845 (65%), Positives = 667/845 (79%), Gaps = 13/845 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKG VVLMKKN LD  D  AS++D++ + +GQ VS QLISA++ D      GK  +PA
Sbjct  20    RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LEDW   +T L  G+SAY+VTF+W E +GVPGA+++KNNH +EF+LKT+TLED    G 
Sbjct  80    YLEDWITTITPLTVGDSAYNVTFDWEEEIGVPGAILIKNNHHSEFFLKTVTLEDVPREGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PLR +RE EL +LRGDG GE +EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP LGG+  YPYP RGRTGR  TKTDP  ESR+PL+    
Sbjct  200   VYDYAYYNDLGNPDKGSKYARPTLGGSSGYPYPPRGRTGRPATKTDPNSESRIPLIMSLN  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             +YVPRDE+FGHLK SDFL YALKSI Q + P + + FD T NEFDSF+D+  LY GG  L
Sbjct  260   VYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L +FP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP S L+PKVYGD TS IT + I +KLDGLTV +A+  N++FILDHHD +
Sbjct  379   PVNISLLQEFPPASKLNPKVYGDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE+G
Sbjct  439   MPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDQFGRISKVYTPAEEG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ++ NA G++E +  P +YAME+S+V+YK+WVF   +LP DLI RG+AV 
Sbjct  558   DTMNINAFARQIVINAGGILETTVFPSRYAMELSSVVYKDWVFTEQALPADLIKRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC+FYYK D ++  DTELQ+WW E+V
Sbjct  618   DANSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQEDTELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQ+ YAGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQFPYAGYLPNRPTLSRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL+++PD   LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D E L+AF++FG+KL  IE+RI  MN D KLKNR GPV +PYTLLFPT   GL+G+GIP
Sbjct  798   ADTEPLKAFDKFGRKLAKIEDRITSMNNDEKLKNRVGPVKMPYTLLFPTSGGGLTGRGIP  857

Query  281   NSISI  267
             NS+SI
Sbjct  858   NSVSI  862



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =  1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/847 (64%), Positives = 662/847 (78%), Gaps = 14/847 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLIS-------AENDDPGKRSK  2610
             K +KG VVLMKKN L++ D+ AS+VD + + +G+KV+FQLI+       +E +  GK  K
Sbjct  19    KTMKGVVVLMKKNLLEVNDIAASVVDSVDEILGRKVAFQLITTSSLDHDSEENLKGKPGK  78

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
              A+LEDW  K+  L AG++ Y VTFEW + +GVPGA  V N H +EFYLKTLTLED  G 
Sbjct  79    IAYLEDWITKIGPLTAGDATYTVTFEWTKEMGVPGAFTVTNFHHSEFYLKTLTLEDVPGH  138

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA  Y  DRVFF+NQ YLP+QTPAPLR +RE EL+NLRG+GTG+ +EW
Sbjct  139   GRVHFVCNSWVYPAQYYETDRVFFANQTYLPNQTPAPLRRYREEELQNLRGNGTGKLEEW  198

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDYD YNDLGDPD G    R ILGG+ EYPYPRRGRTGR +  +DP  ESR+PL   
Sbjct  199   DRVYDYDIYNDLGDPDKGPKHVRSILGGSTEYPYPRRGRTGRPLASSDPNSESRIPLYQS  258

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDE+F HLK SDF+ YALKSI Q + P   + FD T  EFDS +D+  LYEGG+
Sbjct  259   LSIYVPRDERFSHLKMSDFVAYALKSIFQFLAPEFEALFDKTPEEFDSLEDVLQLYEGGI  318

Query  1901  --SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
                 G LLE I ++   E+ KE+LRSDGE  FKFP PQVI   KTAWR+DEEF REMLAG
Sbjct  319   KVQNGSLLEKISEHIPFEMIKELLRSDGEKSFKFPLPQVIKEDKTAWRSDEEFGREMLAG  378

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV I RLQ FPP STLDP++YG  +STI+ EHI + LDG T+ +AI  N++FILDHHD
Sbjct  379   LNPVVIRRLQEFPPASTLDPELYGKQSSTISEEHIVNSLDGFTITEAIEKNKLFILDHHD  438

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y RRIN  T  K YATRT+LFL+ DGTL+P+AIELSLPHP GDKFG VS+VYTPAE
Sbjct  439   NLMPYLRRINT-TAAKTYATRTVLFLKSDGTLKPLAIELSLPHPNGDKFGAVSSVYTPAE  497

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              G+EG++WQLAKAY A NDSG HQLI HWLNTHA IEP IIATNRQLS LHPI+KLL PH
Sbjct  498   DGIEGTVWQLAKAYVAVNDSGYHQLICHWLNTHAAIEPFIIATNRQLSVLHPIHKLLQPH  557

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM++NA+ RQ L NA G +E++  PGKYA+EMS+ +YKNW FP+  LP DL+ RG+A
Sbjct  558   FRDTMNVNAMARQTLINAGGFLEITVFPGKYALEMSSTIYKNWAFPDQGLPADLVKRGVA  617

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             + D SSPHGVRLLIEDYP+AVDGLEIWTAIKTWV +YC+ YYK D MV  D ELQ+WW E
Sbjct  618   IEDSSSPHGVRLLIEDYPFAVDGLEIWTAIKTWVEDYCSIYYKTDDMVQKDIELQSWWKE  677

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             V +KGH DKKDEPWWP++ +R  LID+CT I+W++SALHAAVNFGQY Y GY P RP+ S
Sbjct  678   VREKGHGDKKDEPWWPKMQTRKELIDSCTIIVWVASALHAAVNFGQYPYGGYLPNRPSTS  737

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+F+P+ G+ +Y+ELKT+P+KA LKTIT+  Q++LGISLIEILSRH++DE+YLGQR+ PE
Sbjct  738   RRFIPDKGTPEYDELKTDPEKAFLKTITSQLQSVLGISLIEILSRHSADEVYLGQRDSPE  797

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D EA++AFE FG++LV IE+RI++MN DG+ KNR+GPV +PYTLL P+ + GL+G+G
Sbjct  798   WTTDTEAIKAFEMFGERLVKIEKRIIEMNKDGRWKNRSGPVKMPYTLLCPSSDIGLTGRG  857

Query  287   IPNSISI  267
             IPNSIS+
Sbjct  858   IPNSISM  864



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/849 (65%), Positives = 667/849 (79%), Gaps = 14/849 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA----ENDDP---GKR  2616
             E  K++G VVLMKK  L + D+ AS+VD++ +  G+KV+ QLIS+    ++D     GK 
Sbjct  19    ERSKMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSESYRGKV  78

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              K A+LEDW  K++ L AG++AYDVTFEW   +GVPGA  + N H NEFYLKTLTLED  
Sbjct  79    GKKAYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVP  138

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   V F+C SWVYP++ Y  DR+FF+NQAYLPSQTPAPLR +RE EL+NLRG+GTG+ +
Sbjct  139   GHGRVHFICNSWVYPSEYYKKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLE  198

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDYD YNDLGDPD G    RPILGG+PE+PYPRRGRTGR    +DPK ESR+PL 
Sbjct  199   EWDRVYDYDIYNDLGDPDKGPEHVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLY  258

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                 IYVPRDE+F  LK SDF+ YALKSI Q + P   + FD T +EFDSF+D+  LY+G
Sbjct  259   NSLSIYVPRDERFSQLKMSDFVAYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDG  318

Query  1907  GL--SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G+  S   L+E I++   LE+ KE+LRSDGE  FKFP PQVI   KTAWR+DEEFAREML
Sbjct  319   GIKVSNDSLMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREML  378

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AG+NPV I RLQ FPP S LDP+VYG  +STI+ EHI + LDGLT+ +AI +N++FILDH
Sbjct  379   AGINPVVIRRLQEFPPESKLDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDH  438

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN  T  K YATRT+LFLQKDGTL+P+AIELSLPHP GD  G VS+VYTP
Sbjct  439   HDNLMPYLRRINT-TATKTYATRTILFLQKDGTLKPLAIELSLPHPDGDHHGAVSSVYTP  497

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             AE G+EGS+WQLAKAY A +DSG HQLI HWL+THA IEP IIAT+RQLS LHPI+KLL 
Sbjct  498   AEDGLEGSLWQLAKAYVAISDSGYHQLICHWLSTHAAIEPFIIATHRQLSVLHPIHKLLQ  557

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INAL RQ L NA G +E++  PGKYA+EMSA  YK+WVFP+ +LP DLI RG
Sbjct  558   PHFRDTMNINALARQTLINAGGFLEMTLFPGKYALEMSATSYKDWVFPDQALPADLIKRG  617

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D SSP+GVRLLIEDYPYAVDGLEIWTAI+ WV +YCN YY  D MV  D ELQ+WW
Sbjct  618   VAVEDSSSPNGVRLLIEDYPYAVDGLEIWTAIRMWVEDYCNLYYNTDDMVENDIELQSWW  677

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ +KGH DK +EPWWP++ +R  LID+CT +IW++SALHAAVNFGQY Y GY P RP+
Sbjct  678   KELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLPNRPS  737

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
              SR+F+PEPG+ +YEELK+NP+KA LKTIT+  Q++LGISL+EILSRH+SDEI+LGQRE 
Sbjct  738   TSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLGQRES  797

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D  AL+AFE FG +LV IE+RI++MN DG+ KNR GPV +PYTLL+P+ + GL+G
Sbjct  798   PEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDIGLTG  857

Query  293   KGIPNSISI  267
             +GIPNS+SI
Sbjct  858   RGIPNSVSI  866



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/850 (64%), Positives = 667/850 (78%), Gaps = 15/850 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA----ENDDP----GK  2619
             E  K++G VVLMKK  L + D+ AS+VD++ +  G+KV+ QLIS+    ++D      GK
Sbjct  19    ERSKMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAESYRGK  78

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               K A+LEDW  K++ L AG++AYDVTFEW   +GVPGA  + N H NEFYLKTLTLED 
Sbjct  79    VGKKAYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDV  138

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V F+C SWVYP++ Y  DR+FF+NQAYLPSQTPAPLR +RE EL+NLRG+GTG+ 
Sbjct  139   PGHGRVHFICNSWVYPSEYYKKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKL  198

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDYD YNDLGDPD G    RPILGG+PE+PYPRRGRTGR    +DPK ESR+PL
Sbjct  199   EEWDRVYDYDIYNDLGDPDKGPEHVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPL  258

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
                  IYVPRDE+F  LK SDF+ YALKSI Q + P   + FD T +EFDSF+D+  LY+
Sbjct  259   YNSLSIYVPRDERFSQLKMSDFVAYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYD  318

Query  1910  GGL--SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG+  S   L+E I++   LE+ KE+LRSDGE  FKFP PQVI   KTAWR+DEEFAREM
Sbjct  319   GGIKVSNDSLMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREM  378

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RLQ FPP S LDP+VYG  +STI+ EHI + LDGLT+ +AI +N++FILD
Sbjct  379   LAGINPVVIRRLQEFPPESKLDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILD  438

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YATRT+LFLQKDGTL+P+AIELSLPHP GD  G VS+VYT
Sbjct  439   HHDNLMPYLRRINT-TATKTYATRTILFLQKDGTLKPLAIELSLPHPDGDHHGAVSSVYT  497

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE G+EGS+WQLAKAY A +DSG HQLI HWL+THA IEP IIAT+RQLS LHPI+KLL
Sbjct  498   PAEDGLEGSLWQLAKAYVAISDSGYHQLICHWLSTHAAIEPFIIATHRQLSVLHPIHKLL  557

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ L NA G +E++  PGKYA+EMSA  YK+WVFP+ +LP DLI R
Sbjct  558   QPHFRDTMNINALARQTLINAGGFLEMTLFPGKYALEMSATSYKDWVFPDQALPADLIKR  617

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D SSP+GVRLLIEDYPYAVDGLEIWTAI+ WV +YCN YY  D MV  D ELQ+W
Sbjct  618   GVAVEDSSSPNGVRLLIEDYPYAVDGLEIWTAIRMWVEDYCNLYYNTDDMVENDIELQSW  677

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ +KGH DK +EPWWP++ +R  LID+CT +IW++SALHAAVNFGQY Y GY P RP
Sbjct  678   WKELREKGHADKTNEPWWPKMKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLPNRP  737

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             + SR+F+PEPG+ +YEELK+NP+KA LKTIT+  Q++LGISL+EILSRH+SDEI+LGQRE
Sbjct  738   STSRRFIPEPGTPEYEELKSNPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLGQRE  797

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D  AL+AFE FG +LV IE+RI++MN DG+ KNR GPV +PYTLL+P+ + GL+
Sbjct  798   SPEWTSDAGALKAFEMFGNRLVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDIGLT  857

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  858   GRGIPNSVSI  867



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/880 (64%), Positives = 671/880 (76%), Gaps = 17/880 (2%)
 Frame = -1

Query  2861  FINIYKELSKLVTMILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQ  2682
             F  + + + K++ M   +     A    +  +KIKG VVLMKKN LD TD+ AS +D++ 
Sbjct  3     FCPVSEMMQKVMEMFYTQPKTKAAGNEVEGRRKIKGTVVLMKKNVLDFTDIKASFLDRVH  62

Query  2681  DFVGQKVSFQLISAENDDP----GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLG  2517
             + +G+ VS QL+SA + DP    GK  K A+LE W   +T L AGE+ + +TFEW ES+G
Sbjct  63    ELLGKGVSMQLVSAVHQDPDGLRGKLGKVAYLEKWVATITPLTAGETMFTITFEWDESMG  122

Query  2516  VPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPS  2340
              PGA+I+KN+H ++ YLKT+TLED  G   V F+C SWVYP  +Y YDRVFFSN+AYLP 
Sbjct  123   FPGAIIIKNHHHSQLYLKTVTLEDIPGYGRVHFICNSWVYPTHRYKYDRVFFSNKAYLPC  182

Query  2339  QTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEY  2166
             QTP PLR +RE EL NLRG+G GE KEWDRVYDYDYYNDLG PD G+   RPILGG  EY
Sbjct  183   QTPEPLRLYREEELINLRGNGKGELKEWDRVYDYDYYNDLGSPDKGEEYARPILGGTEEY  242

Query  2165  PYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVI  1986
             PYPRRGRTGR+ TK DP  E RLPL+ + +IYVPRDE+FGHLK SDFL YALKS+ QV++
Sbjct  243   PYPRRGRTGRRKTKNDPHSEQRLPLISL-DIYVPRDERFGHLKFSDFLAYALKSLAQVLL  301

Query  1985  PFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLF  1812
             P   S  D T NEFD+F+D+ +LYEGG  L  G  +  I+ +   E+ KE++R+DGE LF
Sbjct  302   PETTSLCDKTINEFDTFEDVLNLYEGGIKLPNGPTISKIRDHIPWEMLKELVRNDGERLF  361

Query  1811  KFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITR  1632
             KFP P VI A K+AWRTDEEFAREMLAGVNPV ISRLQ FPP S LDPKVYG+  S+I +
Sbjct  362   KFPKPDVIKADKSAWRTDEEFAREMLAGVNPVIISRLQDFPPASKLDPKVYGNQNSSIRK  421

Query  1631  EHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTL  1452
             E I + +DGLTV QAI  NR+FILDHHD +M Y RRIN+ T  K YA+RT+L LQ DGTL
Sbjct  422   ELIEENMDGLTVVQAIKRNRLFILDHHDALMPYLRRINS-TSTKTYASRTILLLQDDGTL  480

Query  1451  RPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNT  1272
             +P+AIELSLPHP GD  G VS V+TPAE GVEGS+WQLAKAYAA NDSG HQL+SHWLNT
Sbjct  481   KPLAIELSLPHPQGDHHGAVSKVFTPAEHGVEGSVWQLAKAYAAVNDSGYHQLVSHWLNT  540

Query  1271  HAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYA  1092
             HAVIEP +IATNRQLS LHPIYKLLHPHFRDTM+INAL RQ+L NA G++E +  P KYA
Sbjct  541   HAVIEPFVIATNRQLSVLHPIYKLLHPHFRDTMNINALARQILINAGGILEKTVFPAKYA  600

Query  1091  MEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKT  912
             MEMS+ +YKNWVF   +LP DL+ RG+AV D S PHG+RLLIEDYPYAVDGLEIW+AI+T
Sbjct  601   MEMSSFVYKNWVFTEQALPTDLLKRGVAVPDSSQPHGLRLLIEDYPYAVDGLEIWSAIET  660

Query  911   WVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTII  732
             WV EYC FYY  D ++  D+ELQ+WWTE+   GH DKKDEPWWP + +   +  TCT II
Sbjct  661   WVKEYCAFYYPTDDLIQGDSELQSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIII  720

Query  731   WISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQ  552
             WI+SALHAAVNFGQY YAGY P RP++SR+FMPEPG+ +Y EL+ NPD A LKTITA  Q
Sbjct  721   WIASALHAAVNFGQYPYAGYLPNRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQ  780

Query  551   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDG  372
             TLLGISLIEILSRH++DE+YLGQR+  EWT D E L AFERF +KL+ IE +I+ MN D 
Sbjct  781   TLLGISLIEILSRHSTDEVYLGQRDTTEWTLDSEPLAAFERFRRKLIEIENKIMDMNNDK  840

Query  371   KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             + KNR GPV VPYTLLFP     + E GL+G+GIPNSISI
Sbjct  841   RWKNRVGPVEVPYTLLFPNTTDYSREGGLTGRGIPNSISI  880



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/881 (64%), Positives = 671/881 (76%), Gaps = 18/881 (2%)
 Frame = -1

Query  2861  FINIYKELSKLVTMILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQ  2682
             F  + + + K++ M   +     A    +  +KIKG VVLMKKN LD TD+ AS +D++ 
Sbjct  3     FCPVSEMMQKVMEMFYTQPKTKAAGNEVEGRRKIKGTVVLMKKNVLDFTDIKASFLDRVH  62

Query  2681  DFVGQKVSFQLISAENDDP-----GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESL  2520
             + +G+ VS QL+SA + DP     GK  K A+LE W   +T L AGE+ + +TFEW ES+
Sbjct  63    ELLGKGVSMQLVSAVHQDPADGLRGKLGKVAYLEKWVATITPLTAGETMFTITFEWDESM  122

Query  2519  GVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLP  2343
             G PGA+I+KN+H ++ YLKT+TLED  G   V F+C SWVYP  +Y YDRVFFSN+AYLP
Sbjct  123   GFPGAIIIKNHHHSQLYLKTVTLEDIPGYGRVHFICNSWVYPTHRYKYDRVFFSNKAYLP  182

Query  2342  SQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPE  2169
              QTP PLR +RE EL NLRG+G GE KEWDRVYDYDYYNDLG PD G+   RPILGG  E
Sbjct  183   CQTPEPLRLYREEELINLRGNGKGELKEWDRVYDYDYYNDLGSPDKGEEYARPILGGTEE  242

Query  2168  YPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVV  1989
             YPYPRRGRTGR+ TK DP  E RLPL+ + +IYVPRDE+FGHLK SDFL YALKS+ QV+
Sbjct  243   YPYPRRGRTGRRKTKNDPHSEQRLPLISL-DIYVPRDERFGHLKFSDFLAYALKSLAQVL  301

Query  1988  IPFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENL  1815
             +P   S  D T NEFD+F+D+ +LYEGG  L  G  +  I+ +   E+ KE++R+DGE L
Sbjct  302   LPETTSLCDKTINEFDTFEDVLNLYEGGIKLPNGPTISKIRDHIPWEMLKELVRNDGERL  361

Query  1814  FKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTIT  1635
             FKFP P VI A K+AWRTDEEFAREMLAGVNPV ISRLQ FPP S LDPKVYG+  S+I 
Sbjct  362   FKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVIISRLQDFPPASKLDPKVYGNQNSSIR  421

Query  1634  REHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGT  1455
             +E I + +DGLTV QAI  NR+FILDHHD +M Y RRIN+ T  K YA+RT+L LQ DGT
Sbjct  422   KELIEENMDGLTVVQAIKRNRLFILDHHDALMPYLRRINS-TSTKTYASRTILLLQDDGT  480

Query  1454  LRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLN  1275
             L+P+AIELSLPHP GD  G VS V+TPAE GVEGS+WQLAKAYAA NDSG HQL+SHWLN
Sbjct  481   LKPLAIELSLPHPQGDHHGAVSKVFTPAEHGVEGSVWQLAKAYAAVNDSGYHQLVSHWLN  540

Query  1274  THAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKY  1095
             THAVIEP +IATNRQLS LHPIYKLLHPHFRDTM+INAL RQ+L NA G++E +  P KY
Sbjct  541   THAVIEPFVIATNRQLSVLHPIYKLLHPHFRDTMNINALARQILINAGGILEKTVFPAKY  600

Query  1094  AMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIK  915
             AMEMS+ +YKNWVF   +LP DL+ RG+AV D S PHG+RLLIEDYPYAVDGLEIW+AI+
Sbjct  601   AMEMSSFVYKNWVFTEQALPTDLLKRGVAVPDSSQPHGLRLLIEDYPYAVDGLEIWSAIE  660

Query  914   TWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTI  735
             TWV EYC FYY  D ++  D+ELQ+WWTE+   GH DKKDEPWWP + +   +  TCT I
Sbjct  661   TWVKEYCAFYYPTDDLIQGDSELQSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTII  720

Query  734   IWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALP  555
             IWI+SALHAAVNFGQY YAGY P RP++SR+FMPEPG+ +Y EL+ NPD A LKTITA  
Sbjct  721   IWIASALHAAVNFGQYPYAGYLPNRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQL  780

Query  554   QTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGD  375
             QTLLGISLIEILSRH++DE+YLGQR+  EWT D E L AFERF +KL+ IE +I+ MN D
Sbjct  781   QTLLGISLIEILSRHSTDEVYLGQRDTTEWTLDSEPLAAFERFRRKLIEIENKIMDMNND  840

Query  374   GKLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
              + KNR GPV VPYTLLFP     + E GL+G+GIPNSISI
Sbjct  841   KRWKNRVGPVEVPYTLLFPNTTDYSREGGLTGRGIPNSISI  881



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/880 (63%), Positives = 673/880 (76%), Gaps = 17/880 (2%)
 Frame = -1

Query  2861  FINIYKELSKLVTMILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQ  2682
             F  + + + K++ M   +          +  +KIKG VVLMKKN LD  D+ AS +D++ 
Sbjct  3     FCPVSEMMQKVMEMFYTQPKTKAEGNEVEGRRKIKGTVVLMKKNVLDFNDIKASFLDRVH  62

Query  2681  DFVGQKVSFQLISAENDDP----GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLG  2517
             + +G+ VS QL+SA + DP    GK  K A+LE W   +T L AGE+ + +TFEW ES+G
Sbjct  63    ELLGKGVSMQLVSAVHQDPDGLRGKLGKVAYLEKWVTTITPLTAGETMFTITFEWDESMG  122

Query  2516  VPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPS  2340
              PGA+I+KN+H ++ YLKT+TLED  G   V F+C SWVYP  +Y YDR FFSN+AYLP 
Sbjct  123   FPGAIIIKNHHHSQLYLKTVTLEDIPGHGRVHFICNSWVYPTHRYKYDRAFFSNKAYLPC  182

Query  2339  QTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEY  2166
             QTP PLR +RE EL NLRG+G GE KEWDRVYDYDYYNDLG PD G+   RPILGG  E+
Sbjct  183   QTPEPLRLYREEELINLRGNGKGELKEWDRVYDYDYYNDLGSPDKGEGYARPILGGTEEH  242

Query  2165  PYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVI  1986
             PYPRRGRTGR+ TK DP  E RLPL+ + +IYVPRDE+FGHLK SDFL YALKS+GQV++
Sbjct  243   PYPRRGRTGRRKTKNDPHCEQRLPLISL-DIYVPRDERFGHLKFSDFLAYALKSLGQVLL  301

Query  1985  PFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLF  1812
             P I S  D T NEFD+F+D+ +LYEGG  L  G  +  I+ +   E+ KE++R+DGE L 
Sbjct  302   PEITSLCDKTINEFDTFEDVLNLYEGGIKLPNGPTISKIRDHIPWEMLKELVRNDGERLL  361

Query  1811  KFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITR  1632
             KFP P VI A K+AWRTDEEFAREMLAGVNPV ISRLQ FPP S LDPKVYG+  S+I +
Sbjct  362   KFPKPDVIKADKSAWRTDEEFAREMLAGVNPVIISRLQDFPPASKLDPKVYGNQNSSIGK  421

Query  1631  EHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTL  1452
             E I + +DGLTV QAI  NR++ILDHHD +M Y RRIN+ T  K YA+RT+LFLQ DGTL
Sbjct  422   ELIEENMDGLTVVQAIKRNRLYILDHHDALMPYLRRINS-TSTKTYASRTILFLQDDGTL  480

Query  1451  RPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNT  1272
             +P++IELSLPHP GD+ G VS V+TPAEQGVEGS+WQLAKAYAA NDSG HQL+SHWLNT
Sbjct  481   KPLSIELSLPHPQGDRHGAVSKVFTPAEQGVEGSVWQLAKAYAAVNDSGYHQLVSHWLNT  540

Query  1271  HAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYA  1092
             HAVIEP +IATNRQLS LHPIYKLLHPHFRDTM+INAL RQ+L NA G++E++  P KYA
Sbjct  541   HAVIEPFVIATNRQLSVLHPIYKLLHPHFRDTMNINALARQILINAGGILEITVFPAKYA  600

Query  1091  MEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKT  912
             MEMS+ +YKNWVF   +LP DL+ RG+AV D S PHG+RLLIEDYPYAVDGLEIW+AI+T
Sbjct  601   MEMSSFVYKNWVFTEQALPTDLLKRGVAVPDSSQPHGLRLLIEDYPYAVDGLEIWSAIET  660

Query  911   WVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTII  732
             WV EYC FYY  D ++  D+ELQ+WWTE+   GH DKKDEPWWP + +   +  TCT II
Sbjct  661   WVKEYCAFYYPTDDLIQGDSELQSWWTEICNVGHGDKKDEPWWPEMQTLVDVTQTCTIII  720

Query  731   WISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQ  552
             WI+SALHAAVNFGQY YAGY P RP++SR+FMPEPG+ +Y EL+ NPD A LKTITA  Q
Sbjct  721   WIASALHAAVNFGQYPYAGYLPNRPSLSRRFMPEPGTPEYAELEKNPDVAYLKTITAQLQ  780

Query  551   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDG  372
             TLLG+SLIEILSRH++DE+YLGQR+  EWT D E L AFERF +KLV IE +I+ MN D 
Sbjct  781   TLLGVSLIEILSRHSTDEVYLGQRDTAEWTLDSEPLAAFERFRRKLVEIENKIMDMNNDK  840

Query  371   KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             + KNR GPV VPYTLLFP     + E GL+G+GIPNSISI
Sbjct  841   RWKNRVGPVEVPYTLLFPNTTDYSREGGLTGRGIPNSISI  880



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/845 (65%), Positives = 660/845 (78%), Gaps = 14/845 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KIKG VVLMKKN LD  D  AS++D + + +G++VS QLISAE  D      GK  KPA+
Sbjct  24    KIKGTVVLMKKNVLDFNDFQASVLDGVHELLGKRVSLQLISAEKGDAANGLQGKLGKPAY  83

Query  2600  LEDWGKLT--SLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             L++W  LT  S VAGES + V F+W E +G PG +++KNNH +EFYLKT++LE     G 
Sbjct  84    LDNW-TLTDASPVAGESKFSVNFDWDEEIGTPGGLLIKNNHHSEFYLKTVSLEHVPDHGP  142

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYP  KY  DR+FFSN+ YLP + P PLR +RE EL+ LRG+G GE +EWDR
Sbjct  143   VHFVCNSWVYPGKKYEKDRIFFSNKTYLPHEMPEPLRKYREEELRALRGNGEGELQEWDR  202

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP+LGG+ +YPYPRRGRTGR   KTDP  ESR+PLL    
Sbjct  203   VYDYAYYNDLGNPDKGPEYARPVLGGSAQYPYPRRGRTGRPPAKTDPNTESRIPLLMSLN  262

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKS+ Q ++P +    D T+NEFDSF D++ LY GG  L
Sbjct  263   IYVPRDERFGHLKLSDFLAYALKSVVQFIVPELEDLTDRTRNEFDSFKDVDDLYYGGVKL  322

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G LL++I KN  LE+ KE+ R+DGE L KFP PQVI  S+TAWRTDEEFAREMLAGV+
Sbjct  323   PSGPLLDNIIKNIPLEMLKEIFRTDGEQLLKFPVPQVIQNSRTAWRTDEEFAREMLAGVD  382

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I  L+ FPP S LDPKVYG+  S IT+EHI   L+GLT+E+A+ +NR+FILDHHD +
Sbjct  383   PVIIRLLEEFPPTSKLDPKVYGNQNSAITKEHIEHNLEGLTIEEALRTNRLFILDHHDTL  442

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RR+N+ T  K YA+RT+L L+ DGTL+P+AIELSLPHP GD  G VS VYTPAE G
Sbjct  443   MPYLRRVNSTTT-KTYASRTVLLLRNDGTLKPLAIELSLPHPNGDPLGAVSKVYTPAEHG  501

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS +HPIYKLL PH+R
Sbjct  502   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSVVHPIYKLLQPHYR  561

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ+L N  G++EL+  PGKYAMEMS+V+YKNW   + +LP DL  RG+AV 
Sbjct  562   DTMNINAFARQILINGGGILELTVFPGKYAMEMSSVIYKNWNLLDQALPRDLKIRGVAVD  621

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SP+G+RLLI+DYPYAVDGLEIW AI+ WV +YC+FYYK D MV  D ELQAWW E+ 
Sbjct  622   DKNSPNGLRLLIKDYPYAVDGLEIWFAIEKWVRDYCSFYYKTDEMVQQDIELQAWWKELR  681

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKK+EPWWP++ +R  LIDTCT IIW++SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  682   EEGHGDKKNEPWWPKMQTREELIDTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTISRR  741

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y EL++NPDKA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+ PEWT
Sbjct  742   FMPEKGTPEYAELESNPDKAYLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTPEWT  801

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D   L AFE FGK+L  IEERI++MN D +LKNR GPVN+PYTLL+PT E GL+GKGIP
Sbjct  802   SDATPLAAFEEFGKRLSGIEERIVEMNKDEQLKNRVGPVNMPYTLLYPTSEGGLTGKGIP  861

Query  281   NSISI  267
             NS+SI
Sbjct  862   NSVSI  866



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =  1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/847 (65%), Positives = 655/847 (77%), Gaps = 12/847 (1%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             +P+KIKG V+LMKKN LD  D  AS +D   + +G++VSFQLIS+++ D      GK  K
Sbjct  20    KPEKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQGKLGK  79

Query  2609  PAFLEDWGKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
              A+LEDW    TS VAGES +DV F++ E +G+PGA ++KNNH +EFYLKTLTLE   G 
Sbjct  80    EAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEHVPGH  139

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
                 FVC SWVYP  KY+  RVFF+N+ YLP   P PL  +RE EL  LRG+G GE +EW
Sbjct  140   GRFHFVCNSWVYPDKKYDNPRVFFTNKTYLPHDMPKPLLQYREQELMALRGNGQGELQEW  199

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG+PD G    RP+LGG+ +YPYPRRGRTGR  TK+DPK ESR+PLL  
Sbjct  200   DRVYDYAYYNDLGNPDKGPEYARPVLGGSAKYPYPRRGRTGRPPTKSDPKTESRIPLLMS  259

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               IYVPRDE+FGHLK SDFL YALKSI Q ++P +    D T NEFDS +D+  LY GG 
Sbjct  260   LNIYVPRDERFGHLKMSDFLAYALKSIVQFIVPELQDLTDKTHNEFDSLEDVLELYYGGV  319

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G LL++I  N  LE+ KE+ R+DG  L KFP PQVI  SKTAWRTDEEFAREMLAG
Sbjct  320   KLPSGPLLDNIINNIPLEMLKEIFRTDGAQLLKFPVPQVIQDSKTAWRTDEEFAREMLAG  379

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I  LQ FPP S LDPKVYG+  S IT+EHI   L+GLTVE+A+ +NR+FILDHHD
Sbjct  380   VNPVIIRLLQEFPPTSNLDPKVYGNQNSAITKEHIEHNLEGLTVEEALRTNRLFILDHHD  439

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y RRIN  T  K YA+RT+L L+ DGTL+P+ IELSLPHP GD+ G VS VYTPAE
Sbjct  440   SLMPYLRRINTTT-TKTYASRTILLLRNDGTLKPLVIELSLPHPNGDQLGAVSKVYTPAE  498

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              GVEGSIWQLAKAY A NDSGVHQLISHWLNTHA +EP +IATNRQLS +HPIYKLL+PH
Sbjct  499   HGVEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAAMEPFVIATNRQLSVVHPIYKLLYPH  558

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INA  RQ+L N  GV+EL+  PGKYAMEMS+V+YK+W   + +LP DL  RG+A
Sbjct  559   FRDTMNINAFARQILINGGGVLELTVFPGKYAMEMSSVIYKSWNLLDQALPRDLKKRGVA  618

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D SSPHG+RLLI+DYPYAVDGLEIW AI+ WV +YC+FYYK D MV  D ELQAWW E
Sbjct  619   VDDKSSPHGLRLLIKDYPYAVDGLEIWFAIEKWVRDYCSFYYKTDEMVQQDPELQAWWKE  678

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDEPWWP++ +R  LID+CT IIW++SALHAAVNFGQY YAGY P RPT+S
Sbjct  679   LREEGHGDKKDEPWWPKMQTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTIS  738

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPE G+ +Y EL++NPDK  LKTITA  QTLLGISLIEILSRH+SDE+YLGQR  PE
Sbjct  739   RRFMPEKGTPEYTELESNPDKVFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRASPE  798

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D+  L AF+ FGK+L  IEERI++MN D +LKNR GPVN+PYTLL+PT E GL+GKG
Sbjct  799   WTSDETPLAAFDEFGKRLTGIEERIVEMNNDEQLKNRVGPVNMPYTLLYPTSEGGLTGKG  858

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  859   IPNSVSI  865



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =  1112 bits (2875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/837 (65%), Positives = 654/837 (78%), Gaps = 13/837 (2%)
 Frame = -1

Query  2741  MKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA------ENDDPGKRSKPAFLEDW-GK  2583
             MKKN L   D  AS++D++ + +GQ+VS QLISA      +ND  GK  +PA+LE+W   
Sbjct  1     MKKNVLGFNDFHASVLDRVHELLGQRVSLQLISAVNSDRSDNDLKGKLGEPAYLEEWVTT  60

Query  2582  LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSW  2406
             +T L AGE+A+ VTF+W E +GVPGA +++NNH +EFYLKT+TLE   G   V FVC SW
Sbjct  61    VTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLSEFYLKTVTLEGVPGHGRVHFVCNSW  120

Query  2405  VYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYN  2226
             +Y A +YN DRVFF+NQ ++P +TP PLR +RE EL +LRG+G GE KEWDRVYDY YYN
Sbjct  121   IYHAKRYNKDRVFFTNQTFMPHETPTPLRKYREEELVHLRGNGEGELKEWDRVYDYAYYN  180

Query  2225  DLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEK  2052
             DLGDPD G    RP+LGG+ EYPYPRRGRTGR  T++DP  ESR PLL    IYVPRDE+
Sbjct  181   DLGDPDKGPKYVRPVLGGSSEYPYPRRGRTGRAATESDPNTESRQPLLMSLNIYVPRDER  240

Query  2051  FGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLLEH  1878
             FGHLK +DFL YALKSI Q V P + +  D+T NEFDSFDD+  LYEGG  L  G LL++
Sbjct  241   FGHLKMADFLAYALKSIAQFVKPELEALCDSTPNEFDSFDDVLKLYEGGFELPEGPLLDN  300

Query  1877  IQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQ  1698
             ++KN  LE+ KE+ R+DGENLFKFP PQVI  + +AWRTDEEF REMLAGVNPV I RL+
Sbjct  301   LRKNIPLEMLKEIFRTDGENLFKFPKPQVIQDNHSAWRTDEEFGREMLAGVNPVIIRRLE  360

Query  1697  VFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRIN  1518
              FPP+S L+ K YGD  S+IT EHI D LDGLT+++AI +NR+FILDHHD +M Y RRIN
Sbjct  361   EFPPKSKLNSKQYGDQNSSITEEHIKDNLDGLTIDEAIKNNRMFILDHHDELMPYLRRIN  420

Query  1517  ANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQL  1338
             + T  K YA+RTLLFL+ DGTL+P+ IELSLPH  GD+FG +S VYTPAE GVEG+IWQL
Sbjct  421   STT-TKTYASRTLLFLKDDGTLKPLVIELSLPHDKGDEFGAISKVYTPAEDGVEGTIWQL  479

Query  1337  AKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINAL  1158
             AKAY   NDSG HQLISH+LNTHAV EP +IATNRQLS LHPIYKLL PHFRDTM+INAL
Sbjct  480   AKAYVGVNDSGYHQLISHFLNTHAVSEPFVIATNRQLSVLHPIYKLLEPHFRDTMNINAL  539

Query  1157  GRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGV  978
              RQ L NA G++E +  P KYAMEMS+V+YKNW F   +LP DL  RG+AV D  +PHGV
Sbjct  540   ARQTLINAGGILESTVYPAKYAMEMSSVIYKNWNFTEQALPEDLKKRGVAVEDPKAPHGV  599

Query  977   RLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKK  798
             RLLI+DYPYAVDGLEIW AIK WV +YC FYYK+D M+  D+ELQ+WW E  ++GH D K
Sbjct  600   RLLIKDYPYAVDGLEIWFAIKEWVKDYCFFYYKDDDMIQKDSELQSWWKEAREEGHGDLK  659

Query  797   DEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSA  618
             D PWWP++ +R  LID+CT IIW++SALHAAVNFGQY YAGY P RPT+SR+F+PE GS 
Sbjct  660   DAPWWPKMKTREELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTISRRFLPEEGSP  719

Query  617   DYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEA  438
             DYEELK+NP+KA LKTITA  QTLLGISLIEILSRH+SDE+YLGQR+ PEWT DKE LEA
Sbjct  720   DYEELKSNPEKAFLKTITAQLQTLLGISLIEILSRHSSDEVYLGQRDTPEWTADKEPLEA  779

Query  437   FERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  267
             FE+FGKKL  IE+R+  MN D  LKNR G V VPYTLL PT E GL+G+GIPNS+SI
Sbjct  780   FEKFGKKLAVIEDRMFDMNKDVNLKNRVGSVKVPYTLLVPTSEGGLTGRGIPNSVSI  836



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =  1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/844 (65%), Positives = 656/844 (78%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW   +T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPNEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+KY  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG  + +EWDRV
Sbjct  142   HFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  N   E+ KE+ R+DG    +FPTP+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDNIPAEMLKEIFRTDGAQFLRFPTPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCAFYYKTNDIIKTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT +IW +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAFE+FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/844 (64%), Positives = 654/844 (77%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW    T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+ Y  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG G+ +EWDRV
Sbjct  142   HFVCNSWVYPAENYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  +   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCTFYYKTNDIIQTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT ++W +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAFE+FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/844 (64%), Positives = 656/844 (78%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW   +T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+KY  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG G+ +EWDRV
Sbjct  142   HFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  +   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIRNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCAFYYKTNEIIQTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT +IW +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAF++FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DTAALEAFDKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =  1108 bits (2865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/844 (64%), Positives = 655/844 (78%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW   +T L AGESA+ +TF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTITPLTAGESAFKITFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGHV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+KY  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG  + +EWDRV
Sbjct  142   HFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  +   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCTFYYKTNDIIQTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT +IW +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAFE+FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =  1107 bits (2863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/844 (64%), Positives = 655/844 (78%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW   +T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+KY  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG  + +EWDRV
Sbjct  142   HFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  +   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCAFYYKTNEIIQTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT ++W +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAFE+FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =  1107 bits (2862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/837 (65%), Positives = 649/837 (78%), Gaps = 14/837 (2%)
 Frame = -1

Query  2741  MKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD------PGKRSKPAFLEDW-GK  2583
             MKKN LD  D+ AS++D + + VGQ VS QLISA + D       GK  +PA+LEDW   
Sbjct  1     MKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPAYLEDWITT  60

Query  2582  LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSW  2406
             +T L  GESA+ VTF++ E +GVPGA ++KNNH +EF+LKT+TLE+  G   V  VC SW
Sbjct  61    ITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGRVHIVCNSW  120

Query  2405  VYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYN  2226
             VYP +KY  DRVFF N+ YLPS+TP PLR +RE EL +LRG+G GE +EWDRVYDY YYN
Sbjct  121   VYPTEKYTTDRVFFVNKTYLPSETPLPLRKYREEELVHLRGNGKGELQEWDRVYDYAYYN  180

Query  2225  DLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEK  2052
             DLG PD G    RP+LGG+ EYPYPRRGRTGR  T+TDP  ES LPL+    IYVPRDE+
Sbjct  181   DLGKPDEGAKYVRPVLGGSSEYPYPRRGRTGRPPTRTDPNSESNLPLIQSLNIYVPRDER  240

Query  2051  FGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLLEH  1878
             FGHLK SDFL YALKS  Q + P + S FD T +EFDSF+D+  LYEGG  L  GLL + 
Sbjct  241   FGHLKLSDFLVYALKSTAQFITPELESLFDQTPSEFDSFEDVLKLYEGGIPLPEGLL-KD  299

Query  1877  IQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQ  1698
             I      E+ KE+ R+DG  L KFP PQVI   K+AWRTDEEFAREMLAGVNPV I+RLQ
Sbjct  300   IGDKIPAEMLKEIFRTDGAQLLKFPKPQVIKEDKSAWRTDEEFAREMLAGVNPVNIARLQ  359

Query  1697  VFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRIN  1518
              FPP S LDPKVYGD  STIT+EHI + LDGLTV++A+  N++FILDHHD +M Y RRIN
Sbjct  360   EFPPASKLDPKVYGDQNSTITKEHIKNNLDGLTVDEALKKNKLFILDHHDSLMPYLRRIN  419

Query  1517  ANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQL  1338
             + T  KIY +RTLLFLQ DGTL+P+ IELSLPHP GD+FGC+SNVYTPAEQGVEGSIWQL
Sbjct  420   S-TSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPEGDQFGCISNVYTPAEQGVEGSIWQL  478

Query  1337  AKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINAL  1158
             AKAY A NDSGVHQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFRDTM+INA 
Sbjct  479   AKAYVAVNDSGVHQLISHWLNTHAVSEPVVIATNRQLSVVHPIYKLLHPHFRDTMNINAF  538

Query  1157  GRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGV  978
              RQ+L NA G++E +  P +YAME S+V+YK+W F   +LP DLI RG+ V D + PHG+
Sbjct  539   ARQILINAGGILETTVFPARYAMEXSSVVYKDWNFXEQALPADLIKRGVVVKDKNYPHGL  598

Query  977   RLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKK  798
              LLIEDYPYAVDG+EIW AI+TWV +YC+FYYK D ++  D ELQ+WW E+V++GH DKK
Sbjct  599   CLLIEDYPYAVDGIEIWFAIRTWVADYCSFYYKTDDIIQKDAELQSWWKELVEEGHGDKK  658

Query  797   DEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSA  618
             DEPWWP++ +   L++ CT IIW +SALHAAVNFGQY YAGY P RPT+SRKFMP  G+A
Sbjct  659   DEPWWPKLQTXEXLVEICTXIIWTASALHAAVNFGQYPYAGYLPNRPTISRKFMPVKGTA  718

Query  617   DYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEA  438
             +YEELK+NPDK  LKT TA  QTLLGISLIEILSRH++DE+YLG+R+ PEWT D   LEA
Sbjct  719   EYEELKSNPDKVFLKTXTAQLQTLLGISLIEILSRHSTDEVYLGKRDTPEWTADAAPLEA  778

Query  437   FERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  267
             F +FGKKL  IEERI+ MN D KLKNR G V VPYTLLFPT   GL+GKGIPNS+SI
Sbjct  779   FNKFGKKLEEIEERIISMNNDEKLKNRVGLVKVPYTLLFPTSGGGLTGKGIPNSVSI  835



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =  1106 bits (2861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/844 (64%), Positives = 655/844 (78%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     GK  K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGKLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW   +T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWISTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+KY  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG  + +EWDRV
Sbjct  142   HFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF+D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFEDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  N   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDNIPAEMLKEIFRTDGAQFLRFPMPEVIKEDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIRNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLP P GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLRSDGTLKILVIELSLPRPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+WVFP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWVFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+ IW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIAIWFAIKTWVEDYCAFYYKTNDIIQTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT +IW +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILIWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDAVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAFE+FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DIAALEAFEKFGKKLAEIEDRITSMNNDDKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =  1103 bits (2854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/845 (64%), Positives = 654/845 (77%), Gaps = 14/845 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW    T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+ Y  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG G+ +EWDRV
Sbjct  142   HFVCNSWVYPAENYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGDGKGKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  +   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQV-FPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             V I  LQ  FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +
Sbjct  381   VNIRLLQQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDAL  440

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQG
Sbjct  441   MPYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQG  499

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFR
Sbjct  500   VESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFR  559

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV 
Sbjct  560   DTMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVK  619

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V
Sbjct  620   DENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCTFYYKTNDIIQTDVELQSWWKELV  679

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH D KDEPWWP++ +   L++TCT ++W +SALHAA+NFGQ++YAGY P RPT+SRK
Sbjct  680   EEGHGDIKDEPWWPKMQTFEELVETCTILVWTASALHAALNFGQFSYAGYLPNRPTISRK  739

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT
Sbjct  740   FMPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWT  799

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D  ALEAFE+FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIP
Sbjct  800   SDTAALEAFEKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIP  859

Query  281   NSISI  267
             NS+SI
Sbjct  860   NSVSI  864



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =  1103 bits (2853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/844 (64%), Positives = 653/844 (77%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI G VVLMKKN LD  D  AS++D++ + VGQ+VS QLISA + DP     G   K A+
Sbjct  22    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDNGLKGNLGKQAY  81

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LEDW   +T L AGESA+ VTF+W E +GVPGA I++NNH +EF+LKT+TL++    G V
Sbjct  82    LEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTVTLDNVPDEGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA+KY  DRVFF+N+ YLPS+ P PLR + E EL  LRGDG  + +EWDRV
Sbjct  142   HFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGDGKRKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPI+GG+ EYPYPRRGRTGR   +TDP  ESRLP++    I
Sbjct  202   YDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTESRLPIVSSLSI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKSI Q + P I + FD T NEFDSF D+  LYEGG  L 
Sbjct  262   YVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDVLQLYEGGIPLP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GL  E I  +   E+ KE+ R+DG    +FP P+VI   KTAWRTDEEFAREMLAGVNP
Sbjct  322   EGLFKE-IGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDPKVYGD TSTIT +HI + LDGLTV++A+ + ++FILDHHD +M
Sbjct  381   VNIRLLQEFPPASKLDPKVYGDQTSTITEQHIRNNLDGLTVDEALKNKKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  KIY +RTLLFL+ DGTL+ + IELSLPHP GD++GC+SNVYTPAEQGV
Sbjct  441   PYLRRINS-TSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGDQYGCISNVYTPAEQGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP+IIA NRQLS +HPIYKLL PHFRD
Sbjct  500   ESSIWQLAKAYVAVNDSGNHQLISHWLNTHAVIEPVIIAANRQLSVVHPIYKLLQPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA+GR +L NA GVIE +  P +YA+ +S+ +YK+W+FP  +LP DLI RG+AV D
Sbjct  560   TMYINAIGRGILLNARGVIESTVFPARYALGLSSAVYKDWIFPEQALPADLIKRGVAVKD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC FYYK + ++ TD ELQ+WW E+V+
Sbjct  620   ENSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCAFYYKTNEIIQTDVELQSWWKELVE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +   L++TCT + W +SALHAA+NFGQ++YAGY P RPT+SRKF
Sbjct  680   EGHGDIKDEPWWPKMQTFEELVETCTILXWTASALHAALNFGQFSYAGYLPNRPTISRKF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +YEEL+ +PD   LKTITA  QT+LGI+ IEILSRH++DE+YLGQR+ P+WT 
Sbjct  740   MPEKGTPEYEELEASPDTVFLKTITAQLQTVLGIATIEILSRHSTDEVYLGQRDTPDWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D  ALEAF +FGKKL  IE+RI  MN D KLKNR G V +PYTLLFPT E G++GKGIPN
Sbjct  800   DTAALEAFXKFGKKLAEIEDRITSMNNDEKLKNRVGSVKIPYTLLFPTSEGGITGKGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =  1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/844 (64%), Positives = 653/844 (77%), Gaps = 13/844 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPAFL  2598
             I+G V++ KKN LD  D+ AS++D++ +FVG++VS QLISA   DPG     K  KPA+L
Sbjct  16    IRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAYL  75

Query  2597  EDW-GKLTSLVAGESAYDVTFEWR--ESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAGV  2427
             EDW   +T L AGESA+ V F+W   E +G PGA +V+NNH +EFYLK+LTLE+    GV
Sbjct  76    EDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKSLTLENVPGHGV  135

Query  2426  -QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
               F+C SWVYPA KY  DR+FFSN+ YLPS+TP PL  +RE EL+NLRGDG G  +EWDR
Sbjct  136   IHFICNSWVYPAHKYKTDRIFFSNKTYLPSETPVPLLKYREEELENLRGDGKGTLQEWDR  195

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  TK+D   ESRL      +
Sbjct  196   VYDYAYYNDLGDPDKGAQYARPVLGGSIEYPYPRRGRTGRPPTKSDANSESRLNFAMSLD  255

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDEKFGHLK SDFL  ALKSI Q+V P + S FD+   EFDSF+D+  LYEGG+  
Sbjct  256   IYVPRDEKFGHLKLSDFLANALKSIAQIVKPELESLFDSIPEEFDSFEDVFKLYEGGIKV  315

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                +L++I+     E+ KE+LR+DGE   KFP PQVI   K+AWRTDEEFAREMLAGVNP
Sbjct  316   PESILKNIRDKIPAEMLKEILRTDGERFLKFPVPQVIKEDKSAWRTDEEFAREMLAGVNP  375

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  L+ FPP S LD KVYGD TSTI ++HI   +DGLTV +AI   ++FILDHHD ++
Sbjct  376   VIIRCLKEFPPESKLDSKVYGDQTSTIRKKHIESNMDGLTVNEAIRQKKLFILDHHDALI  435

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  K YA+RT+LFLQ DGTL+P+ IELSLPHP  D++G +S VYTPAE+GV
Sbjct  436   PYLRRINS-TSTKTYASRTILFLQNDGTLKPLVIELSLPHPEEDQYGVISKVYTPAEEGV  494

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP +IA NRQLS LHPIYKLLHPHFRD
Sbjct  495   ENSIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFVIAANRQLSVLHPIYKLLHPHFRD  554

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L N  G++E +  P KY+MEMS+V+YKNWVFP+ +LP DLI RGMAV D
Sbjct  555   TMNINALARQILINGGGIVEATVFPSKYSMEMSSVIYKNWVFPDQALPTDLIKRGMAVKD  614

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
                PHG+RLLIEDYPYAVDGLEIW AIK WV +YC+FYYK D  V  D+ELQ+WW E+ +
Sbjct  615   SGCPHGLRLLIEDYPYAVDGLEIWFAIKKWVQDYCSFYYKEDDTVKKDSELQSWWKELRE  674

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK+EPWWP++ +R  LI+ CT IIW++SALHA+ NFGQY YAG+ P RPT+SR+F
Sbjct  675   EGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHASTNFGQYPYAGFLPNRPTISRRF  734

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+++Y+EL  NPDK  LKTITA  QTL+GISLIEILSRH+SDE++LGQR+ P WT 
Sbjct  735   MPEEGTSEYDELVNNPDKVFLKTITAQLQTLIGISLIEILSRHSSDELHLGQRDTPNWTC  794

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D E LEAF+ FGKKLV IEERI+ +N DGK KNR GPVN+PYTLLFP+ + GL+G GIPN
Sbjct  795   DVEPLEAFDEFGKKLVEIEERIMALNNDGKHKNRVGPVNMPYTLLFPSSKAGLTGMGIPN  854

Query  278   SISI  267
             S++I
Sbjct  855   SVAI  858



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =  1101 bits (2848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/847 (65%), Positives = 658/847 (78%), Gaps = 10/847 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-NDD--PGKRSKP  2607
             ++ +K+KGRV+LMKKN LD TD+ AS+VD + D +GQKVS QLIS   N D   GKRSKP
Sbjct  14    NDGEKVKGRVILMKKNVLDFTDISASVVDGVADLLGQKVSIQLISGSVNADGLEGKRSKP  73

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
             A+LE W   +T ++AGES + VTF+W  +  GVPGA I+KN H NEF+LK+LTLED    
Sbjct  74    AYLESWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNH  133

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYP+ +Y  DR+FF+NQAYLPS+TP PLR +RE EL  LRGDGTG+ +EW
Sbjct  134   GNIHFVCNSWVYPSFRYKSDRIFFANQAYLPSETPEPLRNYRENELVVLRGDGTGKLEEW  193

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY  YNDLGDPD G+   RPILGG+ EYPYPRRGRTGR+ T+TDP  ESR PLL  
Sbjct  194   DRVYDYACYNDLGDPDKGEEYARPILGGSSEYPYPRRGRTGREPTRTDPNCESRNPLLMT  253

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K SDFL ++LKSI Q ++P   +  D T NEFDSF D+ +LYEGG 
Sbjct  254   LDIYVPRDERFGHVKNSDFLTFSLKSILQTLLPAFKALLDNTPNEFDSFADVLNLYEGGI  313

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G LL+ I  +   EI K++L++DG+ L K+P P+VI   KTAWRTDEEF REMLAG
Sbjct  314   KLPEGPLLKTITDSIPSEILKDILQTDGQGLLKYPIPRVIQDDKTAWRTDEEFGREMLAG  373

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV ISRLQ FPP+S LDP +YG+  STIT EH+ DKLDGLTV++AI +NR+FIL+HHD
Sbjct  374   INPVVISRLQEFPPKSKLDPTIYGNQNSTITTEHVKDKLDGLTVDEAIKTNRLFILNHHD  433

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M   R+IN + + K YA+RTLLFLQ + TL+P+AIELSLPHP GD+FG VS VYTPA+
Sbjct  434   IVMPLLRKINMSANTKAYASRTLLFLQDNRTLKPLAIELSLPHPDGDQFGTVSKVYTPAD  493

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             QGVEGSIWQLAKAY A ND G+HQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL+PH
Sbjct  494   QGVEGSIWQLAKAYVAVNDMGIHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLYPH  553

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FR+TM+INAL R+ L    G +E    P KY+MEMSA  YK+WVF   +LP DLI RG+A
Sbjct  554   FRNTMNINALARETLATCGGFVETYLFPAKYSMEMSAAAYKDWVFNEQALPADLIKRGVA  613

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D SSPHG+RLLI DYPYA+DGLEIW AI +WVTEYC FYYK+D  V  DTELQAWW E
Sbjct  614   VEDSSSPHGIRLLILDYPYAIDGLEIWAAINSWVTEYCKFYYKSDETVQKDTELQAWWKE  673

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDE WWP++ +R  LID CT IIWI+SALHAAVNFG Y+YAG+ P RP++S
Sbjct  674   LREEGHGDKKDEAWWPKMQTRQELIDCCTIIIWIASALHAAVNFGLYSYAGFLPNRPSLS  733

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
                MPEPGSA+YEELKTNPDK  LKT     QTLL +S+ E+LSRH SDE+YLGQR+ PE
Sbjct  734   WNLMPEPGSAEYEELKTNPDKVFLKTFVPQLQTLLEMSIFEVLSRHDSDEVYLGQRDSPE  793

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WTKDKE L AFERF K L  IE RI+ MN     KNR+GPV VPYTLLFP  +EGL+GKG
Sbjct  794   WTKDKEPLVAFERFVKMLNDIENRIMIMNSHKSWKNRSGPVKVPYTLLFPKSQEGLTGKG  853

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  854   IPNSVSI  860



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/889 (62%), Positives = 667/889 (75%), Gaps = 54/889 (6%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA---------------  2640
             E  K++G VVLMKK  L + D+ AS+VD++ +  G+KV+ QLIS+               
Sbjct  19    ERSKMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAHLGESG  78

Query  2639  ---------------------------ENDDP-----GKRSKPAFLEDW-GKLTSLVAGE  2559
                                        +  +P     GK  K A+LEDW  K++ L AG+
Sbjct  79    PLDWYGHTVRWLRCLGTCKGGCCFTGKKESEPIESYRGKVGKKAYLEDWITKISPLTAGD  138

Query  2558  SAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYN  2382
             +AYDVTFEW   +GVPGA  + N H NEFYLKTLTLED  G   V F+C SWVYP++ Y 
Sbjct  139   TAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHGRVHFICNSWVYPSEYYK  198

Query  2381  YDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNG  2202
              DR+FF+NQAYLPSQTPAPLR +RE EL+NLRG+GTG+ +EWDRVYDYD YNDLGDPD G
Sbjct  199   KDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKG  258

Query  2201  KP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSD  2028
                 RPILGG+PE+PYPRRGRTGR    +DPK ESR+PL     IYVPRDE+F  LK SD
Sbjct  259   PEHVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLYNSLSIYVPRDERFSQLKMSD  318

Query  2027  FLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL--SRGLLLEHIQKNTNLE  1854
             F+ YALKSI Q + P   + FD T +EFDSF+D+  LY+GG+  S   L+E I++   LE
Sbjct  319   FVAYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDGGIKVSNDSLMEKIRERIPLE  378

Query  1853  ITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTL  1674
             + KE+LRSDGE  FKFP PQVI   KTAWR+DEEFAREMLAG+NPV I RLQ FPP S L
Sbjct  379   MIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREMLAGINPVVIRRLQEFPPESKL  438

Query  1673  DPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIY  1494
             DP+VYG  +STI+ EHI + LDGLT+ +AI +N++FILDHHD +M Y RRIN  T  K Y
Sbjct  439   DPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDHHDNLMPYLRRINT-TATKTY  497

Query  1493  ATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATN  1314
             ATRT+LFLQKDGTL+P+AIELSLPHP GD  G VS+VYTPAE G+EGS+WQLAKAY A +
Sbjct  498   ATRTILFLQKDGTLKPLAIELSLPHPDGDHHGAVSSVYTPAEDGLEGSLWQLAKAYVAIS  557

Query  1313  DSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNA  1134
             DSG HQLI HWL+THA IEP IIAT+RQLS LHPI+KLL PHFRDTM+INAL RQ L NA
Sbjct  558   DSGYHQLICHWLSTHAAIEPFIIATHRQLSVLHPIHKLLQPHFRDTMNINALARQTLINA  617

Query  1133  DGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYP  954
              G +E++  PGKYA+EMSA  YK+WVFP+ +LP DLI RG+AV D SSP+GVRLLIEDYP
Sbjct  618   GGFLEMTLFPGKYALEMSATSYKDWVFPDQALPADLIKRGVAVEDSSSPNGVRLLIEDYP  677

Query  953   YAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRI  774
             YAVDGLEIWTAI+ WV +YCN YY  D MV  D ELQ+WW E+ +KGH DK +EPWWP++
Sbjct  678   YAVDGLEIWTAIRMWVEDYCNLYYNTDDMVENDIELQSWWKELREKGHADKTNEPWWPKM  737

Query  773   VSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTN  594
              +R  LID+CT +IW++SALHAAVNFGQY Y GY P RP+ SR+F+PEPG+ +YEELK+N
Sbjct  738   KTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLPNRPSTSRRFIPEPGTPEYEELKSN  797

Query  593   PDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKL  414
             P+KA LKTIT+  Q++LGISL+EILSRH+SDEI+LGQRE PEWT D  AL+AFE FG +L
Sbjct  798   PEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLGQRESPEWTSDAGALKAFEMFGNRL  857

Query  413   VAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  267
             V IE+RI++MN DG+ KNR GPV +PYTLL+P+ + GL+G+GIPNS+SI
Sbjct  858   VEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDIGLTGRGIPNSVSI  906



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/849 (65%), Positives = 659/849 (78%), Gaps = 12/849 (1%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKR  2616
             A   KK+KG VVLMKK  LD  D  AS++D + + +G+KVS +L+S  + DP     GK 
Sbjct  24    AGRSKKVKGTVVLMKKYVLDFNDFNASVLDNVDELLGKKVSLRLVSVVHGDPENCLRGKL  83

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              KPA LE W   +T L  G+SA+ VTF W + +GVPGA+IV+NNH ++FYLKT+TLED  
Sbjct  84    GKPAHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVP  143

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   V FVC SWVYPA++Y  DRVFFSN+ YLPSQTPAPL  +RE EL NLRGDGTGE +
Sbjct  144   GEGRVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTGELQ  203

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  T+TDP  ESRLPLL
Sbjct  204   EWDRVYDYAYYNDLGDPDKGSKYARPVLGGSSEYPYPRRGRTGRPPTETDPNTESRLPLL  263

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                  YVPRDE+FGHLK SDFL YALK++GQ + P + S FD+T NEFDSF D+ +LYEG
Sbjct  264   MSLNTYVPRDERFGHLKMSDFLAYALKAVGQFLKPELESIFDSTPNEFDSFQDVLNLYEG  323

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L    LLE +++N  LE+ K + R+DGE L ++P PQVI   K AWRTD EF REML
Sbjct  324   GIKLPNCPLLESLKENIPLEMLKILFRTDGEGLLEYPMPQVIKEDKIAWRTDVEFGREML  383

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I  LQ FPP S LDP +YG+ +S+I  E I ++L+GLTV+QAI  N++FILDH
Sbjct  384   AGVNPVVIRCLQEFPPASKLDPNIYGNQSSSIREELIQEQLNGLTVQQAIKMNKLFILDH  443

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD IM Y RRIN  T +   ATRTLLFL+ DGTL+P+AIELS+PHP GD+FG +S VYTP
Sbjct  444   HDSIMPYLRRINTTTTKTY-ATRTLLFLKDDGTLKPLAIELSMPHPEGDEFGAMSKVYTP  502

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+QGVEGSIWQLAKAY A ND+G HQL SHWLNTHA IEP +IATNRQLS LHPIYKLLH
Sbjct  503   ADQGVEGSIWQLAKAYVAVNDAGYHQLSSHWLNTHAAIEPFVIATNRQLSVLHPIYKLLH  562

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM INA+ RQ++ NA G++E +  P KY+MEMS+ +YKNW+FP  +LP DLI RG
Sbjct  563   PHFRDTMEINAIARQIVINAGGILETTVFPAKYSMEMSSAIYKNWIFPEQALPADLIKRG  622

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D +SPHG+ LLI+DYPYAVDGLEIW+AIKTWV +YC+FYYK+D  V  D ELQ+WW
Sbjct  623   VAVEDANSPHGLHLLIKDYPYAVDGLEIWSAIKTWVEDYCSFYYKSDETVQKDEELQSWW  682

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+V++GH DKK EPWWP++ +   L +TCT  IWI+SALHAAVNFGQY YAGY P RPT
Sbjct  683   RELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPYAGYLPNRPT  742

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR++MPE G+ ++EELK NPDKA LKTITA  QTLLGISLIEILS H++DE+YLGQR+ 
Sbjct  743   LSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEILSSHSTDEVYLGQRDT  802

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D E LEAFERFGKKL  +EERI++MNGD +  NR GPV VPY LL+PT E G++ 
Sbjct  803   PEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWMNRVGPVEVPYMLLYPTSEGGVTA  862

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  863   KGIPNSVSI  871



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/849 (65%), Positives = 660/849 (78%), Gaps = 17/849 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSKPAF  2601
             +KIKG VVLMKKN LD  D+ AS +D++ + +G+ VS QL+SA + DP    GK  K A 
Sbjct  34    RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPDSLRGKLGKVAD  93

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             +E W    T L AGE+ + +TFEW E++G+PGA+I+KN+H ++ YLKT+TLED  G   V
Sbjct  94    VEKWVTTRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGRV  153

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              F+C SWVYP+ +Y Y+RVFFSN+AYLP QTP PLR +RE EL NLRG G GE KEWDRV
Sbjct  154   LFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDRV  213

Query  2246  YDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDYDYYNDLG+PD G+   RPILGG  EYPYPRRGRTGR+ TKTDP  E RLPLL + +I
Sbjct  214   YDYDYYNDLGNPDKGEEYARPILGGTEEYPYPRRGRTGRRKTKTDPHTEKRLPLLSL-DI  272

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKS+ Q+++P I S  D T NEFD+F+D+ +LYEGG  L 
Sbjct  273   YVPRDERFGHLKFSDFLAYALKSLVQILLPEIKSLCDKTINEFDTFEDVLNLYEGGIKLP  332

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                 L  I+ +   E+ +E++R+DGE   KFP P VI A K+AWRTDEEFAREMLAGVNP
Sbjct  333   NKPTLHKIRDHVPWEMLRELVRNDGERFLKFPKPDVIKADKSAWRTDEEFAREMLAGVNP  392

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V ISRLQ FPP S LDPK YG+  S+I +E I + ++GLTV+QA+ SNR++ILDHHD ++
Sbjct  393   VIISRLQEFPPASKLDPKAYGNQNSSIRKELIEENMNGLTVDQALKSNRLYILDHHDALI  452

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  K YA+RT+L LQ DGTL+P+AIELSLPHP GD  G VS V TPAE GV
Sbjct  453   PYLRRINS-TSTKTYASRTILLLQDDGTLKPLAIELSLPHPQGDHHGAVSKVLTPAEHGV  511

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EGS+WQLAKAYAA NDSG HQL+SHWLNTHAVIEP +IATNRQLS +HPI KLLHPHFRD
Sbjct  512   EGSVWQLAKAYAAVNDSGYHQLVSHWLNTHAVIEPFVIATNRQLSVIHPINKLLHPHFRD  571

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L NADGV+E +  P KYAMEMS+ +YKNWVF   +LP DLI RG+AV D
Sbjct  572   TMNINALARQILINADGVLEKTVFPAKYAMEMSSYVYKNWVFTEQALPADLIKRGVAVQD  631

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              S PHG+RLLIEDYPYAVDGL+IW+AI+TWV EYC FYY  D ++  D+ELQ+WWTE+  
Sbjct  632   SSQPHGLRLLIEDYPYAVDGLQIWSAIETWVKEYCAFYYPTDDLIQGDSELQSWWTEIRN  691

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
              GH DKKDEPWWP + +   +  TCT IIWI+SALHAAVNFGQY YAGY P RPT+SR+F
Sbjct  692   VGHGDKKDEPWWPEMQTLADVTQTCTVIIWIASALHAAVNFGQYPYAGYLPNRPTISRRF  751

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPG+ +Y+EL  NPD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQR+ PEWT 
Sbjct  752   MPEPGTPEYDELAKNPDVAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLGQRDTPEWTS  811

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEGLSG  294
             D E L AFERFG+KLV IE +I+ MN D + KNR GPV VPYTLLFP     + E GL+G
Sbjct  812   DSELLAAFERFGRKLVEIENKIMDMNNDNRWKNRVGPVQVPYTLLFPNTTDYSREGGLTG  871

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  872   KGIPNSVSI  880



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =  1100 bits (2845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/890 (62%), Positives = 667/890 (75%), Gaps = 55/890 (6%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA---------------  2640
             E  K++G VVLMKK  L + D+ AS+VD++ +  G+KV+ QLIS+               
Sbjct  19    ERSKMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAHLGESG  78

Query  2639  ---------------------------ENDDP------GKRSKPAFLEDW-GKLTSLVAG  2562
                                        +  +P      GK  K A+LEDW  K++ L AG
Sbjct  79    PLDWYGHTVRWLRCLGTCKGGCCFTGKKESEPIAESYRGKVGKKAYLEDWITKISPLTAG  138

Query  2561  ESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKY  2385
             ++AYDVTFEW   +GVPGA  + N H NEFYLKTLTLED  G   V F+C SWVYP++ Y
Sbjct  139   DTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHGRVHFICNSWVYPSEYY  198

Query  2384  NYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDN  2205
               DR+FF+NQAYLPSQTPAPLR +RE EL+NLRG+GTG+ +EWDRVYDYD YNDLGDPD 
Sbjct  199   KKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDK  258

Query  2204  GKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQS  2031
             G    RPILGG+PE+PYPRRGRTGR    +DPK ESR+PL     IYVPRDE+F  LK S
Sbjct  259   GPEHVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLYNSLSIYVPRDERFSQLKMS  318

Query  2030  DFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL--SRGLLLEHIQKNTNL  1857
             DF+ YALKSI Q + P   + FD T +EFDSF+D+  LY+GG+  S   L+E I++   L
Sbjct  319   DFVAYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDGGIKVSNDSLMEKIRERIPL  378

Query  1856  EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRST  1677
             E+ KE+LRSDGE  FKFP PQVI   KTAWR+DEEFAREMLAG+NPV I RLQ FPP S 
Sbjct  379   EMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREMLAGINPVVIRRLQEFPPESK  438

Query  1676  LDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKI  1497
             LDP+VYG  +STI+ EHI + LDGLT+ +AI +N++FILDHHD +M Y RRIN  T  K 
Sbjct  439   LDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDHHDNLMPYLRRINT-TATKT  497

Query  1496  YATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAAT  1317
             YATRT+LFLQKDGTL+P+AIELSLPHP GD  G VS+VYTPAE G+EGS+WQLAKAY A 
Sbjct  498   YATRTILFLQKDGTLKPLAIELSLPHPDGDHHGAVSSVYTPAEDGLEGSLWQLAKAYVAI  557

Query  1316  NDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTN  1137
             +DSG HQLI HWL+THA IEP IIAT+RQLS LHPI+KLL PHFRDTM+INAL RQ L N
Sbjct  558   SDSGYHQLICHWLSTHAAIEPFIIATHRQLSVLHPIHKLLQPHFRDTMNINALARQTLIN  617

Query  1136  ADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDY  957
             A G +E++  PGKYA+EMSA  YK+WVFP+ +LP DLI RG+AV D SSP+GVRLLIEDY
Sbjct  618   AGGFLEMTLFPGKYALEMSATSYKDWVFPDQALPADLIKRGVAVEDSSSPNGVRLLIEDY  677

Query  956   PYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPR  777
             PYAVDGLEIWTAI+ WV +YCN YY  D MV  D ELQ+WW E+ +KGH DK +EPWWP+
Sbjct  678   PYAVDGLEIWTAIRMWVEDYCNLYYNTDDMVENDIELQSWWKELREKGHADKTNEPWWPK  737

Query  776   IVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKT  597
             + +R  LID+CT +IW++SALHAAVNFGQY Y GY P RP+ SR+F+PEPG+ +YEELK+
Sbjct  738   MKTRKELIDSCTIVIWVASALHAAVNFGQYPYGGYLPNRPSTSRRFIPEPGTPEYEELKS  797

Query  596   NPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKK  417
             NP+KA LKTIT+  Q++LGISL+EILSRH+SDEI+LGQRE PEWT D  AL+AFE FG +
Sbjct  798   NPEKAFLKTITSQLQSVLGISLVEILSRHSSDEIFLGQRESPEWTSDAGALKAFEMFGNR  857

Query  416   LVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  267
             LV IE+RI++MN DG+ KNR GPV +PYTLL+P+ + GL+G+GIPNS+SI
Sbjct  858   LVEIEKRIMEMNNDGRWKNRFGPVKMPYTLLYPSSDIGLTGRGIPNSVSI  907



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =  1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/847 (65%), Positives = 652/847 (77%), Gaps = 11/847 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE----NDDPGKRSK  2610
             D+  K+KGRV+LMKKN LD  ++GAS+VD I D +GQKVS QLIS      +   GK S 
Sbjct  14    DDRPKVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYADGLEGKLSN  73

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
             PA+LE W   +T + AGES + VTF+W +  GVPGA I+KN H NEF+LK+LTLED    
Sbjct  74    PAYLESWLTDITPITAGESTFSVTFDWDDEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNY  133

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL  LRGDGTG+ +EW
Sbjct  134   GKIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEW  193

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY  YNDLGDPD G+   RPILGG+ EYPYPRRGRTGR+ TK DP  ESR PL   
Sbjct  194   DRVYDYACYNDLGDPDKGEEYARPILGGSSEYPYPRRGRTGREPTKADPNCESRNPLPMS  253

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K+SDFL  +LKS  Q ++P   +  D T NEF+SF D+ +LYEGG 
Sbjct  254   LDIYVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKALCDNTPNEFNSFADVLNLYEGGI  313

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I  N + EI K++L++DG+ L K+PTPQVI   KTAWRTDEEF REMLAG
Sbjct  314   KLPEGPWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQGDKTAWRTDEEFGREMLAG  373

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
              NPV ISRLQ FPP+S LDP +YG+  STIT EH+ DKL+GLTV +AI SNR+FIL+HHD
Sbjct  374   SNPVLISRLQEFPPKSKLDPTIYGNQNSTITTEHVQDKLNGLTVNEAIKSNRLFILNHHD  433

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M   R+IN + + K YA+RTLLFLQ D TL+P+AIELSLPHP GD+FG VS VYTPA+
Sbjct  434   IVMPLLRKINMSANTKAYASRTLLFLQDDRTLKPLAIELSLPHPDGDQFGTVSKVYTPAD  493

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             QGVEGSIWQ AKAY A ND G+HQLISHWLNTHAVIEP +IATNR LS LHPI+KLLHPH
Sbjct  494   QGVEGSIWQFAKAYVAVNDMGIHQLISHWLNTHAVIEPFVIATNRHLSVLHPIHKLLHPH  553

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FR+TM+INAL R+ LT  DG  E S  P KY+MEMSA  YK+WVFP  +LP DL+ RG+A
Sbjct  554   FRNTMNINALARETLT-YDGGFETSLFPTKYSMEMSAAAYKDWVFPEQALPADLLKRGVA  612

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V DLSSPHG+RLLI DYPYAVDGLEIW AIK+WVTEYC FYYK+D  V  DTELQAWW E
Sbjct  613   VEDLSSPHGIRLLILDYPYAVDGLEIWAAIKSWVTEYCKFYYKSDETVEKDTELQAWWKE  672

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDE WWP++ +R  L D CT IIWI+SALHAA++FG Y+YAGY P RPT+S
Sbjct  673   LREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAALHFGLYSYAGYLPNRPTLS  732

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
                MPEPGS +YEELKTNPDK  LKT     Q+LL IS+ E+ SRHASDE+YLGQR+  E
Sbjct  733   CNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLGQRDSIE  792

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WTKDKE L AFERFGK L  IE RI+ MN     KNR+GPVNVPYTLLFPT EEGL+GKG
Sbjct  793   WTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPTSEEGLTGKG  852

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  853   IPNSVSI  859



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/849 (65%), Positives = 657/849 (77%), Gaps = 17/849 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-----NDDPGKRSKPA  2604
             KK++G VVLMKKN LDL DVGAS +D++ +  G+ VS QLISA+     N   GK  KPA
Sbjct  30    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  89

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  90    FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  149

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y Y+RVFFSN+ YLPS TP PLRP+RE EL NLRG G+G  KEWDR
Sbjct  150   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDR  209

Query  2249  VYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L +  
Sbjct  210   VYDYAFYNDLGFPDKGPESVRPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPLGL-N  268

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F H+K SDFL YA+KS+GQV+IP I + FD T NEFDSF+D+  LYEGG+  
Sbjct  269   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIKL  328

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                 L  +++    E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGVNP
Sbjct  329   PDHHLNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNP  388

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I RLQ FPP S LDPKVYG+ TS+ITRE I   +D LTV++AI  N++FILDHHD +M
Sbjct  389   VIIRRLQEFPPASKLDPKVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDALM  448

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  T+ K YA+RTLLFLQ +GTLRP+AIELSLPHP GDK G  S V+TPA++GV
Sbjct  449   PYLRRINT-TNTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGDKHGATSLVFTPADEGV  507

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EGS+WQLAKAYAA NDSG HQL+SHWLNTHAVIEP +IATNR LS LHPI+KLL PHFRD
Sbjct  508   EGSVWQLAKAYAAVNDSGYHQLVSHWLNTHAVIEPFVIATNRHLSVLHPIFKLLQPHFRD  567

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L NA GV+EL+  PGKYAMEMS+++YKNWVF    LP DL+ RG+AV D
Sbjct  568   TMYINALARQILINAGGVLELTVFPGKYAMEMSSIVYKNWVFTEQGLPADLLKRGVAVPD  627

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              S P G+RLLIEDYP+AVDGLEIW+AI+ WV +YC+FYY  D M+  DTELQ+WWTEV  
Sbjct  628   SSQPFGLRLLIEDYPFAVDGLEIWSAIEAWVNDYCSFYYPTDDMIQDDTELQSWWTEVRN  687

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +R  L   CT IIW++SALHAAVNFGQY YAGY P RPTVSR+F
Sbjct  688   EGHGDLKDEPWWPQMQTRAELAKACTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSRRF  747

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+SDEIYLGQR+ PEWT 
Sbjct  748   MPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLGQRDTPEWTS  807

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLSG  294
             D +  +AF+RF  +LV +E RI+KMN D + KNR GPV VPY LL+P       E GL+G
Sbjct  808   DIQPRQAFQRFHDRLVEVENRIVKMNNDSRWKNRNGPVKVPYMLLYPNASGDNSESGLTG  867

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  868   KGIPNSVSI  876



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =  1098 bits (2840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/849 (65%), Positives = 657/849 (77%), Gaps = 17/849 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-----NDDPGKRSKPA  2604
             KK++G VVLMKKN LDL DVGAS +D++ +  G+ VS QLISA+     N   GK  KPA
Sbjct  40    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  99

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  100   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  159

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y Y+RVFFSN+ YLPS TP PLRP+RE EL NLRG G+G  KEWDR
Sbjct  160   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDR  219

Query  2249  VYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L +  
Sbjct  220   VYDYAFYNDLGFPDKGPESVRPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPLGL-N  278

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F H+K SDFL YA+KS+GQV+IP I + FD T NEFDSF+D+  LYEGG+  
Sbjct  279   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIKL  338

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                 L  +++    E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGVNP
Sbjct  339   PDHHLNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNP  398

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I RLQ FPP S LDPKVYG+ TS+ITRE I   +D LTV++AI  N++FILDHHD +M
Sbjct  399   VIIRRLQEFPPASKLDPKVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDALM  458

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  T+ K YA+RTLLFLQ +GTLRP+AIELSLPHP GDK G  S V+TPA++GV
Sbjct  459   PYLRRINT-TNTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGDKHGATSLVFTPADEGV  517

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EGS+WQLAKAYAA NDSG HQL+SHWLNTHAVIEP +IATNR LS LHPI+KLL PHFRD
Sbjct  518   EGSVWQLAKAYAAVNDSGYHQLVSHWLNTHAVIEPFVIATNRHLSVLHPIFKLLQPHFRD  577

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L NA GV+EL+  PGKYAMEMS+++YKNWVF    LP DL+ RG+AV D
Sbjct  578   TMYINALARQILINAGGVLELTVFPGKYAMEMSSIVYKNWVFTEQGLPADLLKRGVAVPD  637

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              S P G+RLLIEDYP+AVDGLEIW+AI+ WV +YC+FYY  D M+  DTELQ+WWTEV  
Sbjct  638   SSQPFGLRLLIEDYPFAVDGLEIWSAIEAWVNDYCSFYYPTDDMIQDDTELQSWWTEVRN  697

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +R  L   CT IIW++SALHAAVNFGQY YAGY P RPTVSR+F
Sbjct  698   EGHGDLKDEPWWPQMQTRAELAKACTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSRRF  757

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+SDEIYLGQR+ PEWT 
Sbjct  758   MPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLGQRDTPEWTS  817

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLSG  294
             D +  +AF+RF  +LV +E RI+KMN D + KNR GPV VPY LL+P       E GL+G
Sbjct  818   DIQPRQAFQRFHDRLVEVENRIVKMNNDSRWKNRNGPVKVPYMLLYPNASGDNSESGLTG  877

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  878   KGIPNSVSI  886



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =  1098 bits (2840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/849 (63%), Positives = 659/849 (78%), Gaps = 12/849 (1%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKR  2616
             + E KKI G VVLMKKN LD  D  AS++D++ +  G  VS QLIS+     EN   GK 
Sbjct  23    SGECKKITGSVVLMKKNVLDFNDFHASLLDRVHELFGHGVSLQLISSVTSESENGLQGKV  82

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              +PA+LEDW   +  L  G+SA+ VTF+W E +G+PGA I+KNNH +EFYLKTLTLED  
Sbjct  83    GEPAYLEDWITTIAPLTPGDSAFKVTFDWNEEIGIPGAFIIKNNHHSEFYLKTLTLEDVP  142

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   + FVC SWVYPA  Y  DR+FF+N+ +LP +TP PLR +RE EL+NLRGDG GE +
Sbjct  143   GQGRIHFVCNSWVYPAKHYKKDRIFFANKTFLPHETPMPLRKYREEELENLRGDGKGELQ  202

Query  2261  EWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDP  G    RPILGG+ EYPYPRRGRTGR   ++DP YESRL LL
Sbjct  203   EWDRVYDYAYYNDLGDPKKGPKYVRPILGGSSEYPYPRRGRTGRAPAESDPNYESRLSLL  262

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                 IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD+T NEFDSFDD+  LYEG
Sbjct  263   MSLNIYVPRDERFGHLKMSDFLAYALKSIAQFLKPELEALFDSTPNEFDSFDDILKLYEG  322

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L  G LL+++ KN   E+ KE+ R+DGE LFKFP PQVI  SKTAWRTDEEF REML
Sbjct  323   GIKLPDGPLLDNVMKNIPFEMLKEIFRTDGERLFKFPMPQVIKESKTAWRTDEEFGREML  382

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AG+NPV I RL+ FPP+S L+ K YG+  S+IT +HI + LDGLTV++A+ +N+++ILDH
Sbjct  383   AGINPVIIRRLEEFPPKSKLNNKQYGNQNSSITEDHIKNNLDGLTVDEALKNNKLYILDH  442

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRINA T  K YA+RTLLFL+ D TL+P+AIELSLPHP GD+FG VS V TP
Sbjct  443   HDTVMPYLRRINA-TSTKTYASRTLLFLKADETLKPLAIELSLPHPEGDQFGAVSKVCTP  501

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             AE GVEGSIW LAKAY    DSGVHQLISHWL+THA IEPI+IATNRQLS LHPI+KLLH
Sbjct  502   AEDGVEGSIWLLAKAYVGVVDSGVHQLISHWLHTHATIEPIVIATNRQLSVLHPIHKLLH  561

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INA+ RQ+L NA G++E +  P KY+MEM+++ YK+W F   +LP DL  RG
Sbjct  562   PHFRDTMNINAVARQILINAGGLLEFTVFPAKYSMEMTSIAYKSWNFREQALPEDLKKRG  621

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D  +PHG+ LLI+DYP+AVDGLEIW+AI+ WV +YC+FYY+ D MV  D ELQ+WW
Sbjct  622   IAVEDPKAPHGLSLLIKDYPFAVDGLEIWSAIREWVKDYCSFYYETDDMVIKDPELQSWW  681

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKK+EPWWP++ +R  LI++CT IIWI+SALHAA+NFGQY Y GY P RP+
Sbjct  682   KEIREVGHGDKKEEPWWPKMHTREELIESCTIIIWIASALHAAINFGQYPYGGYLPNRPS  741

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR+F+PE  + +YEELK+NP+KA LKTITA  QT+LGISLIEILSRHASDE+YLGQR+ 
Sbjct  742   ISRRFLPEKDTPEYEELKSNPEKAFLKTITAQLQTVLGISLIEILSRHASDEVYLGQRDT  801

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D++ LEAF++FGKKL  IEE I++MN D +LKNR GPV + YTLL P+ E GL+G
Sbjct  802   PEWTTDEKPLEAFKQFGKKLEKIEEGIIEMNKDVQLKNRVGPVLMTYTLLVPSSEVGLTG  861

Query  293   KGIPNSISI  267
             +GIPNS+SI
Sbjct  862   RGIPNSVSI  870



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =  1098 bits (2840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/846 (64%), Positives = 656/846 (78%), Gaps = 13/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKIKG VVLMKKN LD  D  AS +D I +  G  VS QLIS+ N +P     GK  +PA
Sbjct  27    KKIKGTVVLMKKNVLDFNDFNASFLDGIHELAGHGVSLQLISSVNSEPENGLQGKVGEPA  86

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
              LEDW    T    G+SA+ VTF+W + +G+PGA I++NNH +EFYLKTLTLED  G   
Sbjct  87    LLEDWITTFTPATPGDSAFRVTFDWDDEIGIPGAFIIRNNHHSEFYLKTLTLEDVPGQGR  146

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y  DRVFF+N+AYLP +TP PLR +RE EL +LRGDG  E KEWDR
Sbjct  147   IHFVCNSWVYPAKRYKKDRVFFTNKAYLPHETPMPLRKYREEELVSLRGDGKAELKEWDR  206

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY  YNDL DPD G    RP+LGG+ +YPYPRRGRTGRK  ++DPKYESRL LL    
Sbjct  207   VYDYACYNDLADPDKGPKYDRPVLGGSDDYPYPRRGRTGRKPLESDPKYESRLSLLLSLN  266

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS-  1899
             IYVPRDE+FGHLK +DFL YALKSI Q + P + + FD T NEFDSFDD+  LYEGGL  
Sbjct  267   IYVPRDERFGHLKMADFLAYALKSIAQFIKPELEAVFDKTPNEFDSFDDVLKLYEGGLKL  326

Query  1898  -RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G LL++I KN  LE+ KE+ R+DGE LFKFP PQVI  +KTAWRTDEEF REMLAGVN
Sbjct  327   PEGPLLDNIIKNIPLEMLKEIFRTDGERLFKFPMPQVIKENKTAWRTDEEFGREMLAGVN  386

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I RLQ FPP+S LD K YGD  S++T EHI   LDGLT+++A+ +N+++ILDHHD +
Sbjct  387   PVLICRLQEFPPKSNLDSKRYGDQNSSVTEEHIKHNLDGLTIQEALENNKLYILDHHDTV  446

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y R+INA T  K YA+RTLLFL++DGTL+P+AIELSLPHP GD+FG ++ V TPAE G
Sbjct  447   MPYLRQINA-TSTKTYASRTLLFLKEDGTLKPVAIELSLPHPEGDEFGAINKVCTPAEDG  505

Query  1361  -VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
              VEGSIWQLAKAY A  DSGVHQLISHWL+THA +EP IIATNR LS LHPI+KLLHPHF
Sbjct  506   SVEGSIWQLAKAYVAVIDSGVHQLISHWLHTHAAMEPFIIATNRHLSVLHPIHKLLHPHF  565

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INA+ RQ+L NA G++E +  P KYAMEM++  YKNW F   +LP DL  RGMAV
Sbjct  566   RDTMNINAVARQILINAGGLLEFTVFPAKYAMEMTSKAYKNWNFTEQALPEDLKKRGMAV  625

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D + PHGVRLLI+DYP+AVDGLEIW+AI+ WV +YC+FYY+ D MV  D ELQ+WW E+
Sbjct  626   EDPNCPHGVRLLIKDYPFAVDGLEIWSAIREWVKDYCSFYYETDDMVKKDPELQSWWKEL  685

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              + GH DKK EPWWP++ +R  LI++CT IIW +SALHAA+NFGQY Y GY P RP++SR
Sbjct  686   REVGHGDKKHEPWWPKMQTREELIESCTIIIWTASALHAAINFGQYPYGGYLPNRPSISR  745

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE G+ +YEELKTNPDKA  KT+TA  QT+LGISLIEILSRH+SDE+YLGQR+ PEW
Sbjct  746   RFMPEKGTPEYEELKTNPDKAFFKTVTAQLQTVLGISLIEILSRHSSDEVYLGQRDTPEW  805

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D + LEAF++FGKKL  IE+RI++MN D +LKNR GPV VPYTLL P+ + GL+G+GI
Sbjct  806   TTDSKPLEAFKKFGKKLEKIEDRIIEMNKDVELKNRIGPVLVPYTLLVPSSDVGLTGRGI  865

Query  284   PNSISI  267
             PNS+SI
Sbjct  866   PNSVSI  871



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =  1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/847 (66%), Positives = 654/847 (77%), Gaps = 11/847 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-NDD--PGKRSKP  2607
             D+  K+KGRV+LMKKN LD  ++GAS+VD I D +GQKVS QLIS   N D   GK S P
Sbjct  14    DDRPKVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYDGLEGKLSNP  73

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
             A+LE W   +T + AGES + VTF+W R+  GVPGA I+KN H NEF+LK+LTLED    
Sbjct  74    AYLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNY  133

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL  LRGDGTG+ +EW
Sbjct  134   GKIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEW  193

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY  YNDLG+PD G+   RPILGG+ EYPYPRRGRTGR+ TK DP  ESR PL   
Sbjct  194   DRVYDYACYNDLGEPDKGEEYARPILGGSSEYPYPRRGRTGREPTKADPNCESRNPLPMS  253

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K+SDFL  +LKS  Q ++P   +  D T NEF+SF D+ +LYEGG 
Sbjct  254   LDIYVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKALCDNTPNEFNSFADVLNLYEGGI  313

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I  N + EI K++L++DG+ L K+PTPQVI   KTAWRTDEEF REMLAG
Sbjct  314   KLPEGPWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQGDKTAWRTDEEFGREMLAG  373

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
              NPV ISRLQ FPP+S LDP +YG+  STIT EH+ DKL+GLTV +AI SNR+FIL+HHD
Sbjct  374   SNPVLISRLQEFPPKSKLDPTIYGNQNSTITTEHVQDKLNGLTVNEAIKSNRLFILNHHD  433

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M   R+IN + + K YA+RTLLFLQ D TL+P+AIELSLPHP GD+FG VS VYTPA+
Sbjct  434   IVMPLLRKINMSANTKAYASRTLLFLQDDRTLKPLAIELSLPHPDGDQFGTVSKVYTPAD  493

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             QGVEGSIWQ AKAY A ND G+HQLISHWLNTHAVIEP +IATNR LS LHPI+KLLHPH
Sbjct  494   QGVEGSIWQFAKAYVAVNDMGIHQLISHWLNTHAVIEPFVIATNRHLSVLHPIHKLLHPH  553

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FR+TM+INAL R+ LT  DG  E S  P KY+MEMSA  YK+WVFP  +LP DL+ RG+A
Sbjct  554   FRNTMNINALARETLT-YDGGFETSLFPAKYSMEMSAAAYKDWVFPEQALPADLLKRGVA  612

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V DLSSPHG+RLLI DYPYAVDGLEIW AIK+WVTEYC FYYK+D  V  DTELQAWW E
Sbjct  613   VEDLSSPHGIRLLILDYPYAVDGLEIWAAIKSWVTEYCKFYYKSDETVEKDTELQAWWKE  672

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDE WWP++ +R  L D CT IIWI+SALHAA++FG Y+YAGY P RPT+S
Sbjct  673   LREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAALHFGLYSYAGYLPNRPTLS  732

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
                MPEPGS +YEELKTNPDK  LKT     Q+LL IS+ E+ SRHASDE+YLGQR+  E
Sbjct  733   CNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLGQRDSIE  792

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WTKDKE L AFERFGK L  IE RI+ MN     KNR+GPVNVPYTLLFPT EEGL+GKG
Sbjct  793   WTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPTSEEGLTGKG  852

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  853   IPNSVSI  859



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =  1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/847 (65%), Positives = 654/847 (77%), Gaps = 11/847 (1%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-NDD--PGKRSKP  2607
             D+  K+KGRV+LMKKN LD  ++GAS+VD I D +GQKVS QLIS   N D   GK S P
Sbjct  14    DDRPKVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYDGLEGKLSNP  73

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
             A+LE W   +T + AGES + VTF+W R+  GVPGA I+KN H NEF+LK+LTLED    
Sbjct  74    AYLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNY  133

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y  DR+FF+NQAYLPS+TP PLR +RE EL  LRGDGTG+ +EW
Sbjct  134   GKIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEW  193

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY  YNDLG+PD G+   RPILGG+ EYPYPRRGRTGR+ TK DP  ESR PL   
Sbjct  194   DRVYDYACYNDLGEPDKGEEYARPILGGSSEYPYPRRGRTGREPTKADPNCESRNPLPMS  253

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K+SDFL  +LKS  Q ++P   +  D T NEF+SF D+ +LYEGG 
Sbjct  254   LDIYVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKALCDNTPNEFNSFADVLNLYEGGI  313

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I  N + EI K++L++DG+ L K+PTPQVI   KTAWRTDEEF REMLAG
Sbjct  314   KLPEGPWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQGDKTAWRTDEEFGREMLAG  373

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
              NPV ISRLQ FPP+S LDP +YG+  STIT EH+ DKL+GLTV +AI SNR+FIL+HHD
Sbjct  374   SNPVLISRLQEFPPKSKLDPTIYGNQNSTITTEHVQDKLNGLTVNEAIKSNRLFILNHHD  433

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M   R+IN + + K YA+RTLLFLQ D TL+P+AIELSLPHP GD+FG VS VYTPA+
Sbjct  434   IVMPLLRKINMSANTKAYASRTLLFLQDDRTLKPLAIELSLPHPDGDQFGTVSKVYTPAD  493

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             QGVEGSIWQ AKAY A ND G+HQLISHWLNTHAVIEP ++ATNR LS LHPI+KLLHPH
Sbjct  494   QGVEGSIWQFAKAYVAVNDMGIHQLISHWLNTHAVIEPFVVATNRHLSVLHPIHKLLHPH  553

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FR+TM+INAL R+ LT  DG  E S  P KY+MEMSA  YK+WVFP  +LP DL+ RG+A
Sbjct  554   FRNTMNINALARETLT-YDGGFETSLFPAKYSMEMSAAAYKDWVFPEQALPADLLKRGVA  612

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V DLSSPHG+RLLI DYPYAVDGLEIW AIK+WVTEYC FYYK+D  V  DTELQAWW E
Sbjct  613   VEDLSSPHGIRLLILDYPYAVDGLEIWAAIKSWVTEYCKFYYKSDETVEKDTELQAWWKE  672

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDE WWP++ +R  L D CT IIWI+SALHAA++FG Y+YAGY P RPT+S
Sbjct  673   LREEGHGDKKDEAWWPKLQTRQELRDCCTIIIWIASALHAALHFGLYSYAGYLPNRPTLS  732

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
                MPEPGS +YEELKTNPDK  LKT     Q+LL IS+ E+ SRHASDE+YLGQR+  E
Sbjct  733   CNLMPEPGSVEYEELKTNPDKVFLKTFVPQLQSLLEISIFEVSSRHASDEVYLGQRDSIE  792

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WTKDKE L AFERFGK L  IE RI+ MN     KNR+GPVNVPYTLLFPT EEGL+GKG
Sbjct  793   WTKDKEPLVAFERFGKMLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFPTSEEGLTGKG  852

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  853   IPNSVSI  859



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =  1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/846 (63%), Positives = 655/846 (77%), Gaps = 15/846 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-------KRSKP  2607
             ++KG VVLMKKN LD  D  AS +D++ +FVG++VS QL+S+ N DPG       K  KP
Sbjct  22    RVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKLGKP  81

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG  2430
             A+LEDW   +  L AGE+A+ VTFEW E +G PGA I++NNH +EFYLK+LTLED    G
Sbjct  82    AYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVPGQG  141

Query  2429  V-QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
             V +F+C SWVYPADKY  DR+FFSN+ YLPS+TP PL  +RE EL+NLRG+G G+ +EWD
Sbjct  142   VIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQEWD  201

Query  2252  RVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY  YNDLG+PD G    RP LGG+ +YPYPRRGRT R   K+DPK ESRL +    
Sbjct  202   RVYDYALYNDLGNPDKGPQHARPTLGGSKDYPYPRRGRTSRPPAKSDPKCESRLNIASSL  261

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IYVPRDE+FGHLK +DFL YALKSI QV+ P   S FD+T NEFD F+D+  LYEGG+ 
Sbjct  262   DIYVPRDERFGHLKMADFLAYALKSIVQVLKPEFESLFDSTPNEFDKFEDVLKLYEGGIE  321

Query  1898  --RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                G+L E ++ N   E+ KE+ RSDG+ L KFP PQVI   K+AW+TDEEF RE+LAG+
Sbjct  322   VPEGILTE-VRDNIPAEMLKEIFRSDGQRLLKFPVPQVIAVDKSAWQTDEEFGRELLAGI  380

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I  LQ FPP S LDPK+YG+ TSTIT+EHI   L+G TV++AI   R+FILD HD 
Sbjct  381   NPVVIRGLQEFPPASKLDPKIYGNQTSTITKEHIESNLEGFTVDEAIKERRLFILDLHDA  440

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y +RIN+ T  K+YA+RT+LFLQ  GTL+P+AIELSLPHP GD++G +S VYTP EQ
Sbjct  441   LIPYVKRINS-TSTKMYASRTILFLQDSGTLKPLAIELSLPHPEGDQYGAISKVYTPVEQ  499

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             G+E S WQLAKAY    DSG HQLISHWL+THAVIEPII+ATNR LS LHPI+KLLHPHF
Sbjct  500   GIENSFWQLAKAYVVVADSGYHQLISHWLHTHAVIEPIILATNRHLSVLHPIHKLLHPHF  559

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INALGRQ+L NA G +EL+  P KY+ME S+VLYK+WVFP  +LP DL+ RG+AV
Sbjct  560   RDTMNINALGRQILINAGGALELTVCPSKYSMEFSSVLYKDWVFPEQALPEDLVKRGVAV  619

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D +SP+G+RLLIEDYP+AVDGLEIW AIKTWV +YC+FYYK D  +  DTELQ+WW E+
Sbjct  620   KDSTSPYGLRLLIEDYPFAVDGLEIWFAIKTWVKDYCSFYYKEDDTIKKDTELQSWWKEI  679

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              + GH DKKDEPWWP++ +   LI TCT IIWI+SALHAA+NFGQY Y G+ P RP +SR
Sbjct  680   REVGHGDKKDEPWWPKMQTCEELIQTCTIIIWIASALHAAINFGQYPYGGFPPSRPAISR  739

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE G+ +Y+EL  NPDKA LKT+T+    +LGISL+EILS+H+SDE+YLGQR+ P+W
Sbjct  740   RFMPEKGTPEYDELVANPDKAYLKTVTSQFLAVLGISLVEILSKHSSDEVYLGQRDTPDW  799

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D E L+AFE+FGKKL  IEERIL+MN D K +NR GPV +PYTLL+P+ + GL+G G+
Sbjct  800   TSDAEPLQAFEKFGKKLADIEERILRMNSDEKFRNRYGPVKMPYTLLYPSSKGGLTGMGV  859

Query  284   PNSISI  267
             PNSISI
Sbjct  860   PNSISI  865



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =  1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/880 (62%), Positives = 666/880 (76%), Gaps = 17/880 (2%)
 Frame = -1

Query  2861  FINIYKELSKLVTMILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQ  2682
             F  + +   K++ M   +          +  +KIKG VVLMKKN LD  D+ AS +D++ 
Sbjct  3     FCPVSEMFHKVMEMFCTQPKTKAKGNEVEGRRKIKGTVVLMKKNVLDFHDIKASFLDRVH  62

Query  2681  DFVGQKVSFQLISAENDDP----GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLG  2517
             + +G+ VS QL+SA + DP    G   K A++E W    T L AGE+ + +TFEW E++G
Sbjct  63    ELLGKGVSMQLVSAVHQDPDSLRGTLGKVAYVEKWVTSRTPLTAGETIFTITFEWDENMG  122

Query  2516  VPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPS  2340
             +PGA+I+KN+H ++ YLKT+TLED  G   + F+C SWVYP+ +Y Y+RVFFSN+AYLP 
Sbjct  123   LPGAIIIKNHHHSQLYLKTVTLEDVPGHGRLLFICNSWVYPSHRYKYNRVFFSNKAYLPC  182

Query  2339  QTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEY  2166
             QTP PLR +RE EL NLRG G GE KEWDRVYDYDYYNDLG+PD G+   RPILGG  EY
Sbjct  183   QTPEPLRLYREEELLNLRGHGKGELKEWDRVYDYDYYNDLGNPDKGEEYARPILGGTEEY  242

Query  2165  PYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVI  1986
             PYPRRGRTGR+ TKTDP  E RLPL+ + +IYVPRDE+FGHLK SDFL YALKS+ Q+++
Sbjct  243   PYPRRGRTGRRKTKTDPHTEKRLPLISL-DIYVPRDERFGHLKFSDFLAYALKSLVQILL  301

Query  1985  PFIASRFDATQNEFDSFDDMNSLYEGGLS--RGLLLEHIQKNTNLEITKEVLRSDGENLF  1812
             P I S  D T NEFD+F+D+ +LYEGGL       L  I+ +   E+  E++R+DGE   
Sbjct  302   PEIKSLCDKTINEFDTFEDVLNLYEGGLKLPNKPTLHKIRDHIPWEMLGELVRNDGERFL  361

Query  1811  KFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITR  1632
             KFP P VI A K+AWRTDEEFAREMLAGVNPV ISRLQ FPP S LDPK YG   S+I +
Sbjct  362   KFPKPDVIKADKSAWRTDEEFAREMLAGVNPVIISRLQEFPPASKLDPKAYGHQKSSIRK  421

Query  1631  EHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTL  1452
             E I + ++GLTV+QA+ SNR++ILDHHD ++ Y RRIN+ T  K YA+RT+L LQ DGTL
Sbjct  422   ELIEENMNGLTVDQALKSNRLYILDHHDALIPYLRRINS-TSTKTYASRTILLLQDDGTL  480

Query  1451  RPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNT  1272
             +P+AIELSLPHP GD  G VS V+TPAE GVEGS+WQLAKAYAA NDSG HQL+SHWLNT
Sbjct  481   KPLAIELSLPHPQGDHHGAVSKVFTPAEHGVEGSVWQLAKAYAAVNDSGYHQLVSHWLNT  540

Query  1271  HAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYA  1092
             HAVIEP +IATNRQLS +HPI KLLHPHFRDTM+INAL RQ+L NA G++E +  P KYA
Sbjct  541   HAVIEPFVIATNRQLSVIHPINKLLHPHFRDTMNINALARQILINAGGILEKTVFPAKYA  600

Query  1091  MEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKT  912
             MEMS+ +YKNWVF   +LP DLI RG+AV D S PHG+RLLIEDYPYAVDGL+IW+AI+T
Sbjct  601   MEMSSFVYKNWVFTEQALPADLIKRGVAVQDSSQPHGLRLLIEDYPYAVDGLQIWSAIET  660

Query  911   WVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTII  732
             WV EYC FYY  D ++  D+ELQ+WW E+   GH DKKDEPWWP + +   +  TCT II
Sbjct  661   WVKEYCAFYYPTDDLIQGDSELQSWWAEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVII  720

Query  731   WISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQ  552
             WI+SALHAAVNFGQY YAGY P RPT+SR+FMPEPG+ +Y+EL  NPD A LKTITA  Q
Sbjct  721   WIASALHAAVNFGQYPYAGYLPNRPTISRRFMPEPGTPEYDELAKNPDAAFLKTITAQLQ  780

Query  551   TLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDG  372
             TLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG+KLV IE +I+ MN D 
Sbjct  781   TLLGVSLIEILSRHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNNDK  840

Query  371   KLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             + KNR GPV VPYTLLFP     + E GL+GKGIPNS+SI
Sbjct  841   RWKNRVGPVQVPYTLLFPNTTDYSREGGLTGKGIPNSVSI  880



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =  1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/881 (62%), Positives = 666/881 (76%), Gaps = 18/881 (2%)
 Frame = -1

Query  2861  FINIYKELSKLVTMILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQ  2682
             F  + +   K++ M   +          +  +KIKG VVLMKKN LD  D+ AS +D++ 
Sbjct  3     FCPVSEMFHKVMEMFCTQPKTKAKGNEVEGRRKIKGTVVLMKKNVLDFHDIKASFLDRVH  62

Query  2681  DFVGQKVSFQLISAENDDP-----GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESL  2520
             + +G+ VS QL+SA + DP     G   K A++E W    T L AGE+ + +TFEW E++
Sbjct  63    ELLGKGVSMQLVSAVHQDPADSLRGTLGKVAYVEKWVTSRTPLTAGETIFTITFEWDENM  122

Query  2519  GVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLP  2343
             G+PGA+I+KN+H ++ YLKT+TLED  G   + F+C SWVYP+ +Y Y+RVFFSN+AYLP
Sbjct  123   GLPGAIIIKNHHHSQLYLKTVTLEDVPGHGRLLFICNSWVYPSHRYKYNRVFFSNKAYLP  182

Query  2342  SQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPE  2169
              QTP PLR +RE EL NLRG G GE KEWDRVYDYDYYNDLG+PD G+   RPILGG  E
Sbjct  183   CQTPEPLRLYREEELLNLRGHGKGELKEWDRVYDYDYYNDLGNPDKGEEYARPILGGTEE  242

Query  2168  YPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVV  1989
             YPYPRRGRTGR+ TKTDP  E RLPL+ + +IYVPRDE+FGHLK SDFL YALKS+ Q++
Sbjct  243   YPYPRRGRTGRRKTKTDPHTEKRLPLISL-DIYVPRDERFGHLKFSDFLAYALKSLVQIL  301

Query  1988  IPFIASRFDATQNEFDSFDDMNSLYEGGLS--RGLLLEHIQKNTNLEITKEVLRSDGENL  1815
             +P I S  D T NEFD+F+D+ +LYEGGL       L  I+ +   E+  E++R+DGE  
Sbjct  302   LPEIKSLCDKTINEFDTFEDVLNLYEGGLKLPNKPTLHKIRDHIPWEMLGELVRNDGERF  361

Query  1814  FKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTIT  1635
              KFP P VI A K+AWRTDEEFAREMLAGVNPV ISRLQ FPP S LDPK YG   S+I 
Sbjct  362   LKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVIISRLQEFPPASKLDPKAYGHQKSSIR  421

Query  1634  REHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGT  1455
             +E I + ++GLTV+QA+ SNR++ILDHHD ++ Y RRIN+ T  K YA+RT+L LQ DGT
Sbjct  422   KELIEENMNGLTVDQALKSNRLYILDHHDALIPYLRRINS-TSTKTYASRTILLLQDDGT  480

Query  1454  LRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLN  1275
             L+P+AIELSLPHP GD  G VS V+TPAE GVEGS+WQLAKAYAA NDSG HQL+SHWLN
Sbjct  481   LKPLAIELSLPHPQGDHHGAVSKVFTPAEHGVEGSVWQLAKAYAAVNDSGYHQLVSHWLN  540

Query  1274  THAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKY  1095
             THAVIEP +IATNRQLS +HPI KLLHPHFRDTM+INAL RQ+L NA G++E +  P KY
Sbjct  541   THAVIEPFVIATNRQLSVIHPINKLLHPHFRDTMNINALARQILINAGGILEKTVFPAKY  600

Query  1094  AMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIK  915
             AMEMS+ +YKNWVF   +LP DLI RG+AV D S PHG+RLLIEDYPYAVDGL+IW+AI+
Sbjct  601   AMEMSSFVYKNWVFTEQALPADLIKRGVAVQDSSQPHGLRLLIEDYPYAVDGLQIWSAIE  660

Query  914   TWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTI  735
             TWV EYC FYY  D ++  D+ELQ+WW E+   GH DKKDEPWWP + +   +  TCT I
Sbjct  661   TWVKEYCAFYYPTDDLIQGDSELQSWWAEIRNVGHGDKKDEPWWPEMQTLADVTQTCTVI  720

Query  734   IWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALP  555
             IWI+SALHAAVNFGQY YAGY P RPT+SR+FMPEPG+ +Y+EL  NPD A LKTITA  
Sbjct  721   IWIASALHAAVNFGQYPYAGYLPNRPTISRRFMPEPGTPEYDELAKNPDAAFLKTITAQL  780

Query  554   QTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGD  375
             QTLLG+SLIEILSRH++DE+YLGQR+ PEWT D E L AFERFG+KLV IE +I+ MN D
Sbjct  781   QTLLGVSLIEILSRHSTDEVYLGQRDTPEWTSDSELLAAFERFGRKLVEIENKIMDMNND  840

Query  374   GKLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
              + KNR GPV VPYTLLFP     + E GL+GKGIPNS+SI
Sbjct  841   KRWKNRVGPVQVPYTLLFPNTTDYSREGGLTGKGIPNSVSI  881



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =  1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/849 (65%), Positives = 661/849 (78%), Gaps = 12/849 (1%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKR  2616
             AD  KK+KG VVLMKK  LD  D  AS++D + + +G+KVS +L+SA + DP     GK 
Sbjct  24    ADRSKKVKGTVVLMKKYVLDFNDFNASVLDNVAELLGKKVSLRLVSAVHGDPEKGLRGKL  83

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              KPA+LE+W   +T L AG+SA+ VTF+W E +GVPGA+IV+NNH ++FYLKT+TLED  
Sbjct  84    GKPAYLEEWITTITPLAAGDSAFKVTFDWDEEVGVPGAIIVQNNHHSQFYLKTITLEDVP  143

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   V FVC SWVYPA++Y  DRVFFSN+ YLPSQTPAPL  +RE EL NLRGDGT E +
Sbjct  144   GEGRVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTAELQ  203

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLGDPD      RP+LGG+ EYPYPRRGRT R  T+TDP  ESRLPLL
Sbjct  204   EWDRVYDYAYYNDLGDPDKDPKYARPVLGGSAEYPYPRRGRTSRPPTETDPTTESRLPLL  263

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
                 +YVPRDE+ GHLK SDF+ Y LK++GQ + P + S  D+  NEFDSF D+ +LYEG
Sbjct  264   MSLNVYVPRDERLGHLKMSDFVAYTLKAVGQFLKPELESICDSMPNEFDSFQDVLNLYEG  323

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             G  L    LLE +++N  LE+ K ++R+DGE L ++P PQVI  +KTAWR+D EF REML
Sbjct  324   GIKLPDSPLLESLKENIPLEMLKILVRTDGEGLLEYPMPQVIKENKTAWRSDVEFGREML  383

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I  LQ FPP S LDPK+YG  +S+I  E I  +L+GLT EQAI  N++FILDH
Sbjct  384   AGVNPVMIRCLQEFPPASKLDPKIYGHQSSSIREELIQKQLNGLTAEQAIKMNKLFILDH  443

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD IM Y RRIN  T  K YATRTLLFL+ DGTL+P+AIELSLPHP GD+FG +S VYTP
Sbjct  444   HDAIMPYLRRINTTT-TKTYATRTLLFLKNDGTLKPLAIELSLPHPEGDEFGAISKVYTP  502

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+QGVEGSIWQLAKAY A NDSG HQLISHWLNTHAVIEP +IATNRQLS LHPI+KLLH
Sbjct  503   ADQGVEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLLH  562

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHF DTM+INA+ RQ++ NA G++E +  P KY+MEMS+ +YKNW+FP  +LP DLI RG
Sbjct  563   PHFHDTMNINAIARQIVINAGGILETTVFPAKYSMEMSSAIYKNWIFPEQALPADLIKRG  622

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D +S HG+RLLIEDYPYAVDGLEIW+AIKTWV +YC+FYYK+D  V  D ELQ+WW
Sbjct  623   VAVEDANSLHGLRLLIEDYPYAVDGLEIWSAIKTWVEDYCSFYYKSDQTVQKDEELQSWW  682

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+V++GH DKK EPWWP++ +   L + CT  IWI+SALHAAVNFGQY YAGY P RPT
Sbjct  683   RELVEEGHGDKKGEPWWPKMQTVKDLTEICTITIWIASALHAAVNFGQYPYAGYLPNRPT  742

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR++MPE G+ ++EELK NPDKA LKTITA  QTLL ISL+EILS H++DE+YLGQR+ 
Sbjct  743   LSRRYMPEEGTPEFEELKQNPDKAFLKTITAQFQTLLVISLMEILSMHSTDEVYLGQRDT  802

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D E LEAFERFGKKL  +EERI++MNGD + +NR GPV VPY LL+PT E G + 
Sbjct  803   PEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWRNRVGPVEVPYMLLYPTSEGGATA  862

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  863   KGIPNSVSI  871



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =  1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/847 (63%), Positives = 654/847 (77%), Gaps = 14/847 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLIS-------AENDDPGKRSK  2610
             K +KG VVLMKKN L++ D+ ASIVD + + +G+KV+ QLI+       +E +  GK  K
Sbjct  118   KTMKGIVVLMKKNLLEVNDIAASIVDSVDEILGRKVALQLITTASLDHDSEENLKGKPGK  177

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
              A+LED   K+  L AG++ Y VTFEW + +G+PGA  V N H +EFYLKTLTLED  G 
Sbjct  178   IAYLEDLITKIGPLTAGDATYTVTFEWTKEMGIPGAFTVTNFHHSEFYLKTLTLEDIPGH  237

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA  Y  DRVFF+NQ YLP+QTPA LR +RE EL+NLRG+GTG+ +EW
Sbjct  238   GRVHFVCNSWVYPAQYYKTDRVFFANQTYLPNQTPARLRRYREEELQNLRGNGTGKLEEW  297

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDYD YNDLGDPD      R ILGG+ EYPYPRRGRTGR +  +DP  ESR+PL   
Sbjct  298   DRVYDYDIYNDLGDPDKSPKHVRSILGGSTEYPYPRRGRTGRPLASSDPNSESRIPLYQS  357

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDE+F HLK SDF+ YALKSI Q + P   + FD T  EFDS +D+  LYEGG+
Sbjct  358   LSIYVPRDERFSHLKMSDFVAYALKSIFQFLAPEFEALFDKTPEEFDSLEDVLQLYEGGI  417

Query  1901  S--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
                 G LLE I ++   E  KE++RSDGE  FKFP PQVI   KTAWR+DEEF REMLAG
Sbjct  418   KVPNGSLLEKISEHIPFETIKELIRSDGEKSFKFPLPQVIKEDKTAWRSDEEFGREMLAG  477

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV I RLQ FPP STLDP++YG  +STI+ EHI + LDG T+ +AI  N++FILDHHD
Sbjct  478   LNPVVIRRLQEFPPASTLDPELYGKQSSTISEEHIVNSLDGFTIPEAIEKNKLFILDHHD  537

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y RRIN  T  K YATRT+LFL+ DGTL+P+AIELSLPHP GDKFG VS+VYTPAE
Sbjct  538   NLMPYLRRIN-TTAAKTYATRTVLFLKSDGTLKPLAIELSLPHPNGDKFGAVSSVYTPAE  596

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              G+EG++WQLAKAY A NDSG HQLI HWL THA IEP IIATNRQLS LHPI+KLL PH
Sbjct  597   DGIEGTVWQLAKAYVAVNDSGYHQLICHWLYTHAAIEPFIIATNRQLSVLHPIHKLLQPH  656

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM++NA+ RQ L NA G +E++  PGKYA+EMS+ +YKNW FP+  LP DL+ RG+A
Sbjct  657   FRDTMNVNAMARQTLINAGGFLEITVFPGKYALEMSSSIYKNWAFPDQGLPADLVKRGVA  716

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             + D SSPHGVRLLIEDYP+AVDGLEIWTAIKTWV +YC+ YYK D MV  DTELQ+WW E
Sbjct  717   IEDSSSPHGVRLLIEDYPFAVDGLEIWTAIKTWVEDYCSIYYKTDDMVQKDTELQSWWKE  776

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             V +KGH D KDEPWWP++ +R  LID+CT I+W++SALHAAVNFGQY Y GY P RP+ S
Sbjct  777   VREKGHGDMKDEPWWPKMQTRKELIDSCTIIVWVASALHAAVNFGQYPYGGYLPNRPSTS  836

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R F+P+ G+ +Y+ELKT+P+KA LKTIT+  Q++LGISLIEILSRH++DE+YLGQR+ PE
Sbjct  837   RHFIPDKGTPEYDELKTDPEKAFLKTITSQLQSVLGISLIEILSRHSADEVYLGQRDSPE  896

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D EA++AFE FG++LV IE RI++MN DG+ KNR+GPV +PYTLL P+ + GL+G+G
Sbjct  897   WTTDTEAIKAFEMFGERLVQIENRIIEMNKDGRWKNRSGPVKMPYTLLCPSSDIGLTGRG  956

Query  287   IPNSISI  267
             IPNSIS+
Sbjct  957   IPNSISM  963



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =  1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/851 (64%), Positives = 663/851 (78%), Gaps = 21/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             KK++G VVLMKKN LDLTDVGAS++D+  + +G+ VS QLISA++ +PG     K  KPA
Sbjct  41    KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  100

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  101   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  160

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y YDRVFF+N+ YLP  TP PLRP+RE EL +LRG G+G+ KEWDR
Sbjct  161   LHFVCNSWVYPAHRYKYDRVFFANKTYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDR  220

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L + +
Sbjct  221   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPLGL-D  279

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F  +K SDFL YA+KS+GQV+IP I + FD T NEFDSF+D+  LYEGG+  
Sbjct  280   IYVPRDERFTPVKLSDFLAYAVKSLGQVLIPEIVALFDKTINEFDSFEDVLKLYEGGIK-  338

Query  1895  GLLLEHIQKNTNL---EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
              L   H++K       E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGV
Sbjct  339   -LPDHHLKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGV  397

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP S LDP+VYG+ TS+I REHI   +DGLTV++AI  NR+FILDHHD 
Sbjct  398   NPVIIRRLQEFPPASKLDPEVYGNQTSSIKREHIDKNMDGLTVDEAIECNRLFILDHHDS  457

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YA+RTLLFLQ +GTLRP+AIELSLPHP GDK G  S V+TPA++
Sbjct  458   LLPYLRRINT-TKTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGDKHGATSLVFTPADE  516

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEG++WQLAKAYAA NDSG HQLISHWLNTHA IEP +IATNR LS LHPI+KLL PHF
Sbjct  517   GVEGTVWQLAKAYAAVNDSGYHQLISHWLNTHATIEPFVIATNRHLSVLHPIFKLLQPHF  576

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA G++EL+  PGKYAMEMS+++YKNWVF    LP DL+ RG+AV
Sbjct  577   RDTMYINALARQILINAGGILELTVFPGKYAMEMSSIVYKNWVFTEQGLPADLLKRGVAV  636

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
             +D S P+G++LLIEDYP+AVDGLE+W AI+ WV +YC+FYY  D M+  DTELQ+WW EV
Sbjct  637   LDSSQPYGLKLLIEDYPFAVDGLEVWAAIEAWVDDYCSFYYSTDDMIRDDTELQSWWMEV  696

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDEPWWP++ +R  L++ CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  697   RNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  756

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRHASDEIYLGQRE+PEW
Sbjct  757   RFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHASDEIYLGQRENPEW  816

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGL  300
             T D E  ++F+RF  +LV +E RI++ N D + KNR GPV VPY LL+P       E GL
Sbjct  817   TSDVEPRQSFQRFHDRLVDVENRIVERNNDSRWKNRNGPVKVPYMLLYPNASGDNSESGL  876

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  877   TGKGIPNSVSI  887



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =  1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/851 (64%), Positives = 663/851 (78%), Gaps = 21/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             KK++G VVLMKKN LDLTDVGAS++D+  + +G+ VS QLISA++ +PG     K  KPA
Sbjct  31    KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  90

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  91    FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  150

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y YDRVFF+N+ YLP  TP PLRP+RE EL +LRG G+G+ KEWDR
Sbjct  151   LHFVCNSWVYPAHRYKYDRVFFANKTYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDR  210

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L + +
Sbjct  211   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPLGL-D  269

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F  +K SDFL YA+KS+GQV+IP I + FD T NEFDSF+D+  LYEGG+  
Sbjct  270   IYVPRDERFTPVKLSDFLAYAVKSLGQVLIPEIVALFDKTINEFDSFEDVLKLYEGGIK-  328

Query  1895  GLLLEHIQKNTNL---EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
              L   H++K       E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGV
Sbjct  329   -LPDHHLKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGV  387

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP S LDP+VYG+ TS+I REHI   +DGLTV++AI  NR+FILDHHD 
Sbjct  388   NPVIIRRLQEFPPASKLDPEVYGNQTSSIKREHIDKNMDGLTVDEAIECNRLFILDHHDS  447

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YA+RTLLFLQ +GTLRP+AIELSLPHP GDK G  S V+TPA++
Sbjct  448   LLPYLRRINT-TKTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGDKHGATSLVFTPADE  506

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEG++WQLAKAYAA NDSG HQLISHWLNTHA IEP +IATNR LS LHPI+KLL PHF
Sbjct  507   GVEGTVWQLAKAYAAVNDSGYHQLISHWLNTHATIEPFVIATNRHLSVLHPIFKLLQPHF  566

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA G++EL+  PGKYAMEMS+++YKNWVF    LP DL+ RG+AV
Sbjct  567   RDTMYINALARQILINAGGILELTVFPGKYAMEMSSIVYKNWVFTEQGLPADLLKRGVAV  626

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
             +D S P+G++LLIEDYP+AVDGLE+W AI+ WV +YC+FYY  D M+  DTELQ+WW EV
Sbjct  627   LDSSQPYGLKLLIEDYPFAVDGLEVWAAIEAWVDDYCSFYYSTDDMIRDDTELQSWWMEV  686

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDEPWWP++ +R  L++ CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  687   RNEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  746

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRHASDEIYLGQRE+PEW
Sbjct  747   RFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHASDEIYLGQRENPEW  806

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGL  300
             T D E  ++F+RF  +LV +E RI++ N D + KNR GPV VPY LL+P       E GL
Sbjct  807   TSDVEPRQSFQRFHDRLVDVENRIVERNNDSRWKNRNGPVKVPYMLLYPNASGDNSESGL  866

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  867   TGKGIPNSVSI  877



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =  1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/846 (64%), Positives = 661/846 (78%), Gaps = 16/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-------GKRSK  2610
             KKIKG VVLMKKN LD  D  AS +D+  + +G+KV+ QLISA + +P       GK  K
Sbjct  33    KKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIGK  92

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
              A +E W  K T L AGESA++VTFEW E +GVPGA +++NNH +EFYLKTLTLED  G 
Sbjct  93    LAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPGE  152

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA  YN DR+FF+N+ YLP+QTP PLR +RE EL NLRGDGT E +E 
Sbjct  153   GRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQELVNLRGDGTTELQEH  212

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLGDP  GK   RP+LGG+ +YPYPRRGRTGRK+ + D K ESRL ++  
Sbjct  213   DRVYDYAYYNDLGDPKKGKKFERPVLGGSADYPYPRRGRTGRKLAE-DSKSESRLSIVYS  271

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDE+FGHLK SDFL +ALKSI QV+ P + S  D++ NEFDSFDD+  LYEGG+
Sbjct  272   LNIYVPRDERFGHLKMSDFLAFALKSIAQVIKPALES-LDSSPNEFDSFDDILKLYEGGI  330

Query  1901  SR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                  LL+ I+K+   E+ KE+ R+DG+ L KFP PQVI   ++AWRTDEEF REMLAG+
Sbjct  331   DLPNNLLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIKEDESAWRTDEEFTREMLAGL  389

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I  L+ FPP S L+P++YG+  STIT+  I + LDGLTV++AI  N++FILDHHD 
Sbjct  390   NPVIICCLKEFPPTSKLNPELYGNQRSTITQNDIENNLDGLTVDEAIEKNKLFILDHHDS  449

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T  K YA+RT+LFL+ DGTL+P+AIELSLPHP GD++G VS VYTP+E 
Sbjct  450   LMTYLRRINT-TSTKTYASRTILFLKADGTLKPVAIELSLPHPDGDQYGAVSKVYTPSED  508

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GV+GSIWQLAKAY A NDSG HQLISHWLNTHA IEP +IATNRQLS LHPIYKLLHPHF
Sbjct  509   GVKGSIWQLAKAYVAVNDSGHHQLISHWLNTHAAIEPFVIATNRQLSVLHPIYKLLHPHF  568

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INA  RQ+L NA GV+E++  PGKYAME+S+ LYK+W FP  +LP DL  RG+AV
Sbjct  569   RDTMNINAFARQILINAGGVLEITVFPGKYAMELSSALYKSWSFPEQALPEDLKKRGVAV  628

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D +SPHG+RLLIEDYPYAVDGLEIW +IK WV +YC FYYKND MV  D+ELQ+WW E+
Sbjct  629   EDPNSPHGLRLLIEDYPYAVDGLEIWASIKKWVQDYCYFYYKNDDMVKEDSELQSWWKEL  688

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH DKKDEPWWP++ +R  LID+CT IIW++SALHAA+NFGQY YAGY P RPT+SR
Sbjct  689   REEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAINFGQYPYAGYLPNRPTISR  748

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE G+ +Y+EL++NPDK  LKTITA  QT+LGISLIEILSRH++DE+YLGQR+ PEW
Sbjct  749   RFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEILSRHSTDEVYLGQRDTPEW  808

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D+  L+AF+ FGKKL  +EE+I+  N +  LKNR GPV +PYTLL PT E GL+GKGI
Sbjct  809   TSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVKMPYTLLVPTSEGGLTGKGI  868

Query  284   PNSISI  267
             PNS+SI
Sbjct  869   PNSVSI  874



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =  1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/848 (64%), Positives = 655/848 (77%), Gaps = 13/848 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E KKI+G VVLMKK FLD  D+ AS+ D+  + +G KVS QLISA N DP     GK  K
Sbjct  19    EIKKIQGTVVLMKKKFLDSNDLTASVTDRFDEILGNKVSLQLISAVNGDPEKELRGKLGK  78

Query  2609  PAFLEDWG-KLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA LEDW  K+T+L A    ++VTFEW E +GVPGA I+KN+H NEFYLKT+TLED  G 
Sbjct  79    PANLEDWDTKITALTAPGVTFNVTFEWEEEIGVPGAFIIKNSHHNEFYLKTVTLEDVPGH  138

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA  Y  DRVFF+NQ YLP++TPAPLR +RE EL  LRG+G G+ +EW
Sbjct  139   GRVHFVCNSWVYPASCYKKDRVFFTNQTYLPTETPAPLRCYREEELLTLRGNGNGKLEEW  198

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDYD YNDL +P+ G    RPILGG+ EYPYPRRGRTGR   +TDP++ESR+PL   
Sbjct  199   DRVYDYDIYNDLSEPEKGPKHVRPILGGSSEYPYPRRGRTGRPPAETDPRHESRIPLFKS  258

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDE+F HLK SD + Y LKS  Q ++P + ++FD+T +EFD F+D+  LYE G+
Sbjct  259   LSIYVPRDERFSHLKFSDLVAYGLKSAVQFIVPEVEAQFDSTPSEFDKFEDILQLYEKGI  318

Query  1901  SRGL---LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
              +     LLE I+    L+  KE+LR+DGE  F+FPTPQVI   K+AWRTDEEFAREMLA
Sbjct  319   KKVPNFPLLESIRNQIPLQTLKELLRTDGEQPFRFPTPQVIKEDKSAWRTDEEFAREMLA  378

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I RLQ FPP S L+P+VY +  S+ T+E I   L+GLT+++A+ + ++F LD+H
Sbjct  379   GINPVVICRLQEFPPNSKLNPQVYNNEASSKTKECIEKNLEGLTIDEALNNKKLFTLDYH  438

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN+ T  KIYATRTLLFL+ DGTL+P+AIE+SLPHP  DK G VS VYTPA
Sbjct  439   DILMPYLRRINS-TSTKIYATRTLLFLKNDGTLKPLAIEMSLPHPEDDKLGEVSEVYTPA  497

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E G EG+IWQLAKAY A NDSG HQLISHWL THAVIEP IIATNRQLS LHPI++LLHP
Sbjct  498   EHGAEGTIWQLAKAYVAINDSGYHQLISHWLYTHAVIEPFIIATNRQLSVLHPIHRLLHP  557

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM++NAL RQ L N  G++E +  P KYAME+SAV YK WVFP  +LP DLI RG+
Sbjct  558   HFRDTMNVNALARQTLINGGGLLERTVFPSKYAMELSAVAYKGWVFPEQALPADLIKRGV  617

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV DL SPHGVRLLIEDYPYAVDGLEIW+AIKTWV +YC+ YYK D ++  D ELQ+WW 
Sbjct  618   AVEDLKSPHGVRLLIEDYPYAVDGLEIWSAIKTWVEDYCSSYYKTDDIIQEDLELQSWWN  677

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ +KGH DKKDEPWWP++ +   L++TCTTIIW++SALHAAVNFGQY Y GY P RP +
Sbjct  678   ELREKGHGDKKDEPWWPKMQTHKELVETCTTIIWVASALHAAVNFGQYPYGGYLPNRPAM  737

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+F+PE  + DY EL++NP+KA LKT+T    ++LGISLIEILSRH +DE++LGQR+ P
Sbjct  738   SRRFIPERDTPDYAELESNPEKAFLKTVTPQMLSILGISLIEILSRHTADEVFLGQRDTP  797

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT DKEAL+AFERFG+KL  IE+RI +MN D KL+NRTGP  +PYTLLFPT E GL+GK
Sbjct  798   EWTTDKEALKAFERFGEKLTEIEDRITRMNNDEKLRNRTGPAKMPYTLLFPTSEVGLTGK  857

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  858   GIPNSVSI  865



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/844 (64%), Positives = 651/844 (77%), Gaps = 16/844 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPAFL  2598
             I+G V++ KKN LD  D+ AS++D++ +FVG++VS QLISA   DPG     K  KPA+L
Sbjct  16    IRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAYL  75

Query  2597  EDW-GKLTSLVAGESAYDVTFEWR--ESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAGV  2427
             EDW   +T L AGESA+ V F+W   E +G PGA +V+NNH +EFYLK+LTLE+    GV
Sbjct  76    EDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKSLTLENVPGHGV  135

Query  2426  -QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
               F+C SWVYPA KY  DR+FFSN+ YLPS+TP PL  +RE EL+NLRGDG G  +EWDR
Sbjct  136   IHFICNSWVYPAHKYKTDRIFFSNKTYLPSETPVPLLKYREEELENLRGDGKGTLQEWDR  195

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  TK+D   ESRL      +
Sbjct  196   VYDYAYYNDLGDPDKGAQYARPVLGGSIEYPYPRRGRTGRPPTKSDANSESRLNFAMSLD  255

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDEKFGHLK SDFL  ALKSI Q+V P + S FD+   EFDSF+D+  LYEGG+  
Sbjct  256   IYVPRDEKFGHLKLSDFLANALKSIAQIVKPELESLFDSIPEEFDSFEDVFKLYEGGIKV  315

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                +L++I+     E+ KE+LR+DGE   KFP PQVI   K+AWRTDEEFAREMLAGVNP
Sbjct  316   PESILKNIRDKIPAEMLKEILRTDGERFLKFPVPQVIKEDKSAWRTDEEFAREMLAGVNP  375

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  L+ FPP S LD KVYGD TSTI ++HI   +DGLT   AI   ++FILDHHD ++
Sbjct  376   VIIRCLKEFPPESKLDSKVYGDQTSTIRKKHIESNMDGLT---AIRQKKLFILDHHDALI  432

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  K YA+RT+LFLQ DGTL+P+ IELSLPHP  D++G +S VYTPAE+GV
Sbjct  433   PYLRRINS-TSTKTYASRTILFLQNDGTLKPLVIELSLPHPEEDQYGVISKVYTPAEEGV  491

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWLNTHAVIEP +IA NRQLS LHPIYKLLHPHFRD
Sbjct  492   ENSIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFVIAANRQLSVLHPIYKLLHPHFRD  551

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L N  G++E +  P KY+MEMS+V+YKNWVFP+ +LP DLI RGMAV D
Sbjct  552   TMNINALARQILINGGGIVEATVFPSKYSMEMSSVIYKNWVFPDQALPTDLIKRGMAVKD  611

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
                PHG+RLLIEDYPYAVDGLEIW AIK WV +YC+FYYK D  V  D+ELQ+WW E+ +
Sbjct  612   SGCPHGLRLLIEDYPYAVDGLEIWFAIKKWVQDYCSFYYKEDDTVKKDSELQSWWKELRE  671

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK+EPWWP++ +R  LI+ CT IIW++SALHA+ NFGQY YAG+ P RPT+SR+F
Sbjct  672   EGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHASTNFGQYPYAGFLPNRPTISRRF  731

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+++Y+EL  NPDK  LKTITA  QTL+GISLIEILSRH+SDE++LGQR+ P WT 
Sbjct  732   MPEEGTSEYDELVNNPDKVFLKTITAQLQTLIGISLIEILSRHSSDELHLGQRDTPNWTC  791

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D E LEAF+ FGKKLV IEERI+ +N DGK KNR GPVN+PYTLLFP+ + GL+G GIPN
Sbjct  792   DVEPLEAFDEFGKKLVEIEERIMALNNDGKHKNRVGPVNMPYTLLFPSSKAGLTGMGIPN  851

Query  278   SISI  267
             S++I
Sbjct  852   SVAI  855



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =  1093 bits (2827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/846 (64%), Positives = 660/846 (78%), Gaps = 16/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-------GKRSK  2610
             KKIKG VVLMKKN LD  D  AS +D+  + +G+KV+ QLISA + +P       GK  K
Sbjct  33    KKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIGK  92

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
              A +E W  K T L AGESA++VTFEW E +GVPGA +++NNH +EFYLKTLTLED  G 
Sbjct  93    LAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPGE  152

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SWVYPA  YN DR+FF+N+ YLP+QTP PLR +RE EL NLRGD T E +E 
Sbjct  153   GRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQELVNLRGDVTTELQEH  212

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLGDP  GK   RP+LGG+ +YPYPRRGRTGRK+ + D K ESRL ++  
Sbjct  213   DRVYDYAYYNDLGDPKKGKKFERPVLGGSADYPYPRRGRTGRKLAE-DSKSESRLSIVYS  271

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDE+FGHLK SDFL +ALKSI QV+ P + S  D++ NEFDSFDD+  LYEGG+
Sbjct  272   LNIYVPRDERFGHLKMSDFLAFALKSIAQVIKPALES-LDSSPNEFDSFDDILKLYEGGI  330

Query  1901  SR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                  LL+ I+K+   E+ KE+ R+DG+ L KFP PQVI   ++AWRTDEEF REMLAG+
Sbjct  331   DLPNNLLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIKEDESAWRTDEEFTREMLAGL  389

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I  L+ FPP S L+P++YG+  STIT+  I + LDGLTV++AI  N++FILDHHD 
Sbjct  390   NPVVICCLKEFPPTSKLNPELYGNQRSTITQNDIENNLDGLTVDEAIEKNKLFILDHHDS  449

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T  K YA+RT+LFL+ DGTL+P+AIELSLPHP GD++G VS VYTP+E 
Sbjct  450   LMTYLRRINT-TSTKTYASRTILFLKADGTLKPVAIELSLPHPDGDQYGAVSKVYTPSED  508

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GV+GSIWQLAKAY A NDSG HQLISHWLNTHA IEP +IATNRQLS LHPIYKLLHPHF
Sbjct  509   GVKGSIWQLAKAYVAVNDSGHHQLISHWLNTHAAIEPFVIATNRQLSVLHPIYKLLHPHF  568

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INA  RQ+L NA GV+E++  PGKYAME+S+ LYK+W FP  +LP DL  RG+AV
Sbjct  569   RDTMNINAFARQILINAGGVLEITVFPGKYAMELSSALYKSWSFPEQALPEDLKKRGVAV  628

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D +SPHG+RLLIEDYPYAVDGLEIW +IK WV +YC FYYKND MV  D+ELQ+WW E+
Sbjct  629   EDPNSPHGLRLLIEDYPYAVDGLEIWASIKKWVQDYCYFYYKNDDMVKEDSELQSWWKEL  688

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              ++GH DKKDEPWWP++ +R  LID+CT IIW++SALHAA+NFGQY YAGY P RPT+SR
Sbjct  689   REEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAINFGQYPYAGYLPNRPTISR  748

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE G+ +Y+EL++NPDK  LKTITA  QT+LGISLIEILSRH++DE+YLGQR+ PEW
Sbjct  749   RFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEILSRHSTDEVYLGQRDTPEW  808

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D+  L+AF+ FGKKL  +EE+I+  N +  LKNR GPV +PYTLL PT E GL+GKGI
Sbjct  809   TSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVKMPYTLLVPTSEGGLTGKGI  868

Query  284   PNSISI  267
             PNS+SI
Sbjct  869   PNSVSI  874



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =  1093 bits (2826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/850 (64%), Positives = 661/850 (78%), Gaps = 19/850 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI+G VVLMKKN LD  D+ AS++D+  + +G+ V+ QLIS+ N DP     GK  K A+
Sbjct  27    KIRGTVVLMKKNLLDFNDLHASVLDRFDELLGEGVALQLISSVNADPVNGMRGKVGKAAY  86

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LE+W   +T L AG S++ VTF+W   +GVPGA I+KN H +EF+LKT+TLED  G   +
Sbjct  87    LEEWITTVTPLTAGASSFKVTFDWDADIGVPGAFIIKNFHHSEFFLKTVTLEDVPGVGRL  146

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              F+C SW+YPA +Y  DRVFF+NQ+YLP++TP PLR +RE EL NLRGDGT E +EWDRV
Sbjct  147   HFLCNSWIYPAKRYKNDRVFFTNQSYLPAKTPEPLRKYREEELVNLRGDGTEELQEWDRV  206

Query  2246  YDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLGDPD G    RPILGG+ EYPYPRRGRTGRK T TDP  ESRLP LP  +I
Sbjct  207   YDYAYYNDLGDPDKGPEYARPILGGSTEYPYPRRGRTGRKPTMTDPNSESRLPPLPSLDI  266

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGHLK SDFL YALKS+ Q ++P + +  D T NEFD+F D+ +LYEGG  L 
Sbjct  267   YVPRDERFGHLKMSDFLAYALKSLVQFLLPELKALCDKTPNEFDTFQDVFNLYEGGTQLP  326

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              G   + ++     E+ KE+ R+DGE L KFP PQVI   K AWRTDEEFAREMLAGVNP
Sbjct  327   SGAF-DRLKDAIPFEMLKELFRTDGEQLLKFPLPQVIQHDKFAWRTDEEFAREMLAGVNP  385

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGL-TVEQAIWSNRVFILDHHDGI  1542
             +CI  LQ FPP S LDPK+YG+ TS+ITREHI + L+GL +V++AI   ++FILD+HD +
Sbjct  386   ICICGLQEFPPASKLDPKLYGNQTSSITREHIENNLNGLLSVDEAIRKKKLFILDYHDAL  445

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y  RIN+ T  K YA+RT+LFL+ DGTL+P+AIELSLPHP G + G VS V+TP+E G
Sbjct  446   IPYLERINS-TITKTYASRTILFLKDDGTLKPLAIELSLPHPQGVQHGSVSKVFTPSEHG  504

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHA IEP +IATNRQLS LHPI+KLLHPHFR
Sbjct  505   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHATIEPFVIATNRQLSVLHPIHKLLHPHFR  564

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DT++INAL RQ+L NA GV+E +  P K+AMEMS+VLYK+WVF + +LP DLINRG+A+ 
Sbjct  565   DTLNINALARQILINAGGVLEKTVFPAKFAMEMSSVLYKSWVFTDLALPVDLINRGIAIP  624

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDGLEIW+AI+ WV +YC++YY ND ++  D+ELQ WWTE+ 
Sbjct  625   DSNSPHGLRLLIEDYPYAVDGLEIWSAIERWVHDYCSYYYPNDDLIQGDSELQCWWTELR  684

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
               GH DKKDEPWWP++ +   L  TCT IIW++SA HAAVNFGQY YAGY P RPT+SR+
Sbjct  685   NVGHGDKKDEPWWPKMQTLSDLTQTCTIIIWVASAFHAAVNFGQYPYAGYLPNRPTISRR  744

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ DY EL++NPDK  LKTITA  QTLLG+SLIEILSRH+SDE+YLGQRE PEWT
Sbjct  745   FMPEPGTPDYAELESNPDKVYLKTITAQLQTLLGVSLIEILSRHSSDEVYLGQRESPEWT  804

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEGLS  297
              D  ALEAFERFGKKLV IE RI++MN D + KNR GPV VPY LL+P     TG  GL+
Sbjct  805   SDAAALEAFERFGKKLVEIENRIIEMNNDKRWKNRVGPVKVPYMLLYPDTSNYTGVGGLT  864

Query  296   GKGIPNSISI  267
             G+G+PNSISI
Sbjct  865   GRGVPNSISI  874



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score =  1091 bits (2822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/832 (65%), Positives = 652/832 (78%), Gaps = 13/832 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKG +VLMKKN LD  D  AS++D + + +GQ+VS QLISA++ D      GK  +PA
Sbjct  20    RKIKGTLVLMKKNVLDFNDFNASVLDGVHELLGQRVSLQLISADHGDSENGFKGKLGEPA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +LEDW   +T L  G+SAY VTF+W E +GVPGA+++KNNH +EF+LKT+TLED    G 
Sbjct  80    YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V FVC SWVYPA+KY  DRVFF N+ +LPS+TP PL+ +RE EL +LRGDG GE +EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFLNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PD G    RP LGG+ EYPYPRRGRTGR  TKTD   ESR+PLL    
Sbjct  200   VYDYAYYNDLGNPDMGPKYARPTLGGSSEYPYPRRGRTGRPPTKTDSNSESRIPLLLSLN  259

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YALKSI Q + P + + FD T +EFDS +D+  LYEGG  L
Sbjct  260   IYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPSEFDSLEDVLKLYEGGIPL  319

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               GLL + I  N   E+ KE+ R+DG  L +FP PQVI   K+AWRTDEEFAREMLAGVN
Sbjct  320   PEGLL-KDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV IS LQ FPP S LDPKVYGD TS IT + I + LDGLTV +A+  N++FILDHHD +
Sbjct  379   PVNISLLQEFPPASKLDPKVYGDQTSRITEQDIGNNLDGLTVHEALKQNKLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y RRIN+ T  KIYA+RT+LFL+ DGTL+P+ IELSLPHP GD+FG +S VYTPAE+G
Sbjct  439   MPYLRRINS-TSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGDRFGRISKVYTPAEEG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSG HQLISHWLNTHAV EP++IATNRQLS +HPIYKLLHPHFR
Sbjct  498   VEGSIWQLAKAYVAVNDSGYHQLISHWLNTHAVCEPVVIATNRQLSVVHPIYKLLHPHFR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INA  RQ++ NA G++E +  P +YAME+S+V+YK+WVF   +LP DLI RG+AV 
Sbjct  558   DTMNINAFARQIVINAGGILETTVFPARYAMELSSVVYKDWVFTEQALPEDLIKRGVAVK  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SPHG+RLLIEDYPYAVDG+EIW AIKTWV +YC+FYYK D ++  DTELQ+WW E+V
Sbjct  618   DANSPHGLRLLIEDYPYAVDGIEIWFAIKTWVEDYCSFYYKTDDIIQKDTELQSWWKELV  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             ++GH DKKDEPWWP++ +R  L++TCT IIW +SALHAAVNFGQY +AGY P RPT+SRK
Sbjct  678   EEGHGDKKDEPWWPKMQTREDLVETCTIIIWTASALHAAVNFGQYPFAGYLPNRPTISRK  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPE G+ +Y+EL+++PD   LKTITA  QT+LGI+LIEILSRH++DE+YLGQR+ PEWT
Sbjct  738   FMPEKGTPEYKELESSPDTVFLKTITAQLQTVLGIALIEILSRHSTDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE  306
              D E L+AF++FGKKL  IE+RI  MN D KLKNR GPV VPYTLL    E+
Sbjct  798   ADTEPLKAFDKFGKKLAEIEDRITSMNNDEKLKNRVGPVKVPYTLLLLAKED  849



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =  1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/855 (64%), Positives = 656/855 (77%), Gaps = 19/855 (2%)
 Frame = -1

Query  2780  ADEPK-KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
              DE K KIKG VVLMKKN LD  D+ AS +D++ + +G+ VS QLISA N DP     G+
Sbjct  30    VDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGR  89

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               K A+LE W   +T L A E+ + +TF+W E++GVPGA I++N+H ++FYLKT+TLED 
Sbjct  90    LGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDV  149

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   + FVC SWVYP  +Y YDRVFFSN+ YLP QTP PLR +R  EL NLRG+G GE 
Sbjct  150   PGHGRIHFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGEL  209

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY +YNDLG+PD G    RP+LGG+ EYPYPRRGRTGRK TKTDP  E RLPL
Sbjct  210   KEWDRVYDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPL  269

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             + + +IYVPRDE+FGHLK SDFL YALKS+ Q+++P I S  D T NEFDSFDD+ +LYE
Sbjct  270   ISL-DIYVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYE  328

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L     +  I+     E+ KE++R+DGE   KFP P VI   ++AWRTDEEFAREM
Sbjct  329   GGIKLPNSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREM  388

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV ISRLQ FPP S LDPKVYG+  S+ITR  I   ++ LT+++AI + ++F LD
Sbjct  389   LAGVNPVIISRLQEFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLD  448

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN+ T+ K YA+RTLL LQ DGTL+P+AIELSLPHP GD  G VS V+T
Sbjct  449   HHDALMPYLRRINS-TNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGDHHGAVSKVFT  507

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVEGS+WQLAKAYAA NDSG HQL+SHWL+THAVIEP +IATNRQLS LHPIYKLL
Sbjct  508   PAENGVEGSVWQLAKAYAAVNDSGYHQLVSHWLDTHAVIEPFVIATNRQLSVLHPIYKLL  567

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NA GV+E +  P KYAMEMSAV+YKNWVF   +LP DL+ R
Sbjct  568   HPHFRDTMNINALARQILINAGGVLENTVFPAKYAMEMSAVIYKNWVFTEQALPADLLKR  627

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+A  D S PHG++LLIEDYPYAVDGLEIW AI+TWV EYC+FYY  D ++  D ELQ+W
Sbjct  628   GVAEPDASQPHGIKLLIEDYPYAVDGLEIWAAIETWVKEYCSFYYPRDHLIQGDNELQSW  687

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+   GH DK+DEPWWP + +R  L+ TCT IIW++SALHAAVNFGQY YAGY P RP
Sbjct  688   WEELRNVGHGDKRDEPWWPEMQTRAELVQTCTIIIWVASALHAAVNFGQYPYAGYLPNRP  747

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +Y EL+ NPD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQR+
Sbjct  748   TVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLGQRD  807

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              PEWT D E L AFERFG +L+ IE RIL+MN D + KNR G V VPYTLL+P     + 
Sbjct  808   TPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVPYTLLYPNTSDYSR  867

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  868   EGGLTGKGIPNSVSI  882



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =  1088 bits (2815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/851 (63%), Positives = 663/851 (78%), Gaps = 21/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             +K++G VVLMKKN LD TDVGAS++D+  + +G+ VS QLISA++ +PG     K  +PA
Sbjct  28    QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  87

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  88    FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  147

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYP  +Y YDR+FF+N+ YLPS TP PLRP+RE EL +LRG G+G+ KEWDR
Sbjct  148   LHFVCNSWVYPEHRYKYDRMFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  207

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L + +
Sbjct  208   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPLGL-D  266

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F  +K SDFL YA+KS+GQV++P I + FD T NEFDSF+D+  LYEGG+  
Sbjct  267   IYVPRDERFTPMKLSDFLAYAVKSLGQVLVPEIVALFDKTINEFDSFEDVLKLYEGGIK-  325

Query  1895  GLLLEHIQKNTNL---EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
              L   H++K       E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGV
Sbjct  326   -LPDHHLKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGV  384

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP STLDP+VYG+ TS+I REHI   +DG+TV++AI  NR+FILDHHD 
Sbjct  385   NPVIIRRLQEFPPASTLDPEVYGNQTSSIKREHIEKNMDGVTVDEAIEGNRLFILDHHDA  444

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YA+RTLLFLQ +GTLRP+AIELSLPHP GDK G  S V+TPA++
Sbjct  445   LLPYLRRINT-TKTKTYASRTLLFLQDNGTLRPVAIELSLPHPQGDKHGATSLVFTPADE  503

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEG++WQLAKAYAA NDSG HQLISHWLNTHA IEP +IA NR LS LHPI+KLL PHF
Sbjct  504   GVEGTVWQLAKAYAAVNDSGYHQLISHWLNTHATIEPFVIAANRHLSVLHPIFKLLQPHF  563

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA G++EL+  PGKYAMEMS+++YK+WVF    LP DL+ RG+AV
Sbjct  564   RDTMYINALARQILINAGGILELTVFPGKYAMEMSSIVYKSWVFTEQGLPADLLKRGIAV  623

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D S P+G++LLIEDYP+AVDGLE+W AI+ WV +YC+FYY  D ++  DTELQ+WW EV
Sbjct  624   PDSSQPYGLKLLIEDYPFAVDGLEVWAAIEAWVDDYCSFYYSTDEVIRDDTELQSWWMEV  683

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDEPWWP++ +R  LI+TCTTIIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  684   RNEGHGDLKDEPWWPQMQTRSELIETCTTIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  743

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+S+EIYLGQRE+PEW
Sbjct  744   RFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHSSEEIYLGQRENPEW  803

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGL  300
             T D E  ++F+RF  +LV IE RI++ N D + KNR GPV VPY LL+P       E GL
Sbjct  804   TSDVEPRQSFQRFHDRLVDIENRIVERNSDSRWKNRNGPVKVPYMLLYPNASGDNSESGL  863

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  864   TGKGIPNSVSI  874



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =  1088 bits (2815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/851 (63%), Positives = 663/851 (78%), Gaps = 21/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             +K++G VVLMKKN LD TDVGAS++D+  + +G+ VS QLISA++ +PG     K  +PA
Sbjct  45    QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  104

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  105   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  164

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYP  +Y YDR+FF+N+ YLPS TP PLRP+RE EL +LRG G+G+ KEWDR
Sbjct  165   LHFVCNSWVYPEHRYKYDRMFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  224

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L + +
Sbjct  225   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPLGL-D  283

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F  +K SDFL YA+KS+GQV++P I + FD T NEFDSF+D+  LYEGG+  
Sbjct  284   IYVPRDERFTPMKLSDFLAYAVKSLGQVLVPEIVALFDKTINEFDSFEDVLKLYEGGIK-  342

Query  1895  GLLLEHIQKNTNL---EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
              L   H++K       E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGV
Sbjct  343   -LPDHHLKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGV  401

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP STLDP+VYG+ TS+I REHI   +DG+TV++AI  NR+FILDHHD 
Sbjct  402   NPVIIRRLQEFPPASTLDPEVYGNQTSSIKREHIEKNMDGVTVDEAIEGNRLFILDHHDA  461

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YA+RTLLFLQ +GTLRP+AIELSLPHP GDK G  S V+TPA++
Sbjct  462   LLPYLRRINT-TKTKTYASRTLLFLQDNGTLRPVAIELSLPHPQGDKHGATSLVFTPADE  520

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEG++WQLAKAYAA NDSG HQLISHWLNTHA IEP +IA NR LS LHPI+KLL PHF
Sbjct  521   GVEGTVWQLAKAYAAVNDSGYHQLISHWLNTHATIEPFVIAANRHLSVLHPIFKLLQPHF  580

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA G++EL+  PGKYAMEMS+++YK+WVF    LP DL+ RG+AV
Sbjct  581   RDTMYINALARQILINAGGILELTVFPGKYAMEMSSIVYKSWVFTEQGLPADLLKRGIAV  640

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D S P+G++LLIEDYP+AVDGLE+W AI+ WV +YC+FYY  D ++  DTELQ+WW EV
Sbjct  641   PDSSQPYGLKLLIEDYPFAVDGLEVWAAIEAWVDDYCSFYYSTDEVIRDDTELQSWWMEV  700

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDEPWWP++ +R  LI+TCTTIIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  701   RNEGHGDLKDEPWWPQMQTRSELIETCTTIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  760

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+S+EIYLGQRE+PEW
Sbjct  761   RFMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRHSSEEIYLGQRENPEW  820

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGL  300
             T D E  ++F+RF  +LV IE RI++ N D + KNR GPV VPY LL+P       E GL
Sbjct  821   TSDVEPRQSFQRFHDRLVDIENRIVERNSDSRWKNRNGPVKVPYMLLYPNASGDNSESGL  880

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  881   TGKGIPNSVSI  891



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =  1088 bits (2813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/854 (65%), Positives = 657/854 (77%), Gaps = 18/854 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKR  2616
             A+E  KIKG+VVLMKKN LD  DV AS  D+I +  G+ VS QLISA N DP     GK 
Sbjct  16    AEERFKIKGKVVLMKKNVLDFNDVTASCFDRIHELFGKGVSIQLISAVNPDPENDLRGKH  75

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              K AFLE W  K+T + A E+ +++TF+W ES+ VPGA I++N+H ++ YLKT+TLED  
Sbjct  76    GKVAFLESWVKKITPMAAQETEFNITFDWDESMAVPGAFIIRNHHHSQLYLKTVTLEDVP  135

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   V FVC SWVYPA +Y YDRVFFSN+ YLP QTP  LR +RE EL NLRG+G GE K
Sbjct  136   GHGRVHFVCNSWVYPAHRYKYDRVFFSNKTYLPCQTPESLRKYREEELINLRGNGKGELK  195

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLG PD GK   RP+LGG  +YPYPRRGRTGRK TKTDP  ESRLPLL
Sbjct  196   EWDRVYDYAYYNDLGSPDKGKEYARPVLGGPGKYPYPRRGRTGRKPTKTDPDSESRLPLL  255

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
              + +IYVPRDE+FGHLK SDFL YALKS+ QV++P + S  D T NEFDSF+D+  LYEG
Sbjct  256   SL-DIYVPRDERFGHLKFSDFLAYALKSLVQVLLPEVKSLCDKTINEFDSFEDVLKLYEG  314

Query  1907  GLS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GL      L   I+K+   E+ KE++R+DGE   KFP P VI A K+AWRTDEEFAREML
Sbjct  315   GLKLPNAALTSKIRKSIPWEMLKELVRNDGERFLKFPMPDVIKADKSAWRTDEEFAREML  374

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV IS L+ FPP S LDPK +G+  STI +EHI   ++GLTV+QAI  NR+FILD+
Sbjct  375   AGVNPVIISLLREFPPTSKLDPKEFGNQNSTIRKEHIEGNMNGLTVDQAIRINRLFILDY  434

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y  +IN+ T +       LL LQ DGTL+P+AIELSLPHP G++ G VS V+TP
Sbjct  435   HDALMPYLTKINSTTTKTYATRTILL-LQDDGTLKPLAIELSLPHPQGERHGAVSKVFTP  493

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A+ GVEGSIWQLAKAYAA NDSG HQLISHWLNTHAVIEP IIA+NRQLS LHPIYKLLH
Sbjct  494   AQHGVEGSIWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFIIASNRQLSVLHPIYKLLH  553

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INAL RQ+L NA G++E++  P +YAME+SAV+YKNWVF   +LP DL+ RG
Sbjct  554   PHFRDTMNINALARQILINAGGILEITVFPARYAMELSAVVYKNWVFTEQALPADLLKRG  613

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D S  HG+RLLIEDYPYAVDGLEIW+AI+TWV EYC+FYY  + +V  D+ELQ+WW
Sbjct  614   VAVPDSSQRHGLRLLIEDYPYAVDGLEIWSAIETWVEEYCDFYYPTNDLVRNDSELQSWW  673

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
             TE+   GH DKKDEPWWP + +R  L  TCT IIWI+SALHAAVNFGQY YAGY P RPT
Sbjct  674   TEIRNVGHGDKKDEPWWPEMQTRADLKQTCTIIIWIASALHAAVNFGQYPYAGYLPNRPT  733

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+++Y EL+ +P+   LKTITA  QTLLG+SLIEILSRH++DE+YLGQR+ 
Sbjct  734   VSRRFMPEPGTSEYAELEKDPELGFLKTITAQLQTLLGVSLIEILSRHSTDEVYLGQRDT  793

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGE  309
             PEWT D+E L AFERF K+L  IE +I++MN D K KNR GPV VPYTLLFP     + E
Sbjct  794   PEWTSDREPLAAFERFAKRLSVIENKIMEMNNDEKWKNRNGPVKVPYTLLFPNTSDKSRE  853

Query  308   EGLSGKGIPNSISI  267
              GL+GKGIPNSISI
Sbjct  854   GGLTGKGIPNSISI  867



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/850 (63%), Positives = 649/850 (76%), Gaps = 13/850 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GK  2619
              D   KIKG VVLMKKN L+  D  AS++D+  + +GQ VS Q+I A   DP       K
Sbjct  15    VDSKMKIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGAAKSDPPENGLKEK  74

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA LE+W   +  L+AGE+A+ VTF+W E +GVP A++++NNH +EFYLKT+TLED 
Sbjct  75    LGKPANLENWITTIDPLIAGETAFKVTFDWDEEIGVPVALLIRNNHHSEFYLKTVTLEDV  134

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SW+YPA +Y+YDRVFF+N+ +LP  +PAPLR +REAEL  LRGDG GE 
Sbjct  135   PGEGRVHFVCNSWIYPAKRYDYDRVFFTNKTHLPQDSPAPLRKYREAELVKLRGDGKGEL  194

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  T++DP  ESRLPL
Sbjct  195   KEWDRVYDYAYYNDLGDPDEGTKYARPVLGGSSEYPYPRRGRTGRAATESDPNSESRLPL  254

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L    IYVPRDE+FGHL+ +DFLGYALK + QVV P +   FD+T NEFDSFDD+  +YE
Sbjct  255   LTSLNIYVPRDERFGHLRMADFLGYALKLVAQVVKPGLEGLFDSTPNEFDSFDDVFKIYE  314

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G L+++I++   L++ KE+ R+DGENLF+FP PQVI  +KT WRTDEEF REM
Sbjct  315   GGIELPHGSLVDNIREKIPLQMLKEIFRTDGENLFEFPMPQVIQGNKTGWRTDEEFGREM  374

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RL+ FPP+S LD + YGD  S IT E I + L+GLT ++AI  NR+FILD
Sbjct  375   LAGLNPVVIRRLEEFPPKSKLDSEKYGDQNSKITEEDIKNNLEGLTTDEAIKKNRMFILD  434

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y R+IN  + +  YATRTLLFL+ DGTL+P+AIELSLPH  GD+FG +S VYT
Sbjct  435   HHDALMPYLRKINTPS-KNTYATRTLLFLKDDGTLKPLAIELSLPHEEGDEFGAISKVYT  493

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVEG IWQLAKAY   NDSG HQLISHWL+THA IEP +IATNR LS LHPIY+LL
Sbjct  494   PAEHGVEGPIWQLAKAYVGVNDSGYHQLISHWLHTHAAIEPFVIATNRHLSVLHPIYELL  553

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ+L NA GV+EL+  P KYA+EMSA LYK+W F   +LP DL  R
Sbjct  554   KPHFRDTMNINALARQVLINAGGVLELTVYPSKYALEMSASLYKSWDFTEQALPEDLKKR  613

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK WV +YC+FYYK D  V  D E+Q W
Sbjct  614   GVAVEDPSSPHGVRLLIEDYPYAVDGLEIWSAIKEWVRDYCSFYYKTDDRVQKDHEIQLW  673

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W EV + GH D KD PWWP++ +R  LID+CT IIW++SALHAA+NFGQY + G+ P RP
Sbjct  674   WKEVREVGHGDLKDAPWWPKMQTREELIDSCTIIIWVASALHAAINFGQYPFGGFLPNRP  733

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++SR+ MPE GSA+YEELK+NPDKA LKTIT+  QTLLGISLIEILSRH SDE+YLGQR+
Sbjct  734   SMSRRLMPEKGSAEYEELKSNPDKAFLKTITSQYQTLLGISLIEILSRHTSDEVYLGQRD  793

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
               EWT D + +EA ++F K+L  IE+RI   N D KLKNR GPV +PYTLL PT + GL+
Sbjct  794   TLEWTTDSKPMEALDKFRKELADIEKRIFDRNRDDKLKNRFGPVKMPYTLLVPTSKAGLT  853

Query  296   GKGIPNSISI  267
             G GIPNS+SI
Sbjct  854   GMGIPNSVSI  863



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/855 (64%), Positives = 655/855 (77%), Gaps = 19/855 (2%)
 Frame = -1

Query  2780  ADEPK-KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
              DE K KIKG VVLMKKN LD  D+ AS +D++ + +G+ VS QLISA N DP     G+
Sbjct  30    VDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGR  89

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               K A+LE W   +T L A E+ + +TF+W E++GVPGA I++N+H ++FYLKT+TLED 
Sbjct  90    LGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDV  149

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   + FVC SWVYP  +Y YDRVFFSN+ YLP QTP PLR +R  EL NLRG+G GE 
Sbjct  150   PGHGRIHFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGEL  209

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY +YNDLG+PD G    RP+LGG+ EYPYPRRGRTGRK TKTDP  E RLPL
Sbjct  210   KEWDRVYDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPL  269

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             + + +IYVPRDE+FGHLK SDFL YALKS+ Q+++P I S  D T NEFDSFDD+ +LYE
Sbjct  270   ISL-DIYVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYE  328

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L     +  I+     E+ KE++R+DGE   KFP P VI   ++AWRTDEEFAREM
Sbjct  329   GGIKLPNSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREM  388

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV ISRLQ FPP S LDPKVYG+  S+ITR  I   ++ LT+++AI + ++F LD
Sbjct  389   LAGVNPVIISRLQEFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLD  448

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN+ T+ K YA+RTLL LQ DGTL+P+AIELSLPHP GD  G VS V+T
Sbjct  449   HHDALMPYLRRINS-TNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGDHHGAVSKVFT  507

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVEGS+WQLAKAYAA NDSG HQL+SHWL+THAVIEP +IATNRQLS LHPIYKLL
Sbjct  508   PAENGVEGSVWQLAKAYAAVNDSGYHQLVSHWLDTHAVIEPFVIATNRQLSVLHPIYKLL  567

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NA GV+E +  P KYAMEMSAV YKNWVF   +LP DL+ R
Sbjct  568   HPHFRDTMNINALARQILINAGGVLENTVFPAKYAMEMSAVSYKNWVFTEQALPADLLKR  627

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+A  D S PHG++LLIEDYPYAVDGLEIW AI+TWV EYC+FYY  D ++  D ELQ+W
Sbjct  628   GVAEPDTSQPHGIKLLIEDYPYAVDGLEIWAAIETWVKEYCSFYYPRDHLIQGDNELQSW  687

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+   GH DK+DEPWWP + ++  L+ TCT IIW++SALHAAVNFGQY YAGY P RP
Sbjct  688   WEELRNVGHGDKRDEPWWPEMQTQAELVQTCTIIIWVASALHAAVNFGQYPYAGYLPNRP  747

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +Y EL+ NPD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQR+
Sbjct  748   TVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLGQRD  807

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              PEWT D E L AFERFG +L+ IE RIL+MN D + KNR G V VPYTLL+P     + 
Sbjct  808   TPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVPYTLLYPNTSDYSR  867

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  868   EGGLTGKGIPNSVSI  882



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/846 (63%), Positives = 656/846 (78%), Gaps = 15/846 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-------KRSKP  2607
             ++KG VVLMKKN LD  D  AS +D++ +FVG++VS QL+SA N D G       K  KP
Sbjct  18    RVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSAVNVDSGDSNGLKGKLGKP  77

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG  2430
             A LEDW   +  L  GE+A+ VTFEW E +  PGA I++NNH +EFYLK+LTLED    G
Sbjct  78    AHLEDWITTIAPLTVGETAFKVTFEWDEEIRTPGAFIIRNNHHSEFYLKSLTLEDVPGQG  137

Query  2429  V-QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
             V +F+C SWVYPADKY  DR+FFSN+ YLPS+TP PL  +RE EL+NLRG+G G+ +EWD
Sbjct  138   VIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQEWD  197

Query  2252  RVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDYD YNDLG+PD G    RPILGG+ EYPYPRRGRTGR  TK+DPK E+RL +    
Sbjct  198   RVYDYDLYNDLGNPDKGPQHARPILGGSKEYPYPRRGRTGRPPTKSDPKCETRLNIASSL  257

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IYVPRDE+FGHLK +DFL YALKSI QV+ P + S FD T NEFDSF+D+  LYEGG+ 
Sbjct  258   DIYVPRDERFGHLKMADFLAYALKSIVQVLKPELESLFDNTPNEFDSFEDVFKLYEGGIE  317

Query  1898  --RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                G+L E ++ N   E+ KE+ RSDG+ L KFP PQVI   K+AW+TDEEFAREMLAG+
Sbjct  318   VPEGILTE-VRDNIPAEMLKEIFRSDGQRLLKFPVPQVIAVDKSAWQTDEEFAREMLAGI  376

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I  LQ FPP S LDPK+YG+ TSTIT+EHI   L+GLTV++AI   R+FILD H+ 
Sbjct  377   NPVIIRGLQEFPPGSKLDPKIYGNQTSTITKEHIESNLEGLTVDEAIRERRLFILDLHEA  436

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN+ T  K YA+RT+LFLQK GTL+P+AIELSLPHP GD+ G +S VYTP EQ
Sbjct  437   VIPYIRRINS-TSTKTYASRTILFLQKKGTLKPLAIELSLPHPNGDEHGAISKVYTPVEQ  495

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVE S WQLAKAY    DSG HQL+SHWL+THAVIEP I+ATNRQLS LHPI+KLLHPHF
Sbjct  496   GVEKSFWQLAKAYVVVVDSGYHQLVSHWLHTHAVIEPFILATNRQLSVLHPIHKLLHPHF  555

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INALGRQ+L NA G +E +  P +Y+ME S+VLYK+WVFP  +LP DL+ RG+AV
Sbjct  556   RDTMNINALGRQILINAGGALESTVCPSRYSMEFSSVLYKDWVFPEQALPEDLVKRGVAV  615

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D +SP+G+RLLIEDYP+AVDGLEIW AIKTWV +YC+FYYK    V  DTELQ+WW E+
Sbjct  616   KDPTSPYGLRLLIEDYPFAVDGLEIWFAIKTWVQDYCSFYYKEGDTVKKDTELQSWWKEI  675

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              + GH DKK+EPWWP++ +   LI TCT +IWI+SALHAA+NFGQY + G+ P RP +SR
Sbjct  676   REVGHGDKKNEPWWPKMETSEDLIQTCTILIWIASALHAAINFGQYPFGGFPPSRPAISR  735

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE G+ +Y+EL  +P KA LKTI++  Q +LGISL+EILS+H+SDE+YLGQR+ P+W
Sbjct  736   RFMPEEGTPEYDELVADPAKAYLKTISSQFQAVLGISLVEILSKHSSDEVYLGQRDTPDW  795

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D E L+AFE+FGK L +IEERIL+MN D KL+NR GPV +PYTLL+PT + GL+G G+
Sbjct  796   TSDAEPLQAFEKFGKTLASIEERILRMNSDEKLRNRFGPVKMPYTLLYPTSKGGLTGMGV  855

Query  284   PNSISI  267
             PNSISI
Sbjct  856   PNSISI  861



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =  1087 bits (2811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/851 (64%), Positives = 656/851 (77%), Gaps = 21/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             KK++G VVLMKKN LDL DVGAS +D++ +  G+ VS QLISA++ +PG     K  KPA
Sbjct  27    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  86

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  87    FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  146

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y Y+RVFFSN+ YLPS TP PLRP+RE EL NL G G+G  KEWDR
Sbjct  147   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDR  206

Query  2249  VYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L +  
Sbjct  207   VYDYAFYNDLGFPDKGPESARPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPLGL-N  265

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F H+K SDFL YA+KS+GQV+IP I + FD T NEFDSF+D+  LYEGG+  
Sbjct  266   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIK-  324

Query  1895  GLLLEHIQKNTNL---EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
              L   H+ K       E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGV
Sbjct  325   -LPDHHLNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGV  383

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP S LDP VYG+ TS+ITRE I   +D LTV++AI  N++FILDHHD 
Sbjct  384   NPVIIRRLQEFPPASKLDPIVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDA  443

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T+ K YA+RTLLFLQ +GTLRP+AIELSL HP GDK G  S V+TPA++
Sbjct  444   LMPYLRRINT-TNTKTYASRTLLFLQDNGTLRPLAIELSLSHPQGDKHGATSLVFTPADE  502

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGS+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNR+LS LHP++KLL PHF
Sbjct  503   GVEGSVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRRLSVLHPVFKLLQPHF  562

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA GV+EL+  PGKYAMEMS+++YKNWVF    LP DL+ RG+AV
Sbjct  563   RDTMYINALARQILINAGGVLELTVFPGKYAMEMSSIVYKNWVFTEQGLPADLLKRGVAV  622

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D S P+G+ LLIEDYP+AVDGLEIW+AI+ WV EYC+FYY  D M+  DTELQ+WWTEV
Sbjct  623   PDSSQPYGLSLLIEDYPFAVDGLEIWSAIEAWVNEYCSFYYPTDDMIRDDTELQSWWTEV  682

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDEPWWP++ +R  L + CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  683   RNEGHGDLKDEPWWPQMQTRAELAEACTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  742

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+SDEIYLGQR+ PEW
Sbjct  743   RFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLGQRDTPEW  802

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGL  300
             T D +  +AF+RF  +LV +E RI++ N D +  NR GPV VPY LL+P       E GL
Sbjct  803   TSDIQPRQAFQRFHDRLVEVENRIVERNNDSRWMNRNGPVKVPYMLLYPNASGDNSESGL  862

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  863   TGKGIPNSVSI  873



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =  1087 bits (2811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/855 (63%), Positives = 672/855 (79%), Gaps = 24/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G++VLMKKN LD  D+ AS+VD+I + +G+ VS QLISA + +P        GK  +
Sbjct  32    RIRGKLVLMKKNVLDFNDLKASVVDRIHELLGKGVSMQLISATHPEPAANGLKSRGKLGE  91

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
              A+LE W    TSL AGE+++ ++ +W ES GVPGA++++N+H ++FYLKT+TLED  G 
Sbjct  92    VAYLEKWVTTTTSLSAGEASFSISLDWDESHGVPGALLIRNHHHSQFYLKTITLEDVPGH  151

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               + FVC SWVYPA +Y Y+R+FF N+AYLPS+TP  L P+RE EL NLRG G+GE KEW
Sbjct  152   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSKTPELLHPYREDELVNLRGSGSGELKEW  211

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD G    RP+LGG+ EYPYPRRGRTGR+ TKTDP +ESRLPLL +
Sbjct  212   DRVYDYAYYNDLGSPDKGPEYVRPVLGGSNEYPYPRRGRTGREPTKTDPNFESRLPLLSL  271

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  D T NEFD+F+D+ +LY+GG 
Sbjct  272   -DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFEDVLNLYDGGI  330

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I++    E+ KE++RSDGE   KFP P VI   ++AWRTDEEFAREMLAG
Sbjct  331   KLPNGPTLKKIRECIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDEEFAREMLAG  390

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I+RLQ FPP S LDPKVYG+  S+I  EHIA  ++GLTV +AI SNR+FILDHHD
Sbjct  391   VNPVNITRLQEFPPVSKLDPKVYGNQHSSIREEHIASNMNGLTVREAIESNRLFILDHHD  450

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP--  1374
              +M+Y RRIN+ T  K YATRTLL LQ+DGTL+P+AIELSLPHP GD  GCVS V+TP  
Sbjct  451   ALMIYLRRINS-THTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGDHHGCVSTVFTPPG  509

Query  1373  -AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
               ++G+E S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IAT+RQLS LHPI+KLL
Sbjct  510   QGKKGIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATHRQLSVLHPIHKLL  569

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NADGV+E +  PG+++MEMSAV+YK WVF + +LP DL  R
Sbjct  570   HPHFRDTMNINALARQILINADGVLEKTVFPGRFSMEMSAVIYKGWVFTDQALPADLCKR  629

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV+D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV EYC  YYK+D  V  D ELQ W
Sbjct  630   GMAVLDKTCPHGLRLLIEDYPFAVDGLEIWSAIQTWVDEYCCLYYKSDDAVQGDFELQDW  689

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+   GH DKK+EPWWP++ +R  LI++CT IIW++SALHAAVNFGQY+YAGY P RP
Sbjct  690   WAELRNVGHGDKKNEPWWPQMQTRDELIESCTIIIWVASALHAAVNFGQYSYAGYLPNRP  749

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPE G+A+Y EL++NPD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQ +
Sbjct  750   TVSRRFMPEAGTAEYAELESNPDAAFLKTITAQLQTLLGVSLIEILSRHSTDEVYLGQND  809

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              PEWT D EAL AF RFG+KL+ IE+ I + N D +LKNR GPV++PYTLL+P     + 
Sbjct  810   TPEWTSDAEALAAFARFGEKLMDIEKNINERNKDMRLKNRVGPVDMPYTLLYPNTSDKSR  869

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  870   EGGLTGKGIPNSVSI  884



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =  1087 bits (2811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/850 (64%), Positives = 652/850 (77%), Gaps = 14/850 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GK  2619
              D  KKI+G VVLMKKN LDLTD+ ASI D++ +F+GQ VS QL+SA N DP      GK
Sbjct  15    GDCKKKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDFKGK  74

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE W   +T L AGE+A+ VTF W E +G+PGA++VKNNH +EFYLKT+TLE  
Sbjct  75    LGKPAYLEKWITTVTPLTAGETAFKVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGV  134

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SW+YPA+ Y+  R+FF+N+ YLP +TPAPLR +RE EL +LRG+G GE 
Sbjct  135   PGLGRVHFVCKSWIYPAEHYSKPRIFFTNKTYLPHETPAPLRKYREEELFHLRGNGEGEL  194

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDYD+YNDLG    G    RP+LGG+ EYPYPRRGRTGRK    DP  ESRLPL
Sbjct  195   KEWDRVYDYDFYNDLGSSKKGSEYFRPVLGGSSEYPYPRRGRTGRKKEA-DPHTESRLPL  253

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L    IYVPRDE+FGHLK +DFL YALK++ QVV   + +  D T NEFDSFDD+  LYE
Sbjct  254   LKSLSIYVPRDERFGHLKLADFLAYALKTVAQVVKNGVDTFVDTTPNEFDSFDDVLKLYE  313

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L    LL++I+K   LE  +E+ R+DGE  F+FP PQVI  + +AWRTDEEF REM
Sbjct  314   GGYELPHVPLLDNIRKIFPLEFLEEIFRTDGERFFEFPKPQVIKDNHSAWRTDEEFGREM  373

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I RL+ FPP+S L+ ++YGD  S IT EHI + LDGLT+++AI +NR+FILD
Sbjct  374   LAGVNPVLIRRLEEFPPKSKLNRELYGDQNSKITEEHIQNSLDGLTIDEAIRNNRMFILD  433

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN+ T  K YATRTLLFL+ DGTL+P+AIELS PH  GDK+G  S VYT
Sbjct  434   HHDALMPYLRRINS-TSTKTYATRTLLFLKDDGTLKPLAIELSWPHEEGDKYGSNSEVYT  492

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVE SIWQLAKAY   NDSG HQLISHWL+THAV+EP +IATNR LS LHPIYKLL
Sbjct  493   PAETGVESSIWQLAKAYVGVNDSGYHQLISHWLHTHAVMEPFVIATNRHLSVLHPIYKLL  552

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ+L NA G +EL+  P KYA+EMS+ LY++W F   +LP DL  R
Sbjct  553   EPHFRDTMNINALARQILINAGGFLELTVYPSKYALEMSSSLYRSWDFTEQALPEDLKKR  612

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D +SPHGVRLLI+DYPYAVDGLEIW+AIK WV +YC+FYYK D MV  DTE+Q+W
Sbjct  613   GVAVDDPNSPHGVRLLIKDYPYAVDGLEIWSAIKEWVRDYCSFYYKTDEMVQNDTEIQSW  672

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W EV + GH D+KD PWWP++ +R  LI +CT IIW+ SALHAAVNFGQY Y GY   RP
Sbjct  673   WKEVREVGHGDQKDAPWWPKMQTREELIQSCTIIIWVGSALHAAVNFGQYPYGGYLLNRP  732

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             + SR+FMP+ GS +YEELK+NPDK  L TITA  QTLLGISLIEILSRH+SDE+YLGQR+
Sbjct  733   STSRRFMPQKGSPEYEELKSNPDKFFLGTITAQLQTLLGISLIEILSRHSSDEVYLGQRD  792

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
               EWT +KE +EAF++FG+KL  IE+RIL MN + + KNR GPV VPYTLL PT E GL+
Sbjct  793   ILEWTAEKEPIEAFKKFGRKLAVIEDRILDMNREARYKNRVGPVKVPYTLLVPTSEAGLT  852

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  853   GRGIPNSVSI  862



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =  1087 bits (2810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/851 (64%), Positives = 656/851 (77%), Gaps = 21/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             KK++G VVLMKKN LDL DVGAS +D++ +  G+ VS QLISA++ +PG     K  KPA
Sbjct  37    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  96

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             FLE W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   
Sbjct  97    FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  156

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y Y+RVFFSN+ YLPS TP PLRP+RE EL NL G G+G  KEWDR
Sbjct  157   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDR  216

Query  2249  VYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTDP  ESRLP L +  
Sbjct  217   VYDYAFYNDLGFPDKGPESARPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPLGL-N  275

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F H+K SDFL YA+KS+GQV+IP I + FD T NEFDSF+D+  LYEGG+  
Sbjct  276   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIK-  334

Query  1895  GLLLEHIQKNTNL---EITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
              L   H+ K       E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGV
Sbjct  335   -LPDHHLNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGV  393

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP S LDP VYG+ TS+ITRE I   +D LTV++AI  N++FILDHHD 
Sbjct  394   NPVIIRRLQEFPPASKLDPIVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDA  453

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T+ K YA+RTLLFLQ +GTLRP+AIELSL HP GDK G  S V+TPA++
Sbjct  454   LMPYLRRINT-TNTKTYASRTLLFLQDNGTLRPLAIELSLSHPQGDKHGATSLVFTPADE  512

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVEGS+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNR+LS LHP++KLL PHF
Sbjct  513   GVEGSVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRRLSVLHPVFKLLQPHF  572

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA GV+EL+  PGKYAMEMS+++YKNWVF    LP DL+ RG+AV
Sbjct  573   RDTMYINALARQILINAGGVLELTVFPGKYAMEMSSIVYKNWVFTEQGLPADLLKRGVAV  632

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D S P+G+ LLIEDYP+AVDGLEIW+AI+ WV EYC+FYY  D M+  DTELQ+WWTEV
Sbjct  633   PDSSQPYGLSLLIEDYPFAVDGLEIWSAIEAWVNEYCSFYYPTDDMIRDDTELQSWWTEV  692

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDEPWWP++ +R  L + CT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  693   RNEGHGDLKDEPWWPQMQTRAELAEACTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  752

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+SDEIYLGQR+ PEW
Sbjct  753   RFMPEPGTPEYAELESNPDLAFLKTITAQFQTLLGVSLIEILSRHSSDEIYLGQRDTPEW  812

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGL  300
             T D +  +AF+RF  +LV +E RI++ N D +  NR GPV VPY LL+P       E GL
Sbjct  813   TSDIQPRQAFQRFHDRLVEVENRIVERNNDSRWMNRNGPVKVPYMLLYPNASGDNSESGL  872

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  873   TGKGIPNSVSI  883



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =  1086 bits (2809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/850 (63%), Positives = 649/850 (76%), Gaps = 13/850 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GK  2619
              D   KIKG VVLMKKN L+  D  AS++D+  + +GQ VS Q+I     DP       K
Sbjct  15    GDSKMKIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGTAKSDPPENGLKEK  74

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA LE+W   +  L+AGE+ + VTF+W E +G+P A++++NNH +EFYLKT+TLED 
Sbjct  75    LGKPANLENWITTIDPLIAGETEFKVTFDWDEEIGIPVALLIRNNHHSEFYLKTVTLEDV  134

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SW+YPA +YNYDRVFF+N+ +LP   PAPLR +RE EL  LRGDG GE 
Sbjct  135   PGQGRVHFVCNSWIYPAKRYNYDRVFFTNKTHLPQDAPAPLRKYREEELVKLRGDGKGEL  194

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  T++DP  ESRLP+
Sbjct  195   KEWDRVYDYAYYNDLGDPDEGAKYVRPVLGGSSEYPYPRRGRTGRAATESDPNSESRLPI  254

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L    IYVPRDE+FGHL+ +DFLGYALK + QVV P +   FD+T NEFDSFDD+  LYE
Sbjct  255   LTSLNIYVPRDERFGHLRMADFLGYALKLVAQVVKPGLEGLFDSTPNEFDSFDDVFKLYE  314

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G L+++I++   L++ KE+ R+DGENLF+FP PQVI  +KT WRTDEEF REM
Sbjct  315   GGIELPHGPLVDNIREKIPLQMLKEIFRTDGENLFEFPMPQVIEGNKTGWRTDEEFGREM  374

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RL+ FPP+S LD K YGD  S IT E I + L+GLT ++AI  NR+FILD
Sbjct  375   LAGLNPVVIRRLEEFPPKSKLDSKQYGDQNSKITEEDIKNNLEGLTTDEAIKKNRMFILD  434

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y R+IN  + +  YATRTLLFL+ DGTL+P+ IELSLPH  GD+FG +S +YT
Sbjct  435   HHDALMPYLRKINTPS-KNTYATRTLLFLKDDGTLKPLVIELSLPHEEGDEFGAISKIYT  493

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVEGSIWQLAKAY   NDSG HQLISHWL+THA IEP +IATNR LS LHPIY+LL
Sbjct  494   PAEHGVEGSIWQLAKAYVGVNDSGYHQLISHWLHTHAAIEPFVIATNRHLSVLHPIYELL  553

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ+L NA G++EL+  P KYA+EMSA LYK+W F   +LP DL  R
Sbjct  554   KPHFRDTMNINALARQVLINAGGILELTVYPLKYALEMSASLYKSWDFTEQALPEDLKKR  613

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D SSPHGVRLLIEDYPYAVDGLEIW+AIK WV +YC+FYYK D  V  D E+Q+W
Sbjct  614   GVAVEDPSSPHGVRLLIEDYPYAVDGLEIWSAIKEWVRDYCSFYYKTDDRVQEDYEIQSW  673

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W EV ++GH D KD PWWP++ +R  LID+CT IIW++SALHAA+NFGQY + G+ P RP
Sbjct  674   WKEVREEGHGDLKDAPWWPKMQTREELIDSCTIIIWVASALHAAINFGQYPFGGFLPNRP  733

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++SR+ MPE GSA+YEELK+NP+KA LKTIT+  QTLLGISLIEILSRH SDE+YLGQR+
Sbjct  734   SMSRRLMPEEGSAEYEELKSNPEKAFLKTITSQYQTLLGISLIEILSRHTSDEVYLGQRD  793

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
               EWT D + +EA ++F KKL  IE+RI  MN D KLKNR GPV +PYTLL PT + GL+
Sbjct  794   TLEWTTDSKPMEALDKFRKKLADIEKRIFDMNRDDKLKNRFGPVKMPYTLLVPTSKVGLT  853

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  854   GRGIPNSVSI  863



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =  1086 bits (2808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/844 (65%), Positives = 666/844 (79%), Gaps = 19/844 (2%)
 Frame = -1

Query  2750  VVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFLEDW-  2589
             VVLMKKN LD  D+ AS++D++ + VG+ V+ QLIS+ N DP     GK  K A+LE+W 
Sbjct  43    VVLMKKNVLDFNDLHASVLDRVHELVGKGVALQLISSVNTDPANGLRGKLGKEAYLEEWI  102

Query  2588  GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCF  2412
               +T L AGES++++TF+W E +GVPGA I++N H ++F+LKT+TLED  G   V F+C 
Sbjct  103   TTITPLSAGESSFNITFDWDEGIGVPGAFIIRNFHHSQFFLKTVTLEDVPGVGRVHFICN  162

Query  2411  SWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDY  2232
             SWVYP   Y YDRVFFSNQ YLP+ TP PLR +RE E+ NLRGDGTGE +EWDRVYDY Y
Sbjct  163   SWVYPTKHYKYDRVFFSNQTYLPANTPEPLRKYREEEIVNLRGDGTGELQEWDRVYDYAY  222

Query  2231  YNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRD  2058
             YNDLG+PD G    RP+LGG+ +YPYPRRGRTGRK T+TDPK ESRLPLL + +IYVPRD
Sbjct  223   YNDLGNPDKGPDSARPVLGGSTQYPYPRRGRTGRKPTQTDPKTESRLPLLSL-DIYVPRD  281

Query  2057  EKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLL  1884
             E+FGHLK SDFL YALKS+ Q ++P + +  D T NEFD+F D+  LYEGG  L +G+L 
Sbjct  282   ERFGHLKMSDFLAYALKSLVQFLLPELKAFCDNTPNEFDTFQDVLDLYEGGIQLPKGVL-  340

Query  1883  EHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISR  1704
             + +++   LE+ KE++R+DGE L KFP PQVI   K AWRTDEEFAREMLAGVNPV I R
Sbjct  341   DSVKEAIPLEMLKELVRTDGEQLLKFPMPQVIQEDKFAWRTDEEFAREMLAGVNPVSIRR  400

Query  1703  LQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARR  1524
             LQ FPP S LDPK+YG+  S+IT+EHI   L+GLTV++A+ + ++F+LD+HD +M Y  R
Sbjct  401   LQEFPPASNLDPKLYGNQNSSITKEHIESNLNGLTVDEALENGKLFVLDYHDALMPYLTR  460

Query  1523  INANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIW  1344
             IN+ T +   ATRTLLFL+ DGTL+P+AIELSLPHP G++ G VS V+TPAE GV+GSIW
Sbjct  461   INSTTTKTY-ATRTLLFLKDDGTLQPLAIELSLPHPEGEQHGAVSKVFTPAEHGVQGSIW  519

Query  1343  QLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHIN  1164
             QLAKAYAA NDSG HQLISHWLNTHA IEP +IATNRQLS LHPIYKLLHPHFRDTM+IN
Sbjct  520   QLAKAYAAVNDSGFHQLISHWLNTHAAIEPFVIATNRQLSVLHPIYKLLHPHFRDTMNIN  579

Query  1163  ALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPH  984
             AL RQ+L NA GV+E +  P K+AMEMS+V+YK+WVFP  +LP DLI RG+AV D +SPH
Sbjct  580   ALARQILINAGGVLEKTVFPAKFAMEMSSVVYKSWVFPEQALPVDLIKRGVAVPDNNSPH  639

Query  983   GVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHED  804
             G+RLLIEDYPYAVDGLEIW+AI+TWV +YC+FYY ND ++  D+ELQ+WW+E+   GH D
Sbjct  640   GLRLLIEDYPYAVDGLEIWSAIETWVHDYCSFYYPNDDLIQGDSELQSWWSELRNVGHGD  699

Query  803   KKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPG  624
             KKDEPWWP++ +   L  TCT IIW++SALHAAVNFGQY YAGY P RPT+SR+FMPEPG
Sbjct  700   KKDEPWWPKMQTLSELTQTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTISRRFMPEPG  759

Query  623   SADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEAL  444
             + +Y EL++NPD   L+TITA  QTLLG+SLIEILSRH+SDE+YLGQR+ PEWT D   L
Sbjct  760   TPEYAELESNPDTFYLRTITAQLQTLLGVSLIEILSRHSSDEVYLGQRDTPEWTTDAAPL  819

Query  443   EAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPT-----GEEGLSGKGIPN  279
             EAFERF +KLV IE RI +MN D +LKNR GPV VPYTLLFP      G  GL+G+GIPN
Sbjct  820   EAFERFREKLVEIENRIREMNLDKRLKNRVGPVKVPYTLLFPDTSNVYGVGGLTGRGIPN  879

Query  278   SISI  267
             SISI
Sbjct  880   SISI  883



>ref|XP_010667400.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=895

 Score =  1085 bits (2805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/847 (63%), Positives = 656/847 (77%), Gaps = 17/847 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-ENDDP-----GKRSKPAF  2601
             IKG +VLMKKN LD+TDV ASI+DKI +  G+ VS QLISA ++++P     GK  K ++
Sbjct  51    IKGTIVLMKKNVLDMTDVSASILDKIHELGGKGVSLQLISADQSNEPARISRGKLGKASY  110

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAGVQ  2424
             +E W   +T L AGE+ +++TF+W ES+ VPGA I+KN H ++FYLKT+TL+  G  GV 
Sbjct  111   VEKWVSTITPLTAGETTFNITFDWHESMDVPGAFIIKNYHRSQFYLKTVTLDVPGHGGVH  170

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVY  2244
             FVC SWVYP  +Y Y+RVFFSN+ YLP QTP  LR +RE EL NLRGDG G  KEWDRVY
Sbjct  171   FVCNSWVYPTHRYRYNRVFFSNKTYLPHQTPEALRIYREEELVNLRGDGKGMLKEWDRVY  230

Query  2243  DYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             DYDYYNDLG PD G+   RP+LGG+ EYPYPRRG+TGRK TK DP  ESRLPLL + +IY
Sbjct  231   DYDYYNDLGMPDKGEEYARPVLGGSTEYPYPRRGKTGRKPTKADPNTESRLPLLSL-DIY  289

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR-G  1893
             VPRDE+FGH+K SDFL YA+KSI Q+++P + S  D T NEFDSF+D+  LYEGG++   
Sbjct  290   VPRDERFGHIKFSDFLAYAMKSIAQILLPELKSICDKTPNEFDSFEDVMKLYEGGITLPD  349

Query  1892  LLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
               L+ ++     E+ KE+ R+DGE   KFP P VI   K+AWRTDEEF REMLAGVNPV 
Sbjct  350   GALKKLKDRIPWEMLKELFRTDGEQFLKFPMPDVIKEDKSAWRTDEEFGREMLAGVNPVL  409

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I RL+ FPP+S LDPKVYG+  S+ITREHI   +DG + E+AI SNR++ILDHHD +M Y
Sbjct  410   IRRLEEFPPKSKLDPKVYGNQNSSITREHIEKNMDGYSTEKAIESNRLYILDHHDSLMPY  469

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEG  1353
               RIN+ T  K YATRT+LFL+ DGTL+P+AIELSLPHP GD +G VS VYTPAE+GVEG
Sbjct  470   ITRINS-TPTKTYATRTILFLKHDGTLQPLAIELSLPHPQGDNYGAVSQVYTPAEEGVEG  528

Query  1352  SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTM  1173
             S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP IIATNRQLS LHPIYKLL PHFRDTM
Sbjct  529   SVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFIIATNRQLSVLHPIYKLLQPHFRDTM  588

Query  1172  HINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLS  993
             +IN L RQ+L NA GV+E +  P ++AMEMS+ +YKNWV  +H+LP DL+ RGMA+ D +
Sbjct  589   NINGLARQILINAGGVLERTVFPARFAMEMSSFVYKNWVLTDHALPVDLLKRGMAIEDSN  648

Query  992   SPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKG  813
              PHG+RLLIEDYP+AVDGLEIW AI+ WV +YC+FYY ND +V  D ELQ+WW E+   G
Sbjct  649   YPHGLRLLIEDYPFAVDGLEIWFAIEAWVGDYCSFYYPNDNLVEEDPELQSWWKEIRYVG  708

Query  812   HEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMP  633
             H DKKDE WWP + +RH L  TCT IIW++SALHAAVNFGQY YAGY P RPTVSR+FMP
Sbjct  709   HGDKKDESWWPEMKTRHDLTRTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSRRFMP  768

Query  632   EPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDK  453
             +PG+++Y EL+++P+K  LKTITA  QTLLG+SLIE+LSRH++DE+YLGQR+  EWT D 
Sbjct  769   QPGTSEYAELESDPEKGYLKTITAQFQTLLGVSLIEMLSRHSTDEVYLGQRDTSEWTSDS  828

Query  452   EALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----GLSGKG  288
             E L AF RF ++L+ IE+ I + N D +L+NR GPV +PYTLL+P   +     G++GKG
Sbjct  829   EPLAAFHRFQQRLLGIEKNITERNSDKRLQNRNGPVKIPYTLLYPNSSDYSRVGGIAGKG  888

Query  287   IPNSISI  267
             IPNSIS+
Sbjct  889   IPNSISM  895



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =  1085 bits (2805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/855 (63%), Positives = 667/855 (78%), Gaps = 24/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G+VVLMKKN LD  D+ AS VD+I + +G+ VS QLISA + +         GK  K
Sbjct  27    RIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPRGKLGK  86

Query  2609  PAFLEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
              A+LE W   +TSL AGE+++ ++ +W ES G PGA++++N+H ++FYLKT+TLED    
Sbjct  87    VAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLEDVPEH  146

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y Y+R+FF N+AYLPSQTP  L P+RE EL NLRG G+GE KEW
Sbjct  147   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSGELKEW  206

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGRK TKTDP  ESRLPLL +
Sbjct  207   DRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTDPNSESRLPLLSL  266

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  D T NEFD+FDD+ +LYEGG 
Sbjct  267   -DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFDDVVNLYEGGI  325

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I++    E+ KE++RSDGE   KFP P VI   ++AWRTD+EF REMLAG
Sbjct  326   KLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAG  385

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I+RL+ FPP S LDPKVYG+  S+I  E+I   ++GLTVE+A   NR+FILDHHD
Sbjct  386   VNPVNITRLKEFPPVSKLDPKVYGNQNSSIREEYIKGNMNGLTVEEATEKNRLFILDHHD  445

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +MLY R+IN+ TD K YATRTLL LQ+DGTL+P+AIELSLPHP GD+ G VS V+TP  
Sbjct  446   ALMLYLRQINS-TDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGDRHGAVSKVFTPPG  504

Query  1367  QG---VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             QG   +E S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +I TNRQLS LHPI+KLL
Sbjct  505   QGNERIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVITTNRQLSVLHPIHKLL  564

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NA GV+E +  PG+++MEMSAV+YK+WVF   +LP DL+ R
Sbjct  565   HPHFRDTMNINALARQILINAGGVLEKTVFPGRFSMEMSAVIYKSWVFTEQALPADLLKR  624

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV EYC+ YY++D +V  D+ELQ W
Sbjct  625   GMAVPDTTCPHGLRLLIEDYPFAVDGLEIWSAIETWVNEYCSLYYQSDDVVQGDSELQNW  684

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+   GH DKK+EPWWP++ +R  LI++CT IIW++SALHAAVNFGQY+YAGY P RP
Sbjct  685   WTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLPNRP  744

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+A+Y EL ++PD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQ +
Sbjct  745   TVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLGQND  804

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              PEWT D EAL AF RFG+KL+ IE+RI   N D +LKNR GPV+VPYTLL P     + 
Sbjct  805   TPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSDKSR  864

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  865   EGGLTGKGIPNSVSI  879



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =  1084 bits (2803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/855 (64%), Positives = 667/855 (78%), Gaps = 24/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G+VVLMKKN LD  D+ AS VD+I + +G+ VS QLISA + +P        GK  K
Sbjct  42    RIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEPAANGLKSRGKLGK  101

Query  2609  PAFLEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
              A+LE W   +TSL AGE+++ ++ +W ES GVPGA++++N+H ++FYLKT+TLED    
Sbjct  102   VAYLEKWATTITSLSAGETSFTISLDWDESHGVPGALLIRNHHHSQFYLKTITLEDVPEH  161

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y Y+R+FF N+AYLPSQTP  L P+RE EL NLRG G+GE KEW
Sbjct  162   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSGELKEW  221

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGRK TKTDP  ESRLPLL +
Sbjct  222   DRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTDPNSESRLPLLSL  281

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  D T NEFD+FDD+ +LYEGG 
Sbjct  282   -DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFDDVVNLYEGGI  340

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I++    E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAG
Sbjct  341   KLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDEEFGREMLAG  400

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I+RL+ FPP S L+P+VYG+  S+I  EHI   ++GLTVE+A   NR+FILDHHD
Sbjct  401   VNPVNITRLEEFPPVSKLNPEVYGNQNSSIREEHIKGNMNGLTVEEATEKNRLFILDHHD  460

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +MLY R+IN+ TD K YATRTLL LQ+DGTL+P+AIELSLPHP GD+ G VS V+TP  
Sbjct  461   ALMLYLRQINS-TDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGDRHGAVSKVFTPPG  519

Query  1367  QG---VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             QG   +E S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL
Sbjct  520   QGNERIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPIHKLL  579

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NA GV+E +  PG+++MEMSAV+YK+WV    +LP DL+ R
Sbjct  580   HPHFRDTMNINALARQILINAGGVLEKTVFPGRFSMEMSAVIYKSWVLTEQALPADLVKR  639

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV EYC+ YY++D  V  D+ELQ W
Sbjct  640   GMAVPDTTCPHGLRLLIEDYPFAVDGLEIWSAIETWVNEYCSLYYQSDDGVQGDSELQNW  699

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+   GH DKK+EPWWP++ +R  LI++CT IIW++SALHAAVNFGQY+YAGY P RP
Sbjct  700   WTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLPNRP  759

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+A+Y EL ++PD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQ +
Sbjct  760   TVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLGQND  819

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              PEWT D EAL AF RF +KL+ IE+RI   N D +LKNR GPV+VPYTLL P     + 
Sbjct  820   TPEWTSDAEALIAFARFREKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSDKSR  879

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  880   EGGLTGKGIPNSVSI  894



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =  1083 bits (2802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/855 (64%), Positives = 666/855 (78%), Gaps = 24/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G+VVLMKKN LD  D+ AS VD+I + +G+ VS QLISA + +         GK  K
Sbjct  27    RIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKSRGKLGK  86

Query  2609  PAFLEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
              A+LE W   +TSL AGE+++ V+ +W ES G PGA++++N+H ++FYLKT+TLED    
Sbjct  87    VAYLEKWATTITSLSAGETSFTVSLDWDESHGAPGALLIRNHHHSQFYLKTITLEDVPEH  146

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y Y+R+FF N+AYLPSQTP  L P+RE EL NLRG G+GE KEW
Sbjct  147   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSGELKEW  206

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGRK TKTDP  ESRLPLL +
Sbjct  207   DRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTDPNSESRLPLLSL  266

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  D T NEFD+FDD+ +LYEGG 
Sbjct  267   -DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFDDVVNLYEGGI  325

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G  L+ I++    E+ KE++RSDGE   KFP P VI   ++AWRTD+EF REMLAG
Sbjct  326   KLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAG  385

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I+RL+ FPP S LDPKVYG+  S+I  EHI   ++ LTVE+A   NR+FILDHHD
Sbjct  386   VNPVNITRLKEFPPVSKLDPKVYGNQNSSIREEHIKGNMNDLTVEEATEKNRLFILDHHD  445

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +MLY R+IN+ TD K YATRTLL LQ+DGTL+P+AIELSLPHP GD+ G VS V+TP  
Sbjct  446   ALMLYLRQINS-TDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGDRHGAVSKVFTPPG  504

Query  1367  QG---VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             QG   +E S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +I TNRQLS LHPI+KLL
Sbjct  505   QGNERIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVITTNRQLSVLHPIHKLL  564

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NA GV+E +  PG+++MEMSAV+YK+WVF   +LP DL+ R
Sbjct  565   HPHFRDTMNINALARQILINAGGVLEKTVFPGRFSMEMSAVIYKSWVFTEQALPADLLKR  624

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV EYC+ YY++D +V  D+ELQ W
Sbjct  625   GMAVPDTTCPHGLRLLIEDYPFAVDGLEIWSAIETWVNEYCSLYYQSDDVVEGDSELQNW  684

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+   GH DKK+EPWWP++ +R  LI++CT IIW++SALHAAVNFGQY+YAGY P RP
Sbjct  685   WTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVASALHAAVNFGQYSYAGYLPNRP  744

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+A+Y EL ++PD A LKTITA  QTLLG+SLIEILSRH++DE+YLGQ +
Sbjct  745   TVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLGVSLIEILSRHSTDEVYLGQND  804

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              PEWT D EAL AF RFG+KL+ IE+RI   N D +LKNR GPV+VPYTLL P     + 
Sbjct  805   TPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKNRVGPVDVPYTLLHPNTSDKSR  864

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  865   EGGLTGKGIPNSVSI  879



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =  1083 bits (2800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/859 (63%), Positives = 658/859 (77%), Gaps = 22/859 (3%)
 Frame = -1

Query  2783  HADEPKK---IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----  2625
             H + PK    +KG V+LMKKN LD  D  AS++D + +F+G+ VSFQL+SA   DP    
Sbjct  16    HHEAPKSSTTVKGSVLLMKKNVLDFNDFNASLLDGLHEFLGKGVSFQLVSATVADPHNGN  75

Query  2624  -GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTL  2451
              GK   PA+LE+W   +TS+  GE+ + V F W ES GVPGA+IVKNNH + FYLKT+TL
Sbjct  76    KGKIGPPAYLEEWITTMTSVATGETKFTVHFSWDESQGVPGAIIVKNNHHSAFYLKTITL  135

Query  2450  ED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG-  2277
             E       + FVC SWVYP DKY YDR+FF+N  YLPS+TP PL+ +RE EL +LRGD  
Sbjct  136   EGVPNKEHIHFVCNSWVYPVDKYKYDRIFFANNTYLPSKTPEPLKRYREEELVHLRGDDV  195

Query  2276  TGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYES  2103
             TGE KE DR+Y+Y YYNDLG+PD G    RPILGG+ E PYPRRGRTGR  TKTDP YES
Sbjct  196   TGELKEHDRIYNYAYYNDLGNPDKGHDYARPILGGSQEQPYPRRGRTGRHPTKTDPNYES  255

Query  2102  RLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMN  1923
             RLPLL + +IYVPRDE+FGHLK SDFL YALKS+ Q ++P +++ FD T  EFDSF D+ 
Sbjct  256   RLPLLSL-DIYVPRDERFGHLKMSDFLAYALKSLTQSLLPTLSAVFDTTPMEFDSFKDVL  314

Query  1922  SLYEGGLS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEF  1749
              LYEGGL   +   L+ I+ +   E+ KE++R+DGE + K P PQVI   + AWRTDEEF
Sbjct  315   QLYEGGLPIPQSPELDEIRSHLPFEMLKELVRTDGERVLKLPLPQVIQEDRNAWRTDEEF  374

Query  1748  AREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRV  1569
              REMLAGVNPV ISR+Q FPP S LDPKVYGDHTS+I   HI   L+GLTV++A+  N++
Sbjct  375   GREMLAGVNPVIISRVQEFPPVSKLDPKVYGDHTSSINASHIEKNLEGLTVQKAMKENKL  434

Query  1568  FILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVS  1389
             FILDHHD +M Y RRIN+ ++ KIYA+RTLL L+ DGTL+P+ IELSLPHP GD+ G V+
Sbjct  435   FILDHHDALMPYLRRINSGSN-KIYASRTLLLLKDDGTLKPLVIELSLPHPDGDQHGAVN  493

Query  1388  NVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPI  1209
              V+TPAEQGVEGSIWQLAKAYA  NDSG HQLISHWLNTHAVIEP +IATNRQLS +HP+
Sbjct  494   RVFTPAEQGVEGSIWQLAKAYACVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVVHPV  553

Query  1208  YKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPND  1029
             YKLL PH+RDTM+INAL RQ L NA GV+E +  PGKYAMEMS+V+YK+W      LP+D
Sbjct  554   YKLLSPHYRDTMNINALARQTLINAGGVLESTVFPGKYAMEMSSVVYKSWKLTEQGLPDD  613

Query  1028  LINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTE  849
             L+ RG+AV D +SP+ +RLLI+DYP+AVDGL IW+AI+TWVTEYC+ YY ND  +  D E
Sbjct  614   LLKRGVAVEDPASPNKLRLLIKDYPFAVDGLAIWSAIETWVTEYCSIYYSNDAAIRADVE  673

Query  848   LQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYN  669
             LQAWW EV + GH DKKDE WWP++ +   L  TCTTIIW++SALHAAVNFGQY YAGY 
Sbjct  674   LQAWWKEVREVGHGDKKDEDWWPKMQTLAELAKTCTTIIWVASALHAAVNFGQYPYAGYL  733

Query  668   PCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYL  489
             P RPT+SR+FMPEPG+ +Y EL+ NPD A LKTIT+  QT+LG+SLIE+LSRH+SDE+YL
Sbjct  734   PNRPTISRRFMPEPGTPEYHELEKNPDLAFLKTITSQFQTILGVSLIEVLSRHSSDEVYL  793

Query  488   GQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP---  318
             GQR+ PEWT D+ ALEAFERF  KL+ IE RI+ MN D  L+NRTGPV +PYTLL+P   
Sbjct  794   GQRDSPEWTTDRSALEAFERFSHKLIEIENRIISMNQDASLRNRTGPVKMPYTLLYPNVS  853

Query  317   --TGEEGLSGKGIPNSISI  267
               TG  GL+G+GIPNS+SI
Sbjct  854   DLTGVGGLTGRGIPNSVSI  872



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =  1082 bits (2799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/850 (63%), Positives = 649/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             +E KKI G VVLMK N LD  D  AS++D + +FVG++VS QL+SA + DP     GK  
Sbjct  5     EERKKILGEVVLMKSNVLDFDDFSASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLG  64

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRES-LGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             + A+LE+W   +T L  GE+ + VTF+W E  +G+PGA  + N+H + FYLK+LTL+   
Sbjct  65    EEAYLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVP  124

Query  2438  AAGVQ--FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
               G    F C SW+YP+ +Y  DR+FF NQ+YLPS+TP PLR FRE EL++LRG G GE 
Sbjct  125   PHGTTLFFPCNSWIYPSHRYKNDRIFFLNQSYLPSETPDPLRKFREDELQSLRGGGNGEL  184

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY  YNDL DPD      RP+LGG+  YPYPRRGRTGR  TK+DP+ ESR+PL
Sbjct  185   QEWDRVYDYALYNDLADPDKAPQYARPVLGGSTTYPYPRRGRTGRPPTKSDPETESRIPL  244

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    +YVPRDE+FGHLK SDFL YALK+I Q + P +   F+    EFDS  D   LYE
Sbjct  245   VKSLNVYVPRDERFGHLKLSDFLAYALKAISQFIKPGLEEYFEGIPGEFDSLQDFLDLYE  304

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  +  GL  E I++N      KE+ R+DGE LFKFP PQVI   K+AWRTDEEF REM
Sbjct  305   GGFPVPEGLF-EVIRENIAAPFLKEIFRTDGERLFKFPLPQVIKEDKSAWRTDEEFGREM  363

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RLQ FPPRS LDP+VYGD  S IT E I   LDGLTVE+AI  NR+FILD
Sbjct  364   LAGLNPVVIRRLQDFPPRSKLDPEVYGDQKSKITEEQIIHNLDGLTVEEAIKKNRLFILD  423

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YA+RT+LFLQ++GTL+P+AIELSLP+P GDKFG VS V+ 
Sbjct  424   HHDSLMPYLRRINT-TSTKTYASRTILFLQENGTLKPLAIELSLPNPQGDKFGVVSKVFF  482

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAEQGV  SIWQLAKAY A NDSG HQLISHWLNTHAVIEP +IATNRQLS LHP++KLL
Sbjct  483   PAEQGVGSSIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPVFKLL  542

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INA  RQ+L NA G++E +  P KYAMEMSAVLYK+W F   +LP DLI R
Sbjct  543   HPHFRDTMNINAFARQMLINAGGILEATVFPSKYAMEMSAVLYKDWAFHEQALPADLIKR  602

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMA+ D +SPHG+RL+IEDYPYAVDGLEIW+AIKTWVT+YC+FYYK D  V  D ELQ+W
Sbjct  603   GMAIEDSNSPHGLRLVIEDYPYAVDGLEIWSAIKTWVTDYCSFYYKTDEAVRNDPELQSW  662

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKD+PWWP++ +   LIDTC  IIWI+SALHAAVNFGQY YAGY P RP
Sbjct  663   WKELREEGHGDKKDKPWWPKMQNIEELIDTCAIIIWIASALHAAVNFGQYPYAGYLPNRP  722

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             T+SRKFMPE G+ +Y+EL+TNP+KA L+TITA  QTLLGI+ IEILSRH+SDE+YLGQR+
Sbjct  723   TISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEILSRHSSDEVYLGQRD  782

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              P+WT DKEAL+AFE+FGKKL  IE+ I K N D  L+NR GPV +PYTLL+P+ EEGL+
Sbjct  783   SPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEEGLT  842

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  843   GKGIPNSVSI  852



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =  1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/850 (63%), Positives = 648/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GK  2619
              D  KKI+G VVLMKKN LDLTD+ ASI D++ +F+GQ VS QL+SA N DP      GK
Sbjct  15    GDCKKKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDLKGK  74

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE W   +T L AGE+A+ VTF W E +G+PGA++VKNNH +EFYLKT+TLE  
Sbjct  75    LGKPAYLEKWITTVTPLTAGETAFQVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGV  134

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SW+YPA+ Y+  R+FF+N+ YLP +TPAPLR +RE EL +LRG+G GE 
Sbjct  135   PGLGRVHFVCKSWIYPAEHYSKPRIFFTNKTYLPHETPAPLRKYREEELFHLRGNGEGEL  194

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDYD+YNDLG    G    RP+LGG+ E+PYPRRGRTGRK    DP  ESRLPL
Sbjct  195   KEWDRVYDYDFYNDLGSSKKGSEYFRPVLGGSSEHPYPRRGRTGRKKE--DPNTESRLPL  252

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L    IYVPRDE+FGHLK +DFL YALK++ QVV   + +  D T NEFDSFDD+  LYE
Sbjct  253   LKSLSIYVPRDERFGHLKMADFLAYALKTVAQVVKNGVDTFVDTTPNEFDSFDDVLKLYE  312

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L    LL++I+KN  LE  +E+ R+DGE  F+FP PQVI  + +AWRTDEEF REM
Sbjct  313   GGIELPHVPLLDNIRKNFPLEFLEEIFRTDGERFFEFPKPQVIKDNHSAWRTDEEFGREM  372

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I RL+ FPP+S L+ ++YGD  S IT EHI + LDGLT+++AI +NR+FILD
Sbjct  373   LAGVNPVLIRRLEEFPPKSKLNTELYGDQNSKITEEHIQNSLDGLTIDEAIRNNRMFILD  432

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YATRTLLFL+ DGTL+P+AIELS PH  GDK+G  S VYT
Sbjct  433   HHDALMPYLRRINT-TSTKTYATRTLLFLKDDGTLKPLAIELSSPHEEGDKYGSKSEVYT  491

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVE  IWQLAKAY   NDSG HQLISHWL+THAVIEP +IATNR LS LHPI+KLL
Sbjct  492   PAETGVESFIWQLAKAYVGVNDSGYHQLISHWLHTHAVIEPFVIATNRHLSVLHPIHKLL  551

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ+L NA G +E++  P KYA+EMS+ LY++W F   +LP DL  R
Sbjct  552   EPHFRDTMYINALARQILINAGGFLEMTVYPSKYALEMSSSLYRSWDFTEQALPEDLKKR  611

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D +SPHGVRLLI+DYPYAVDGLEIW+AIK WV +YC+FYYK D MV  DTE+Q+W
Sbjct  612   GVAVDDPNSPHGVRLLIKDYPYAVDGLEIWSAIKEWVRDYCSFYYKTDEMVQNDTEIQSW  671

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W EV + GH D+KD PWWP++ +R  LI++CT IIW+ SALHAAVNFGQY Y GY P RP
Sbjct  672   WKEVREVGHGDQKDAPWWPKMRTREELIESCTIIIWVGSALHAAVNFGQYPYGGYLPNRP  731

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             + SR+FMP+  S  YEELK+NPDK  L+TITA  QTLLGISLIEILSRH+SDE+YLGQR+
Sbjct  732   STSRRFMPQKDSPQYEELKSNPDKFFLETITAQLQTLLGISLIEILSRHSSDEVYLGQRD  791

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
               EWT DKE  EAF++FG+KL  IE+RIL MN + + KNR GPV V YTLL PT   GL+
Sbjct  792   ILEWTADKEPTEAFKKFGRKLAVIEDRILDMNREARYKNRVGPVKVSYTLLVPTSGPGLT  851

Query  296   GKGIPNSISI  267
              +GIPNS+SI
Sbjct  852   ARGIPNSVSI  861



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =  1080 bits (2794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/849 (64%), Positives = 656/849 (77%), Gaps = 18/849 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KIKG VVLMKKN LD +D+ AS +D++ + +G+ VS QLISA + DP     GK  K A+
Sbjct  22    KIKGTVVLMKKNVLDFSDIKASFLDRVHELLGKGVSMQLISAVHHDPANKLRGKLGKVAY  81

Query  2600  LEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LE W + +T + A ++ +++TF+W ES+GVPGA I++N+H ++ YLKT+TL+D  G   V
Sbjct  82    LEKWVRSITPITAVDTVFNITFDWDESMGVPGAFIIRNHHHSQLYLKTVTLDDVPGHGRV  141

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA  YNYDRVFFSN+ YLP QTP PLR +RE EL NLRG+G G+ +EWDRV
Sbjct  142   HFVCNSWVYPAHCYNYDRVFFSNKTYLPCQTPKPLRKYREEELINLRGNGKGKLEEWDRV  201

Query  2246  YDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLG PD GK   RP+LGG+ +YPYPRRGRTGRK TKTDP  ESRLPLL + +I
Sbjct  202   YDYAYYNDLGSPDKGKEYARPVLGGSEQYPYPRRGRTGRKPTKTDPNSESRLPLLNL-DI  260

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LS  1899
             YVPRDE+FGH+K SDFL YALKS+ QV++P I S  D T NEFDSF+D+  LYEGG  L 
Sbjct  261   YVPRDERFGHIKFSDFLAYALKSVVQVLVPEIKSLCDKTINEFDSFEDVLKLYEGGIKLP  320

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              G     ++     E+ KE++R+DGE   KFP P VI   K+AWRTDEEFAREMLAGVNP
Sbjct  321   SGTKATKLRNRIPWEMLKELVRNDGERFLKFPMPDVIKEDKSAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V ISRLQ FPP S LDPK YG+  S+IT+EH+   ++GLTV+QAI +N++FILDHHD +M
Sbjct  381   VIISRLQEFPPPSKLDPKEYGNQKSSITKEHVEKSMNGLTVDQAIRNNKLFILDHHDALM  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y  +IN+ T R       LL LQ DGTL+P+AIELSLPHP G++ G VS V+TPAE GV
Sbjct  441   PYLTKINSTTTRTYATRTILL-LQDDGTLKPLAIELSLPHPQGERHGAVSKVFTPAEDGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EGS+WQLAKAYAA NDSG HQLISHWLNTHA IEP IIATNRQLS LHPIYKLLHPHFRD
Sbjct  500   EGSVWQLAKAYAAVNDSGYHQLISHWLNTHAAIEPFIIATNRQLSVLHPIYKLLHPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L NA G++E++  P KYAME+S+V+YK+WVF  H+LP DL+ RG+AV D
Sbjct  560   TMNINALARQILINAGGILEITVFPAKYAMELSSVVYKSWVFTEHALPADLLKRGVAVPD  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              S  HG+RLLIEDYPYAVDGLE+W+AI+TWV EYC FYY  D +V  DTELQ+WW E+  
Sbjct  620   SSQRHGLRLLIEDYPYAVDGLEVWSAIETWVMEYCAFYYPTDDLVRDDTELQSWWAEIRN  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKKDEPWWP + +R  L  TCT IIWI+SALHAAVNFGQY YAGY P RPTVSR+F
Sbjct  680   EGHGDKKDEPWWPEMQTRADLTQTCTIIIWIASALHAAVNFGQYPYAGYLPNRPTVSRRF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPG+ +Y EL+ +P+ A LKTITA  QTLLG+SLIEILSRH +DE+YLGQR+  EWT 
Sbjct  740   MPEPGTPEYTELEKDPNLAFLKTITAQLQTLLGVSLIEILSRHPTDEVYLGQRDTAEWTS  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-TGEE----GLSG  294
             D+E L AFERF ++L  IE +I+ MN D K KNR GPV VPYTLLFP T +E    GL+G
Sbjct  800   DREPLAAFERFSERLKEIENKIMDMNSDNKYKNRIGPVKVPYTLLFPNTSDESRQGGLTG  859

Query  293   KGIPNSISI  267
             KGIPNSISI
Sbjct  860   KGIPNSISI  868



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =  1080 bits (2794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/849 (63%), Positives = 659/849 (78%), Gaps = 17/849 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPA  2604
             KK++G VVLMKKN LDLTDVGAS +D++ +  G+ VS QLISA++ +PG     K  KPA
Sbjct  30    KKVRGTVVLMKKNVLDLTDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  89

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             F+E+W   LTS+ AG++ ++VTF+W ES+G PGA I+KN H ++ YL+T+ LED  G   
Sbjct  90    FMENWVSTLTSISAGDATFNVTFDWDESMGFPGAFIIKNYHHSQLYLRTVVLEDVPGHGQ  149

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA +Y Y+RVFF+N+ YLPS TP PLRP+RE EL +LRG G+G  KEWDR
Sbjct  150   LHFVCNSWVYPAHRYKYNRVFFANKTYLPSNTPEPLRPYREEELLSLRGSGSGMLKEWDR  209

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY +YNDLG PD G    RP+LGG+ EYPYPRRGRT R+ TKTD   ES+LP L +  
Sbjct  210   VYDYAFYNDLGFPDKGPEYVRPVLGGSKEYPYPRRGRTSRRATKTDLNSESQLPPLGL-N  268

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+F H+K SDFL YALKS+GQV+IP I + FD T +EFDSF+D+  LYEGG+  
Sbjct  269   IYVPRDERFTHVKLSDFLAYALKSLGQVLIPEIVALFDKTIDEFDSFEDVLKLYEGGIKL  328

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                 L  +++    E+ KE++RSDGE   KFP P VI A ++AWRTDEEF REMLAGVNP
Sbjct  329   PDHHLNKLRQCIPWEMLKELIRSDGEPPLKFPMPDVIKADRSAWRTDEEFGREMLAGVNP  388

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I RLQ FPP S LDPKVYG+ TS+ITREHI   LDGLTV++AI  N++FILDHHD +M
Sbjct  389   VIIRRLQEFPPASKLDPKVYGNQTSSITREHIEKNLDGLTVDEAIEYNKLFILDHHDALM  448

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  T  K YA+RTLLFLQ +GTL+P+AIELSLPHP GDK G  S V+TPA++GV
Sbjct  449   PYLRRINT-TKTKTYASRTLLFLQDNGTLKPLAIELSLPHPQGDKHGATSLVFTPADEGV  507

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             EG++WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNRQLS LHPI+KLL PHFRD
Sbjct  508   EGTVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPIFKLLQPHFRD  567

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L NA G++E +  P KYAMEMS+++Y+NWVF    LP DL+ RG+AV D
Sbjct  568   TMYINALARQILINAGGILERTVFPAKYAMEMSSIVYRNWVFTEQGLPADLLKRGVAVPD  627

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              S P+G++LLIEDYPYAVDGLEIW AI+ WV +YC+FYY  D M+  D+ELQ+WW EV  
Sbjct  628   SSQPYGLKLLIEDYPYAVDGLEIWEAIEAWVDDYCSFYYSTDDMIRGDSELQSWWKEVRD  687

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH D KDEPWWP++ +R  L+  CT IIW +SALHAAVNFGQY YAGY P RPTVSR+F
Sbjct  688   EGHGDLKDEPWWPQMQTRAELVQACTIIIWTASALHAAVNFGQYPYAGYLPNRPTVSRRF  747

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPG+A+Y EL++NPD A LKTITA  QTLLG+SLIEILSRH+SDEIYLGQR++PEWT 
Sbjct  748   MPEPGTAEYAELESNPDLAYLKTITAQFQTLLGVSLIEILSRHSSDEIYLGQRDNPEWTS  807

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLSG  294
             D +  ++F+RF  +LV +E++I++ N D + KNR GPV VPY LL+P       E GL+ 
Sbjct  808   DIQPRQSFQRFHDRLVDVEKKIVERNNDSRWKNRNGPVKVPYMLLYPNASGDNSESGLTV  867

Query  293   KGIPNSISI  267
             KGIPNS+SI
Sbjct  868   KGIPNSVSI  876



>ref|XP_004296897.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=884

 Score =  1080 bits (2793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/855 (64%), Positives = 661/855 (77%), Gaps = 21/855 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GK  2619
             E KKI+G VVLMKKN LD  D+ AS++D+I +F+G+ VS QLISA + +P        GK
Sbjct  32    ESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSMQLISATHPEPAANRLVLRGK  91

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               K A+LE W   +TSL AG++A+  + +W ES+GVPGA+++ N+H ++FYLKT+TL+D 
Sbjct  92    PGKIAYLEKWITTVTSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLDDV  151

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SWVYPA +Y Y+R+FFSN+AYLPSQTP  L P+RE EL NLRG G+GE 
Sbjct  152   PGHGRVHFVCNSWVYPAHRYKYNRIFFSNKAYLPSQTPELLLPYREEELTNLRGIGSGEL  211

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLG PD G    RP+LGG+ EYPYPRRGRTGRK TKTD   ESRL L
Sbjct  212   KEWDRVYDYAYYNDLGSPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDHNSESRLFL  271

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L + +IYVPRDE+FGH+K SDFL YALKS+ Q+++P + S  D T NEFD+F+D+  LYE
Sbjct  272   LSL-DIYVPRDERFGHVKFSDFLAYALKSLVQILLPELRSLCDKTINEFDTFEDVLDLYE  330

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G  L+ ++     E+ KE+LRSDGE   KFP P VI   K+AWRTDEEFAREM
Sbjct  331   GGIKLPNGPTLKKLRDRVPWELLKELLRSDGERFLKFPMPDVIKVDKSAWRTDEEFAREM  390

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I+RLQ FPP S LDPKVYG+  S+I +E I   ++GL+VE+AI SNR FILD
Sbjct  391   LAGVNPVNITRLQEFPPTSKLDPKVYGNQNSSIRKEQIEKNMNGLSVEEAIKSNRFFILD  450

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T +       LL LQ+DGTL+P+AIELSLPHP G+  G VS V+T
Sbjct  451   HHDALMTYLRRINTTTTKTYATRTFLL-LQEDGTLKPLAIELSLPHPQGEHHGAVSKVFT  509

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE G+E S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP IIATNRQLS LHPI+KLL
Sbjct  510   PAEDGIEASVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFIIATNRQLSVLHPIHKLL  569

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ+L NA GV+E +  P +YAMEMSA +YK+WVF   +LP DL+ R
Sbjct  570   QPHFRDTMNINALARQILINAGGVLEKTVFPAQYAMEMSAGIYKHWVFTEQALPADLLKR  629

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMA+ D SSPHG+RLLIEDYP+AVDGLEIW+AI+TWVTEYC+ YY  D +V +DTELQ W
Sbjct  630   GMAISDPSSPHGLRLLIEDYPFAVDGLEIWSAIETWVTEYCSVYYATDNVVRSDTELQKW  689

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+  +GH DKK EPWWP + +R  LI +CT IIW++SALHAAVNFGQ+ YAGY P RP
Sbjct  690   WEELRNEGHGDKKAEPWWPEMHTRAELIQSCTIIIWVASALHAAVNFGQWPYAGYLPNRP  749

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             T+SR+FMPEPG+A+Y EL+TNPD A LKTIT+  QTLLG+SLIE+LSRHA+DEIYLGQR+
Sbjct  750   TISRRFMPEPGTAEYAELETNPDVAFLKTITSQLQTLLGVSLIEVLSRHATDEIYLGQRD  809

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----  312
              PEWT D EAL AF RFG+KL+ IE+RI + N D +LKNR GP+ +PYTLL+P+      
Sbjct  810   TPEWTSDGEALAAFGRFGEKLIEIEKRITERNRDERLKNRVGPIKMPYTLLYPSTSDYSR  869

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNSISI
Sbjct  870   EGGLTGKGIPNSISI  884



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =  1080 bits (2792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/851 (64%), Positives = 656/851 (77%), Gaps = 15/851 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GK  2619
               + +KI+G VVLMKKN LD  D  AS++D++ + +G+ VS QL+SA + D       GK
Sbjct  24    GSQSRKIQGTVVLMKKNVLDFNDFHASLLDRVHELLGKGVSLQLVSAVHADSQANGLGGK  83

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDG  2442
               +PA+L+DW  K+T L AGESA+ VTF+  E +GVPGA IVKNNH +EFYLKTLTL+D 
Sbjct  84    VGEPAYLKDWITKITPLAAGESAFKVTFDADEEIGVPGAFIVKNNHHSEFYLKTLTLDDV  143

Query  2441  GAAG-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
                G + FVC SWVYPA  Y YDRVFF+NQ YLPS+ P PLR +RE EL NLRGDG+ E 
Sbjct  144   PRHGRMHFVCNSWVYPAKYYKYDRVFFTNQTYLPSEMPPPLRYYREQELLNLRGDGSDEE  203

Query  2264  -KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
               E+DRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRGRTGR  TK+DP  ESRLP
Sbjct  204   LNEYDRVYDYAYYNDLGNPDKGAKYARPVLGGSAEYPYPRRGRTGRPPTKSDPNTESRLP  263

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
             +     IYVPRDE+FGHLK SDFL YALKSI Q + P + S  D+T NEFDSFDD+  LY
Sbjct  264   VTSSLNIYVPRDERFGHLKMSDFLAYALKSIAQFIKPALES-IDSTPNEFDSFDDVQKLY  322

Query  1913  EGGLS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             EGGL      LL+ I+KN  LE+ KE+ ++DG  LF++P PQVI  ++TAWRTDEEFARE
Sbjct  323   EGGLDLPDSHLLDDIRKNIPLELLKEIFQTDGARLFEYPMPQVIQNNRTAWRTDEEFARE  382

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAGVNPV I RL+ FPP S LD K+YG+  STIT +HI   LDG+T+E+A+ +NR+FIL
Sbjct  383   MLAGVNPVIIRRLEEFPPTSKLDSKLYGNQNSTITAKHIEGNLDGVTIEEALKNNRLFIL  442

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD +  Y RRIN  T  K YA+RT+LFL+ DGTL+P+ IELS PH  GD+FG  S VY
Sbjct  443   DHHDILTPYLRRINTTT-TKTYASRTILFLKDDGTLKPLVIELSRPHDKGDQFGADSKVY  501

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TPAE GVEGS+WQLAKAY A NDSGVHQLISHWLNTHA IEP +IATNRQLS LHPIYKL
Sbjct  502   TPAEHGVEGSLWQLAKAYVAVNDSGVHQLISHWLNTHAAIEPFVIATNRQLSVLHPIYKL  561

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRDTM+INA  RQ++ NA G++E +  P KYAMEMS+V+YKNWVF   +LP DL  
Sbjct  562   LHPHFRDTMNINAFARQIVINAGGILETTVFPAKYAMEMSSVVYKNWVFTEQALPEDLKK  621

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D +SPHG+RLLIEDYPYAVDG+EIW+AIK WV +YC+FYY +D MV  D ELQ 
Sbjct  622   RGVAVEDPNSPHGLRLLIEDYPYAVDGMEIWSAIKKWVEDYCSFYYTSDEMVQKDAELQN  681

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ ++GH DKK+EPWWP++ +R  LID+CT IIW++SALHAAVNFGQY YAGY P R
Sbjct  682   WWRELREEGHGDKKNEPWWPKMHARKELIDSCTIIIWVASALHAAVNFGQYPYAGYLPNR  741

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SRKFMPE G+ +Y  L+ NPDKA L+TITA  Q LLGISLIEILSRH++DE+YLGQR
Sbjct  742   PTMSRKFMPEEGTPEYAGLEKNPDKAFLRTITAQLQALLGISLIEILSRHSTDEVYLGQR  801

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
               PEWT D + L+AF+ FG  L  IEERILK+N +  LKNR GPV +PYTLL+PT   GL
Sbjct  802   ATPEWTLDDQPLQAFQEFGNTLAKIEERILKLNNNENLKNRVGPVKMPYTLLYPTSGGGL  861

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  862   TGKGIPNSVSI  872



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =  1079 bits (2791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/850 (63%), Positives = 649/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             +E KKI G VVLMK N LD  D  AS++D + +FVG++VS QL+SA + DP     GK  
Sbjct  5     EEKKKILGEVVLMKSNVLDFDDFNASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLG  64

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             + A+LE+W   +T L  GE+ + VTF+W  E +G+PGA  + N+H  +FYLK+LTL+   
Sbjct  65    EEAYLEEWITTITPLTTGEATFKVTFDWDEEHMGIPGAFFITNHHHTQFYLKSLTLQHVP  124

Query  2438  AAGVQ--FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
               G    F C SW+YP+ +YN DR+FF NQ+YLPS+TP PLR FRE EL++LRGDG GE 
Sbjct  125   PHGTTLFFPCNSWIYPSHRYNKDRIFFVNQSYLPSETPEPLRKFREDELQSLRGDGNGEL  184

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY  YNDL DPD      RP+LGG+  YPYPRRGRTGR  TK+DP+ ESR+PL
Sbjct  185   QEWDRVYDYALYNDLADPDKAPQYARPVLGGSTTYPYPRRGRTGRPPTKSDPETESRIPL  244

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    +YVPRDE+FGHLK SDFL YALK++ QV+ P +   F+    EFDS  D+  LYE
Sbjct  245   VKSLNVYVPRDERFGHLKLSDFLAYALKAVSQVIKPGLEEYFEGIPGEFDSLQDVLDLYE  304

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  +  GL  E I++N      KE+ R+DGE LFKFP PQVI   K+AWRTDEEF REM
Sbjct  305   GGFPVPEGLF-EVIRENIAAPFLKEIFRTDGERLFKFPLPQVIKEDKSAWRTDEEFGREM  363

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RLQ FPPRS LDPKVYGD  S IT E I   LDGLTVE+AI  NR+FILD
Sbjct  364   LAGLNPVIIRRLQDFPPRSKLDPKVYGDQKSKITEEQIIHNLDGLTVEEAIKKNRLFILD  423

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RR+N  T  K YA+RT+LFLQ++GTL+P+AIELSLP+  GD+FG VS V+ 
Sbjct  424   HHDSLMPYLRRVNT-TSTKTYASRTILFLQENGTLKPLAIELSLPNLQGDEFGVVSRVFF  482

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAEQGV  +IWQLAKAY A NDSG HQLISHWLNTHAVIEP +IATNRQLS LHP++KLL
Sbjct  483   PAEQGVGSTIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPVFKLL  542

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INA  RQ+L NA G++E +  P KYAMEMS+VLYK+W F   + P DLI R
Sbjct  543   HPHFRDTMNINAFARQILINAGGILEATVFPSKYAMEMSSVLYKDWAFHEQAPPTDLIKR  602

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMA+ D +SPHG+RL+IEDYPYAVDGLEIW+AIKTWVT+YC+FYYK D  V  D ELQ+W
Sbjct  603   GMAIEDSNSPHGLRLVIEDYPYAVDGLEIWSAIKTWVTDYCSFYYKTDEAVRNDPELQSW  662

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +   LIDTC  IIWI+SALHAAVNFGQY YAGY P RP
Sbjct  663   WKELREEGHGDKKDEPWWPKMQNIEDLIDTCAIIIWIASALHAAVNFGQYPYAGYLPNRP  722

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             T+SRKFMPE G+ +Y+EL+TNP+K  L+TITA  QTLLGI+ IEILSRH+SDE+YLGQR+
Sbjct  723   TISRKFMPEEGTPEYKELETNPEKVFLRTITAQLQTLLGIASIEILSRHSSDEVYLGQRD  782

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              P+WT DKE L+AFE+FGKKL  IE+ I K N D  L+NR GPV +PYTLL+P+ EEGL+
Sbjct  783   SPKWTADKEVLDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEEGLT  842

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  843   GKGIPNSVSI  852



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =  1078 bits (2789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/844 (64%), Positives = 649/844 (77%), Gaps = 17/844 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             +KG VVLMKKNFLDL DV AS+VD++ + +G KVS QLI A N DP     GK  KPAFL
Sbjct  15    VKGTVVLMKKNFLDLDDVKASVVDRVDEVLGHKVSLQLIGAVNADPANKCRGKPGKPAFL  74

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQ  2424
             E+W  K T L A ++ + VTFEW E  GVPGA ++KN H  EFYLK LTL+D  G   V 
Sbjct  75    ENWEAKFTPLTATDATFRVTFEWEEEAGVPGAFLIKNFHQKEFYLKKLTLDDVPGHGRVC  134

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVY  2244
             F+C SW+YP++ Y  DR+FFSNQ YLPSQTP  LR +RE EL+NLRG+G G+ +EWDR+Y
Sbjct  135   FICNSWIYPSEYYKKDRIFFSNQTYLPSQTPENLRSYREEELENLRGNGIGKLEEWDRIY  194

Query  2243  DYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             DYD YNDLGDPD      R ILGG+ +YPYPRRGRTGR  T TDPK ESRLP++   EIY
Sbjct  195   DYDVYNDLGDPDKAPKYERKILGGSADYPYPRRGRTGRLPTLTDPKSESRLPMIKSLEIY  254

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQ-NEFDSFDDMNSLYEGGLSRG  1893
             VPRDE+F  LK SDF  YALK + Q    F+ +  +A+   EFD+F+D   +Y+ G    
Sbjct  255   VPRDERFNQLKMSDFAAYALKLLSQ----FLLAELEASNFTEFDTFEDELKIYDDGFKFP  310

Query  1892  L--LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                L+  I+ +  +E+ KE+LRSDGE+L KFP PQVI   K+AWRTDEEFAREMLAG+NP
Sbjct  311   FESLVHKIRDHVPMELVKELLRSDGEHLCKFPMPQVIKDDKSAWRTDEEFAREMLAGLNP  370

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             + I  L+ FPP S LDPKV+GD  STIT EHI + +DGLTVE AI  NR+FIL+HHD +M
Sbjct  371   IIICSLKEFPPTSNLDPKVFGDQKSTITVEHIKNHIDGLTVEHAIKENRLFILNHHDTLM  430

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y R IN+ T  K YATRTLLFL++DGTL+P+AIELSLPHP GD  G VSNVYTPA  G 
Sbjct  431   PYLRCINSTT-TKTYATRTLLFLKEDGTLKPVAIELSLPHPDGDHLGAVSNVYTPANDGQ  489

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E  +WQLAKAY A NDSG HQLISHWLNTHA++EP +IATNRQLS LHPIYKLLHPHFRD
Sbjct  490   EAVVWQLAKAYVAVNDSGYHQLISHWLNTHAIVEPFVIATNRQLSVLHPIYKLLHPHFRD  549

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM INA  RQ L NA G++E++  P K+AMEMSAV+YKNWVF + +LP DLI RGMAV D
Sbjct  550   TMFINAFARQTLINACGIVEMTVFPSKFAMEMSAVIYKNWVFLDQALPADLIKRGMAVED  609

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              ++PHG+RLLI+DYP+AVDGLEIW AIK+WV EYC+FYYK+D M+  D ELQAWW E+ +
Sbjct  610   SNAPHGLRLLIQDYPFAVDGLEIWAAIKSWVEEYCHFYYKSDDMIQGDAELQAWWKELRE  669

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             KGH DKKDEPWWP++ +   LID+CT +IWI+SALHAAVNFGQY YAGY P RPT+SR+F
Sbjct  670   KGHGDKKDEPWWPKMQTVLELIDSCTIVIWIASALHAAVNFGQYPYAGYLPNRPTLSRRF  729

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPEPG+ +YEEL TNP+KA LKTIT   QTLLGISLIE+LSRH +DE+YLG R+ PEWT 
Sbjct  730   MPEPGTPEYEELNTNPEKAFLKTITPQMQTLLGISLIEMLSRHTADEVYLGLRDTPEWTN  789

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D+E L+AFERFGK+L  IEERI +MN D K KNR+GPV VPYT  +P+ E GL+GKGIPN
Sbjct  790   DQEPLQAFERFGKRLREIEERITQMNCDEKWKNRSGPVKVPYTSFYPSSEMGLTGKGIPN  849

Query  278   SISI  267
             S+SI
Sbjct  850   SVSI  853



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =  1078 bits (2789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/849 (63%), Positives = 653/849 (77%), Gaps = 14/849 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E KKIKGRVVLMKKN LDL D+ AS++D++ + VG+ VS QLIS+ N DP     GK  K
Sbjct  32    EDKKIKGRVVLMKKNVLDLNDLTASVLDRVDELVGKAVSLQLISSVNGDPEKGSPGKVGK  91

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LE+W   +T L AG+SA+D+TF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  92    PAYLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  151

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG---TGER  2265
               + FVC SWVYPADKY  DR+FF+N+ YL S TP PL+ FRE EL NLRGD    T E 
Sbjct  152   GRIHFVCNSWVYPADKYKKDRIFFTNKTYLSSDTPKPLQKFREEELVNLRGDDDDKTREL  211

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLG+PD G+   RP+LGG+ E+PYPRRGRTGR  TKTDP  ES+L L
Sbjct  212   QEWDRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTKTDPNTESQLKL  271

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    IYVPRDE+FG LK SD L Y LK+I QV+ P +A+    + NEF++  ++  LYE
Sbjct  272   IMSLNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEILMLYE  331

Query  1910  GGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GG+     +L++I+ + + E+ KE+  +DGEN  KFP PQVI  +K+AWRTDEEFAREML
Sbjct  332   GGIELPDGILKYIRDSIHEELFKELFPTDGENFLKFPVPQVIQDNKSAWRTDEEFAREML  391

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LD K YGD TS IT+EHI   L GL++++AI +N++FILDH
Sbjct  392   AGVNPVAIRRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDH  451

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN  T  K Y++RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYTP
Sbjct  452   HDALMPYLRRINT-TSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGDQFGCISKVYTP  510

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             + QGVE SIWQLAKAY   NDSG HQLISHWL THAVIEP +IA NRQLS LHPI+KLLH
Sbjct  511   SSQGVESSIWQLAKAYVNVNDSGHHQLISHWLKTHAVIEPFVIAANRQLSVLHPIHKLLH  570

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+ NA+ R++LTNA G+IE +  P K++ME S+V+YKNWVFP  +LP DLI RG
Sbjct  571   PHFRETMNANAIAREVLTNAGGIIEETVFPAKFSMEWSSVMYKNWVFPEQALPVDLIKRG  630

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             MAV D  S H VRLLIEDYPYA DGLEIW+AIKTWV E+C+FYYKND MV  D+ELQ+WW
Sbjct  631   MAVEDPKSSHSVRLLIEDYPYAADGLEIWSAIKTWVKEFCSFYYKNDEMVQNDSELQSWW  690

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DKKDEPWWP++ +   LI++CT IIW+SSA HAA+N+GQY+  GY P RP+
Sbjct  691   KELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAINYGQYSIGGYVPNRPS  750

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +S  FMPE G+ +YEELKTNPDKA LKT T   QTLLG++ IEILSRH  DE+YLGQR  
Sbjct  751   ISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLGQRGT  810

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D   L+A E F KKL  IE+RI+KMN D KLKNR GP  +PYTLL+P+ E GL+G
Sbjct  811   PEWTTDANMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEPGLTG  870

Query  293   KGIPNSISI  267
             KGIPNS++I
Sbjct  871   KGIPNSVNI  879



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =  1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/850 (63%), Positives = 647/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             +E +KI G VVLMK N LD  D   S++D + +FVG++VS QL+SA + DP     GK  
Sbjct  5     EERRKILGEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLG  64

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRES-LGVPGAVIVKNNHANEFYLKTLTLEDGG  2439
             + A+LE+W   +T L  GE+ + VTF+W E  +G+PGA  + N+H + FYLK+LTL+   
Sbjct  65    EEAYLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVP  124

Query  2438  AAGVQ--FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
               G    F C SW+YP+ +Y  DR+FF NQ+YLPS+TP PLR FRE EL++LRG G GE 
Sbjct  125   PHGTTLFFPCNSWIYPSHRYKNDRIFFLNQSYLPSETPDPLRKFREDELQSLRGGGNGEL  184

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY  YNDL DPD      RP+LGG+  YPYPRRGRTGR  TK+DP+ ESR+PL
Sbjct  185   QEWDRVYDYALYNDLADPDKAPQYARPVLGGSTTYPYPRRGRTGRPPTKSDPETESRIPL  244

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    +YVPRDE+FGHLK SDFL YALK+I Q + P +   F+    EFDS  D   LYE
Sbjct  245   VKSLNVYVPRDERFGHLKLSDFLAYALKAISQFIKPGLEEYFEGIPGEFDSLQDFLDLYE  304

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  +  GL  E I++N      KE+ R+DGE LFKFP PQVI   K+AWRTDEEF REM
Sbjct  305   GGFPVPEGLF-EVIRENIAAPFLKEIFRTDGERLFKFPLPQVIKEDKSAWRTDEEFGREM  363

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I +LQ FPPRS LDP+VYGD  S IT E I   LD LTVE+AI  NR+FILD
Sbjct  364   LAGLNPVVIRKLQDFPPRSKLDPEVYGDQKSKITEEQIIHNLDELTVEEAIKKNRLFILD  423

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YA+RT+LFLQ++GTL+P+AIELSLP+P GDKFG VS V+ 
Sbjct  424   HHDSLMPYLRRINT-TSTKTYASRTILFLQENGTLKPLAIELSLPNPQGDKFGVVSKVFF  482

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAEQGV  SIWQLAKAY A NDSG HQLISHWLNTHAVIEP +IATNRQLS LHP++KLL
Sbjct  483   PAEQGVGSSIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPVFKLL  542

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INA  RQ+L NA G++E +  P KYAMEMSAVLYK+W F   +LP DLI R
Sbjct  543   HPHFRDTMNINAFARQMLINAGGILEATVFPSKYAMEMSAVLYKDWAFHEQALPADLIKR  602

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMA+ D +SPHG+RL+IEDYPYAVDGLEIW+AIKTWVT+YC+FYYK D  V  D ELQ+W
Sbjct  603   GMAIEDSNSPHGLRLVIEDYPYAVDGLEIWSAIKTWVTDYCSFYYKTDEAVRNDPELQSW  662

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +   LIDTC  IIWI+SALHAAVNFGQY YAGY P RP
Sbjct  663   WKELREEGHGDKKDEPWWPKMQNIEELIDTCAIIIWIASALHAAVNFGQYPYAGYLPNRP  722

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             T+SRKFMPE G+ +Y+EL+TNP+KA L+TITA  QTLLGI+ IEILSRH+SDE+YLGQR+
Sbjct  723   TISRKFMPEEGTPEYKELETNPEKAFLRTITAQLQTLLGIASIEILSRHSSDEVYLGQRD  782

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              P+WT DKEAL+AFE+FGKKL  IE+ I K N D  L+NR GPV +PYTLL+P+ EEGL+
Sbjct  783   SPKWTADKEALDAFEKFGKKLAEIEDGITKRNEDLTLRNRVGPVFMPYTLLYPSSEEGLT  842

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  843   GKGIPNSVSI  852



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =  1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/855 (64%), Positives = 659/855 (77%), Gaps = 21/855 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GK  2619
             E KKI+G VVLMKKN LD  D+ AS++D+I +F+G+ VS QLISA + +P        GK
Sbjct  32    ESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSLQLISATHPEPAANRLVLRGK  91

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDG  2442
               K A+LE W    TSL AG++A+  + +W ES+GVPGA+++ N+H ++FYLKT+TL+D 
Sbjct  92    PGKIAYLEKWITTATSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLDDV  151

Query  2441  -GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SWVYPA +Y Y+R+FFSN+AYLPSQTP  L P+RE EL NLRG G+GE 
Sbjct  152   LGHGRVHFVCNSWVYPAHRYKYNRIFFSNKAYLPSQTPELLLPYREEELTNLRGIGSGEL  211

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLG PD G    RP+LGG+ EYPYPRRGRTGRK TKTD   ESRL L
Sbjct  212   KEWDRVYDYAYYNDLGSPDKGPEYERPVLGGSQEYPYPRRGRTGRKPTKTDHNSESRLFL  271

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L + +IYVPRDE+FGH+K SDFL YALKS+ Q+++P + S  D T NEFD+F+D+  LYE
Sbjct  272   LSL-DIYVPRDERFGHVKFSDFLAYALKSLVQILLPELRSLCDKTINEFDTFEDVLDLYE  330

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G  L+ ++     E+ KE+LRSDGE   KFP P VI   K+AWRTDEEFAREM
Sbjct  331   GGIKLPNGPTLKKLRDRVPWELLKELLRSDGERFLKFPMPDVIKVDKSAWRTDEEFAREM  390

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I+RLQ FPP S LDPKVYG+  S+I +E I   ++GL+VE+AI SNR FILD
Sbjct  391   LAGVNPVNITRLQEFPPTSKLDPKVYGNQNSSIRKEQIEKNMNGLSVEEAIKSNRFFILD  450

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T +       LL LQ+DGTL+P+AIELSLPHP G+  G VS V+T
Sbjct  451   HHDALMTYLRRINTTTTKTYATRTFLL-LQEDGTLKPLAIELSLPHPQGEHHGAVSKVFT  509

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE G+E S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP IIATNRQLS LHPI+KLL
Sbjct  510   PAEDGIEASVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFIIATNRQLSVLHPIHKLL  569

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTM+INAL RQ+L NA GV+E +  P +YAMEMSA +YK+WVF   +LP DL+ R
Sbjct  570   QPHFRDTMNINALARQILINAGGVLEKTVFPAQYAMEMSAGIYKHWVFTEQALPADLLKR  629

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMA+ D SSPHG+RLLIEDYP+AVDGLEIW+AI+TWVTEYC+ YY  D +V +DTELQ W
Sbjct  630   GMAISDPSSPHGLRLLIEDYPFAVDGLEIWSAIETWVTEYCSVYYATDNVVRSDTELQKW  689

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+  +GH DKK EPWWP + +R  LI +CT IIW++SALHAAVNFGQ+ YAGY P RP
Sbjct  690   WEELRNEGHGDKKAEPWWPEMHTRAELIQSCTIIIWVASALHAAVNFGQWPYAGYLPNRP  749

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             T+SR+FMPEPG+A+Y EL+TNPD A LKTIT+  QTLLG+SLIE+LSRHA+DEIYLGQR+
Sbjct  750   TISRRFMPEPGTAEYAELETNPDVAFLKTITSQLQTLLGVSLIEVLSRHATDEIYLGQRD  809

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----  312
              PEWT D EAL AF RFG+KL+ IE+RI +   D +LKNR GP+ +PYTLL+P+      
Sbjct  810   TPEWTSDGEALAAFGRFGEKLIEIEKRITERTRDERLKNRVGPIKMPYTLLYPSTSDYSR  869

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNSISI
Sbjct  870   EGGLTGKGIPNSISI  884



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =  1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/850 (64%), Positives = 652/850 (77%), Gaps = 19/850 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--GKRSK---PAF  2601
             KIKG VVLMKKN LD  D+ AS++D++ + +GQ V+FQL+SA   DP  GKR K   PA+
Sbjct  19    KIKGTVVLMKKNVLDFNDLHASLLDRMHEILGQGVTFQLVSATEGDPNNGKRGKVGPPAY  78

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LE+W   LTSL AGES ++VTF W ES G+PGAVIVKN+H +EF+LK+LTLE     G +
Sbjct  79    LEEWITTLTSLSAGESRFNVTFNWDESQGIPGAVIVKNSHHSEFFLKSLTLEGVPRKGRI  138

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG-TGERKEWDR  2250
              FVC SWVYP DKY YDRVFF+N  YLPS+TP PLRP+R  EL +LRGD  TGE +E DR
Sbjct  139   HFVCNSWVYPVDKYTYDRVFFANHTYLPSKTPEPLRPYRLEELLHLRGDDVTGELQEHDR  198

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VY Y YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ESRLPLL +  
Sbjct  199   VYAYAYYNDLGDPDKGAEYVRPVLGGSSEYPYPRRGRTGRPPTKTDPNSESRLPLLSL-N  257

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+FGHLK SDFL YALKS+ Q + P + + FD T  EFDS  D+ +LYEGGL  
Sbjct  258   IYVPRDERFGHLKMSDFLAYALKSLTQSLQPLLNTVFDKTPMEFDSLQDVLNLYEGGLKL  317

Query  1895  GLL--LEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                  LE I+    LE+ KE++RSDGE + K P PQVI   K AWRTDEEF REMLAGVN
Sbjct  318   PEFPALEEIKDRIPLEMIKELVRSDGEQVLKLPLPQVIKEDKDAWRTDEEFGREMLAGVN  377

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I RL+ FPP S LDPK YGDHTS+IT  HI   L+GLTV+QA+ SNR+FILDHHD +
Sbjct  378   PVIIRRLEEFPPTSKLDPKTYGDHTSSITAAHIEKNLEGLTVDQALKSNRLFILDHHDAL  437

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
               Y  RIN+ T  KIYA+RT+L L+ DGTL+P+AIELS PHP G++ G V+ V+TPAE G
Sbjct  438   FPYLNRINS-TSHKIYASRTILLLKDDGTLKPLAIELSKPHPDGEQHGSVNQVFTPAEDG  496

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A +DSG HQLISHWLNTHAVIEP +IATNRQLS +HPIYKLL PH+R
Sbjct  497   VEASIWQLAKAYVAVDDSGYHQLISHWLNTHAVIEPFVIATNRQLSVMHPIYKLLSPHYR  556

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA GV+E +  PGKYAMEMSAV+YK+W   +H+LP+DL+ RG+AV 
Sbjct  557   DTMNINALARQILINAGGVLESTVFPGKYAMEMSAVIYKDWKLTDHALPDDLLKRGVAVR  616

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSPH VRLLI+DYPYAVDGL IW AI+ WV EYC+ YY +D  V  D ELQAWW EV 
Sbjct  617   DPSSPHKVRLLIKDYPYAVDGLVIWWAIEKWVAEYCSIYYPSDAAVRGDVELQAWWKEVR  676

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKK E WWP + +   L  TC+TIIW++SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  677   EVGHGDKKKETWWPNMRTFRELTKTCSTIIWVASALHAAVNFGQYPYAGYLPNRPTISRR  736

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+  YEEL+ NP+   LKTIT+  QT+LG+SLIEILSRH+SDE+YLGQR+ PEWT
Sbjct  737   FMPEPGTPAYEELEKNPEGVFLKTITSQFQTILGVSLIEILSRHSSDEVYLGQRDTPEWT  796

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----GLS  297
              D++AL+AF+RFG  LV IE+RIL MN D ++KNR GPV +PYTLL+P   +     GL+
Sbjct  797   TDRKALDAFKRFGDNLVEIEKRILTMNEDTRIKNRNGPVKMPYTLLYPNTSDFSRVGGLT  856

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  857   GKGIPNSVSI  866



>ref|NP_001281026.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82794.1| lipoxygenase [Malus domestica]
Length=933

 Score =  1077 bits (2785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/851 (63%), Positives = 647/851 (76%), Gaps = 16/851 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KKIKG VVLMKKN L+L D+ AS +D+  +  G+KVS QLIS+ N DP     GK  
Sbjct  85    DDDKKIKGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVG  144

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K A+LEDW  K+T L A E+A+D+TF+W E +GVPGA I++N H +EFYLK+LTLED  G
Sbjct  145   KAAYLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPG  204

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SWVYPA KY  DRVFF+N+ YL S TP PL+ FRE EL+NLRGD   E++E
Sbjct  205   EGRVHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRE  264

Query  2258  ---WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
                WDRVY Y YYNDLG PD G    RPILGG+ E+PYPRRGRTGR+ T+ DPK ES + 
Sbjct  265   LEEWDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRGRTGRQATEKDPKSESPMM  324

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
             L+    +YVPRDE+FGHLK SD + YA+KS+ Q+V P   +   ATQNEF S  D+  LY
Sbjct  325   LIMSIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLY  384

Query  1913  EGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             EGG  L +GLL + ++ N  +E  KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  385   EGGIELPKGLL-KSVRDNIPVETIKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  443

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAG+NPV I RLQ FPP S LD K YGD TS IT+E IA  L GL++++AI +N++FIL
Sbjct  444   MLAGINPVSIRRLQEFPPASKLDRKAYGDQTSRITKEQIAHNLKGLSIDEAIDNNKLFIL  503

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD IM Y RRINA T  K YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FGC SNVY
Sbjct  504   DHHDSIMPYLRRINA-TSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGCTSNVY  562

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQLAKAY A  DSG HQLISHWL THA +EP IIATNRQLS LHPI+KL
Sbjct  563   TPSSQGVESSIWQLAKAYVAVVDSGYHQLISHWLTTHAAMEPFIIATNRQLSVLHPIHKL  622

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRD M++NAL RQ+L NA G++E +  P K++ME S+ +YKNWVFP  +LP DLI 
Sbjct  623   LHPHFRDNMNVNALARQVLINAGGILEATLFPAKFSMEWSSAMYKNWVFPEQALPVDLIK  682

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RGMAV D SS HGVRLLIEDYP+A DGLEIW+AIKTWV +YC+FYYK D  V  D+ELQ+
Sbjct  683   RGMAVEDSSSSHGVRLLIEDYPFAADGLEIWSAIKTWVKDYCSFYYKTDETVQKDSELQS  742

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ ++GH DKKDEPWWP++ +R  LI++CT IIWI+SA HAA+NFGQY Y GY P R
Sbjct  743   WWKELREEGHGDKKDEPWWPKMQTREELIESCTIIIWIASAHHAAINFGQYPYGGYPPNR  802

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             P++SR+FMPE G+ +YEELKT+P+K  LKT+T   QTLLG++ IEILSRH++DE+YLGQR
Sbjct  803   PSISRRFMPEEGAPEYEELKTDPEKEFLKTMTPELQTLLGMASIEILSRHSADEVYLGQR  862

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F KKL   EE + + N D KLKNR GP  +PYTLL+P+ E GL
Sbjct  863   DSAEWTTDADILQASENFRKKLKEAEESMKRKNKDEKLKNRAGPAKMPYTLLYPSSEAGL  922

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  923   TGKGIPNSVSI  933



>ref|XP_008245950.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =  1076 bits (2782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/849 (63%), Positives = 653/849 (77%), Gaps = 14/849 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E  KIKGRVVLMKKN LDL D+ AS++D++++ VG+ VS QLIS+ N DP     GK  K
Sbjct  76    EGMKIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGK  135

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LE+W   +T L AG+SA+D+TF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  136   PAYLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  195

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG---TGER  2265
               + FVC SWVYPADKY  DR+FF+N+ YL S TP PL+ FRE EL NLRGD    T E 
Sbjct  196   GQIHFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTREL  255

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLG+PD G+   RP+LGG+ E+PYPRRGRTGR  T+TDP  ES+L L
Sbjct  256   QEWDRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTETDPNTESQLKL  315

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    IYVPRDE+FG LK SD L Y LK+I QV+ P +A+    + NEF++  ++  LYE
Sbjct  316   IMSLNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEVLKLYE  375

Query  1910  GGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GG+     +L++I+ + + E+ KE+ R+DGE   KFP PQVI  +K+AWRTDEEFAREML
Sbjct  376   GGIELPDGILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQDNKSAWRTDEEFAREML  435

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LD K YGD TS IT+EHI   L GL++++AI +N++FILDH
Sbjct  436   AGVNPVAIRRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDH  495

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN  T  K Y++RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYTP
Sbjct  496   HDELMPYLRRINT-TSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGDQFGCISKVYTP  554

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             + QGVE SIWQLAKAY   NDSG HQLISHWL THAVIEP +IA NRQLS LHPI+KLLH
Sbjct  555   SSQGVESSIWQLAKAYVNVNDSGHHQLISHWLKTHAVIEPFVIAANRQLSVLHPIHKLLH  614

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+ NA+ R++LTNA G+IE +  P K++ME S+V+YKNWVFP  +LP DLI RG
Sbjct  615   PHFRETMNANAIAREVLTNAGGIIEETVFPAKFSMEWSSVMYKNWVFPEQALPVDLIKRG  674

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             MAV D  S H VRLLIEDYPYA DGLEIW+AIKTWV EYC+FYY+ND MV  D+ELQ+WW
Sbjct  675   MAVEDPKSSHSVRLLIEDYPYAADGLEIWSAIKTWVKEYCSFYYRNDEMVQNDSELQSWW  734

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DK+DEPWWP++ +   LI++CT IIW+SSA HAA+N+GQY+  GY P RPT
Sbjct  735   KELREEGHGDKRDEPWWPKMQTCEELIESCTIIIWLSSAYHAAINYGQYSIGGYVPNRPT  794

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +S  FMPE G+ +YEELKTNPDKA LKT T   QTLLG++ IEILSRH  DE+YLGQR  
Sbjct  795   ISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLGQRGT  854

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D   L+A E F KKL  IE+RI+KMN D KLKNR GP  +PYTLL+P+ E GL+G
Sbjct  855   PEWTTDANMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEPGLTG  914

Query  293   KGIPNSISI  267
             KGIP+S++I
Sbjct  915   KGIPSSVNI  923



>ref|XP_008246451.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =  1076 bits (2782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/849 (63%), Positives = 652/849 (77%), Gaps = 14/849 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E  KIKGRVVLMKKN LDL D+ AS++D++++ VG+ VS QLIS+ N DP     GK  K
Sbjct  76    EGMKIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGK  135

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LE+W   +T L AG+SA+D+TF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  136   PAYLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  195

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG---TGER  2265
               + FVC SWVYPADKY  DR+FF+N+ YL S TP PL+ FRE EL NLRGD    T E 
Sbjct  196   GQIHFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTREL  255

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLG+PD G+   RP+LGG+ E+PYPRRGRTGR  T+TDP  ES+L L
Sbjct  256   QEWDRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTETDPNTESQLKL  315

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    IYVPRDE+FG LK SD L Y LK+I QV+ P +A+    + NEF++  ++  LYE
Sbjct  316   IMSLNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEVLKLYE  375

Query  1910  GGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GG+     +L++I+ + + E+ KE+ R+DGE   KFP PQVI  +K+AWRTDEEFAREML
Sbjct  376   GGIELPDGILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQDNKSAWRTDEEFAREML  435

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LD K YGD TS IT+EHI   L GL++++AI +N++FILDH
Sbjct  436   AGVNPVAIRRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDH  495

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN  T  K Y++RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYTP
Sbjct  496   HDELMPYLRRINT-TSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGDQFGCISKVYTP  554

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             + QGVE SIWQLAKAY   NDSG HQLISHWL THAVIEP +IA NRQLS LHPI+KLLH
Sbjct  555   SSQGVESSIWQLAKAYVNVNDSGHHQLISHWLKTHAVIEPFVIAANRQLSVLHPIHKLLH  614

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+ NA+ R++LTNA G+IE +  P K++ME S+V+YKNWVFP  +LP DLI RG
Sbjct  615   PHFRETMNANAIAREVLTNAGGIIEETVFPAKFSMEWSSVMYKNWVFPEQALPVDLIKRG  674

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             MAV D  S H VRLLIEDYPYA DGLEIW+AIKTWV EYC+FYY+ND MV  D+ELQ+WW
Sbjct  675   MAVEDPKSSHSVRLLIEDYPYAADGLEIWSAIKTWVKEYCSFYYRNDEMVQNDSELQSWW  734

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ ++GH DK DEPWWP++ +   LI++CT IIW+SSA HAA+N+GQY+  GY P RPT
Sbjct  735   KELREEGHGDKTDEPWWPKMQTCEELIESCTIIIWLSSAYHAAINYGQYSIGGYVPNRPT  794

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +S  FMPE G+ +YEELKTNPDKA LKT T   QTLLG++ IEILSRH  DE+YLGQR  
Sbjct  795   ISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLGQRGT  854

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D   L+A E F KKL  IE+RI+KMN D KLKNR GP  +PYTLL+P+ E GL+G
Sbjct  855   PEWTTDANMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEPGLTG  914

Query  293   KGIPNSISI  267
             KGIPNS++I
Sbjct  915   KGIPNSVNI  923



>ref|XP_009376660.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=931

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/851 (62%), Positives = 646/851 (76%), Gaps = 16/851 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KKI+G VVLMKKN L+L D+ AS +D+  +  G+KVS QLIS+ N DP     GK  
Sbjct  83    DDDKKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVG  142

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K A+LEDW  K+T L A E+A+D+TF+W E +GVPGA I++N H +EFYLK+LTLED  G
Sbjct  143   KAAYLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPG  202

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SWVYPA KY  DRVFF+N+ YL S TP PL+ FRE EL+NLRGD   E++E
Sbjct  203   EGRVHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRE  262

Query  2258  ---WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
                WDRVY Y YYNDLG PD G    RPILGG+ E+PYPRR RTGR+ T+ DPK ES + 
Sbjct  263   LEEWDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRVRTGRQATEKDPKSESPMM  322

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
             L+    +YVPRDE+FGHLK SD + YA+KS+ Q+V P   +   ATQNEF S  D+  LY
Sbjct  323   LIMSIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLY  382

Query  1913  EGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             EGG  L +GLL + ++ N  +E  KE+LR+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  383   EGGIELPKGLL-KSVRDNIPVETIKELLRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  441

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAG+NPV I RLQ FPP S LD K YGD TS IT+EHIA  L GL++++AI +N++FIL
Sbjct  442   MLAGINPVTIRRLQEFPPASKLDQKAYGDQTSRITKEHIAHNLKGLSIDEAIDNNKLFIL  501

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD IM Y R IN  T  K YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FGC SNVY
Sbjct  502   DHHDSIMPYLRGIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGCTSNVY  560

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQLAKAY A  DSG HQLISHWL THA +EP IIATNRQLS LHPI+KL
Sbjct  561   TPSSQGVESSIWQLAKAYVAVVDSGYHQLISHWLRTHAAMEPFIIATNRQLSVLHPIHKL  620

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRD M++NAL RQ+L NA G++E +  P K++ME ++ +YKNWVFP  +LP DLI 
Sbjct  621   LHPHFRDNMNVNALARQVLINAGGILEATLFPAKFSMEWTSAMYKNWVFPEQALPVDLIK  680

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RGMAV D SS HGVRLLIEDYP+A DGLEIW+AIKTWV +YC+FYYK D  V  D+ELQ+
Sbjct  681   RGMAVEDSSSSHGVRLLIEDYPFAADGLEIWSAIKTWVKDYCSFYYKTDETVQKDSELQS  740

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ ++GH DKKDEPWWP++ +R  LI++CT IIWI+SA HAA+NFGQY Y GY P R
Sbjct  741   WWKELREEGHGDKKDEPWWPKMQTREELIESCTIIIWIASAHHAAINFGQYPYGGYPPNR  800

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             P++SR+FMPE G+ +YEELKT+P+KA LKT+T   QTLLG++ IEILSRH++DE+YLGQR
Sbjct  801   PSISRRFMPEEGTPEYEELKTDPEKAFLKTMTPELQTLLGMASIEILSRHSADEVYLGQR  860

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F  KL   EE + + N D KLKNR GP  +PYTLL+P+ E GL
Sbjct  861   DSAEWTTDADILQASENFRMKLKEAEESMKRKNEDEKLKNRAGPAKMPYTLLYPSSEAGL  920

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  921   TGKGIPNSVSI  931



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =  1073 bits (2775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/854 (65%), Positives = 660/854 (77%), Gaps = 18/854 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKR  2616
             A E KKIKG VVLMKKN LD  D+ AS++D+I +  G+ VS Q+IS+   DP     GK 
Sbjct  33    AVETKKIKGTVVLMKKNVLDFNDIKASLLDRIHELFGKVVSMQIISSVLPDPENGFRGKL  92

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              K A+LE W   ++   A E+ + VTFEW E++G+PGA I+KN+H ++F+LKT+TLED  
Sbjct  93    GKVAYLEKWISTISPTAARETQFTVTFEWGETMGLPGAFIIKNHHHSQFFLKTVTLEDVP  152

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   V FVC SWVYP  +Y Y+RVFFS++ YLP QTP  LR +RE ELKNLRG+GTGE K
Sbjct  153   GHGRVHFVCNSWVYPTHRYKYNRVFFSSKTYLPCQTPDLLRYYREEELKNLRGNGTGELK  212

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLG PD G    RP+LGG  EYPYPRRGRTGRK TKTDP  E RLPLL
Sbjct  213   EWDRVYDYAYYNDLGSPDKGPDYARPVLGGTQEYPYPRRGRTGRKPTKTDPNSEKRLPLL  272

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
              + +IYVPRDE+FGH+K SDFL YALKS+ QV++P + S  D T NEFD F+D+  LYEG
Sbjct  273   NL-DIYVPRDERFGHVKFSDFLAYALKSLVQVLLPELKSLCDKTINEFDKFEDVLRLYEG  331

Query  1907  GLS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GL    G  L  I++    E+ +E+ RSDGE   KFP P VI   K+AWRTDEEF REML
Sbjct  332   GLKLPNGHTLGKIRERIPWELLRELARSDGERFLKFPIPAVIKEDKSAWRTDEEFGREML  391

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LDP+VYG   S+IT+E I   ++GLTV+QAI  N++FILDH
Sbjct  392   AGVNPVIIRRLQEFPPVSKLDPEVYGKQNSSITKEQIEKYMNGLTVDQAIEENKLFILDH  451

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M   +RIN+ T  K YATRTLL LQ DGTL+P+AIELSLPHP GD  G VS V+TP
Sbjct  452   HDALMPCLKRINSTT-TKTYATRTLLLLQDDGTLKPLAIELSLPHPQGDSHGAVSKVFTP  510

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             AE+GVEG+IWQLAKAYAA NDSG HQLISHWLNTHAVIEP IIATNRQLS +HPIYKLL 
Sbjct  511   AEEGVEGTIWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFIIATNRQLSVVHPIYKLLD  570

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INAL RQ+L NA GV+E +  P  YAMEMSAVLYKNWVF +H+LP DL+NRG
Sbjct  571   PHFRDTMNINALARQILINAGGVLERTVFPATYAMEMSAVLYKNWVFTDHALPTDLLNRG  630

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +A+ D  SPHG++LLI DYPYAVDGLEIW+AIKTWVT+Y + YY +D  V  D ELQ WW
Sbjct  631   VAIPDPGSPHGLKLLIPDYPYAVDGLEIWSAIKTWVTDYISLYYPSDSAVAADPELQFWW  690

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
             TE+ + GH DKKDEPWWP++ +   L+++ TTIIW++SALHAAVNFGQY YAG+ P RPT
Sbjct  691   TEIRKVGHGDKKDEPWWPQMSTIADLVNSATTIIWVASALHAAVNFGQYPYAGFLPNRPT  750

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ ++ EL+++PD A LKTITA  Q LLG+SLIEILSRH++DE+YLGQR+ 
Sbjct  751   VSRRFMPEPGTPEFAELESDPDAAFLKTITAQFQALLGVSLIEILSRHSTDEVYLGQRDT  810

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGE  309
             PEWT D EA+EAFERFGK+LV IEERIL+ N D +L+NR GPV VPYTLLFP     T E
Sbjct  811   PEWTDDGEAIEAFERFGKRLVEIEERILERNRDERLRNRVGPVKVPYTLLFPGTSDFTRE  870

Query  308   EGLSGKGIPNSISI  267
              GL+GKGIPNSISI
Sbjct  871   GGLTGKGIPNSISI  884



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score =  1073 bits (2774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/802 (66%), Positives = 630/802 (79%), Gaps = 36/802 (4%)
 Frame = -1

Query  2657  FQLISAENDDPGKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHA  2481
             F    A N   GK   PAFLE W   LTSL AGESA++VTF+W E +G PGA I+KN H 
Sbjct  2     FSCFFAGNALKGKLGTPAFLEKWITTLTSLTAGESAFNVTFDWDEEVGAPGAFIIKNLHH  61

Query  2480  NEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREA  2304
             NEFYLKT+TLED  G   + FVC SWVYPADKY  DR+FFSNQAYLP  TP PL+ +REA
Sbjct  62    NEFYLKTVTLEDVPGHERIHFVCNSWVYPADKYKTDRIFFSNQAYLPHNTPEPLKFYREA  121

Query  2303  ELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGKP---RPILGGNPEYPYPrrgrtgrk  2133
             EL NLRGDGTGERKEWDR+YDY YYNDLGDPD   P   RP+LGG+ EYPYPRRGRTGR 
Sbjct  122   ELVNLRGDGTGERKEWDRIYDYAYYNDLGDPDKNDPSYVRPVLGGSVEYPYPRRGRTGRP  181

Query  2132  mtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQ  1953
              TKTDPK ESRLPLL    IYVPRDE+FGHLK SDFL Y LKSI Q++   + ++FD+T 
Sbjct  182   PTKTDPKSESRLPLLMSLNIYVPRDERFGHLKMSDFLAYGLKSISQLLSSELEAQFDSTP  241

Query  1952  NEFDSFDDMNSLYEGGLSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKT  1773
             +EFDSF+DM  +YEGG+    L + + +N +LEI K+VL +DGE L K+P P++I   ++
Sbjct  242   SEFDSFEDMQKIYEGGIK---LPKSLTENISLEILKQVLPTDGEGLLKYPLPKIIEGDRS  298

Query  1772  AWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVE  1593
             AWRTDEEFAREMLAG+NPV IS L+ FPP S +DP VYG+HTSTITREHI +KLDGLTVE
Sbjct  299   AWRTDEEFAREMLAGLNPVIISALKEFPPVSKIDPNVYGNHTSTITREHIENKLDGLTVE  358

Query  1592  QAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPL  1413
             +AI +NR+FIL+HHD IM Y RRINA T  K YA+RTLLFL ++GTL+P+AIELSLPHP 
Sbjct  359   EAIKTNRLFILNHHDTIMPYLRRINA-TPTKTYASRTLLFLHENGTLKPVAIELSLPHPD  417

Query  1412  GDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNR  1233
             GD+FG +S VYTPAEQGVE +IWQLAKAY A NDSG+HQLI+HWL THAVIEPI+IATNR
Sbjct  418   GDQFGAISEVYTPAEQGVENAIWQLAKAYVAVNDSGIHQLITHWLRTHAVIEPIVIATNR  477

Query  1232  QLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVF  1053
             QLS LHPIYKLLHPHFRDTM+INA+ RQ+LTNA GV+E +  P                 
Sbjct  478   QLSVLHPIYKLLHPHFRDTMNINAIARQILTNAKGVVESTLFP-----------------  520

Query  1052  PNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKND  873
                       +R MAV D +SP G+RLLIEDYPYAVDGL+IW+AIKTWVT+YC+FYYK+D
Sbjct  521   ----------SRKMAVKDSTSPFGLRLLIEDYPYAVDGLKIWSAIKTWVTDYCSFYYKSD  570

Query  872   IMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFG  693
              M+  D ELQ+WW EV +KGH DKKDEPWWPR+ +   LID+CT IIW+SSALHAA NFG
Sbjct  571   QMIQEDIELQSWWKEVREKGHADKKDEPWWPRMKTITELIDSCTIIIWLSSALHAATNFG  630

Query  692   QYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSR  513
             Q+ YAGY P RPT SR+FMPEPG+ +YEELK+NPDKA LKTIT   QTLLG+S IEILSR
Sbjct  631   QWPYAGYQPNRPTTSRRFMPEPGTPEYEELKSNPDKAFLKTITPQFQTLLGLSTIEILSR  690

Query  512   HASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPY  333
             H +DE+YLGQRE+P+WTKD E LEAF+RFG+ L  IE++IL+MNGD K +NR GPVN+PY
Sbjct  691   HTTDEVYLGQRENPQWTKDTEPLEAFKRFGQTLSEIEDQILQMNGDPKWRNRVGPVNIPY  750

Query  332   TLLFPTGEEGLSGKGIPNSISI  267
             TLLFPT + G++G+GIPNSI+I
Sbjct  751   TLLFPTSDSGITGRGIPNSIAI  772



>ref|XP_009376680.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=931

 Score =  1072 bits (2773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/851 (62%), Positives = 645/851 (76%), Gaps = 16/851 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KKI+G VVLMKKN L+L D+ AS +D+  +  G+KVS QLIS+ N DP     GK  
Sbjct  83    DDDKKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVG  142

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K A+LEDW  K+T L A E+A+D+TF+W E +GVPGA I++N H +EFYLK+LTLED  G
Sbjct  143   KAAYLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPG  202

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SWVYPA KY  DRVFF+N+ YL S TP PL+ FRE EL+NLRGD   E++E
Sbjct  203   EGRVHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRE  262

Query  2258  ---WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
                WDRVY Y YYNDLG PD G    RPILGG+ E+PYPRR RTGR+ T+ DPK ES + 
Sbjct  263   LEEWDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRVRTGRQATEKDPKSESPMM  322

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
             L+    +YVPRDE+FGHLK SD + YA+KS+ Q+V P   +   ATQNEF S  D+  LY
Sbjct  323   LIMSIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLY  382

Query  1913  EGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             EGG  L +GLL + ++ N  +E  KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  383   EGGIELPKGLL-KSVRDNIPVETIKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  441

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAG+NPV I RLQ FPP S LD K YGD TS IT+EHIA  L GL++++AI +N++FIL
Sbjct  442   MLAGINPVTIRRLQEFPPASKLDQKAYGDQTSRITKEHIAHNLKGLSIDEAIDNNKLFIL  501

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD IM Y R IN  T  K YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FGC SNVY
Sbjct  502   DHHDSIMPYLRGIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGCTSNVY  560

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQLAKAY A  DSG HQLISHWL THA +EP IIATNRQLS LHPI+KL
Sbjct  561   TPSSQGVESSIWQLAKAYVAVVDSGYHQLISHWLRTHAAMEPFIIATNRQLSVLHPIHKL  620

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRD M++NAL RQ+L NA G++E +  P K++ME ++ +YKNWVFP  +LP DLI 
Sbjct  621   LHPHFRDNMNVNALARQVLINAGGILEATLFPAKFSMEWTSAMYKNWVFPEQALPVDLIK  680

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RGMAV D SS HGVRLLIEDYP+A DGLEIW+AIKTWV +YC+FYYK D  V  D+ELQ+
Sbjct  681   RGMAVEDSSSSHGVRLLIEDYPFAADGLEIWSAIKTWVKDYCSFYYKTDETVQKDSELQS  740

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ ++GH DKKDEPWWP++ +R  LI++CT IIWI+SA HAA+NFGQY Y GY P R
Sbjct  741   WWKELREEGHGDKKDEPWWPKMQTREELIESCTIIIWIASAHHAAINFGQYPYGGYPPNR  800

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             P++SR+FMPE G+ +YEELKT+P+KA LKT+T   QTLLG++ IEILSRH++DE+YLGQR
Sbjct  801   PSISRRFMPEEGTPEYEELKTDPEKAFLKTMTPELQTLLGMASIEILSRHSADEVYLGQR  860

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F  KL   EE + + N D KLKNR GP  +PYTLL+P+ E GL
Sbjct  861   DSAEWTTDADILQASENFRMKLKEAEESMKRKNEDEKLKNRAGPAKMPYTLLYPSSEAGL  920

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  921   TGKGIPNSVSI  931



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =  1072 bits (2773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/850 (64%), Positives = 661/850 (78%), Gaps = 19/850 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--GKRSK---PAF  2601
             KIKG VVLMKKN LD  D+ AS++D++ + +G+ +SFQL+SA   DP  GKR K    A+
Sbjct  20    KIKGTVVLMKKNVLDFNDLHASLLDRMHEVLGKGISFQLVSATVGDPNNGKRGKVGPAAY  79

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-V  2427
             LE+W   LTSL AGES ++VTF+W ES G+PGAVIVKN+H +EFYLK+LTL+     G +
Sbjct  80    LEEWITTLTSLSAGESRFNVTFDWDESQGIPGAVIVKNSHHSEFYLKSLTLDGVPRKGSI  139

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG-TGERKEWDR  2250
              FVC SWVYP DKY YDR+FF+N  YLPS+TP PLRP+R+ EL +LRGD  +GE +E DR
Sbjct  140   HFVCNSWVYPVDKYKYDRIFFANTTYLPSKTPEPLRPYRQEELLHLRGDDDSGELQEHDR  199

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VY Y YYNDLG+PD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ESRLPLL + +
Sbjct  200   VYAYAYYNDLGNPDKGAEYARPVLGGSSEYPYPRRGRTGRPPTKTDPNTESRLPLLSL-D  258

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+FGHLK SDFLGYALKS+ Q + P + + FD T  EFDSF D+ +LYEGGL  
Sbjct  259   IYVPRDERFGHLKMSDFLGYALKSLTQSLQPILNTLFDKTPMEFDSFQDVLNLYEGGLKL  318

Query  1895  GLL--LEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                  L+ I+     E+ KE++RSDGE + K P PQVI   K AWRTDEEF REMLAG+N
Sbjct  319   PECPELDEIRDRIPFEMIKELIRSDGEQVLKLPLPQVIKEDKYAWRTDEEFGREMLAGLN  378

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I RL  FPP S LDPK YGDHTS+IT   I   L+GLTV+QA+ SNR+FILDHHD +
Sbjct  379   PVMIRRLGEFPPTSKLDPKTYGDHTSSITAAQIEKNLEGLTVDQALKSNRLFILDHHDAL  438

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y  R+N+ T  K+YA+RT+LFL+ DGTL+P+AIELSLPHP G++ G V+ V+TPAE G
Sbjct  439   IPYLNRVNS-TSNKVYASRTILFLKDDGTLKPLAIELSLPHPDGEQKGAVNQVFTPAEDG  497

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A +DSG HQLISHWLNTHA IEP +IATNRQLS +HP+YKLL PH+R
Sbjct  498   VEASIWQLAKAYVAVDDSGFHQLISHWLNTHAAIEPFVIATNRQLSAMHPVYKLLSPHYR  557

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA GV+E +  PGKYAMEMSAV+YK+W   +H+LP+DL+ RG+AV 
Sbjct  558   DTMNINALARQILINAGGVLESTVFPGKYAMEMSAVVYKDWKLTDHALPDDLLKRGVAVR  617

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D SSP+ VRLLI+DYPYAVDGL IW AI+TWVT+YC+ YY +D  V  D ELQAWW EV 
Sbjct  618   DPSSPYKVRLLIKDYPYAVDGLVIWWAIETWVTDYCSIYYPSDAAVRADVELQAWWKEVR  677

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKKDE WWP++ +   L  TC+TIIW++SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  678   EVGHGDKKDETWWPKMQTFRELTKTCSTIIWVASALHAAVNFGQYPYAGYLPNRPTISRR  737

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+  YE+L+ NPD   L+TIT+  QT+LG+SLIEILSRH+SDE+YLGQR+ PEWT
Sbjct  738   FMPEPGTPAYEKLENNPDGVFLETITSQFQTILGVSLIEILSRHSSDEVYLGQRDTPEWT  797

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEGLS  297
              D++AL+AF+RFG+ LV IE RIL+MN D +LKNR GPV +PYTLL+P     +G  GL+
Sbjct  798   TDRKALDAFKRFGEHLVEIENRILRMNQDKRLKNRNGPVKMPYTLLYPSTSDFSGVGGLT  857

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  858   GRGIPNSVSI  867



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =  1072 bits (2773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/847 (63%), Positives = 658/847 (78%), Gaps = 16/847 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKRSKPAF  2601
             +++G V+LMKKN LD  D+ +S++D++ +F+G++VS QLISA      N+  GK  KPA+
Sbjct  19    RMRGTVILMKKNVLDFNDLSSSLLDRLHEFMGKRVSLQLISAFQTDSGNEMKGKLGKPAY  78

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRE---SLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
             LEDW   +T L AGESA+ VTF+W +   S+G P A +++N+H +EFYLK++TLE     
Sbjct  79    LEDWITTITPLTAGESAFGVTFDWDDDDDSIGTPQAFLIRNHHHSEFYLKSMTLESVPGH  138

Query  2432  GV-QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             GV  F C SWVYPA KY  DR+FFSN+AYLPS+TP PL  +RE EL++LRGDG G  +EW
Sbjct  139   GVVHFNCNSWVYPAHKYKKDRIFFSNKAYLPSETPEPLLKYREEELESLRGDGRGTLQEW  198

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDL DPD G    RP+LGG+ EYPYPRRGRTGR  TK+D K ESRL L   
Sbjct  199   DRVYDYAYYNDLSDPDKGAQYARPVLGGSTEYPYPRRGRTGRPPTKSDVKIESRLNLAMS  258

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
              +IYVPRDE+FGHLK SDFL  ALKSI QV+ P + S  D+T +EFDSF+DM  LYEGG+
Sbjct  259   LDIYVPRDERFGHLKLSDFLANALKSIVQVIKPELESLLDSTPDEFDSFEDMFKLYEGGI  318

Query  1901  S--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
                 G++ ++++     E+ KE+LR+DGE   KFP PQVI   K+AWRTDEEFAREMLAG
Sbjct  319   KVPEGII-KNVRDKIPAELLKEILRTDGERFLKFPVPQVIKEDKSAWRTDEEFAREMLAG  377

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I  LQ FPP S LD KVYG+ TSTI +E+I   ++GLTV++AI   ++FILDHHD
Sbjct  378   VNPVIIRCLQEFPPASKLDAKVYGNQTSTIRKENIERNMNGLTVDEAIRHKKLFILDHHD  437

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              ++ Y RRIN+ T  K YA+RT+LFLQ DGTL+P+AIELSLPH  GD++G +S VYTPA+
Sbjct  438   TLIPYLRRINS-TSTKTYASRTILFLQNDGTLKPMAIELSLPHSEGDQYGVISKVYTPAD  496

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             +GVE SIWQLAKAY A NDSG HQL+SHWL+THAVIEP IIA NR+LS LHPI+ LLHPH
Sbjct  497   EGVENSIWQLAKAYVAVNDSGYHQLVSHWLHTHAVIEPFIIAANRRLSVLHPIHILLHPH  556

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INAL RQ L NA G++E +  P KY+MEMS+V+YKNW+FP+ +LP+DLI RGMA
Sbjct  557   FRDTMNINALARQFLINAGGLVEATVFPSKYSMEMSSVIYKNWIFPDQALPSDLIKRGMA  616

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D  S HG+RL+IEDYPYAVDGLEIW AIK WV EYC+FYYK D  V  D ELQ+WW E
Sbjct  617   VKDSGSQHGLRLVIEDYPYAVDGLEIWFAIKNWVEEYCSFYYKEDDTVKKDPELQSWWKE  676

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKK+EPWWP++ +R  LI+ CT IIW++SALHA+ NFGQY YAG+ P RPTVS
Sbjct  677   LREEGHGDKKNEPWWPKMQTREDLIEVCTIIIWVASALHASTNFGQYPYAGFLPNRPTVS  736

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+ MPE G+ +Y+EL  NP+KA LKTITA  QTL+G+SLIEILS+H+SDE+YLGQR+ P 
Sbjct  737   RRLMPEEGTPEYDELVNNPEKAFLKTITAQLQTLIGLSLIEILSKHSSDEVYLGQRDTPN  796

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D E LEAFERFGKKL  IEERI+ MN DGK KNR GPVN+PYTLL+P+ + GL+G G
Sbjct  797   WTSDVEPLEAFERFGKKLAQIEERIVTMNNDGKHKNRVGPVNMPYTLLYPSSKAGLTGMG  856

Query  287   IPNSISI  267
             IPNS++I
Sbjct  857   IPNSVAI  863



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =  1072 bits (2772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/876 (62%), Positives = 667/876 (76%), Gaps = 45/876 (5%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G+VVLMKKN LD  D+ AS VD+I + +G+ VS QLISA + +         GK  K
Sbjct  27    RIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPRGKLGK  86

Query  2609  PAFLEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
              A+LE W   +TSL AGE+++ ++ +W ES G PGA++++N+H ++FYLKT+TLED    
Sbjct  87    VAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLEDVPEH  146

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y Y+R+FF N+AYLPSQTP  L P+RE EL NLRG G+GE KEW
Sbjct  147   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSGELKEW  206

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkT-------------  2121
             DRVYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGRK TKT             
Sbjct  207   DRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTEHERHEEFLRFYD  266

Query  2120  --------DPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRF  1965
                     DP  ESRLPLL + +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  
Sbjct  267   QFSFMLRTDPNSESRLPLLSL-DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLC  325

Query  1964  DATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQV  1791
             D T NEFD+FDD+ +LYEGG  L  G  L+ I++    E+ KE++RSDGE   KFP P V
Sbjct  326   DKTINEFDTFDDVVNLYEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDV  385

Query  1790  IGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKL  1611
             I   ++AWRTD+EF REMLAGVNPV I+RL+ FPP S LDPKVYG+  S+I  E+I   +
Sbjct  386   IKKDRSAWRTDKEFGREMLAGVNPVNITRLKEFPPVSKLDPKVYGNQNSSIREEYIKGNM  445

Query  1610  DGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIEL  1431
             +GLTVE+A   NR+FILDHHD +MLY R+IN+ TD K YATRTLL LQ+DGTL+P+AIEL
Sbjct  446   NGLTVEEATEKNRLFILDHHDALMLYLRQINS-TDTKTYATRTLLLLQEDGTLKPLAIEL  504

Query  1430  SLPHPLGDKFGCVSNVYTPAEQG---VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVI  1260
             SLPHP GD+ G VS V+TP  QG   +E S+WQLAKAYAA NDSG HQLISHWLNTHAVI
Sbjct  505   SLPHPQGDRHGAVSKVFTPPGQGNERIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVI  564

Query  1259  EPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMS  1080
             EP +I TNRQLS LHPI+KLLHPHFRDTM+INAL RQ+L NA GV+E +  PG+++MEMS
Sbjct  565   EPFVITTNRQLSVLHPIHKLLHPHFRDTMNINALARQILINAGGVLEKTVFPGRFSMEMS  624

Query  1079  AVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTE  900
             AV+YK+WVF   +LP DL+ RGMAV D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV E
Sbjct  625   AVIYKSWVFTEQALPADLLKRGMAVPDTTCPHGLRLLIEDYPFAVDGLEIWSAIETWVNE  684

Query  899   YCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISS  720
             YC+ YY++D +V  D+ELQ WWTE+   GH DKK+EPWWP++ +R  LI++CT IIW++S
Sbjct  685   YCSLYYQSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVAS  744

Query  719   ALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLG  540
             ALHAAVNFGQY+YAGY P RPTVSR+FMPEPG+A+Y EL ++PD A LKTITA  QTLLG
Sbjct  745   ALHAAVNFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLG  804

Query  539   ISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKN  360
             +SLIEILSRH++DE+YLGQ + PEWT D EAL AF RFG+KL+ IE+RI   N D +LKN
Sbjct  805   VSLIEILSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKN  864

Query  359   RTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             R GPV+VPYTLL P     + E GL+GKGIPNS+SI
Sbjct  865   RVGPVDVPYTLLHPNTSDKSREGGLTGKGIPNSVSI  900



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score =  1071 bits (2770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/851 (64%), Positives = 655/851 (77%), Gaps = 19/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             +KIKGRVVLMKKN LD+  +GASI+D++ + +G+ VS QLISA   DP     GK  K A
Sbjct  38    RKIKGRVVLMKKNVLDMNHLGASILDRVHEVLGKGVSIQLISANRGDPANGKRGKLGKTA  97

Query  2603  FLEDW-GKLTSL-VAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG  2430
             +LE+W   +TS+  A +++++V+FEW E++G+PGA I+KN+H  E YLKT+TLED    G
Sbjct  98    YLENWIATITSVATADDASFNVSFEWDEAMGIPGAFIIKNHHHYEVYLKTVTLEDVPRHG  157

Query  2429  -VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              V FVC SWVYPA +Y YDR+FF+N+ YLP QTP PLR +RE EL NLRG+G+GE K+WD
Sbjct  158   QVHFVCNSWVYPAHRYKYDRIFFTNKTYLPGQTPEPLRDYREQELVNLRGNGSGELKKWD  217

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYN+LG P+ GK   RP+LGG+ +YPYPRRGRTGRK TK+DP  ESRLPLL + 
Sbjct  218   RVYDYAYYNNLGMPNKGKEYERPVLGGSKDYPYPRRGRTGRKPTKSDPNTESRLPLLSL-  276

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IYVPRDE+F  +K SDFL YALKS+GQV++P +AS FD T NEFD+F D+ +LYEGGL 
Sbjct  277   DIYVPRDERFSPVKMSDFLAYALKSLGQVLLPELASLFDKTINEFDTFQDVLNLYEGGLK  336

Query  1898  --RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                G+ +  I+     E+ KE+LRSDGE L KFP P VI A K+AWRTDEEF REMLAGV
Sbjct  337   LPNGVPISKIKDCIPWEMLKELLRSDGERLLKFPMPDVIKADKSAWRTDEEFGREMLAGV  396

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             +PV I RLQ FPP S LD K YG+ TS++TRE I   ++GLTV +AI +NR+FILDHHD 
Sbjct  397   SPVIIRRLQEFPPASKLDHKKYGNQTSSMTREQIEKNMNGLTVYEAIENNRMFILDHHDA  456

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN  T  K YA+RTLL LQ DGTL+P+AIELSLPHP GD  G  S V+TPAE 
Sbjct  457   LMPYLRRINT-TSTKTYASRTLLLLQDDGTLKPLAIELSLPHPQGDTHGAKSQVFTPAEV  515

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             G+EGS+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +I T+RQLS LHPI+KLLHPHF
Sbjct  516   GIEGSVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIVTHRQLSVLHPIHKLLHPHF  575

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+IN L RQ+L NA GV+E +  P KYAME+S+V+YK W F   +LP DL+ RG+AV
Sbjct  576   RDTMYINGLARQILINAGGVLEKTVFPAKYAMELSSVVYKEWNFTEQALPADLLKRGVAV  635

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D S PHG++LLIEDYPYAVDGLEIW AIKTWV EYC+FYY  D +V  D+ELQ+WW E+
Sbjct  636   PDSSQPHGLKLLIEDYPYAVDGLEIWLAIKTWVREYCSFYYYTDELVRDDSELQSWWREL  695

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
               +GH D KDE WWP + +R  LI TCT IIW++SALHAAVNFGQY YAGY P RPTVSR
Sbjct  696   RNEGHGDLKDEQWWPDMETRADLIQTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSR  755

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPEPG+ +Y EL++ PD A LKTITA  QTLLG+SLIE LSRHASDEIYLGQR+  EW
Sbjct  756   RFMPEPGTHEYAELESKPDLAYLKTITAQIQTLLGVSLIESLSRHASDEIYLGQRDTAEW  815

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----GL  300
             T D + L+AF+RFG KL+ IE RI   N +   KNR GPV VPYTLL+P+  +     GL
Sbjct  816   TSDAQPLDAFKRFGMKLIEIENRITDRNNNKMWKNRFGPVKVPYTLLYPSTSDAKKATGL  875

Query  299   SGKGIPNSISI  267
             SG GIPNS+SI
Sbjct  876   SGMGIPNSVSI  886



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =  1070 bits (2766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/876 (62%), Positives = 667/876 (76%), Gaps = 45/876 (5%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G+VVLMKKN LD  D+ AS VD+I + +G+ VS QLISA + +         GK  K
Sbjct  27    RIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISANHPEAAANGLKSRGKLGK  86

Query  2609  PAFLEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
              A+LE W   +TSL AGE+++ ++ +W ES G PGA++++N+H ++FYLKT+TLED    
Sbjct  87    VAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLEDVPEH  146

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y Y+R+FF N+AYLPSQTP  L P+RE EL NLRG G+GE KEW
Sbjct  147   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSGELKEW  206

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkT-------------  2121
             DRVYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGRK +KT             
Sbjct  207   DRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTSKTEHERHEEFLRFYD  266

Query  2120  --------DPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRF  1965
                     DP  ESRLPLL + +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  
Sbjct  267   QFSFMLRTDPNSESRLPLLSL-DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLC  325

Query  1964  DATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQV  1791
             D T NEFD+FDD+ +LYEGG  L  G  L+ +++    E+ KE++RSDGE   KFP P V
Sbjct  326   DKTINEFDTFDDVVNLYEGGIKLPNGPTLKKLRERIPWELLKELIRSDGERFLKFPMPDV  385

Query  1790  IGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKL  1611
             I   ++AWRTD+EF REMLAGVNPV I+RL+ FPP S LDPK+YG+  S+I  E+I   +
Sbjct  386   IKKDRSAWRTDKEFGREMLAGVNPVNITRLKEFPPVSKLDPKLYGNQNSSIREEYIKGNM  445

Query  1610  DGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIEL  1431
             +GLTVE+A   NR+FILDHHD +MLY R+IN+ TD K YATRTLL LQ+DGTL+P+AIEL
Sbjct  446   NGLTVEEATEKNRLFILDHHDALMLYLRQINS-TDTKTYATRTLLLLQEDGTLKPLAIEL  504

Query  1430  SLPHPLGDKFGCVSNVYTPAEQG---VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVI  1260
             SLPHP GD+ G VS V+TP  QG   +E S+WQLAKAYAA NDSG HQLISHWLNTHAVI
Sbjct  505   SLPHPQGDRHGAVSKVFTPPGQGNERIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVI  564

Query  1259  EPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMS  1080
             EP +I TNRQLS LHPI+KLLHPHFRDTM+INAL RQ+L NA GV+E +  PG+++MEMS
Sbjct  565   EPFVITTNRQLSVLHPIHKLLHPHFRDTMNINALARQILINAGGVLEKTVFPGRFSMEMS  624

Query  1079  AVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTE  900
             AV+YK+WVF   +LP DL+ RGMAV D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV E
Sbjct  625   AVIYKSWVFTEQALPADLLKRGMAVPDTTCPHGLRLLIEDYPFAVDGLEIWSAIETWVNE  684

Query  899   YCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISS  720
             YC+ YY++D +V  D+ELQ WWTE+   GH DKK+EPWWP++ +R  LI++CT IIW++S
Sbjct  685   YCSLYYQSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVAS  744

Query  719   ALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLG  540
             ALHAAVNFGQY+YAGY P RPTVSR+FMPEPG+A+Y EL ++PD A LKTITA  QTLLG
Sbjct  745   ALHAAVNFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLG  804

Query  539   ISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKN  360
             +SLIEILSRH++DE+YLGQ + PEWT D EAL AF RFG+KL+ IE+RI   N D +LKN
Sbjct  805   VSLIEILSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKN  864

Query  359   RTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             R GPV+VPYTLL P     + E GL+GKGIPNS+SI
Sbjct  865   RVGPVDVPYTLLHPNTSDKSREGGLTGKGIPNSVSI  900



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =  1070 bits (2766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/876 (62%), Positives = 666/876 (76%), Gaps = 45/876 (5%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP--------GKRSK  2610
             +I+G+VVLMKKN LD  D+ AS VD+I + +G+ VS QLISA + +         GK  K
Sbjct  27    RIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPRGKLGK  86

Query  2609  PAFLEDWGK-LTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAA  2433
              A+LE W   +TSL AGE+++ ++ +W ES G PGA++++N+H ++FYLKT+TLED    
Sbjct  87    VAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLEDVPEH  146

Query  2432  G-VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
             G + FVC SWVYPA +Y Y+R+FF N+AYLPSQTP  L P+RE EL NLRG G+GE KEW
Sbjct  147   GQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSGELKEW  206

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkT-------------  2121
             DRVYDY YYNDLG PD G    RPILGG+ EYPYPRRGRTGRK TKT             
Sbjct  207   DRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTEHERHEEFLRFYD  266

Query  2120  --------DPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRF  1965
                     DP  ESRLPLL + +IYVPRDE+FGH+K SDFL Y LKS+ Q+++P + S  
Sbjct  267   QFSFMLRTDPNSESRLPLLSL-DIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLC  325

Query  1964  DATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQV  1791
             D T NEFD+FDD+ +LYEGG  L  G  L+ I++    E+ KE++RSDGE   KFP P V
Sbjct  326   DKTINEFDTFDDVVNLYEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDV  385

Query  1790  IGASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKL  1611
             I   ++AWRTD+EF REMLAGVNPV I+RL+ FPP S LDPKVYG+  S+I  E+I   +
Sbjct  386   IKKDRSAWRTDKEFGREMLAGVNPVNITRLKEFPPVSKLDPKVYGNQNSSIREEYIKGNM  445

Query  1610  DGLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIEL  1431
             +GLTVE+A   NR+FILDHHD +MLY R+IN+ TD K YATRTLL LQ+DGTL+P+AIEL
Sbjct  446   NGLTVEEATEKNRLFILDHHDALMLYLRQINS-TDTKTYATRTLLLLQEDGTLKPLAIEL  504

Query  1430  SLPHPLGDKFGCVSNVYTPAEQG---VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVI  1260
             SLPHP GD+ G VS V+TP  QG   +E S+WQLAKAYAA NDSG HQLISHWLNTHAVI
Sbjct  505   SLPHPQGDRHGAVSKVFTPPGQGNERIEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVI  564

Query  1259  EPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMS  1080
             EP +I TNRQLS LHPI+KLLHPHFRDTM+INAL RQ+L NA GV+E +  PG+++MEMS
Sbjct  565   EPFVITTNRQLSVLHPIHKLLHPHFRDTMNINALARQILINAGGVLEKTVFPGRFSMEMS  624

Query  1079  AVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTE  900
             AV+YK+WVF   +LP DL+ RGMAV D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV E
Sbjct  625   AVIYKSWVFTEQALPADLLKRGMAVPDTTCPHGLRLLIEDYPFAVDGLEIWSAIETWVNE  684

Query  899   YCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISS  720
             YC+ YY++D +V  D+ELQ WWTE+   GH DKK+EPWWP++ +R  LI++CT IIW++S
Sbjct  685   YCSLYYQSDDVVQGDSELQNWWTELRNIGHGDKKNEPWWPKMQTRAELIESCTIIIWVAS  744

Query  719   ALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLG  540
             ALH AVNFGQY+YAGY P RPTVSR+FMPEPG+A+Y EL ++PD A LKTITA  QTLLG
Sbjct  745   ALHEAVNFGQYSYAGYLPNRPTVSRRFMPEPGTAEYYELVSSPDTAFLKTITAQFQTLLG  804

Query  539   ISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKN  360
             +SLIEILSRH++DE+YLGQ + PEWT D EAL AF RFG+KL+ IE+RI   N D +LKN
Sbjct  805   VSLIEILSRHSTDEVYLGQNDTPEWTSDAEALAAFARFGEKLMDIEKRIDARNKDNRLKN  864

Query  359   RTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             R GPV+VPYTLL P     + E GL+GKGIPNS+SI
Sbjct  865   RVGPVDVPYTLLHPNTSDKSREGGLTGKGIPNSVSI  900



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score =  1069 bits (2764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/837 (64%), Positives = 641/837 (77%), Gaps = 17/837 (2%)
 Frame = -1

Query  2741  MKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFLEDW-GKL  2580
             MKKNFLDL DV AS+VD++ + +G KVS QLISA N DP     GK  KPAFLE+W  K 
Sbjct  1     MKKNFLDLDDVKASVVDRVDEILGHKVSLQLISAVNADPANKCRGKPGKPAFLENWEAKF  60

Query  2579  TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWV  2403
             T L A ++ + VTFEW E  GVPGA ++KN H  EFYLKTLTL+D  G   V F+C SW+
Sbjct  61    TPLTATDATFGVTFEWEEEAGVPGAFLIKNFHQKEFYLKTLTLDDVPGRGRVCFICNSWI  120

Query  2402  YPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYND  2223
             YP++ Y  DR+FFSNQ YLPSQTP PLR +RE EL+NLRG+G G+ +EWDR+YDYD YND
Sbjct  121   YPSEYYKRDRIFFSNQTYLPSQTPEPLRSYREEELENLRGNGIGKLEEWDRIYDYDVYND  180

Query  2222  LGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKF  2049
             LGDPD G    R ILGG+ +YPYPRRGRTGR  T TDPK ESRLPL    EIYVPRDEKF
Sbjct  181   LGDPDKGPKYERKILGGSADYPYPRRGRTGRLPTATDPKSESRLPLHKSLEIYVPRDEKF  240

Query  2048  GHLKQSDFLGYALKSIGQVVIPFIASRFDATQ-NEFDSFDDMNSLYEGGLSRGL--LLEH  1878
               LK SDF  YALK + Q    F+ +  +A+   EFD+F+D   +Y+ G       L+  
Sbjct  241   NQLKMSDFAAYALKLLSQ----FLLAELEASNFTEFDTFEDELKIYDDGFKFPFESLVHK  296

Query  1877  IQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQ  1698
             ++    +E+ KE+LRSDGE+L KFP PQVI   K+AWRTDEEFAREMLAG+NP+ I  L+
Sbjct  297   LRDLVPMELVKELLRSDGEHLCKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPIIICSLK  356

Query  1697  VFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRIN  1518
              FPP S LDPKV+GD  S IT EHI   LDGL VEQAI  NR+FIL+HHD +M Y RRIN
Sbjct  357   EFPPTSNLDPKVFGDQKSAITVEHIKKNLDGLAVEQAIKDNRLFILNHHDTLMPYLRRIN  416

Query  1517  ANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQL  1338
               T  K YATRTLLFL++DGTL+P+AI+LSLPHP GD  G VS VYTPA  G E  +WQL
Sbjct  417   TTT-TKTYATRTLLFLKEDGTLKPVAIDLSLPHPDGDHLGAVSKVYTPAIDGQEAIVWQL  475

Query  1337  AKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINAL  1158
             AKAY A NDSG HQLISHWLNTHAV+EP +IATNRQLS LHPIYKLLHPHFRDTM INA 
Sbjct  476   AKAYVAVNDSGFHQLISHWLNTHAVVEPFVIATNRQLSVLHPIYKLLHPHFRDTMFINAF  535

Query  1157  GRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGV  978
              RQ L NA G++E++  P K+AMEMSAV+YKNW+F + +LP DLI RGMAV D ++PHG+
Sbjct  536   ARQTLINACGIVEMTVFPSKFAMEMSAVIYKNWMFLDQALPTDLIKRGMAVEDSNAPHGL  595

Query  977   RLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKK  798
             RLLI+DYP+AVDGLEIW AIK WV EYC+FYYK+D M+  DTELQAWW E+ +KGH DKK
Sbjct  596   RLLIQDYPFAVDGLEIWAAIKIWVEEYCHFYYKSDDMIQGDTELQAWWKELREKGHGDKK  655

Query  797   DEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSA  618
             DEPWWP++ +   LI++CT +IWI+SALHAAVNFGQY YAGY P RPT+SR+FMPEPG+ 
Sbjct  656   DEPWWPKMQTVQELINSCTIVIWIASALHAAVNFGQYPYAGYLPNRPTLSRRFMPEPGTQ  715

Query  617   DYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEA  438
             +YEEL TNP+ A LKTIT   QTLLGISLIE+LSRH +DE+YLGQR+ PEWT D+E L+A
Sbjct  716   EYEELNTNPENAFLKTITPQMQTLLGISLIEMLSRHTADEVYLGQRDTPEWTNDQEPLQA  775

Query  437   FERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  267
             FERFGK+L  IE+RI +MN D K KNR+GPV VPYT  + + E GL+GKGIPNS+SI
Sbjct  776   FERFGKRLREIEKRITQMNCDEKWKNRSGPVKVPYTSFYASSEMGLTGKGIPNSVSI  832



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/846 (62%), Positives = 644/846 (76%), Gaps = 28/846 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-------KRSKP  2607
             ++KG VVLMKKN LD  D  AS +D++ +FVG++VS QL+S+ N DPG       K  KP
Sbjct  22    RVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKLGKP  81

Query  2606  AFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG  2430
             A+LEDW   +  L AGE+A+ VTFEW E +G PGA I++NNH +EFYLK+LTLED    G
Sbjct  82    AYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVPGQG  141

Query  2429  V-QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
             V +F+C SWVYPADKY  DR+FFSN+ YLPS+TP PL  +RE EL+NLRG+G G+ +EWD
Sbjct  142   VIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQEWD  201

Query  2252  RVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY  YNDLG+PD G    RP LGG+ +YPYPRRGRT R   K+DPK ESRL +    
Sbjct  202   RVYDYALYNDLGNPDKGPQHARPTLGGSKDYPYPRRGRTSRPPAKSDPKCESRLNIASSL  261

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IYVPRDE+FGHLK +DFL YALKSI QV+ P   S FD+T NEFD F+D+  LYEGG+ 
Sbjct  262   DIYVPRDERFGHLKMADFLAYALKSIVQVLKPEFESLFDSTPNEFDKFEDVLKLYEGGIE  321

Query  1898  --RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                G+L E ++ N   E+ KE+ RSDG+ L KFP PQVI   K+AW+TDEEF RE+LAG+
Sbjct  322   VPEGILTE-VRDNIPAEMLKEIFRSDGQRLLKFPVPQVIAVDKSAWQTDEEFGRELLAGI  380

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I  LQ FPP S LDPK+YG+ TSTIT+EHI   L+G TV++AI   R+FILD HD 
Sbjct  381   NPVVIRGLQEFPPASKLDPKIYGNQTSTITKEHIESNLEGFTVDEAIKERRLFILDLHDA  440

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y +RIN+ T  K+YA+RT+LFLQ  GTL+P+AIELSLPHP GD++G +S VYTP EQ
Sbjct  441   LIPYVKRINS-TSTKMYASRTILFLQDSGTLKPLAIELSLPHPEGDQYGAISKVYTPVEQ  499

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             G+E S WQLAKAY    DSG HQLISHWL+THAVIEPII+ATNR LS LHPI+KLLHPHF
Sbjct  500   GIENSFWQLAKAYVVVADSGYHQLISHWLHTHAVIEPIILATNRHLSVLHPIHKLLHPHF  559

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INALGRQ+L NA G +EL+  P KY+ME S+VLYK+WVFP  +LP DL+ RG+AV
Sbjct  560   RDTMNINALGRQILINAGGALELTVCPSKYSMEFSSVLYKDWVFPEQALPEDLVKRGVAV  619

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D +SP+G+RLLIEDYP+AVDGLEIW AIKTWV +YC+FYYK D  +  DTELQ+WW E+
Sbjct  620   KDSTSPYGLRLLIEDYPFAVDGLEIWFAIKTWVKDYCSFYYKEDDTIKKDTELQSWWKEI  679

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              + GH DKKDEPWWP++ +   LI TCT IIWI+SALHAA+NFGQY Y G+ P  P    
Sbjct  680   REVGHGDKKDEPWWPKMQTCEELIQTCTIIIWIASALHAAINFGQYPYGGFPPSTP----  735

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
                      +Y+EL  NPDKA LKT+T+    +LGISL+EILS+H+SDE+YLGQR+ P+W
Sbjct  736   ---------EYDELMANPDKAYLKTVTSQFLAVLGISLVEILSKHSSDEVYLGQRDTPDW  786

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D E L+AFE+FGKKL  IEERIL+MN D K +NR GPV +PYTLL+P+ + GL+G G+
Sbjct  787   TSDAEPLQAFEKFGKKLADIEERILRMNSDEKFRNRYGPVKMPYTLLYPSSKGGLTGMGV  846

Query  284   PNSISI  267
             PNSISI
Sbjct  847   PNSISI  852



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Fragaria 
vesca subsp. vesca]
Length=919

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/847 (63%), Positives = 641/847 (76%), Gaps = 19/847 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             IKG VVLMKKN L+L D+GAS +D++ + +G+ VS +L+SA N DP     GK  K A+L
Sbjct  77    IKGTVVLMKKNLLELNDLGASFIDRVHELLGKAVSLRLVSAVNTDPANGNRGKIGKAAYL  136

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQ  2424
             E+W  K+T L A E A+ V F W E +GVPGA I++N HA+EFYLK+LTLE+  G   V 
Sbjct  137   ENWISKVTPLTAAECAFKVNFVWDEKIGVPGAFIIRNEHASEFYLKSLTLENVPGKGRVH  196

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT---GERKEWD  2253
             F C SWVYPADKY  DRVFF+N+ YL S+TP  L+ FRE EL  LRGD     GE +EWD
Sbjct  197   FDCNSWVYPADKYKKDRVFFTNKTYLSSETPVGLKKFREEELVTLRGDDVVKKGELQEWD  256

Query  2252  RVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLG PD G+   RPILGG+ E+PYPRRGRTGR     DPK E  LPL+   
Sbjct  257   RVYDYAYYNDLGSPDKGEKYARPILGGSAEFPYPRRGRTGRAANLKDPKSERPLPLVKGL  316

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
              +YVPRDEKFGHLK SD + YALKSI Q++ P   +     Q EFDS +D+  LYEGG  
Sbjct  317   FVYVPRDEKFGHLKMSDLIAYALKSISQILKPDELATLLGHQKEFDSLEDVLKLYEGGVE  376

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L  GLL + ++  T  E  KE+ R+DGE L KFP PQVI   K+AWRTDEEFAREMLAG+
Sbjct  377   LPEGLL-KFVRSTTPAETVKELFRTDGERLLKFPVPQVIKEDKSAWRTDEEFAREMLAGL  435

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I RLQ FPP S LDP VYGD TS IT+EHIADKLDGL++++AI  N++FILDHHD 
Sbjct  436   NPVSIHRLQEFPPASKLDPNVYGDQTSKITKEHIADKLDGLSIDEAINKNKLFILDHHDS  495

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y  RINA T  K YA+RTLLFL+ DGTL+P+AIELS+P+P G   GC S VYTPA Q
Sbjct  496   LMPYLERINA-TSVKGYASRTLLFLKNDGTLKPVAIELSVPNPGG--VGCTSEVYTPASQ  552

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVE  IWQLAKAY A NDSG HQL+SHWL THAVIEP+IIATNRQLS LHPIYKLLHPHF
Sbjct  553   GVESHIWQLAKAYVAINDSGYHQLVSHWLRTHAVIEPVIIATNRQLSVLHPIYKLLHPHF  612

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMA  1008
             RDTM++NA+ RQ+L NA GV+E +  P KY+ME S+V+YKN WVFP  +LP DLI RGMA
Sbjct  613   RDTMNVNAVARQILINAGGVLENTVFPAKYSMEWSSVMYKNSWVFPEQALPKDLIKRGMA  672

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D S+ HGVRLL+EDYPYA DGLEIW+AI+TWV EYC+FY+K D MV  D+ELQ+WW E
Sbjct  673   VEDSSASHGVRLLVEDYPYAADGLEIWSAIRTWVEEYCSFYFKTDEMVQKDSELQSWWKE  732

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + ++GH DKKDEPWWP++ +   LI++CT IIW +SA HAA+NFGQY Y GY   RP++S
Sbjct  733   LREEGHGDKKDEPWWPKMQTVEELIESCTIIIWTASAYHAAINFGQYPYGGYPANRPSIS  792

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMP+ G+ +YE+LK NP+KA L+TIT   QTLLG++ IEILSRH++DEIYLGQRE  E
Sbjct  793   RRFMPKIGTPEYEQLKKNPEKAFLETITPQLQTLLGMASIEILSRHSADEIYLGQRESQE  852

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D + LEA E F  KL A+ ER+ KMN D KLKNRTGP  +PYTLL+P+ E GL+GKG
Sbjct  853   WTADTKVLEASENFRSKLKAVGERVTKMNKDDKLKNRTGPAKMPYTLLYPSSEPGLTGKG  912

Query  287   IPNSISI  267
             IPNS+SI
Sbjct  913   IPNSVSI  919



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =  1068 bits (2762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/858 (64%), Positives = 652/858 (76%), Gaps = 23/858 (3%)
 Frame = -1

Query  2777  DEPK----KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----P  2625
             DEPK    KI+GRVVLMKKN +D  DVGAS++D++ +  G+ VSFQLISAE  D      
Sbjct  15    DEPKIQEKKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKR  74

Query  2624  GKRSKPAFLEDW-GKLTSLVA-GESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTL  2451
             GK  K A+LE W  K TSL A  E+ +DV+F+W ESLGVPGA IV+N+H ++FYLKT+TL
Sbjct  75    GKLGKEAYLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTL  134

Query  2450  ED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT  2274
             ED  G   V FVC SWVYPA  Y YDRVFF+N+AYLPS TP PLR +RE EL NL+G+G+
Sbjct  135   EDVPGHGPVHFVCNSWVYPAHCYKYDRVFFTNKAYLPSDTPEPLRVYREQELINLQGNGS  194

Query  2273  GERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESR  2100
             G  KEWDRVYDY YYNDLG P+ GK   RP+LGG+ +YPYPRRGRTGR+  K D   ESR
Sbjct  195   GMLKEWDRVYDYAYYNDLGSPEKGKDYARPVLGGSKDYPYPRRGRTGRRPNKKDLNTESR  254

Query  2099  LPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNS  1920
             L LL +   YVPRDEKF  +K SDF+GY+LKS+ QV+IP I + FD T NEFD+F+D+ +
Sbjct  255   LFLLSL-NTYVPRDEKFNQVKFSDFIGYSLKSLVQVLIPEIKAVFDKTINEFDTFEDVLN  313

Query  1919  LYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFA  1746
             LYEGG  L  G  L  I++    E+ KE++RSDGE   KFP P VI   +TAWRTDEEF 
Sbjct  314   LYEGGIKLPDGHTLHKIRECVPWELIKELIRSDGERFLKFPMPDVIKEDRTAWRTDEEFG  373

Query  1745  REMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVF  1566
             REMLAGVNPV I RLQ FPP S LDP+ YGD  STITREHI   ++GLTV++AI +N++F
Sbjct  374   REMLAGVNPVVIRRLQEFPPTSKLDPQAYGDQNSTITREHIEKNMNGLTVDEAIENNKLF  433

Query  1565  ILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSN  1386
             ILDHHD +M Y RRIN  T  K YA+RT+L LQ DGTL+P+AIELSLPH  GD+ G VS 
Sbjct  434   ILDHHDALMPYLRRINTTTT-KTYASRTVLLLQDDGTLKPLAIELSLPHEDGDEQGAVSE  492

Query  1385  VYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIY  1206
             V+TP ++GV  SIWQLAKAYAA NDSG HQLISHWLNTHAVIEP +IA+NRQLS LHPIY
Sbjct  493   VFTPCDEGVGSSIWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIASNRQLSVLHPIY  552

Query  1205  KLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDL  1026
             KLL PHFRDT+HINAL RQ+L NA GV+E +  P +YAMEMS+ +YKNW F   +LP DL
Sbjct  553   KLLKPHFRDTVHINALARQILINAGGVLERTVFPARYAMEMSSAIYKNWNFTEQALPQDL  612

Query  1025  INRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTEL  846
             I RG+AV D + P G+RLLIEDYP+AVDGLEIW+AI+ WV EY +FYY  D  +  D+EL
Sbjct  613   IKRGIAVPDPTQPQGLRLLIEDYPFAVDGLEIWSAIELWVKEYYSFYYPTDEKIQGDSEL  672

Query  845   QAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNP  666
             Q+WWTE+ + GH D +DEPWWP + +R  LI  CT IIWI+SALHAAVNFGQY YAGY P
Sbjct  673   QSWWTELREVGHGDLRDEPWWPNMQTRAELIHACTIIIWIASALHAAVNFGQYPYAGYLP  732

Query  665   CRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLG  486
              RPTVSR+FMP+PG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH++DEIYLG
Sbjct  733   NRPTVSRRFMPKPGTPEYAELESNPDSAFLKTITAQFQTLLGVSLIEILSRHSTDEIYLG  792

Query  485   QREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP----  318
             Q+E P+WT D    EAFERF   LV IE RI   N DG+L+NR+GPV +PY LL+P    
Sbjct  793   QQESPDWTADAHPREAFERFSAALVEIESRITDRNKDGRLRNRSGPVKMPYMLLYPNTSD  852

Query  317   -TGEEGLSGKGIPNSISI  267
              + E GL+GKGIPNSISI
Sbjct  853   NSKEGGLTGKGIPNSISI  870



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score =  1068 bits (2762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/872 (62%), Positives = 650/872 (75%), Gaps = 16/872 (2%)
 Frame = -1

Query  2840  LSKLVTMILgkiagaiaaKHADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKV  2661
             L KL+  + GK           E  KIKG VVLMKKN LD+ DVGASI+D++ +   + V
Sbjct  13    LGKLLETVCGKNRDTPIEIENGERPKIKGTVVLMKKNILDVKDVGASILDRLHELFHRGV  72

Query  2660  SFQLISAENDDP----GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIV  2496
             S QL+SA+  DP    GK  K A LE W  KLTS+ A +  +DV FEW ES+G PGA+IV
Sbjct  73    SIQLVSADQIDPENGRGKLGKAAILEKWNAKLTSVSATDVKFDVNFEWDESMGAPGALIV  132

Query  2495  KNNHANEFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLR  2319
             +N+H ++FYLKT+TL+D  G   + FVC SWVYP  +Y Y+RVFF+N+ YLPS TP  LR
Sbjct  133   RNHHHSQFYLKTVTLDDVPGHGQLHFVCNSWVYPQHRYKYNRVFFANKTYLPSNTPEALR  192

Query  2318  PFREAELKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgr  2145
             P+RE EL NLRG+GTG  KEWDRVYDY YYNDLG+PD G    R +LGG+ +YPYPRRGR
Sbjct  193   PYREEELDNLRGNGTGMLKEWDRVYDYAYYNDLGNPDGGPEHERSVLGGSKQYPYPRRGR  252

Query  2144  tgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRF  1965
             TGR  TK DP  ESRL LL ++ IYVPRDEKF H+K +DF+ YA+KS+GQV++P +AS F
Sbjct  253   TGRAPTKKDPTTESRLRLLDLS-IYVPRDEKFSHVKFADFIAYAVKSVGQVLLPEVASVF  311

Query  1964  DATQNEFDSFDDMNSLYEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVI  1788
             D T NEFDSF D+  LYEGG+      ++ ++   + E+ KE++RSDGE + KFP P VI
Sbjct  312   DKTFNEFDSFQDVLDLYEGGIKLPSHAMDKLKHCISWELLKELVRSDGEGMMKFPVPSVI  371

Query  1787  GASKTAWRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLD  1608
                KTAWRTDEEF REMLAGVNPV I  L+ FPP S LDP VYG+ TSTI REHI   ++
Sbjct  372   KEDKTAWRTDEEFGREMLAGVNPVIIRSLREFPPTSKLDPIVYGNQTSTIRREHIEKNMN  431

Query  1607  GLTVEQAIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELS  1428
             G TV+ A+  +++FILDHHD +M Y RRIN  T  K YA+RT+L LQ DGTL+P+AIELS
Sbjct  432   GQTVDDALRHSKLFILDHHDALMPYLRRINTTTT-KTYASRTILLLQDDGTLKPLAIELS  490

Query  1427  LPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPII  1248
             LPHP GDK G  S V+TPAE   EGS+WQLAKAY A NDSG HQLISHWL THAVIEP I
Sbjct  491   LPHPQGDKHGAQSEVFTPAEHDAEGSVWQLAKAYVAVNDSGYHQLISHWLYTHAVIEPFI  550

Query  1247  IATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLY  1068
             IATNR LS LHP+YKLL PHFRDTM+INAL R  L NA GV+EL+  P K+A+EMS+ +Y
Sbjct  551   IATNRHLSALHPMYKLLQPHFRDTMNINALARHTLINAGGVLELTVFPSKFALEMSSAVY  610

Query  1067  KNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNF  888
             KNWVFP  +LP DL+ RG+AV D + P G++LLIEDYP+AVDGLEIW+AI+ WV EYC+F
Sbjct  611   KNWVFPEQALPADLLKRGIAVPDSTKPLGLKLLIEDYPFAVDGLEIWSAIEEWVREYCSF  670

Query  887   YYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHA  708
             YY ND MV  D+ELQ+WWTE+   GH D KDEPWWP++ +R  L+  CT IIWI+SALHA
Sbjct  671   YYHNDGMVQGDSELQSWWTELRNVGHGDLKDEPWWPQMQTRDELVQACTIIIWIASALHA  730

Query  707   AVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLI  528
             AVNFGQY YAGY P RPTVSR+FMPEPG+ +Y EL +NPD A LKTITA  QTLLG+SLI
Sbjct  731   AVNFGQYPYAGYLPNRPTVSRRFMPEPGTPEYAELASNPDLAFLKTITAQFQTLLGVSLI  790

Query  527   EILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGP  348
             EILSRH+SDEIYLGQR++PEWT D    +AF RFG KLV IE  IL  N D K KNRTGP
Sbjct  791   EILSRHSSDEIYLGQRDNPEWTSDTIPRDAFTRFGAKLVEIENHILARNNDKKYKNRTGP  850

Query  347   VNVPYTLLFPTGEE-----GLSGKGIPNSISI  267
             V +PYTLL P   +     GL+GKGIPNSISI
Sbjct  851   VKMPYTLLIPNSSDYSKVGGLTGKGIPNSISI  882



>ref|XP_004230207.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=863

 Score =  1068 bits (2762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/848 (63%), Positives = 654/848 (77%), Gaps = 16/848 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKR  2616
             A E K IKG VVLMKKNFLDLTD   ++VD+I + +G KVS QLISA N D      GK 
Sbjct  22    AGETKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDAANKGRGKL  81

Query  2615  SKPAFLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
              KPA LE W K+++L   E+ + V FEW E +G+PGA ++KN+H NEFYLKTLTL+D  G
Sbjct  82    GKPANLEGW-KISTLTEREATFSVNFEWNEEIGIPGAFLIKNSHHNEFYLKTLTLDDVPG  140

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V+FVC SW+Y ++ Y  DRVFF+NQ YLP++TPAPL+ +RE EL+NLRG+GTG+R+E
Sbjct  141   HGKVKFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREE  200

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDYD YNDLGDP+ G+   R ILGG+ +YPYPRRGRTGR  TK DPK ESRLPL  
Sbjct  201   WDRVYDYDVYNDLGDPEKGETYVRKILGGSSDYPYPRRGRTGRPPTKIDPKSESRLPLRK  260

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+F  LK SDF    LKSI Q ++P   + F+ T  EFDSF+DM  LYEGG
Sbjct  261   TLDIYVPRDERFSPLKMSDFAATGLKSIFQFLVPGFLALFNKTPFEFDSFEDMWKLYEGG  320

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L     ++ I+ +  LE+ KE+LRSDG+  FKFP PQVI   K+AW TDEEFAREMLA
Sbjct  321   IRLPSKSFVDKIRDHLPLELLKELLRSDGDYAFKFPMPQVIREDKSAWGTDEEFAREMLA  380

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP S LDP + G+  STI+ EH+   LDGLT+E+AI   R+FILDHH
Sbjct  381   GLNPVVIRCLQEFPPTSKLDPTLSGEQRSTISEEHVKHNLDGLTIEKAIKDKRLFILDHH  440

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y +RIN  T  + YA+RTLLFL++DG+L P+AIEL+  +   ++   VSNVYTPA
Sbjct  441   DSLMPYLKRINTTTT-QTYASRTLLFLKEDGSLTPLAIELTREN---EQSRIVSNVYTPA  496

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E G E +IWQLAKAY   NDSG HQL+SHWL+THAV EP IIATNRQLS LHPIYKLLHP
Sbjct  497   ETGAEATIWQLAKAYVTVNDSGFHQLVSHWLHTHAVTEPFIIATNRQLSVLHPIYKLLHP  556

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NADG++E++  PGK+++EMSA +YK+WVFP  +LP DLI RGM
Sbjct  557   HFRDTMYINALARQMLINADGILEMTVFPGKFSLEMSATIYKDWVFPQQALPADLIKRGM  616

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D S PHG++L+IEDYPYAVDGLEIW+AIKTWV +YCNFYYK D MV  DTELQ WW 
Sbjct  617   AVEDSSQPHGIKLVIEDYPYAVDGLEIWSAIKTWVRDYCNFYYKTDEMVKIDTELQCWWK  676

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E  +KGH DKK++PWWP++ +R  LID CT IIWI+SALHAA+NFGQY Y GY P RP++
Sbjct  677   EAREKGHGDKKEQPWWPKMQTREELIDCCTIIIWIASALHAAINFGQYPYGGYPPNRPSM  736

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEP +++YEELK+NP+KA LKTIT LPQ++LGISLIE LS H SDE++LG+R  P
Sbjct  737   SRRFMPEPETSEYEELKSNPEKAFLKTITPLPQSILGISLIEALSLHTSDEVFLGKRA-P  795

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D+E L+AFERFGKKL  IE++I+KMN D  LKNR GP N+PYTLL P+ E GL+G+
Sbjct  796   EWTTDEEPLQAFERFGKKLEEIEQKIIKMNDDPNLKNRVGPANIPYTLLCPSSELGLTGR  855

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  856   GIPNSVSI  863



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/858 (64%), Positives = 652/858 (76%), Gaps = 23/858 (3%)
 Frame = -1

Query  2777  DEPK----KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----P  2625
             DEPK    KI+GRVVLMKKN +D  DVGAS++D++ +  G+ VSFQLISAE  D      
Sbjct  26    DEPKIQEKKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKR  85

Query  2624  GKRSKPAFLEDW-GKLTSLVA-GESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTL  2451
             GK  K A+LE W  K TSL A  E+ +DV+F+W ESLGVPGA IV+N+H ++FYLKT+TL
Sbjct  86    GKLGKEAYLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTL  145

Query  2450  ED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT  2274
             ED  G   V FVC SWVYPA  Y YDRVFF+N+AYLPS TP PLR +RE EL NL+G+G+
Sbjct  146   EDVPGHGPVHFVCNSWVYPAHCYKYDRVFFTNKAYLPSDTPEPLRVYREQELINLQGNGS  205

Query  2273  GERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESR  2100
             G  KEWDRVYDY YYNDLG P+ GK   RP+LGG+ +YPYPRRGRTGR+  K D   ESR
Sbjct  206   GMLKEWDRVYDYAYYNDLGSPEKGKDYARPVLGGSKDYPYPRRGRTGRRPNKKDLNTESR  265

Query  2099  LPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNS  1920
             L LL +   YVPRDEKF  +K SDF+GY+LKS+ QV+IP I + FD T NEFD+F+D+ +
Sbjct  266   LFLLSL-NTYVPRDEKFNQVKFSDFIGYSLKSLVQVLIPEIKAVFDKTINEFDTFEDVLN  324

Query  1919  LYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFA  1746
             LYEGG  L  G  L  I++    E+ KE++RSDGE   KFP P VI   +TAWRTDEEF 
Sbjct  325   LYEGGIKLPDGHTLHKIRECVPWELIKELIRSDGERFLKFPMPDVIKEDRTAWRTDEEFG  384

Query  1745  REMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVF  1566
             REMLAGVNPV I RLQ FPP S LDP+ YGD  STITREHI   ++GLTV++AI +N++F
Sbjct  385   REMLAGVNPVVIRRLQEFPPTSKLDPQAYGDQNSTITREHIEKNMNGLTVDEAIENNKLF  444

Query  1565  ILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSN  1386
             ILDHHD +M Y RRIN  T  K YA+RT+L LQ DGTL+P+AIELSLPH  GD+ G VS 
Sbjct  445   ILDHHDALMPYLRRINTTTT-KTYASRTVLLLQDDGTLKPLAIELSLPHEDGDEQGAVSE  503

Query  1385  VYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIY  1206
             V+TP ++GV  SIWQLAKAYAA NDSG HQLISHWLNTHAVIEP +IA+NRQLS LHPIY
Sbjct  504   VFTPCDEGVGSSIWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIASNRQLSVLHPIY  563

Query  1205  KLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDL  1026
             KLL PHFRDT+HINAL RQ+L NA GV+E +  P +YAMEMS+ +YKNW F   +LP DL
Sbjct  564   KLLKPHFRDTVHINALARQILINAGGVLERTVFPARYAMEMSSAIYKNWNFTEQALPQDL  623

Query  1025  INRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTEL  846
             I RG+AV D + P G+RLLIEDYP+AVDGLEIW+AI+ WV EY +FYY  D  +  D+EL
Sbjct  624   IKRGIAVPDPTQPQGLRLLIEDYPFAVDGLEIWSAIELWVKEYYSFYYPTDEKIQGDSEL  683

Query  845   QAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNP  666
             Q+WWTE+ + GH D +DEPWWP + +R  LI  CT IIWI+SALHAAVNFGQY YAGY P
Sbjct  684   QSWWTELREVGHGDLRDEPWWPNMQTRAELIHACTIIIWIASALHAAVNFGQYPYAGYLP  743

Query  665   CRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLG  486
              RPTVSR+FMP+PG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSRH++DEIYLG
Sbjct  744   NRPTVSRRFMPKPGTPEYAELESNPDSAFLKTITAQFQTLLGVSLIEILSRHSTDEIYLG  803

Query  485   QREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP----  318
             Q+E P+WT D    EAFERF   LV IE RI   N DG+L+NR+GPV +PY LL+P    
Sbjct  804   QQESPDWTADAHPREAFERFSAALVEIESRITDRNKDGRLRNRSGPVKMPYMLLYPNTSD  863

Query  317   -TGEEGLSGKGIPNSISI  267
              + E GL+GKGIPNSISI
Sbjct  864   NSKEGGLTGKGIPNSISI  881



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =  1067 bits (2760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/846 (62%), Positives = 641/846 (76%), Gaps = 16/846 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPAFL  2598
             ++G V+LMKKN LD  D+ AS  D I + VG++VS QL+SA+  DPG     K  KPA+L
Sbjct  24    MRGEVILMKKNVLDFKDLSASFFDGIHELVGKRVSLQLVSADKGDPGNGMKGKVGKPAYL  83

Query  2597  EDWGK-LTSLVAGESAYDVTFEWRES--LGVPGAVIVKNNHANEFYLKTLTLEDGGAAGV  2427
             EDW   +T L+AGES Y VTF+  +   +G PGA ++KNNH +EFYLK+L L++    GV
Sbjct  84    EDWNSTITPLIAGESTYKVTFDLDDDDDIGTPGAFLIKNNHHSEFYLKSLKLQNVPGQGV  143

Query  2426  -QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERKEWD  2253
               F C SWVYP+ KY  DR+FFSN+ Y  S+TPAPL  +RE EL+ LRG G   + KEWD
Sbjct  144   IHFTCNSWVYPSQKYQKDRIFFSNKTYFLSETPAPLLKYREEELETLRGSGDSIQLKEWD  203

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDL DPD G    RP+LGG+ EYPYPRRGRT R   K+D   ESRL L    
Sbjct  204   RVYDYAYYNDLADPDKGPKYVRPVLGGSSEYPYPRRGRTNRPPAKSDANSESRLNLAMSL  263

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IYVPRDE+FGH+K SDFL YA+K+I QV+ P + S FD+T NEFDS +D+  LYEGG+ 
Sbjct  264   DIYVPRDERFGHVKMSDFLAYAIKAIVQVIKPELESLFDSTPNEFDSLEDVLKLYEGGIE  323

Query  1898  --RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                G + + I+     E+ KE+LR+DG+ L K+P P VI   K+AWRTDEEFAREMLAGV
Sbjct  324   VPEGAV-KRIRDKIPAEMLKEILRTDGQKLLKYPVPHVIKEDKSAWRTDEEFAREMLAGV  382

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I  LQ FPP S LDP VYGD +STI +  I   LDGLTV++AI   ++FILDHHD 
Sbjct  383   NPVIIRGLQEFPPTSKLDPNVYGDQSSTIRKSDIESNLDGLTVDEAIAQKKLFILDHHDA  442

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M Y RRIN+ T  K YA+RT+LFLQ++GTL+P+AIELSLPHP GD+ G +SNVY PAE 
Sbjct  443   LMTYLRRINS-TSTKTYASRTILFLQQNGTLKPLAIELSLPHPNGDQHGAISNVYMPAEN  501

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVE SIWQLAKAY A NDSG HQLISHWL+THA IEP II+ NRQLS LHPI+KLLHPHF
Sbjct  502   GVENSIWQLAKAYVAVNDSGYHQLISHWLHTHASIEPFIISANRQLSVLHPIHKLLHPHF  561

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             RDTM+INAL RQ+L NA G++E +  P KYAME+S+ LYK+W FP  +LP DL+ RGMA+
Sbjct  562   RDTMNINALARQILINAGGLLEATVYPSKYAMELSSALYKDWTFPEQALPVDLVKRGMAI  621

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D +SPHG+RL++ DYPYAVDGLEIW AI TWV +YC+FYYKND  V  D ELQ+WW E+
Sbjct  622   KDSASPHGLRLIVNDYPYAVDGLEIWFAINTWVQDYCSFYYKNDDTVKKDAELQSWWKEL  681

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
             +Q+GH DKK+EPWWP++ +   L +TCT IIWI+SALHAAVNFGQY +AGY+P RPT+SR
Sbjct  682   IQEGHGDKKNEPWWPKMQTVEELTETCTIIIWIASALHAAVNFGQYPFAGYSPNRPTISR  741

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             +FMPE G+ +Y+EL TNPDKA LKTITA  QTL+GISLIEILS H+SDE+YLGQR+   W
Sbjct  742   RFMPEKGTIEYDELVTNPDKAFLKTITAQLQTLVGISLIEILSTHSSDEVYLGQRDSMHW  801

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D E LEAF+RFGKKL  IEERI+ MN D  LKNR GPV +PYTLL+P  E GL+G GI
Sbjct  802   TCDAEPLEAFDRFGKKLKEIEERIVAMNDDVNLKNRVGPVKMPYTLLYPRSEAGLTGAGI  861

Query  284   PNSISI  267
             PNS+SI
Sbjct  862   PNSVSI  867



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/844 (63%), Positives = 646/844 (77%), Gaps = 14/844 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPAFL  2598
             I+G+VVLMKKN LD  D+ AS +D + +FVG++VS QL+SA   DPG     K  K  +L
Sbjct  22    IRGKVVLMKKNVLDFNDLSASFLDDLHEFVGKRVSLQLVSAVKVDPGNDMKGKVGKAEYL  81

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAGV-Q  2424
             EDW    T L+AGES + VTF+W E +G PGA I+KNNH +EFYLK+ TLE+  + GV  
Sbjct  82    EDWITTSTPLIAGESTFSVTFDWDEDIGTPGAFIIKNNHHSEFYLKSFTLENVPSQGVIH  141

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER-KEWDRV  2247
             F+C SWVYPA KY  DR+FFSN+ Y+ S+TP PL  +R+ EL++LRG    ++ +EWDRV
Sbjct  142   FICNSWVYPAHKYEKDRIFFSNRTYILSETPKPLLEYRKEELESLRGIRNNQQLQEWDRV  201

Query  2246  YDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY  YNDLGDPD G    RPILGG+ +YPYPRRGRT R  TK+D   ESRL L    +I
Sbjct  202   YDYANYNDLGDPDKGPQYARPILGGSSQYPYPRRGRTSRPPTKSDANSESRLNLAMSLDI  261

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS--  1899
             YVPRDE+FGHLK +DFL Y+LK++ QV+ P + S FD T NEFD+ +D+  LYEGG+   
Sbjct  262   YVPRDERFGHLKLTDFLAYSLKAVVQVIKPELESLFDNTPNEFDTLEDVLKLYEGGIKVP  321

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
             +GL+ + I+ N   ++ K++ R DGEN  K+P PQVI   K+AWRTDEEFAREMLAGVNP
Sbjct  322   QGLV-KGIRDNIPAKMLKQIFRIDGENFLKYPVPQVIKEDKSAWRTDEEFAREMLAGVNP  380

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP S LDP VYGD +S I +EHI   LDGLTVE+AI   ++FILDHHD ++
Sbjct  381   VIICCLQEFPPTSKLDPTVYGDQSSKIRKEHIESNLDGLTVEEAITQKKLFILDHHDALI  440

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN+ T  K YA+RT+LFLQ +GTL+P+AIELSLPHP GDK+G +S VY  AE GV
Sbjct  441   PYLRRINS-TSTKTYASRTILFLQNNGTLKPLAIELSLPHPEGDKYGAISKVYMSAEDGV  499

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A NDSG HQLISHWL+THA IEP II+ NRQLS LHPI+KLLHPHFRD
Sbjct  500   ENSIWQLAKAYVAVNDSGYHQLISHWLHTHATIEPFIISVNRQLSVLHPIHKLLHPHFRD  559

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INAL RQ+L NA G++E +  P KY+MEMS++LYK+WVFP  +LP DL+ RGMA+ D
Sbjct  560   TMNINALARQILINAGGILEATVFPSKYSMEMSSILYKDWVFPEQALPVDLVKRGMAIED  619

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              + P G+RLLI DYPYAVDGLEIW AIKTWV +YC+FYYKND  V  D ELQ+WW E+ +
Sbjct  620   STLPRGLRLLINDYPYAVDGLEIWFAIKTWVQDYCSFYYKNDDTVKKDEELQSWWKELRE  679

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKKDEPWWP++ +   LI++CT IIWI+SALHAAVNFGQY YAGY P RPT+SR+F
Sbjct  680   EGHGDKKDEPWWPKMQTLEELIESCTIIIWIASALHAAVNFGQYPYAGYLPNRPTISRRF  739

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+A+Y+EL +NPDK  LKTITA  QTL+GISLIEILS H+SDE+YLGQR+   WT 
Sbjct  740   MPEIGTAEYDELVSNPDKVFLKTITAQLQTLIGISLIEILSTHSSDEVYLGQRDTVHWTY  799

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D E LEAFERFGKKL  IE +I+ MN D +LKNR G V +PYTLL+PTGE GL+G GIPN
Sbjct  800   DAEPLEAFERFGKKLREIEGKIVAMNDDVRLKNRVGVVKMPYTLLYPTGESGLAGTGIPN  859

Query  278   SISI  267
             S+SI
Sbjct  860   SVSI  863



>ref|XP_010024349.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW60798.1| hypothetical protein EUGRSUZ_H03535 [Eucalyptus grandis]
Length=899

 Score =  1065 bits (2755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/851 (64%), Positives = 648/851 (76%), Gaps = 19/851 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKI+G V LMKKN LD+ D+ AS++D+I +  G+ VS QL+SA + DP     GK  K A
Sbjct  51    KKIRGTVKLMKKNVLDMNDMKASLLDRIHELFGKGVSLQLVSAVHSDPSNGSRGKLGKVA  110

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LE W  K+TSL AGE+ + VTF+W +S+G+PGA I++N+H ++FYLKT+TLED  G   
Sbjct  111   YLEKWIRKITSLTAGEAEFGVTFDWDKSMGIPGAFIIRNHHHSQFYLKTVTLEDVPGHGP  170

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V+FVC SWVYP+ +Y YDRVFFSN+ YLP QTP  L  +RE EL NL+G G+GE KEWDR
Sbjct  171   VKFVCNSWVYPSHRYMYDRVFFSNKTYLPCQTPLALLKYREEELVNLQGSGSGELKEWDR  230

Query  2249  VYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG PD G    R +LGG+ ++PYPRRGRTGRK TK DP  ESRLPLL +  
Sbjct  231   VYDYAYYNDLGSPDKGPDHARQVLGGSKDFPYPRRGRTGRKPTKKDPNCESRLPLLSL-N  289

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+F H+K SDFL YALKS+GQVV+P I S  + T NEFDSF+D+  LYEGG  L
Sbjct  290   IYVPRDERFSHIKFSDFLAYALKSLGQVVLPEIKSLGNKTFNEFDSFEDVLRLYEGGIKL  349

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
               G     ++     E+ KE++R+DGE   KFP P VI   K+AWRTDEEF REMLAGVN
Sbjct  350   PSGPKFSKLKDRIPWELLKELVRNDGERPLKFPMPDVIKEDKSAWRTDEEFGREMLAGVN  409

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRLQ FPPRS LDP  YG+  STI +EHI   ++G+TV++AI SNR+FILDHHD +
Sbjct  410   PVIISRLQEFPPRSKLDPAKYGNQHSTIRKEHIEMNMNGITVDEAIRSNRMFILDHHDAL  469

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y  RIN+ T  K+YATRTLL LQ DGTL+P+ IELSLPH  GD  G VS V+TPAE G
Sbjct  470   MPYLTRINS-TATKMYATRTLLLLQDDGTLKPLVIELSLPHSQGDHHGAVSKVFTPAENG  528

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             V GS+WQLAKAY A  DSG HQLISHWLNTHAVIEP IIATNR LS +HPIYKLLHPHFR
Sbjct  529   VGGSVWQLAKAYVAVTDSGYHQLISHWLNTHAVIEPFIIATNRHLSVIHPIYKLLHPHFR  588

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L N  GV+E +  PGKYAMEMSAVLYKNWVF   +LP DLI RGMA+ 
Sbjct  589   DTMNINALARQILINDGGVLERTVFPGKYAMEMSAVLYKNWVFTEQALPADLIKRGMAIP  648

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D   PHG+ L+I DYPYAVDGLEIW+AI+TWV +YC+ YY +D +V  D+ELQ+WW EV 
Sbjct  649   DSRCPHGLSLVIRDYPYAVDGLEIWSAIETWVKDYCSHYYTHDDLVRGDSELQSWWKEVR  708

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
              +GH D KDEPWWP + +R  LI +CT IIW++SALHAAVNFGQY YAGY P RPTVSR+
Sbjct  709   TEGHGDMKDEPWWPAMQTRADLIQSCTIIIWVASALHAAVNFGQYPYAGYLPNRPTVSRR  768

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR-EHPEW  465
             FMPE G+A+YEEL+ NPD A LKTITA  QTLLG+SLIEILSRH++DEIYLGQR + P+W
Sbjct  769   FMPELGTAEYEELEKNPDVAYLKTITAQLQTLLGVSLIEILSRHSTDEIYLGQRDDSPDW  828

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----GL  300
             T D+E  +AF+RF  +L  IEERI  MN D + KNR GPV VPYTLL+P   +     GL
Sbjct  829   TSDEEPKQAFQRFIDQLTKIEERITDMNQDKRWKNRVGPVKVPYTLLYPNALDYSNVGGL  888

Query  299   SGKGIPNSISI  267
             +GKGIPNSISI
Sbjct  889   TGKGIPNSISI  899



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =  1065 bits (2753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/847 (61%), Positives = 650/847 (77%), Gaps = 14/847 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKI G VVLM+ N LD  D G++++D + + +G  VS QL+SA++ DP     GK  + A
Sbjct  18    KKIHGTVVLMRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKEFQGKVGEAA  77

Query  2603  FLEDW--GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             +LE+W    +  + AGE+A+ +TF+W E +G+PGA  + N H +EF+LK+LTL+D  G  
Sbjct  78    YLENWIGNTILPIFAGETAFSITFDWDEEIGIPGAFFITNQHFSEFFLKSLTLDDVPGHG  137

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              + F C SWVYPADKY   R+FF+NQAYLP++ P PL  +R  EL  LRG+G GERKEWD
Sbjct  138   RIHFDCNSWVYPADKYQTPRIFFANQAYLPNEMPKPLVKYRADELLTLRGNGKGERKEWD  197

Query  2252  RVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             R+YDYD YND+GDPD+     RP+LGG+ +YPYPRRGRTGR  +K DPK ESRL     A
Sbjct  198   RIYDYDVYNDIGDPDSNLDLSRPVLGGSSKYPYPRRGRTGRPPSKKDPKSESRLASSSKA  257

Query  2078  -EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
              ++YVPRDE+FGHLK SDFL Y LKSI + + P +   FD+T  EFD F+D+  LYE GL
Sbjct  258   TDVYVPRDERFGHLKMSDFLAYGLKSISRSIKPKLEDLFDSTPGEFDDFNDVFDLYEKGL  317

Query  1901  S-RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                  LL+ I +N    + KE+ R+DGE   +FPTPQ+I   KTAW TDEEFAREMLAGV
Sbjct  318   PVPRTLLQGITENIPAPLLKEIFRTDGERFLRFPTPQLIHEDKTAWSTDEEFAREMLAGV  377

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I+RLQ FPP+STLDP +YGD TS IT EHI D LDGLTV++A+   +++IL+HHD 
Sbjct  378   NPVVIARLQEFPPKSTLDPNIYGDQTSKITEEHIQDGLDGLTVDEALEKKKLYILNHHDS  437

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YATRT+LFL+ DGTL+P+AIELSLPHP GD+FG +S V  P+  
Sbjct  438   LIPYLRRINT-TPTKTYATRTVLFLKNDGTLKPLAIELSLPHPQGDEFGVISKVILPSNT  496

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             G++ SIWQLAKAY   ND+G HQLISHWLNTHA IEP +IATNRQLS +HPI+KLL PHF
Sbjct  497   GIDASIWQLAKAYVTVNDTGYHQLISHWLNTHATIEPFVIATNRQLSVVHPIHKLLLPHF  556

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYK-NWVFPNHSLPNDLINRGMA  1008
             RDTM+INAL RQ L NADG+IE +  P KY+MEMS+ +YK NWVFP  +LP DLI RG+A
Sbjct  557   RDTMNINALARQSLINADGIIETTHYPSKYSMEMSSFVYKTNWVFPQQALPADLIKRGVA  616

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             + D +SPHG++LLIEDYPYAVDGLEIW+AIKTWV +YC+FYYK+D  +  DTELQ+WW E
Sbjct  617   IEDSNSPHGLQLLIEDYPYAVDGLEIWSAIKTWVQDYCSFYYKDDQTLHNDTELQSWWKE  676

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + +KGH DKKDEPWWPR+ S   L++TCT IIWISSALHAAVNFGQY Y G+ P RP+ S
Sbjct  677   LREKGHADKKDEPWWPRMDSLQDLVETCTIIIWISSALHAAVNFGQYPYGGFAPNRPSTS  736

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+F+PE G++DY+EL++NP+KA L+TIT+  Q L+G+S+IEILSRH+SDE+YLGQR +PE
Sbjct  737   RRFLPESGTSDYKELESNPEKAFLRTITSQLQVLVGVSVIEILSRHSSDEVYLGQRSNPE  796

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT DKEALEAFE+FG+KL  IE +I   N D +LKNR GPV++PYTLLFPT  EGL+G+G
Sbjct  797   WTLDKEALEAFEKFGEKLGEIERKIAMRNKDPQLKNRVGPVDMPYTLLFPTSSEGLTGRG  856

Query  287   IPNSISI  267
             IPNSISI
Sbjct  857   IPNSISI  863



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =  1064 bits (2751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/846 (61%), Positives = 641/846 (76%), Gaps = 13/846 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             K+IKGRVVLMKK  LD  D  ASI+D+  + +G+KVSFQL SA N DP     GK  KP+
Sbjct  17    KEIKGRVVLMKKYVLDFNDFTASILDRFDELLGKKVSFQLASAVNADPENESKGKLGKPS  76

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED--GGAA  2433
             +L DW    T L  GESA+ +TF W E +GVPGA++++N H N+FYLK++TLED      
Sbjct  77    YLGDWLTNFTGLTPGESAFSITFAWDEDIGVPGAIVIRNEHQNQFYLKSVTLEDTPDNIG  136

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              + FVC SW+YP  +Y  DR+FFSN+ YLP QTPAPLR +RE EL+ LRG+G G+ +EWD
Sbjct  137   KIHFVCNSWIYPTQRYTKDRIFFSNKTYLPHQTPAPLRKYREEELEILRGNGEGKLEEWD  196

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDLGDPD G    RP+LGG+ E+PYPRRGRT R  +KTDP  ESRLPL+   
Sbjct  197   RVYDYAYYNDLGDPDKGPKYVRPVLGGSAEFPYPRRGRTSRPPSKTDPNTESRLPLVKGL  256

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--  1905
             ++YVPRDEKFGHLK SDFLGYALKS+ Q  +  + S FD   NEFDSF D   LYEGG  
Sbjct  257   DVYVPRDEKFGHLKMSDFLGYALKSLSQDFVAGLESIFDKNPNEFDSFQDELDLYEGGVK  316

Query  1904  LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
             L    ++  I+++   E  K  L+SDG  + KFP P VI   K+AWRTDEEFAREMLAGV
Sbjct  317   LPESDIINKIKESIPFEFLKAFLQSDGAPILKFPMPDVIKEDKSAWRTDEEFAREMLAGV  376

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NP+ I RL+ FPP S LDPK YG+  S+IT++H+   L  LTVE+AI  N++FILDHHD 
Sbjct  377   NPLVIRRLEEFPPVSKLDPKTYGNQNSSITKQHLEQNLGRLTVEEAIKKNKLFILDHHDT  436

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             +M + R IN+ T  KIYATRT+LFL+ DGTL P+AIELSLPHP GD  G VS V+TPA +
Sbjct  437   LMPHVRHINS-TASKIYATRTILFLKDDGTLTPLAIELSLPHPDGDGLGAVSKVFTPAHE  495

Query  1364  GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHF  1185
             GVE SIWQLAKAY A NDSG HQLISHW+ THAVIEP +IA+NRQLS LHPIYKLLHPHF
Sbjct  496   GVESSIWQLAKAYVAVNDSGHHQLISHWMLTHAVIEPFVIASNRQLSVLHPIYKLLHPHF  555

Query  1184  RDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAV  1005
             R TM INA+ RQ+L NA+G++E +  P +Y+ME+S+  YKNW+F   ++P DL+ RGMAV
Sbjct  556   RYTMDINAIARQVLLNAEGLLEKTVFPRQYSMELSSATYKNWIFTEQAVPRDLVKRGMAV  615

Query  1004  VDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEV  825
              D  SP+G +LLIEDYPYAVD L+IW+AI+TWV +YC+FYYK+D M+  D ELQ+WW E+
Sbjct  616   KDSKSPYGYKLLIEDYPYAVDALDIWSAIETWVKDYCSFYYKSDDMITNDIELQSWWKEI  675

Query  824   VQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSR  645
              +KGH DKKDE WWP + +   LI+TCTTIIW++SALHAAVNFGQY YAGY+P RPT+SR
Sbjct  676   REKGHGDKKDEKWWPELKTFDELIETCTTIIWVASALHAAVNFGQYPYAGYHPNRPTISR  735

Query  644   KFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEW  465
             + MPEP + +YEEL+ NPD   L+TI++  Q++LGISLIE+LSRH +DE+YLGQRE  EW
Sbjct  736   RLMPEPNTPEYEELEKNPDTIFLRTISSKLQSVLGISLIELLSRHPTDEVYLGQRETREW  795

Query  464   TKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGI  285
             T D   LEAFERFGKK+  IE++I++ N DG+ KNR GPV +PYTLL+P+ E GL+G+GI
Sbjct  796   TADSAPLEAFERFGKKVEEIEDKIVERNKDGRWKNRVGPVKLPYTLLYPSSEAGLTGRGI  855

Query  284   PNSISI  267
             PNS S+
Sbjct  856   PNSTSV  861



>ref|XP_006344625.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
Length=863

 Score =  1064 bits (2751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/848 (63%), Positives = 651/848 (77%), Gaps = 16/848 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKR  2616
             A E K IKG VVLMKKNFLDLTD   ++VD+I + +G KVS QLISA N D      GK 
Sbjct  22    AGETKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDVANKGRGKL  81

Query  2615  SKPAFLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
              KPA LE W K+++L   ++ + V FEW E +GVPGA ++KN+H NEFYLKTLTL+D  G
Sbjct  82    GKPAHLEGW-KISTLTERDATFSVNFEWNEEIGVPGAFLIKNSHHNEFYLKTLTLDDVPG  140

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SW+Y ++ Y  DRVFF+NQ YLP++TPAPL+ +RE EL+NLRG+GTG+R+E
Sbjct  141   HGKVCFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREE  200

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDYD YNDLGDP+ G+   R ILGG+ +YPYPRRGRTGR  TK DPK ESRLPL  
Sbjct  201   WDRVYDYDVYNDLGDPEKGETHVRKILGGSSDYPYPRRGRTGRPPTKIDPKSESRLPLRK  260

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+F  LK SDF    LKSI Q ++P   + F+ T  EFDSF DM+ LYEGG
Sbjct  261   TLGIYVPRDERFSPLKMSDFAATGLKSIFQFLVPGFLALFNKTPFEFDSFKDMSKLYEGG  320

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L     ++ I+ +  LE+ KE+LRSDG+  FKFP PQVI   K+AW TDEEFAREMLA
Sbjct  321   IKLPSKSFMDKIRDHLPLELLKELLRSDGDYAFKFPMPQVIREDKSAWGTDEEFAREMLA  380

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I  LQ FPP S LDP ++G+  STI+ EH+   LDGLT+EQAI   R+FILDHH
Sbjct  381   GLNPVVIRCLQEFPPISKLDPTLFGEQRSTISEEHVKHNLDGLTIEQAIKEKRLFILDHH  440

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y +RIN  T  + YA+RTLLFL++DG+L+P+AIEL+      ++   VSNVYTPA
Sbjct  441   DSLMPYLKRINTTTT-QTYASRTLLFLKEDGSLKPLAIELTRE---DEQSRIVSNVYTPA  496

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E G E +IWQLAKAY   NDSG HQL+SHWL+THAV EP IIATNRQLS LHPIYKLLHP
Sbjct  497   ETGAEATIWQLAKAYVTVNDSGFHQLVSHWLHTHAVTEPFIIATNRQLSVLHPIYKLLHP  556

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ+L NADG++E++  PGK+++EMSA +YK+WVFP  +LP DLI RGM
Sbjct  557   HFRDTMYINALARQILINADGILEMTVFPGKFSLEMSATIYKDWVFPQQALPADLIKRGM  616

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D S PHG++L+IEDYPYAVDGLEIW+AI TWV +YCNFYYK D M+  DTELQ+WW 
Sbjct  617   AVEDSSQPHGIKLVIEDYPYAVDGLEIWSAINTWVRDYCNFYYKADEMIKIDTELQSWWK  676

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E  +KGH DKK+EPWWP++ +R  LID CT IIWI+SALHAA+NFGQY Y GY P RP++
Sbjct  677   EAREKGHGDKKEEPWWPKMQTREELIDCCTIIIWIASALHAAINFGQYPYGGYPPNRPSM  736

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEP +++YEELK+NP+KA L TIT LPQ++LGISLIE LS H SDE++LG+R  P
Sbjct  737   SRRFMPEPETSEYEELKSNPEKAFLNTITPLPQSILGISLIEALSLHTSDEVFLGKRA-P  795

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D+E L+AFERFGKKL  IE++I+K N D  LKNR GP N+PYTLL P+ E GL+G+
Sbjct  796   EWTTDEEPLQAFERFGKKLEEIEQKIIKTNNDPNLKNRVGPANIPYTLLCPSSELGLTGR  855

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  856   GIPNSVSI  863



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score =  1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/792 (65%), Positives = 632/792 (80%), Gaps = 8/792 (1%)
 Frame = -1

Query  2624  GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE  2448
             G+  KPA+LEDW   ++ L AG+SAY+V F+W E +GVPGA I++N H +EFY+KTLTLE
Sbjct  3     GRVGKPAYLEDWITTISPLTAGDSAYEVYFDWDEKIGVPGAFIIRNEHHSEFYMKTLTLE  62

Query  2447  D-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG  2271
             +  G   + FVC SWVYP DKY  DR+FF+N+ YLPS+TPA LR +RE EL NLRGDG G
Sbjct  63    NVPGHGRLHFVCNSWVYPTDKYRTDRIFFTNKTYLPSETPATLRKYREEELVNLRGDGKG  122

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E KEWDRVYDY YYNDLG+PD G+   RP+LGG+ +YPYPRRGRTGR  TKTDPK E+RL
Sbjct  123   ELKEWDRVYDYAYYNDLGNPDKGEKYVRPVLGGSAKYPYPRRGRTGRPPTKTDPKVETRL  182

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
              LL    IY PRDE+FGHLK SDFL YALKSIGQ + P +   F++T NEFDSF+D+  L
Sbjct  183   QLLLSLNIYAPRDERFGHLKLSDFLAYALKSIGQFLKPELEDVFNSTPNEFDSFEDVLKL  242

Query  1916  YEGGLS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAR  1743
             YEGG+    GLL + I+ +T  EI KE+ R+DGE L KFP PQVI   KTAW TDEEFAR
Sbjct  243   YEGGVEVPEGLL-KSIRDSTPAEIIKEIFRTDGERLLKFPVPQVIKEDKTAWSTDEEFAR  301

Query  1742  EMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFI  1563
             EMLAG+NPV I  LQ FPP S LDPKVYGDHTSTIT+EHI   L+GL+V++AI ++++FI
Sbjct  302   EMLAGINPVMIRCLQQFPPTSKLDPKVYGDHTSTITKEHIEHNLNGLSVDEAIKNSKLFI  361

Query  1562  LDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNV  1383
             LDHHD +M + RRIN+ T  KIYA+RT+L LQ+DGTL+P+AIELSLPHP GD FGC S V
Sbjct  362   LDHHDTLMPFLRRINS-TSTKIYASRTILSLQEDGTLKPLAIELSLPHPRGDVFGCTSKV  420

Query  1382  YTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYK  1203
             YTPA +GVEG++WQLAKAY A NDSG HQLISHWL+THA IEP +IATNRQ+S +HPI+K
Sbjct  421   YTPANKGVEGTLWQLAKAYVAVNDSGYHQLISHWLHTHAAIEPFVIATNRQMSVIHPIHK  480

Query  1202  LLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLI  1023
             LLH HFRDTM++NA+ RQ+L NA G +E +  PGKY+MEM++  YK W FP+ ++P DLI
Sbjct  481   LLHTHFRDTMNLNAVARQILINAGGALEWTVFPGKYSMEMTSASYKEWSFPDQAIPVDLI  540

Query  1022  NRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQ  843
              RGMAV D +SPHG+RLLIEDYPYAVDGLEIW+AIKTWV +YC+ YYK +  V  D ELQ
Sbjct  541   KRGMAVKDENSPHGLRLLIEDYPYAVDGLEIWSAIKTWVKDYCSLYYKTNETVQNDNELQ  600

Query  842   AWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPC  663
             +WW E+ + GH DKKDEPWW ++ +   LI+TCTTIIWI+SALHAA+NFGQY Y GY P 
Sbjct  601   SWWKELREVGHGDKKDEPWWSKLQTLEELIETCTTIIWIASALHAAINFGQYPYGGYPPN  660

Query  662   RPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQ  483
             RP++SR+F+PE G+ +YEELKT+P+KA LKTIT    ++LGI+L+EILSRH+SDE+YLGQ
Sbjct  661   RPSMSRRFIPEEGTPEYEELKTDPEKAFLKTITGQLLSVLGIALVEILSRHSSDEVYLGQ  720

Query  482   REHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEG  303
             R+ PEWT D E LEAFERFGKKL  IEE+I++MN D KLKNR GP  +PYTLL+P+ E G
Sbjct  721   RDTPEWTTDGEVLEAFERFGKKLREIEEKIVRMNKDEKLKNRVGPAKMPYTLLYPSSEGG  780

Query  302   LSGKGIPNSISI  267
             L+GKGIPNS+SI
Sbjct  781   LTGKGIPNSVSI  792



>ref|XP_006344624.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=865

 Score =  1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/850 (63%), Positives = 651/850 (77%), Gaps = 18/850 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-------PG  2622
             A E K IKG VVLMKKNFLDLTD   ++VD+I + +G KVS QLISA N D        G
Sbjct  22    AGETKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDVVLANKGRG  81

Query  2621  KRSKPAFLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
             K  KPA LE W K+++L   ++ + V FEW E +GVPGA ++KN+H NEFYLKTLTL+D 
Sbjct  82    KLGKPAHLEGW-KISTLTERDATFSVNFEWNEEIGVPGAFLIKNSHHNEFYLKTLTLDDV  140

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SW+Y ++ Y  DRVFF+NQ YLP++TPAPL+ +RE EL+NLRG+GTG+R
Sbjct  141   PGHGKVCFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKR  200

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDYD YNDLGDP+ G+   R ILGG+ +YPYPRRGRTGR  TK DPK ESRLPL
Sbjct  201   EEWDRVYDYDVYNDLGDPEKGETHVRKILGGSSDYPYPRRGRTGRPPTKIDPKSESRLPL  260

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
                  IYVPRDE+F  LK SDF    LKSI Q ++P   + F+ T  EFDSF DM+ LYE
Sbjct  261   RKTLGIYVPRDERFSPLKMSDFAATGLKSIFQFLVPGFLALFNKTPFEFDSFKDMSKLYE  320

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L     ++ I+ +  LE+ KE+LRSDG+  FKFP PQVI   K+AW TDEEFAREM
Sbjct  321   GGIKLPSKSFMDKIRDHLPLELLKELLRSDGDYAFKFPMPQVIREDKSAWGTDEEFAREM  380

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I  LQ FPP S LDP ++G+  STI+ EH+   LDGLT+EQAI   R+FILD
Sbjct  381   LAGLNPVVIRCLQEFPPISKLDPTLFGEQRSTISEEHVKHNLDGLTIEQAIKEKRLFILD  440

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y +RIN  T  + YA+RTLLFL++DG+L+P+AIEL+      ++   VSNVYT
Sbjct  441   HHDSLMPYLKRINTTTT-QTYASRTLLFLKEDGSLKPLAIELTRE---DEQSRIVSNVYT  496

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE G E +IWQLAKAY   NDSG HQL+SHWL+THAV EP IIATNRQLS LHPIYKLL
Sbjct  497   PAETGAEATIWQLAKAYVTVNDSGFHQLVSHWLHTHAVTEPFIIATNRQLSVLHPIYKLL  556

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL RQ+L NADG++E++  PGK+++EMSA +YK+WVFP  +LP DLI R
Sbjct  557   HPHFRDTMYINALARQILINADGILEMTVFPGKFSLEMSATIYKDWVFPQQALPADLIKR  616

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D S PHG++L+IEDYPYAVDGLEIW+AI TWV +YCNFYYK D M+  DTELQ+W
Sbjct  617   GMAVEDSSQPHGIKLVIEDYPYAVDGLEIWSAINTWVRDYCNFYYKADEMIKIDTELQSW  676

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E  +KGH DKK+EPWWP++ +R  LID CT IIWI+SALHAA+NFGQY Y GY P RP
Sbjct  677   WKEAREKGHGDKKEEPWWPKMQTREELIDCCTIIIWIASALHAAINFGQYPYGGYPPNRP  736

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++SR+FMPEP +++YEELK+NP+KA L TIT LPQ++LGISLIE LS H SDE++LG+R 
Sbjct  737   SMSRRFMPEPETSEYEELKSNPEKAFLNTITPLPQSILGISLIEALSLHTSDEVFLGKRA  796

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D+E L+AFERFGKKL  IE++I+K N D  LKNR GP N+PYTLL P+ E GL+
Sbjct  797   -PEWTTDEEPLQAFERFGKKLEEIEQKIIKTNNDPNLKNRVGPANIPYTLLCPSSELGLT  855

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  856   GRGIPNSVSI  865



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =  1061 bits (2745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/848 (61%), Positives = 651/848 (77%), Gaps = 15/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKI G VVL++ N LD  D G++++D + + +G  VS QL+SA++ DP     GK  + A
Sbjct  18    KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  2603  FLEDW--GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             +LE+W    +  + AGE+A+ +TF+W E +GVPGA  + N H +EF+LK+LTLED  G  
Sbjct  78    YLENWIGNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGHG  137

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              + F C SWVYPADKY   R+FF+NQAYLP++ P PL  +R  EL NLRG+G GERKEWD
Sbjct  138   RLHFDCNSWVYPADKYKTPRIFFANQAYLPNEMPKPLVKYRADELLNLRGNGKGERKEWD  197

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             R+YDYD YND+GDPD+     RP+LGG+ +YPYPRRGRTGR  +K DPK ESRLP    A
Sbjct  198   RIYDYDVYNDIGDPDSNLDLGRPVLGGSSKYPYPRRGRTGRPPSKKDPKSESRLPSSSKA  257

Query  2078  -EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
              ++YVPRDE+FGHLK SDFL Y LKSI + + P +   FD+T  EFD F+D+  LYE GL
Sbjct  258   TDVYVPRDERFGHLKMSDFLAYGLKSISRSLKPKLEDLFDSTPGEFDDFNDVFDLYEKGL  317

Query  1901  SRGL-LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                  LL+ I +N    + KE+ R+DGE   +FPTPQ++   KTAW +DEEFAREMLAGV
Sbjct  318   PVPRSLLQGITENIPAPLLKEIFRTDGERFLRFPTPQLVHEDKTAWSSDEEFAREMLAGV  377

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I+RL  FPP+STLD  +YGD TS IT EHI D LDGLTV +A+   +++IL+HHD 
Sbjct  378   NPVLIARLDEFPPKSTLDTNIYGDQTSKITEEHIKDGLDGLTVNEAVEKKKLYILNHHDS  437

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YATRT+LFL+ DGTL+P+AIELSLPHP GD+FG +S V  P++ 
Sbjct  438   LIPYLRRINT-TPTKTYATRTVLFLKNDGTLKPLAIELSLPHPQGDQFGVISKVILPSKT  496

Query  1364  -GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              G++ SIWQLAKAY A ND+G HQLISHWLNTHA IEP +IATNRQLS +HPI+KLL PH
Sbjct  497   TGIDASIWQLAKAYVAVNDTGYHQLISHWLNTHATIEPFVIATNRQLSVVHPIHKLLVPH  556

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYK-NWVFPNHSLPNDLINRGM  1011
             FRDTM+INAL RQ L NADG+IE +  P KY+MEM + +YK NWVFP  +LP DLI RG+
Sbjct  557   FRDTMNINALARQSLINADGIIETTHYPSKYSMEMCSFVYKTNWVFPQQALPADLIKRGV  616

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             A+VD +SPHG+RLLIEDYPYAVDGLEIW+AIK WV +YC+FYYK+D  +  DTELQ+WW 
Sbjct  617   AIVDSNSPHGLRLLIEDYPYAVDGLEIWSAIKAWVQDYCSFYYKDDQTLRNDTELQSWWK  676

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ +KGH DKKDEPWWPR+ S H LI+TCT IIWISSALHAAVNFGQY Y G+ P RP+ 
Sbjct  677   ELREKGHADKKDEPWWPRMDSLHDLIETCTIIIWISSALHAAVNFGQYPYGGFAPNRPST  736

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+F+PE G+ DY+EL++NP+KA L+TIT+  Q L+G+S+IEILSRH+SDE+YLGQR +P
Sbjct  737   SRRFLPESGTPDYKELESNPEKAFLRTITSQLQALVGVSVIEILSRHSSDEVYLGQRSNP  796

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT DKEALEAFE+FG+KL  IE++I   N D +LKNR GPV++PYTLLFPT  EGL+G+
Sbjct  797   EWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDPQLKNRVGPVDMPYTLLFPTSSEGLTGR  856

Query  290   GIPNSISI  267
             GIPNSISI
Sbjct  857   GIPNSISI  864



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =  1061 bits (2745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/844 (63%), Positives = 647/844 (77%), Gaps = 14/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             +++G VVLMKK+ LD  D  AS++D + +FVG+ VS QL+S  N D      GK  KPA 
Sbjct  18    QVEGTVVLMKKSVLDFNDFTASMLDGLHEFVGKGVSLQLVSTVNTDSENGLKGKLGKPAN  77

Query  2600  LEDWGKLTS-LVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             L DW   +  L  GES + V+F+W E +G PGA ++ NNH NEFYLK+LTL+   G   +
Sbjct  78    L-DWSTASKPLSTGESTFKVSFDWDEEIGTPGAFLIWNNHDNEFYLKSLTLKGVPGQDVI  136

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA  Y  DR+FFSN+ YLPS+TP  L  +RE EL+ LRGDG G+ ++WDRV
Sbjct  137   HFVCNSWVYPAKNYVKDRIFFSNKTYLPSETPTTLLKYREEELETLRGDGKGQLEKWDRV  196

Query  2246  YDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY  YNDLG+PD G    RPILGG+ EYPYPRRGRTGR+  K+DP YE+RL L    +I
Sbjct  197   YDYACYNDLGNPDKGLEHSRPILGGSAEYPYPRRGRTGREPAKSDPNYETRLDLEMSLKI  256

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS--  1899
             YVPRDEKFGHLK SDFL YALKSI QV+ P + S FD+T NEFDSF+D+  LYE G+   
Sbjct  257   YVPRDEKFGHLKMSDFLAYALKSIVQVLKPELESLFDSTPNEFDSFEDVLKLYESGIDVP  316

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
              GLL + +++N + EI KE+LR+DGE L KFP PQVI   K+AWRTDEEFAREMLAGVNP
Sbjct  317   EGLL-KDVRENIHGEILKEILRTDGEKLLKFPLPQVIAVDKSAWRTDEEFAREMLAGVNP  375

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             V I  LQ FPP+S LD KVYGD +S IT+EHI   LDGLTV++AI + ++FILDHHD +M
Sbjct  376   VMICSLQEFPPKSKLDHKVYGDQSSKITKEHIEINLDGLTVDEAIRAKKLFILDHHDTLM  435

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y RRIN  T  K YA+RT+LFLQK+GTL+ +AIELSLPH +GD++G VS VY PAE+GV
Sbjct  436   PYLRRINY-TSTKTYASRTILFLQKNGTLKLLAIELSLPHSVGDQYGAVSKVYLPAEKGV  494

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A  DSG HQLISHWL+THAV+EP IIA+NR+LS LHPI+KLLHPHFRD
Sbjct  495   EKSIWQLAKAYVAVVDSGYHQLISHWLHTHAVVEPFIIASNRRLSVLHPIHKLLHPHFRD  554

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+IN L RQ+L NA G +E +  P KY+ME S+ LYK+W FP  +LP DL+ RGMAV D
Sbjct  555   TMNINGLARQILINAGGALESTVFPSKYSMEFSSFLYKDWSFPEQALPEDLLKRGMAVKD  614

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SP+G+RLLIEDYPYAVDGLEIW AIKTWV +YC+ YYK++  +  D+ELQ+WW E+ +
Sbjct  615   STSPYGLRLLIEDYPYAVDGLEIWFAIKTWVKDYCSIYYKDEDSIKKDSELQSWWKEIRE  674

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKKDEPWWP++ +   LI+TCT IIWI+SALHAAVNFGQY Y GY P RP++SR+ 
Sbjct  675   EGHGDKKDEPWWPKMHTLEELIETCTIIIWIASALHAAVNFGQYPYGGYPPSRPSMSRRL  734

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+ +Y EL  NPDKA LKTIT+  Q +LG+SL+EILSRHASDE+YLGQR+ P+WT 
Sbjct  735   MPEKGTQEYNELLENPDKAFLKTITSQFQAVLGLSLVEILSRHASDEVYLGQRDTPDWTS  794

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D +ALEAFE+FG KLV IE+RI  MN D KLKNR GPV + YTLL PT E GL+G GIPN
Sbjct  795   DIKALEAFEKFGNKLVEIEKRIGIMNNDEKLKNRFGPVKMSYTLLKPTSEGGLTGMGIPN  854

Query  278   SISI  267
             SISI
Sbjct  855   SISI  858



>ref|XP_009376681.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=927

 Score =  1060 bits (2742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/851 (62%), Positives = 642/851 (75%), Gaps = 20/851 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D+ KKI+G VVLMKKN L+L D+ AS +D+  +  G+KVS QLIS+ N DP     GK  
Sbjct  83    DDDKKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVG  142

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K A+LEDW  K+T L A E+A+D+TF+W E +GVPGA I++N H +EFYLK+LTLED  G
Sbjct  143   KAAYLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPG  202

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SWVYPA KY  DRVFF+N+ YL S TP PL+ FRE EL+NLRGD   E++E
Sbjct  203   EGRVHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRE  262

Query  2258  ---WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
                WDRVY Y YYNDLG PD G    RPILGG+ E+PYPRR RTGR+ T    + ES + 
Sbjct  263   LEEWDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRVRTGRQAT----EKESPMM  318

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
             L+    +YVPRDE+FGHLK SD + YA+KS+ Q+V P   +   ATQNEF S  D+  LY
Sbjct  319   LIMSIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLY  378

Query  1913  EGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             EGG  L +GLL + ++ N  +E  KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  379   EGGIELPKGLL-KSVRDNIPVETIKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  437

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAG+NPV I RLQ FPP S LD K YGD TS IT+EHIA  L GL++++AI +N++FIL
Sbjct  438   MLAGINPVTIRRLQEFPPASKLDQKAYGDQTSRITKEHIAHNLKGLSIDEAIDNNKLFIL  497

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD IM Y R IN  T  K YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FGC SNVY
Sbjct  498   DHHDSIMPYLRGIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGCTSNVY  556

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQLAKAY A  DSG HQLISHWL THA +EP IIATNRQLS LHPI+KL
Sbjct  557   TPSSQGVESSIWQLAKAYVAVVDSGYHQLISHWLRTHAAMEPFIIATNRQLSVLHPIHKL  616

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRD M++NAL RQ+L NA G++E +  P K++ME ++ +YKNWVFP  +LP DLI 
Sbjct  617   LHPHFRDNMNVNALARQVLINAGGILEATLFPAKFSMEWTSAMYKNWVFPEQALPVDLIK  676

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RGMAV D SS HGVRLLIEDYP+A DGLEIW+AIKTWV +YC+FYYK D  V  D+ELQ+
Sbjct  677   RGMAVEDSSSSHGVRLLIEDYPFAADGLEIWSAIKTWVKDYCSFYYKTDETVQKDSELQS  736

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ ++GH DKKDEPWWP++ +R  LI++CT IIWI+SA HAA+NFGQY Y GY P R
Sbjct  737   WWKELREEGHGDKKDEPWWPKMQTREELIESCTIIIWIASAHHAAINFGQYPYGGYPPNR  796

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             P++SR+FMPE G+ +YEELKT+P+KA LKT+T   QTLLG++ IEILSRH++DE+YLGQR
Sbjct  797   PSISRRFMPEEGTPEYEELKTDPEKAFLKTMTPELQTLLGMASIEILSRHSADEVYLGQR  856

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F  KL   EE + + N D KLKNR GP  +PYTLL+P+ E GL
Sbjct  857   DSAEWTTDADILQASENFRMKLKEAEESMKRKNEDEKLKNRAGPAKMPYTLLYPSSEAGL  916

Query  299   SGKGIPNSISI  267
             +GKGIPNS+SI
Sbjct  917   TGKGIPNSVSI  927



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =  1060 bits (2742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/848 (61%), Positives = 651/848 (77%), Gaps = 15/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKI G VVL++ N LD  D G++++D + + +G  VS QL+SA++ DP     GK  + A
Sbjct  18    KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  2603  FLEDW--GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAA  2433
             +LE+W    +  + AGE+A+ +TF+W E +GVPGA  + N H +EF+LK+LTLED  G  
Sbjct  78    YLENWIGNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGHG  137

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWD  2253
              + F C SWVYPADKY   R+FF+NQAYLP++ P PL  +R  EL NLRG+G GERKEWD
Sbjct  138   RLHFDCNSWVYPADKYKTPRIFFANQAYLPNEMPKPLVKYRADELLNLRGNGKGERKEWD  197

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             R+YDYD YND+GDPD+     RP+LGG+ +YPYPRRGRTGR  +K DPK ESRLP    A
Sbjct  198   RIYDYDVYNDIGDPDSNLDLGRPVLGGSSKYPYPRRGRTGRPPSKADPKSESRLPSSSKA  257

Query  2078  -EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
              ++YVPRDE+FGHLK SDFL Y LKSI + + P +   FD+T  EFD F+D+  LYE GL
Sbjct  258   TDVYVPRDERFGHLKMSDFLAYGLKSISRSLKPKLEDLFDSTPGEFDDFNDVFDLYEKGL  317

Query  1901  SRGL-LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                  LL+ I +N    + KE+ R+DGE   +FPTPQ++   KTAW TDEEFAREMLAGV
Sbjct  318   PVPRSLLQGITENIPAPLLKEIFRTDGERFLRFPTPQLVHEDKTAWSTDEEFAREMLAGV  377

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDG  1545
             NPV I+RL  FPP+STLD  +YGD TS IT EHI D LDGLTV +A+   +++IL+HHD 
Sbjct  378   NPVVIARLDEFPPKSTLDTNIYGDQTSKITEEHIKDGLDGLTVNEAVEKKKLYILNHHDS  437

Query  1544  IMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQ  1365
             ++ Y RRIN  T  K YATRT+LFL+ DGTL+P+AIELSLPHP GD+FG +S V  P++ 
Sbjct  438   LIPYLRRINT-TPTKXYATRTVLFLKNDGTLKPLAIELSLPHPQGDQFGVISKVILPSKT  496

Query  1364  -GVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              G++ SIWQLAKAY A ND+G HQLISHWLNTHA IEP +IATNRQLS +HPI+KLL PH
Sbjct  497   TGIDASIWQLAKAYVAVNDTGYHQLISHWLNTHATIEPFVIATNRQLSVVHPIHKLLVPH  556

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYK-NWVFPNHSLPNDLINRGM  1011
             FRDTM+INAL RQ L NADG+IE +  P KY+MEM + +YK NWVFP  +LP DLI RG+
Sbjct  557   FRDTMNINALARQSLINADGIIETTHYPSKYSMEMCSFVYKTNWVFPQQALPADLIKRGV  616

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             A+VD +SPHG++LLIEDYPYAVDGLEIW+AIK WV +YC+FYYK+D  +  DTELQ+WW 
Sbjct  617   AIVDSNSPHGLQLLIEDYPYAVDGLEIWSAIKAWVQDYCSFYYKDDQTLRNDTELQSWWK  676

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ +KGH DKKDEPWWPR+ S H LI+TCT IIWISSALHAAVNFGQY Y G+ P RP+ 
Sbjct  677   ELREKGHADKKDEPWWPRMDSLHDLIETCTIIIWISSALHAAVNFGQYPYGGFAPNRPST  736

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+F+PE G+ DY+EL++NP+KA L+TIT+  Q L+G+S+IEILSRH+SDE+YLGQR +P
Sbjct  737   SRRFLPESGTPDYKELESNPEKAFLRTITSQLQALVGVSVIEILSRHSSDEVYLGQRSNP  796

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT DKEALEAFE+FG+KL  IE++I   N D +LKNR GPV++PYTLLFPT  EGL+G+
Sbjct  797   EWTLDKEALEAFEKFGEKLGEIEKKIAMRNKDPQLKNRVGPVDMPYTLLFPTSSEGLTGR  856

Query  290   GIPNSISI  267
             GIPNSISI
Sbjct  857   GIPNSISI  864



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/850 (63%), Positives = 651/850 (77%), Gaps = 20/850 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             ++KG VVLMKKN LD TD  AS  D++ +FVG+ VSFQL+S+   DP     GK  +PA+
Sbjct  5     RVKGAVVLMKKNVLDFTDFNAS-XDRLDEFVGKSVSFQLVSSTIADPDNGNRGKVGEPAY  63

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             +E+W   +TS+  GES + VTF+W ES G+PGAVIV+N H  EFYLKTLTLED  G   +
Sbjct  64    IEEWITTITSIADGESKFQVTFQWDESQGIPGAVIVRNYHHFEFYLKTLTLEDFPGNGRI  123

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG-TGERKEWDR  2250
              FVC SWVYP D Y YDR+FF+N  YLP+ TPAPL+ +R  EL +LRGD  TGE KE+ R
Sbjct  124   HFVCNSWVYPVDYYMYDRIFFTNHTYLPTNTPAPLQAYRNEELVHLRGDNVTGELKEFQR  183

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+PDNG    RP+LGG+ ++PYPRRGRTGR  T+TDPK ESRLP L + +
Sbjct  184   VYDYAYYNDLGNPDNGSNYARPVLGGSEQFPYPRRGRTGRPPTRTDPKTESRLPGLSL-D  242

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YA+K++ Q ++P + + F+ T  EFDS  D+ +LYEGG  L
Sbjct  243   IYVPRDERFGHLKMSDFLAYAIKALVQSLLPVLKTLFNKTPFEFDSLQDVLNLYEGGIQL  302

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                  L+ I+     E+ KE++R+DGE+L K P PQVI A K AWRTDEEF REMLAGVN
Sbjct  303   PECPELDKIKDRIPFEMIKELVRTDGEHLLKLPMPQVIQADKFAWRTDEEFGREMLAGVN  362

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRL+ FPP S LDPK+YG+HTS+IT   I   +DGLTVEQA+ SNR+FILDHHD +
Sbjct  363   PVIISRLEEFPPTSKLDPKIYGNHTSSITASQIEKNMDGLTVEQALKSNRLFILDHHDTL  422

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y  RIN  T  KIYA+RTLL L+ DG+L+P+AIELSL HP G+  G V+ V+TPA+ G
Sbjct  423   VPYLNRINT-TSSKIYASRTLLLLKDDGSLKPLAIELSLLHPDGEHLGAVNKVFTPADLG  481

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS +HPIYKLL PH+R
Sbjct  482   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSAMHPIYKLLSPHYR  541

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA G++EL+  PGKYAMEMS+ LYK+W   + +LP DL+ RG+A+ 
Sbjct  542   DTMNINALARQILINAGGILELTVFPGKYAMEMSSFLYKSWKLTDQALPADLLKRGVAIE  601

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SP+ +RLLI+DYPYAVDGL IW+AI+TWV EYC+ YY ND  V  D ELQAWW EV 
Sbjct  602   DPTSPNNIRLLIKDYPYAVDGLAIWSAIETWVNEYCSIYYINDAAVKDDVELQAWWKEVR  661

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
               GH DKKDEPWWP++ S   L  TCT IIW++SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  662   DVGHGDKKDEPWWPKMDSLSELTKTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTISRR  721

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEP + +Y+ELK NPD+  L TIT+  QT+LG+SLIEILSRH+SDE+YLGQR+  EWT
Sbjct  722   FMPEPNTPEYDELKRNPDQVFLSTITSQLQTILGVSLIEILSRHSSDEVYLGQRDTHEWT  781

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----GLS  297
              D++ALEAF++FG KLV IE +I+ MN D  LKNR GPV V YTLL+P   +     GL+
Sbjct  782   ADEKALEAFKKFGDKLVEIENKIVDMNQDKSLKNRNGPVKVSYTLLYPNTSDLSHVGGLT  841

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  842   GRGIPNSVSI  851



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/850 (62%), Positives = 653/850 (77%), Gaps = 19/850 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             ++KG V+LMKKN LD TD  AS+ D++ +F+G+ VSFQL+S+   DP     GK  +P +
Sbjct  5     RVKGTVILMKKNVLDFTDFHASLHDRLDEFLGKGVSFQLVSSTIADPNNGNKGKVGEPGY  64

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             +E+W  K+TS+ AGES + VTF+W ES G+PGAVIV+N+H +EFYLKTLTLE   G   +
Sbjct  65    IEEWITKITSIAAGESKFQVTFQWDESEGIPGAVIVRNHHHSEFYLKTLTLEHFPGNGRI  124

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG-TGERKEWDR  2250
              FVC SWVYP D Y YDR+FF+N  YLP  TPAPL+ +R  EL +LRGD  TGE KE+ R
Sbjct  125   HFVCNSWVYPVDYYTYDRIFFANHTYLPINTPAPLQAYRNEELVHLRGDNITGELKEFQR  184

Query  2249  VYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDY YYNDLGDPDNG    RP+LGG+ ++PYPRRGRTGR  T+TDPK ESRLP L + +
Sbjct  185   IYDYAYYNDLGDPDNGSNYARPVLGGSEQFPYPRRGRTGRPPTRTDPKTESRLPGLSL-D  243

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--L  1902
             IYVPRDE+FGHLK SDFL YA+K++ Q ++P + +  D T  EF+S  D+ +LYEGG  L
Sbjct  244   IYVPRDERFGHLKMSDFLAYAIKALVQSLLPVLKALLDKTPFEFNSLQDVLNLYEGGIQL  303

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                  L+ I+     E+ KE+++++GE+L K P PQVI A K AWRTDEEF REMLAGVN
Sbjct  304   PECAELDEIKDRIPFEMIKELVQTNGEHLLKLPMPQVIQADKFAWRTDEEFGREMLAGVN  363

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV ISRL+ FPP S LDPK+YG+HTS+IT   I   +DGLTVEQA+ SNR+FILDHHD +
Sbjct  364   PVIISRLEEFPPTSKLDPKIYGNHTSSITAPQIEKNMDGLTVEQALKSNRLFILDHHDTL  423

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y  RIN+ T  KIYA+RTLL L+ DG+L+P+AIELSL HP G+  G V+ V+TPA+ G
Sbjct  424   VPYLNRINS-TSSKIYASRTLLLLKDDGSLKPLAIELSLLHPDGEHLGAVNKVFTPADLG  482

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIWQLAKAY A NDSGVHQLISHWLNTHAVIEP +IATNRQLS +HPIYKLL PH+R
Sbjct  483   VEGSIWQLAKAYVAVNDSGVHQLISHWLNTHAVIEPFVIATNRQLSAMHPIYKLLSPHYR  542

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA G++EL+  PGKYAME+S+ LYK+W   + +LP DL+ RG+AV 
Sbjct  543   DTMNINALARQILINAGGILELTVFPGKYAMELSSFLYKSWKLTDQALPADLLKRGVAVE  602

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SP+ +RLLI+DYPYAVDGL IW+AI+TWV EYC+ YY ND  V  D ELQAWW EV 
Sbjct  603   DPTSPNNIRLLIKDYPYAVDGLAIWSAIETWVNEYCSIYYINDAAVKDDVELQAWWKEVR  662

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
               GH DKKDEPWWP++ S   L  TCT IIW++SALHAAVNFGQY YAGY P RPT+SR+
Sbjct  663   DVGHGDKKDEPWWPKMDSLSELTKTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTISRR  722

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEP S +Y+ELK NPD+  L TIT+  QT+LG+SLIEILSRH+SDE+YLGQR+  EWT
Sbjct  723   FMPEPNSPEYDELKRNPDRVFLSTITSQLQTILGVSLIEILSRHSSDEVYLGQRDTHEWT  782

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----GLS  297
              D++ALEAF++FG KLV IE +I+ MN D  LKNR GPV V YTLL+P   +     GL+
Sbjct  783   ADEKALEAFKKFGDKLVEIENKIVDMNQDKSLKNRNGPVEVSYTLLYPNTSDFSQVGGLT  842

Query  296   GKGIPNSISI  267
             G+GIPNS+SI
Sbjct  843   GRGIPNSVSI  852



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/850 (62%), Positives = 646/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D  KKIKGRVVLMKKN L+L D+ AS +D++ +  G+ VS QLIS+ N DP    GK  K
Sbjct  86    DGGKKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENGRGKVGK  145

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LEDW   +  L AGE  ++VTF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  146   PAYLEDWVTTIIPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  205

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER--K  2262
               + FVC SWVYPA  Y  DRVFF+N+ YL S TP PL+ FRE EL NLRGD   E   +
Sbjct  206   GRIHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQ  265

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVY Y YYNDLG P  G    RPILGG+ ++PYPRRGRTGR+ TK DP+ E+ + LL
Sbjct  266   EWDRVYGYAYYNDLGKPHKGPKYARPILGGSSKFPYPRRGRTGRRPTKEDPESETPMMLL  325

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIP-FIASRFDATQNEFDSFDDMNSLYE  1911
                 IYVPRDE+FGHLK SD + YALKSI Q++ P  +AS     Q  FDS +D+  LYE
Sbjct  326   LSLFIYVPRDERFGHLKMSDLIAYALKSISQLLRPDELASILVGPQKHFDSLEDVLKLYE  385

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G+L + ++ N   E  KE+ R+DGE   KFP PQVI   K+AW+TDEEFAREM
Sbjct  386   GGIELPEGIL-KSVRDNIPAETIKELFRTDGEKFLKFPVPQVIKVDKSAWKTDEEFAREM  444

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RLQ FPP S LD  +YGD TS IT+EHI   LDGL++++AI + ++FILD
Sbjct  445   LAGINPVVIRRLQEFPPASKLDQNIYGDQTSQITKEHIGHNLDGLSIDEAIKNKKLFILD  504

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYT
Sbjct  505   HHDALMPYLRRINT-TSTKTYASRTLLFLENDGTLKPLAIELSLPHPGGDQFGCISKVYT  563

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P+ QGVE SIWQLAKAY   NDSG HQLISHWL THAV+EP +IATNRQLS LHPI+KLL
Sbjct  564   PSSQGVESSIWQLAKAYVNVNDSGYHQLISHWLRTHAVMEPFVIATNRQLSVLHPIHKLL  623

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM++NA+ RQ+L NA G++E +  P K++ME S+V+YK+WVFP  +LP DLI R
Sbjct  624   HPHFRDTMNVNAVARQVLINAGGILEATVFPAKFSMEWSSVMYKSWVFPEQALPIDLIKR  683

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D +S HGVRLLIEDYPYA DGLEIW+AIKTWV +YC+FYYK D MV  D+ELQ+W
Sbjct  684   GMAVEDPNSSHGVRLLIEDYPYAADGLEIWSAIKTWVKDYCSFYYKTDEMVQKDSELQSW  743

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +   LI++CT IIWI+SA HAA+NFGQY + GY P RP
Sbjct  744   WKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWIASAHHAAINFGQYPFGGYPPNRP  803

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++S +FMPE G+ +YEELKTNP+KA LKTIT   QTLLG++ IEILSRH++DE+YLGQR+
Sbjct  804   SISLQFMPEEGTPEYEELKTNPEKAFLKTITPQLQTLLGMASIEILSRHSADELYLGQRD  863

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D + L+AF++F KKL  IEE + +MN D KLKNR GP  +PYTLL P+ E GL+
Sbjct  864   APEWTADNDILQAFKKFRKKLEEIEENMKRMNKDEKLKNRVGPAKMPYTLLHPSSEAGLT  923

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  924   GKGIPNSVSI  933



>ref|XP_007208174.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
 gb|EMJ09373.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
Length=933

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/850 (62%), Positives = 646/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D  KKIKGRVVLMKKN L+L D+ AS +D++ +  G+ VS QLIS+ N DP    GK  K
Sbjct  86    DGGKKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENGRGKVGK  145

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LEDW   +T L AGE  ++VTF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  146   PAYLEDWVTTITPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  205

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER--K  2262
               + FVC SWVYPA  Y  DRVFF+N+ YL S TP PL+ FRE EL NLRGD   E   +
Sbjct  206   GRIHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQ  265

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVY Y YYNDLG P  G    RPILGG+ ++PYPRRGRTGR+ TK DP+ E+ + LL
Sbjct  266   EWDRVYGYAYYNDLGKPHKGPKYARPILGGSSKFPYPRRGRTGRRPTKEDPESETPMMLL  325

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIP-FIASRFDATQNEFDSFDDMNSLYE  1911
                 IYVPRDE+FGHLK SD + YALKSI Q++ P  +AS     Q  FDS +D+  LYE
Sbjct  326   LSLFIYVPRDERFGHLKMSDLIAYALKSISQLLRPDELASILVGPQKHFDSLEDVLKLYE  385

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G+L + ++ N   E  KE+ R+DGE   KFP PQVI   K+AW+TDEEFAREM
Sbjct  386   GGIELPEGIL-KSVRDNIPAETIKELFRTDGEKFLKFPVPQVIKVDKSAWKTDEEFAREM  444

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RLQ FPP S LD  +YGD TS IT+EHI   LDGL++++AI + ++FILD
Sbjct  445   LAGINPVVIRRLQEFPPASKLDQNIYGDQTSQITKEHIGHNLDGLSIDEAIKNKKLFILD  504

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYT
Sbjct  505   HHDALMPYLRRINT-TSTKTYASRTLLFLENDGTLKPLAIELSLPHPGGDQFGCISKVYT  563

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P+ QGVE SIWQLAKAY   NDSG HQLISHWL THAV+EP +IATNRQLS LHPI+KLL
Sbjct  564   PSSQGVESSIWQLAKAYVNVNDSGYHQLISHWLRTHAVMEPFVIATNRQLSVLHPIHKLL  623

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM++NA+ RQ+L NA G++E +  P K++ME S+V+YK+WVFP  +LP DLI R
Sbjct  624   HPHFRDTMNVNAVARQVLINAGGILEATVFPAKFSMEWSSVMYKSWVFPEQALPIDLIKR  683

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D +S HGVRLLIEDYPYA DGLEIW+AIKTWV +YC+FYYK D MV  D+ELQ+W
Sbjct  684   GMAVEDPNSSHGVRLLIEDYPYAADGLEIWSAIKTWVKDYCSFYYKTDEMVQKDSELQSW  743

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +   LI++CT IIWI+SA HAA+NFGQY + GY P RP
Sbjct  744   WKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWIASAHHAAINFGQYPFGGYPPNRP  803

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++S +FMPE G+ +YEELKTNP+KA LKTIT   QTLLG++ IEILSRH++DE+YLGQR+
Sbjct  804   SISLQFMPEEGTPEYEELKTNPEKAFLKTITPQLQTLLGMASIEILSRHSADELYLGQRD  863

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D + L+A ++F KKL  IEE + +MN D KLKNR GP  +PYTLL P+ E GL+
Sbjct  864   APEWTADNDILQASKKFRKKLEEIEENMKRMNKDEKLKNRVGPAKMPYTLLHPSSEAGLT  923

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  924   GKGIPNSVSI  933



>ref|XP_008246454.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=934

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/850 (62%), Positives = 643/850 (76%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D  KKIKGRVVLMKKN L+L D+ AS +D++ +  G+ VS QLIS+ N DP    GK  K
Sbjct  87    DGGKKIKGRVVLMKKNVLELNDLKASFLDRVHELWGEVVSLQLISSVNGDPENGRGKVGK  146

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LEDW   +T L A E  ++VTF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  147   PAYLEDWVTTITPLTAEECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  206

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER--K  2262
               + FVC SWVYPA  Y  DRVFF+N+ YL S TP PL+ FRE EL NLRGD   E   +
Sbjct  207   GRIHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQ  266

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVY Y YYNDLG P  G    RPILGG+ ++PYPRRGRTGR+ TK DP+ E+ + LL
Sbjct  267   EWDRVYGYAYYNDLGKPHKGPKYARPILGGSSKFPYPRRGRTGRRPTKEDPESETPMMLL  326

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIP-FIASRFDATQNEFDSFDDMNSLYE  1911
                 IYVPRDE+FGHLK SD + YALKSI Q++ P  +AS     Q  FDS +D+  LYE
Sbjct  327   LSLFIYVPRDERFGHLKMSDLIAYALKSISQLLRPDELASILVGPQKHFDSLEDVLKLYE  386

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G+L + ++ N   E  KE+ R+DGE   KFP PQVI   K+AW+TDEEFAREM
Sbjct  387   GGIELPEGIL-KSVRDNIPAETIKELFRTDGEKFLKFPVPQVIKVDKSAWKTDEEFAREM  445

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I RLQ FPP S LD   YGD TS IT+EHI   LDGL++++AI +N++FILD
Sbjct  446   LAGINPVLIRRLQEFPPASELDQNTYGDQTSQITKEHIGHYLDGLSIDEAIKNNKLFILD  505

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K YA+RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYT
Sbjct  506   HHDALMPYLRRIN-RTSTKTYASRTLLFLENDGTLKPLAIELSLPHPDGDQFGCISKVYT  564

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P+ QGVE SIWQLAKAY   NDSG HQLISHWL THA +EP +IATNRQLS LHPI+KLL
Sbjct  565   PSSQGVESSIWQLAKAYVNVNDSGYHQLISHWLRTHAAMEPFVIATNRQLSVLHPIHKLL  624

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM++NA+ RQ+L NA G++E +  P K++ME S+V+YKNWVFP  +LP DLI R
Sbjct  625   HPHFRDTMNVNAVARQVLINAGGILEATVFPAKFSMEWSSVMYKNWVFPEQALPVDLIKR  684

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D ++ HGVRLLIEDYPYA DGLEIW+AIKTWV +YC+FYYK D  V  D+ELQ+W
Sbjct  685   GMAVEDPNTSHGVRLLIEDYPYAADGLEIWSAIKTWVKDYCSFYYKTDETVQKDSELQSW  744

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +R  LI+ CT IIWI+SA HAA+NFGQY + GY P RP
Sbjct  745   WKELREEGHGDKKDEPWWPKMQTREELIEACTIIIWIASAHHAAINFGQYPFGGYPPNRP  804

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++S +FMPE G+ DYEELKTNP+KA LKTIT   QTLLG++ IEILSRH++DE+YLGQR+
Sbjct  805   SISLQFMPEEGTPDYEELKTNPEKAFLKTITPQLQTLLGMASIEILSRHSADELYLGQRD  864

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D + L+A ++F KKL  IEE + +MN D KLKNR GP  +PYTLL P+ E GL+
Sbjct  865   APEWTTDNDILQASKKFRKKLEEIEENMKRMNKDEKLKNRVGPAKMPYTLLHPSSEAGLT  924

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  925   GKGIPNSVSI  934



>gb|KCW61801.1| hypothetical protein EUGRSUZ_H044981, partial [Eucalyptus grandis]
Length=795

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/792 (66%), Positives = 624/792 (79%), Gaps = 7/792 (1%)
 Frame = -1

Query  2624  GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE  2448
             GK  KPA LE W   +T L  G+SA+ VTF W + +GVPGA+IV+NNH ++FYLKT+TLE
Sbjct  5     GKLGKPAHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNNHHSQFYLKTITLE  64

Query  2447  D-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG  2271
             D  G   V FVC SWVYPA++Y  DRVFFSN+ YLPSQTPAPL  +RE EL NLRGDGTG
Sbjct  65    DVPGEGRVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTG  124

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E +EWDRVYDY YYNDLGDPD G    RP+LGG+ EYPYPRRGRTGR  T+TDP  ESRL
Sbjct  125   ELQEWDRVYDYAYYNDLGDPDKGSKYARPVLGGSSEYPYPRRGRTGRPPTETDPNTESRL  184

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
             PLL     YVPRDE+FGHLK SDFL YALK++GQ + P + S FD+T NEFDSF D+ +L
Sbjct  185   PLLMSLNTYVPRDERFGHLKMSDFLAYALKAVGQFLKPELESIFDSTPNEFDSFQDVLNL  244

Query  1916  YEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAR  1743
             YEGG  L    LLE +++N  LE+ K + R+DGE L ++P PQVI   K AWRTD EF R
Sbjct  245   YEGGIKLPNCPLLESLKENIPLEMLKILFRTDGEGLLEYPMPQVIKEDKIAWRTDVEFGR  304

Query  1742  EMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFI  1563
             EMLAGVNPV I  LQ FPP S LDP +YG+ +S+I  E I ++L+GLTV+QAI  N++FI
Sbjct  305   EMLAGVNPVVIRCLQEFPPASKLDPNIYGNQSSSIREELIQEQLNGLTVQQAIKMNKLFI  364

Query  1562  LDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNV  1383
             LDHHD IM Y RRIN  T +   ATRTLLFL+ DGTL+P+AIELS+PHP GD+FG +S V
Sbjct  365   LDHHDSIMPYLRRINTTTTKTY-ATRTLLFLKDDGTLKPLAIELSMPHPEGDEFGAMSKV  423

Query  1382  YTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYK  1203
             YTPA+QGVEGSIWQLAKAY A ND+G HQL SHWLNTHA IEP +IATNRQLS LHPIYK
Sbjct  424   YTPADQGVEGSIWQLAKAYVAVNDAGYHQLSSHWLNTHAAIEPFVIATNRQLSVLHPIYK  483

Query  1202  LLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLI  1023
             LLHPHFRDTM INA+ RQ++ NA G++E +  P KY+MEMS+ +YKNW+FP  +LP DLI
Sbjct  484   LLHPHFRDTMEINAIARQIVINAGGILETTVFPAKYSMEMSSAIYKNWIFPEQALPADLI  543

Query  1022  NRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQ  843
              RG+AV D +SPHG+ LLI+DYPYAVDGLEIW+AIKTWV +YC+FYYK+D  V  D ELQ
Sbjct  544   KRGVAVEDANSPHGLHLLIKDYPYAVDGLEIWSAIKTWVEDYCSFYYKSDETVQKDEELQ  603

Query  842   AWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPC  663
             +WW E+V++GH DKK EPWWP++ +   L +TCT  IWI+SALHAAVNFGQY YAGY P 
Sbjct  604   SWWRELVEEGHGDKKGEPWWPKMQTVKDLTETCTITIWIASALHAAVNFGQYPYAGYLPN  663

Query  662   RPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQ  483
             RPT+SR++MPE G+ ++EELK NPDKA LKTITA  QTLLGISLIEILS H++DE+YLGQ
Sbjct  664   RPTLSRRYMPEEGTPEFEELKQNPDKAFLKTITAQLQTLLGISLIEILSSHSTDEVYLGQ  723

Query  482   REHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEG  303
             R+ PEWT D E LEAFERFGKKL  +EERI++MNGD +  NR GPV VPY LL+PT E G
Sbjct  724   RDTPEWTADAEPLEAFERFGKKLGEVEERIMRMNGDKRWMNRVGPVEVPYMLLYPTSEGG  783

Query  302   LSGKGIPNSISI  267
             ++ KGIPNS+SI
Sbjct  784   VTAKGIPNSVSI  795



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =  1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/845 (63%), Positives = 643/845 (76%), Gaps = 17/845 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             +KG VVLM+KN LD TD  AS++D +Q+ +GQ+VS QL+SA   DP     G    PA+L
Sbjct  15    VKGTVVLMRKNTLDFTDFTASLLDGVQELLGQRVSLQLVSATVGDPKHGNRGVVGDPAYL  74

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQ  2424
             + +  KL S+ AGES +DVTF W+E  GVPGAVIVKN HA++FYLK++TL+D  G   + 
Sbjct  75    DGFVSKLPSIAAGESTFDVTFHWQEKNGVPGAVIVKNRHASQFYLKSITLKDFPGKGRIH  134

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRG-DGTGERKEWDRV  2247
             FVC SWVY ADKY YDRVFF+N AYLP +TPAPL+P+RE EL NLRG D TG+ +EWDR+
Sbjct  135   FVCNSWVYSADKYKYDRVFFANTAYLPGETPAPLKPYREDELLNLRGEDVTGQLQEWDRI  194

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY YYNDLG+PD+     RP+LGG+ EYPYPRRGRTGR  TKTDP  ESRLPL+ + +I
Sbjct  195   YDYAYYNDLGNPDSDAALARPVLGGSSEYPYPRRGRTGRPPTKTDPNSESRLPLISL-DI  253

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL--S  1899
             YVPRDE+FGHLK +DFL YALK++ Q V+P + +  D T NEFDSF+D+  LYEGGL  +
Sbjct  254   YVPRDERFGHLKMADFLTYALKALVQAVVPVLEAIADETPNEFDSFEDILKLYEGGLPVA  313

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDG-ENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
             +  LL+ ++     E+ +E+ R++G + L K P PQ+I  +K AWRTDEEFAREMLAGVN
Sbjct  314   KVPLLDELRDRIPFEMIRELFRTEGNQRLLKLPIPQIIEVNKYAWRTDEEFAREMLAGVN  373

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I RL+VFPP S LDP  YG+  S IT  HI   L+GLTV+QA+  NR+FILDHHD +
Sbjct  374   PVIIRRLEVFPPVSKLDPSKYGNQNSRITAAHIEHNLEGLTVDQALGGNRLFILDHHDAL  433

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y  RIN+ T  KIYATRT+LFL+ D TL+P+AIELSLPHP G++ G VS VY P E G
Sbjct  434   MPYVNRINS-TASKIYATRTVLFLRDDSTLKPLAIELSLPHPDGEQHGAVSEVYMPEEAG  492

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEGSIW+LAKAY   NDSGVHQLISHWLNTHA +EP +IATNR LS LHPI+KLL PH+R
Sbjct  493   VEGSIWELAKAYVVVNDSGVHQLISHWLNTHATMEPFVIATNRHLSVLHPIHKLLTPHYR  552

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA G++E +  P KYAMEMSAV+YKNW F   +LP DLI RG+AV 
Sbjct  553   DTMNINALARQILINAGGILEATVFPAKYAMEMSAVVYKNWNFVEQALPADLIKRGVAVK  612

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D  S + +RLLI+DYPYAVDGL IW  I+TWVTEYC  YY ND ++  D ELQAWW EV 
Sbjct  613   D--SNNELRLLIKDYPYAVDGLAIWRTIETWVTEYCAIYYPNDAVLQADVELQAWWKEVR  670

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKKDE WWP++ +   L   CTTIIW++SALHAA+NFGQY YAGY P RPT+SR+
Sbjct  671   EVGHGDKKDEAWWPQMQTVSELTQACTTIIWVASALHAALNFGQYPYAGYLPNRPTISRR  730

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMP PG+ +YEELK +PDKA L TIT+  QT+LG+SLIEILS H+SDE+YLGQR+ PEWT
Sbjct  731   FMPAPGTPEYEELKAHPDKAFLMTITSQLQTILGVSLIEILSMHSSDEVYLGQRDTPEWT  790

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D+ AL AF RFG  L  IE+ I+  NGD  LKNR G   VPYTLLFPT E GL+GKGIP
Sbjct  791   TDQRALVAFNRFGSTLKRIEDEIIGRNGDESLKNRNGAAQVPYTLLFPTSERGLTGKGIP  850

Query  281   NSISI  267
             NS+SI
Sbjct  851   NSVSI  855



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =  1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/850 (63%), Positives = 640/850 (75%), Gaps = 15/850 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP----GKRSK  2610
             D  KKIKGRVVLMKKN L+L D+ AS +D++ +  G+ VS QLIS+ N DP    GK  K
Sbjct  86    DGGKKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENGRGKVGK  145

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LEDW   +T L AGE  ++VTF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  146   PAYLEDWVTTITPLTAGECTFEVTFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  205

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER--K  2262
               + FVC SWVYPA  Y  DRVFF+N+ YL S TP PL+ FRE EL NLRGD   E   +
Sbjct  206   GRIHFVCNSWVYPAKNYKKDRVFFANKTYLLSDTPGPLKKFREEELVNLRGDDDDETELQ  265

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVY Y YYNDLG P  G    RPILGG+ ++PYPRRGRTGR+ TK DP+ E+ + LL
Sbjct  266   EWDRVYGYAYYNDLGKPHKGPKYARPILGGSSKFPYPRRGRTGRRPTKEDPESETPMMLL  325

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIP-FIASRFDATQNEFDSFDDMNSLYE  1911
                 IYVPRDE+FGHLK SD + YALKSI Q++ P  +AS     Q  FDS +D+  LYE
Sbjct  326   LSLFIYVPRDERFGHLKMSDLIAYALKSISQLLRPDELASILVGPQKHFDSLEDVLKLYE  385

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  G+L + ++ N   E  KE+ R+DGE   KFP PQVI   K AWRTDEEFAREM
Sbjct  386   GGIELPEGIL-KSVRDNIPAETIKELFRTDGEKFPKFPVPQVIKVDKPAWRTDEEFAREM  444

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I RLQ FPP S LD K YGD TS IT+EHI   L GL++++AI +N++FILD
Sbjct  445   LAGVNPVAIRRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILD  504

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y RRIN  T  K Y++RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYT
Sbjct  505   HHDALMPYLRRINT-TSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGDQFGCISKVYT  563

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P+ QGVE SIWQLAKAY   NDSG HQLISHWL THAVIEP +IA NRQLS LHPI+KLL
Sbjct  564   PSSQGVESSIWQLAKAYVNVNDSGHHQLISHWLKTHAVIEPFVIAANRQLSVLHPIHKLL  623

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFR+TM+ NA+ R++LTNA G+IE +  P K++ME S+V+YKNWVFP  +LP DLI R
Sbjct  624   HPHFRETMNANAIAREVLTNAGGIIEETVFPAKFSMEWSSVMYKNWVFPEQALPVDLIKR  683

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D  S H VRLLIEDYPYA DGLEIW+AIKTWV E+C+FYYKND MV  D+ELQ+W
Sbjct  684   GMAVEDPKSSHSVRLLIEDYPYAADGLEIWSAIKTWVKEFCSFYYKNDEMVQNDSELQSW  743

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +   LI++CT IIW+SSA HAA+N+GQY+  GY P RP
Sbjct  744   WKELREEGHGDKKDEPWWPKMQTCEELIESCTIIIWLSSAYHAAINYGQYSIGGYVPNRP  803

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             ++S  FMPE G+ +YEELKTNPDKA LKT T   QTLLG++ IEILSRH  DE+YLGQR 
Sbjct  804   SISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLGQRG  863

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
              PEWT D   L+AFE F KKL  IE+RI+KMN D KLKNR GP  +PYTLL+P+ E GL+
Sbjct  864   TPEWTTDANMLQAFEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEPGLT  923

Query  296   GKGIPNSISI  267
             GKGIPNS++I
Sbjct  924   GKGIPNSVNI  933



>ref|XP_009774054.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=844

 Score =  1055 bits (2727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/845 (62%), Positives = 640/845 (76%), Gaps = 17/845 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRSK-----  2610
             E KKI G VVL+KK  LD+          + + +G KV+ QLIS+   D GK  K     
Sbjct  8     ENKKINGTVVLIKKRPLDIAPSEVVQQQAVYEILGHKVTLQLISSFTGDSGKEMKGKLGN  67

Query  2609  PAFLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE--DGGA  2436
             P  L D          ES ++VTF+W E +G PGA I+KN + +EF+LK LTLE  D   
Sbjct  68    PTHLRDENN----SGNESKFNVTFDWDEEVGAPGAFIIKNFNPSEFFLKKLTLEVDDPSH  123

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               + FVC SWVYPA+KY  DRVFF NQA+LPS+TPAPLR +RE EL NLRG+GTG+ +EW
Sbjct  124   DSIHFVCNSWVYPAEKYKSDRVFFVNQAWLPSETPAPLRWYREEELLNLRGNGTGKLEEW  183

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLGDP+ G    RPILGG+ +YPYPRRGRTGR  TKTDP  ESRLPLL  
Sbjct  184   DRVYDYAYYNDLGDPEKGSDYVRPILGGSEKYPYPRRGRTGRPPTKTDPNSESRLPLLMS  243

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDEKF  LK +DF+G ALK I Q+++P + S  + + NEF+SF+++  +YE G+
Sbjct  244   FGIYVPRDEKFAPLKMTDFVGIALKVIVQLLVPELESLANISLNEFNSFEEILKIYEEGI  303

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
             +   L   + + +   + KE ++S G+   K+P PQVI   K+AWRTDEEFAREMLAG+N
Sbjct  304   N---LPNDLLERSTTHMLKEFIQSAGQGFLKYPMPQVIKEDKSAWRTDEEFAREMLAGIN  360

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PVCI  L+ FPP S LDPKVYGD T  ITRE I ++LDGL +E+AI +N++FILDHHD I
Sbjct  361   PVCICALKEFPPTSKLDPKVYGDQTCKITREQIQNQLDGLIIEEAIKANQLFILDHHDTI  420

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y R+IN  T  KIY++RT+LFL+KDGTL+P+AIELSLPHP GD+ G +S V+TP E+G
Sbjct  421   MPYVRQINM-TSTKIYSSRTILFLRKDGTLKPLAIELSLPHPDGDQLGAISEVFTPHEEG  479

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             +E S+WQLAKAY A NDSGVHQLISHWL+THA IEP +IATNRQLS LHPIYKLLHPHFR
Sbjct  480   IEASVWQLAKAYVAVNDSGVHQLISHWLHTHAAIEPFVIATNRQLSVLHPIYKLLHPHFR  539

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTMHINAL RQ L NA G++E +  P KYAMEM++V YK+W FP+ +LP DLI RG+A+ 
Sbjct  540   DTMHINALARQTLLNAGGILEQTVFPTKYAMEMTSVAYKDWTFPDQALPADLIKRGVAIE  599

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D  S  G+RLLIEDYPYAVDGLEIW+AIK+WV EYC++YYK D M+  DTELQAWW EV 
Sbjct  600   DPESEQGIRLLIEDYPYAVDGLEIWSAIKSWVQEYCSYYYKTDDMIKKDTELQAWWKEVR  659

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH D+K EPWWP++ +   LID+C  IIWI+SALHAA+NFGQY Y GY P RP++SR+
Sbjct  660   EDGHGDRKSEPWWPKMQTLKELIDSCNIIIWIASALHAAINFGQYPYGGYLPNRPSMSRR  719

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPGS +YE+LKTNP+K  L+TIT   QTL+GIS IEILS H+SDEIYLGQR+ PEWT
Sbjct  720   FMPEPGSPEYEDLKTNPEKGYLRTITPQLQTLIGISAIEILSIHSSDEIYLGQRDTPEWT  779

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KDKE L+A ERFGKKL  IEE+I+KMN D KLKNR GPV +PYTLL+PT E GL+GKGIP
Sbjct  780   KDKEPLQALERFGKKLAEIEEKIMKMNNDTKLKNRIGPVKMPYTLLYPTSEPGLTGKGIP  839

Query  281   NSISI  267
             NS+SI
Sbjct  840   NSVSI  844



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/852 (62%), Positives = 652/852 (77%), Gaps = 18/852 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRSK---P  2607
             +  K++KGRVVLMKK  LD  D+ A+++D++ + +G+ VS QLISA   DPG R K    
Sbjct  2     ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPGLRGKLGKV  61

Query  2606  AFLEDW-GKLTSLV-AGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             A LE W   +TSL  A ++ + VTFEW ES+GVPGA I++NNH ++FYLKT+T+ED  G 
Sbjct  62    AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               V FVC SW+YPA +Y +DRVFF+N+AYLP QTP PLR FRE EL  LRG G G+  EW
Sbjct  122   GPVNFVCNSWIYPAHRYAHDRVFFANKAYLPYQTPEPLRKFREQELIALRGKGFGKLNEW  181

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD+G    RP+LGG+ + PYPRRGRTGR   KTDPK ESRL LL +
Sbjct  182   DRVYDYAYYNDLGLPDDGPDYARPVLGGS-QCPYPRRGRTGRPHCKTDPKTESRLRLLNL  240

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               +YVPRDE+FGH+K SDFL Y+LKS+ QV++P I S  D T NEFD+F+D+  +YEG  
Sbjct  241   -NVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFEDVLDIYEGSI  299

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G L   +++    E+ +E++R+DGE   KFP P VI  SKTAWRTDEEFAREMLAG
Sbjct  300   KLPSGPLASKLRELVPYELLRELIRNDGERFLKFPVPDVIKVSKTAWRTDEEFAREMLAG  359

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I RLQ FPP S LD +VYGD TS+I   HI + LDGLT+++AI + R+FILDHHD
Sbjct  360   VNPVIIRRLQEFPPASKLDSRVYGDQTSSIRATHIENSLDGLTIDEAIQNMRLFILDHHD  419

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y  RIN+ T+ K YA+RT+LFLQ DGTL+P+AIELSLPHP G++ G VS V+TPA+
Sbjct  420   ALMPYISRINS-TNTKTYASRTILFLQDDGTLKPLAIELSLPHPQGEQHGAVSKVFTPAQ  478

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             +GV  S+WQLAKAYAA NDSG HQL+SHWL THAVIEP II TNRQLS LHPI+KLL PH
Sbjct  479   EGVSASVWQLAKAYAAVNDSGYHQLVSHWLYTHAVIEPFIITTNRQLSILHPIHKLLKPH  538

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTMHINAL R  L NA GV+E +  PGK+A+EMS+V+YK+WVF   +LP DL+ RGMA
Sbjct  539   FRDTMHINALARHTLINAGGVLEKTVFPGKFALEMSSVIYKSWVFTEQALPADLLKRGMA  598

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D S  HG+RL+IEDYP+AVDG+EIW AI+TWVTEYCNFYY ++ MV  D+ELQ+WW E
Sbjct  599   VPDSSCRHGLRLVIEDYPFAVDGIEIWDAIETWVTEYCNFYYTSNDMVEDDSELQSWWKE  658

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             V  +GH D KD  WWP + ++  LI +CT IIW++SA HAAVNFGQY +AGY P RPTVS
Sbjct  659   VRNEGHGDLKDRHWWPEMKTKEELIQSCTIIIWLASAFHAAVNFGQYPFAGYLPNRPTVS  718

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPEPG+ +YEELK++PD A LKTITA  QTLLG+SLIE+LSRH+++E+YLGQ E+PE
Sbjct  719   RRFMPEPGTPEYEELKSDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTEEVYLGQCENPE  778

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEG  303
             WT D E L AFERF +KL+ IE  I++ N D +LKNR GPV +PYTLLFP     + E G
Sbjct  779   WTLDAEPLAAFERFRQKLLEIESNIIERNKDKRLKNRNGPVKMPYTLLFPNTSDYSREGG  838

Query  302   LSGKGIPNSISI  267
             L+GKGIPNSISI
Sbjct  839   LTGKGIPNSISI  850



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/853 (64%), Positives = 645/853 (76%), Gaps = 18/853 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             DE  KIKG VVLMKKN +D+ D+ AS +D++ +  G+ VS QLISA   DP     GK  
Sbjct  23    DEKMKIKGTVVLMKKNVMDMNDLTASFLDRVYELFGRGVSLQLISAVYTDPANEMRGKLG  82

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA LE W  K+T L AGE  + VTFEW ES+GVPGA I+KN H ++FYLKT+TLED  G
Sbjct  83    KPANLEKWITKITPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPG  142

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                V FVC SWVYP  +Y YDRVFFSN+ YLPSQ   PLR +RE EL NLRGDG G  KE
Sbjct  143   HGRVHFVCNSWVYPTHRYKYDRVFFSNKTYLPSQMAVPLRKYREEELVNLRGDGKGCLKE  202

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDYD+YNDL  P+ G    RP+LGG+ + PYPRRGRTGRK  K D + ESRL LL 
Sbjct  203   WDRVYDYDFYNDLAMPERGHDFHRPVLGGSLDCPYPRRGRTGRKPHKKDSRTESRLFLLS  262

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
             + +IYVPRDE+F  +K SDF+ YALKS+ QV+IP +A+  D T NEFDSF D+  LYEGG
Sbjct  263   L-KIYVPRDEQFSLVKFSDFVAYALKSLFQVLIPEVAALCDKTINEFDSFQDVLDLYEGG  321

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L     L+ I+     E+ +E++R+DGE L KFP P VI   ++AWRTDEEFARE LA
Sbjct  322   IKLPDDATLKKIRDCVPWEMIRELVRNDGERLMKFPMPAVIKEDRSAWRTDEEFARETLA  381

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV ISRLQ FPP S LDP+VYG+  STIT+EHI   +DG TVE A+  N++FIL+HH
Sbjct  382   GVNPVIISRLQEFPPASKLDPEVYGNQKSTITKEHIERNMDGFTVEDALKHNKLFILNHH  441

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y  RIN+ T  K YATRTL FLQ+D TL+P+AIELSLPHP GD  G VS V+TPA
Sbjct  442   DALMPYLARINSTT-TKTYATRTLFFLQEDDTLKPLAIELSLPHPQGDSHGAVSKVFTPA  500

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GV  SIWQLAKAYAA NDSG HQL+SHWLNTHAVIEP IIA NRQLS +HPIYKLLHP
Sbjct  501   EDGVGSSIWQLAKAYAAVNDSGYHQLVSHWLNTHAVIEPFIIAANRQLSVVHPIYKLLHP  560

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL RQ L NA GV+EL+  PGKYA+EMS+ +Y+NWVF   +LP DL+ RGM
Sbjct  561   HFRDTMNINALARQTLINAGGVLELTVFPGKYALEMSSAIYRNWVFTEQALPVDLVKRGM  620

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D S P+G++L+I DYPYAVDGLEIW AI+TWVTEYC+FYY +D  V  DTE+Q+WW+
Sbjct  621   AVPDSSCPYGLKLMINDYPYAVDGLEIWAAIETWVTEYCSFYYPSDETVKNDTEIQSWWS  680

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV  +GH D ++EPWWP + +   L   CT IIWI+SA HAAVNFGQY YAGY P RPTV
Sbjct  681   EVKNEGHGDLRNEPWWPEMNTLADLTQACTIIIWIASAFHAAVNFGQYPYAGYLPNRPTV  740

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+ +Y+EL+ +PD A LKTITA  QTLLG+SLIE+LSRH++DEIYLGQR+  
Sbjct  741   SRRFMPEPGTKEYDELENDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTDEIYLGQRDTA  800

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEE  306
             EWT D E L AFERFGKKL+ IE RI++ N D KLKNR GPV VPYTLL+P     + E 
Sbjct  801   EWTTDDEPLAAFERFGKKLLEIESRIMERNNDSKLKNRVGPVKVPYTLLYPNTSDYSREG  860

Query  305   GLSGKGIPNSISI  267
             GL+GKGIPNSISI
Sbjct  861   GLTGKGIPNSISI  873



>ref|XP_009625817.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=844

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/845 (62%), Positives = 634/845 (75%), Gaps = 17/845 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRSK-----  2610
             E KKI G VVL+KK  LDL            + +G KV+ QLIS+   D GK  K     
Sbjct  8     EKKKINGTVVLIKKRPLDLVPSEVVQQQAAYEILGHKVTLQLISSFTGDSGKEMKGKLGN  67

Query  2609  PAFLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE--DGGA  2436
             P  L D          ES + VTF+W E +G PGA I+KN + +EF+LK LT E  D   
Sbjct  68    PTHLRDENN----SGNESKFSVTFDWDEEVGAPGAFIIKNFNPSEFFLKKLTFEVDDPSH  123

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEW  2256
               + FVC SWVYPA+KY  DRVFF NQA+LPS+TPAPLR +RE EL NLRG+GTG+ +EW
Sbjct  124   GSMHFVCNSWVYPAEKYKSDRVFFVNQAWLPSETPAPLRWYREEELLNLRGNGTGKLEEW  183

Query  2255  DRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DR+YDY YYNDLGDP+ G    RPILGG+ +YPYPRRGRTGR  T TDP  ESRLPL+  
Sbjct  184   DRIYDYAYYNDLGDPEKGSDYVRPILGGSEKYPYPRRGRTGRPPTNTDPNSESRLPLIMS  243

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGL  1902
               IYVPRDE F  LK +DF+G ALK I Q+++P + S  + + NEF+SF+++  +YE G+
Sbjct  244   FGIYVPRDENFAPLKMTDFVGIALKVIVQLLVPELESLANISLNEFNSFEEILKIYEEGI  303

Query  1901  SRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
             +   L   + + +   + KE ++S G+   K+P PQVI   K+AWRTDEEFAREMLAG+N
Sbjct  304   N---LPNDLLQRSTTHMLKEFIQSAGQQFLKYPMPQVIKEDKSAWRTDEEFAREMLAGIN  360

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PVCI  L+ FPP S LD KVYGD TS +TRE I ++LDG T+E+AI +N++FILDHHD I
Sbjct  361   PVCICALKEFPPTSKLDLKVYGDQTSKLTREQIQNQLDGFTIEEAINANQLFILDHHDTI  420

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y R+IN  T  +IYA+RTLLFLQ DGTL+P+AIELSLPHP GD+ G +S V+T  E G
Sbjct  421   MPYLRQINM-TSTQIYASRTLLFLQNDGTLKPLAIELSLPHPDGDQLGAISKVFTSHENG  479

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VE SIWQLAKAY A NDSGVHQLISHWL+THA IEP +IATNRQLS LHPIYKLLHPHFR
Sbjct  480   VEASIWQLAKAYVAVNDSGVHQLISHWLHTHAAIEPFVIATNRQLSVLHPIYKLLHPHFR  539

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTMHINAL RQ L NA G++E +  P KYAMEM++V YK+W FP+ +LP DLI RG+AV 
Sbjct  540   DTMHINALARQTLLNAGGILEQTVFPTKYAMEMTSVAYKDWSFPDQALPADLIKRGVAVE  599

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D  S  GVRLLIEDYPYAVDGLEIW+AIK+WV EYC+FYYK D M+  DTELQAWW EV 
Sbjct  600   DPESEQGVRLLIEDYPYAVDGLEIWSAIKSWVQEYCSFYYKTDDMIQKDTELQAWWKEVR  659

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKK EPWWP++ +   LID+CTTIIWI+SALHAA+NFGQY Y GY P RP++SR+
Sbjct  660   EDGHGDKKSEPWWPKMQALKELIDSCTTIIWIASALHAAINFGQYPYGGYLPNRPSMSRR  719

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPGS +YEELKTNP+K  L+TIT   QTL+GIS IEILS H+SDEIYLGQR+ PEWT
Sbjct  720   FMPEPGSPEYEELKTNPEKGYLRTITPQLQTLIGISAIEILSTHSSDEIYLGQRDTPEWT  779

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KDKE ++A ERFGKKL  IEE+I+KMN D KLKNR GPV +PYTLL+PT E GL+GKGIP
Sbjct  780   KDKEPIQALERFGKKLAEIEEKIIKMNNDKKLKNRMGPVKMPYTLLYPTSEPGLTGKGIP  839

Query  281   NSISI  267
             NS+SI
Sbjct  840   NSVSI  844



>ref|XP_003626279.1| Chalcone synthase [Medicago truncatula]
Length=1317

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/874 (60%), Positives = 643/874 (74%), Gaps = 39/874 (4%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG-----KRSKPAFL  2598
             ++G V+LMKKN LD  D+ AS  D I + VG++VS QL+SA+  DPG     K  KPA+L
Sbjct  19    MRGEVILMKKNVLDFKDLSASFFDGIHELVGKRVSLQLVSADKGDPGNGMKGKVGKPAYL  78

Query  2597  EDWGK-LTSLVAGESAYDVTFEWRES--LGVPGAVIVKNNHANEFYLKTLTLEDGGAAGV  2427
             EDW   +T L+AGES Y VTF+  +   +G PGA ++KNNH +EFYLK+L L++    GV
Sbjct  79    EDWNSTITPLIAGESTYKVTFDLDDDDDIGTPGAFLIKNNHHSEFYLKSLKLQNVPGQGV  138

Query  2426  -QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERKEWD  2253
               F C SWVYP+ KY  DR+FFSN+ Y  S+TPAPL  +RE EL+ LRG G   + KEWD
Sbjct  139   IHFTCNSWVYPSQKYQKDRIFFSNKTYFLSETPAPLLKYREEELETLRGSGDSIQLKEWD  198

Query  2252  RVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVA  2079
             RVYDY YYNDL DPD G    RP+LGG+ EYPYPRRGRT R   K+D   ESRL L    
Sbjct  199   RVYDYAYYNDLADPDKGPKYVRPVLGGSSEYPYPRRGRTNRPPAKSDANSESRLNLAMSL  258

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IYVPRDE+FGH+K SDFL YA+K+I QV+ P + S FD+T NEFDS +D+  LYEGG+ 
Sbjct  259   DIYVPRDERFGHVKMSDFLAYAIKAIVQVIKPELESLFDSTPNEFDSLEDVLKLYEGGIE  318

Query  1898  --RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGV  1725
                G + + I+     E+ KE+LR+DG+ L K+P P VI   K+AWRTDEEFAREMLAGV
Sbjct  319   VPEGAV-KRIRDKIPAEMLKEILRTDGQKLLKYPVPHVIKEDKSAWRTDEEFAREMLAGV  377

Query  1724  NPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIW------------  1581
             NPV I  LQ FPP S LDP VYGD +STI +  I   LDGLTV++AI+            
Sbjct  378   NPVIIRGLQEFPPTSKLDPNVYGDQSSTIRKSDIESNLDGLTVDEAIFKFDMIFCFDHTI  437

Query  1580  -----------SNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIE  1434
                          ++FILDHHD +M Y RRIN+ T  K YA+RT+LFLQ++GTL+P+AIE
Sbjct  438   FFEFCDNFAIAQKKLFILDHHDALMTYLRRINS-TSTKTYASRTILFLQQNGTLKPLAIE  496

Query  1433  LSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEP  1254
             LSLPHP GD+ G +SNVY PAE GVE SIWQLAKAY A NDSG HQLISHWL+THA IEP
Sbjct  497   LSLPHPNGDQHGAISNVYMPAENGVENSIWQLAKAYVAVNDSGYHQLISHWLHTHASIEP  556

Query  1253  IIIATNRQLSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAV  1074
              II+ NRQLS LHPI+KLLHPHFRDTM+INAL RQ+L NA G++E +  P KYAME+S+ 
Sbjct  557   FIISANRQLSVLHPIHKLLHPHFRDTMNINALARQILINAGGLLEATVYPSKYAMELSSA  616

Query  1073  LYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYC  894
             LYK+W FP  +LP DL+ RGMA+ D +SPHG+RL++ DYPYAVDGLEIW AI TWV +YC
Sbjct  617   LYKDWTFPEQALPVDLVKRGMAIKDSASPHGLRLIVNDYPYAVDGLEIWFAINTWVQDYC  676

Query  893   NFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSAL  714
             +FYYKND  V  D ELQ+WW E++Q+GH DKK+EPWWP++ +   L +TCT IIWI+SAL
Sbjct  677   SFYYKNDDTVKKDAELQSWWKELIQEGHGDKKNEPWWPKMQTVEELTETCTIIIWIASAL  736

Query  713   HAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGIS  534
             HAAVNFGQY +AGY+P RPT+SR+FMPE G+ +Y+EL TNPDKA LKTITA  QTL+GIS
Sbjct  737   HAAVNFGQYPFAGYSPNRPTISRRFMPEKGTIEYDELVTNPDKAFLKTITAQLQTLVGIS  796

Query  533   LIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRT  354
             LIEILS H+SDE+YLGQR+   WT D E LEAF+RFGKKL  IEERI+ MN D  LKNR 
Sbjct  797   LIEILSTHSSDEVYLGQRDSMHWTCDAEPLEAFDRFGKKLKEIEERIVAMNDDVNLKNRV  856

Query  353   GPVNVPYTLLFPTGEEGLSGKGIPNSISI*FLWL  252
             GPV +PYTLL+P  E GL+G GIPNS+    +W+
Sbjct  857   GPVKMPYTLLYPRSEAGLTGAGIPNSVPEITIWI  890


 Score = 95.1 bits (235),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 18/107 (17%)
 Frame = -1

Query  734  IWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALP  555
            IWI+SALHAAV FGQY YA Y+                  ++ L+    +  LKT+ A  
Sbjct  888  IWIASALHAAVKFGQYPYASYSIMNL--------------WQILR----RLFLKTVAAQL  929

Query  554  QTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFERFGKKL  414
            Q L+G+SLIEILS H+SDE+YLG+R+   W  D E LEAF++FGKKL
Sbjct  930  QILVGVSLIEILSAHSSDEVYLGERDTKHWIYDAEPLEAFDKFGKKL  976



>ref|XP_009376663.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376684.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=868

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/849 (62%), Positives = 639/849 (75%), Gaps = 13/849 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             +E KKIKGRVVLMKK  LD+ D+ ASI+D++ + +G+ VS +LIS+ N DP     GK  
Sbjct  21    NEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVG  80

Query  2612  KPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             KPA+LE+W   +T L AGE+A+DVTF+W + +GVPGA +V+N H +EFYLKTLTLED  G
Sbjct  81    KPAYLENWVTTITPLTAGEAAFDVTFDWDKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPG  140

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--GER  2265
                V FVC SWVYPADKY  DRVFFSN+ YL S TP PL+ FRE EL NLRGD    GE 
Sbjct  141   EGRVHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGEL  200

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ESRL L
Sbjct  201   QEWDRVYDYAYYNDLGNPDKGTEYARPVLGGSIEYPYPRRGRTGRPATKTDPNTESRLKL  260

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             + +  +YVPRDE+FG +K SD L Y LKSI QV+ P I       +NEF+S +++  LYE
Sbjct  261   IQILNVYVPRDERFGPVKMSDLLAYVLKSIPQVLKPEIRDLLVGNKNEFESMEEVLKLYE  320

Query  1910  GGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GGL     +L+HI  +T  E+ KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE+L
Sbjct  321   GGLELPDGILKHISDSTPEEMFKELFRTDGERFLKFPVPQVIKEDKSAWRTDEEFARELL  380

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LD + YGD TS IT+EHI   L+GLT+++AI SN++FILDH
Sbjct  381   AGVNPVTIRRLQEFPPSSELDREAYGDQTSQITKEHIEHNLNGLTIDEAIMSNKLFILDH  440

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD  M Y RRIN  T  K YA+RTLLFL  DGTL+PIAIELSLPHP GD+FGC+S VYTP
Sbjct  441   HDAWMPYLRRINT-TSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGDQFGCISKVYTP  499

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             + QGVE SIWQLAK YA  NDSG HQL SHWL  HAV EP +IA NRQLS LHPI+KLLH
Sbjct  500   SSQGVESSIWQLAKGYALVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPIHKLLH  559

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI RG
Sbjct  560   PHFRGTMNANASARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPADLIKRG  619

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +AV D S  HG RLLIEDYPYA DGLE+W+AIKTWV +YC+FYYKND MV  D+ELQ+WW
Sbjct  620   VAVEDSSVSHGARLLIEDYPYAADGLELWSAIKTWVKDYCSFYYKNDQMVQNDSELQSWW  679

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              E+ + GH DKKDEPWWP++ +R  LI++CTTII+I+SA HAA+N+GQ++  G+ P RPT
Sbjct  680   KELREVGHGDKKDEPWWPKMQTRDELIESCTTIIYIASAHHAAINYGQFSIGGFVPNRPT  739

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +SR+FMPE G+ +YEEL+TNPDKA LKT      TLLG++ +EILSRH +DE+YLGQR+ 
Sbjct  740   LSRRFMPEEGTPEYEELRTNPDKAFLKTFAPQLPTLLGMATVEILSRHPTDELYLGQRDT  799

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
              EWT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL+ 
Sbjct  800   AEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGLTN  859

Query  293   KGIPNSISI  267
             KG+P SI+I
Sbjct  860   KGVPTSINI  868



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =  1053 bits (2722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/848 (62%), Positives = 647/848 (76%), Gaps = 23/848 (3%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKRSK  2610
             E KKI+G V+LMK N LD  D   S++D + +F+G++VS QL+SA N D      GK  +
Sbjct  9     EKKKIEGTVILMKSNVLDFNDFHESLLDYLYEFLGKRVSLQLVSAINGDHSNGLRGKLGE  68

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
              A+LEDW    T L+AGE+A+ V F+W  E +G+PGA  ++N+H +EFYLK+LTLE   G
Sbjct  69    AAYLEDWITTRTPLIAGEAAFKVRFDWDEEEMGIPGAFFIRNDHHSEFYLKSLTLEHVPG  128

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + F+C SWVYP  + +    +F  Q+ + SQ         +  + N + +G G    
Sbjct  129   HGRIYFLCNSWVYPF-RTSKKESYFLRQSDISSQRNTRAASQVQRCMANSK-NGIG----  182

Query  2258  WDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
                 YDY +YNDL DPD G    RP+LGG+ +YPYPRRGRTGR   K+DP++ESR+PL+ 
Sbjct  183   ---FYDYAFYNDLADPDKGSEYARPVLGGSTQYPYPRRGRTGRPPAKSDPEFESRIPLVK  239

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
               +IYVPRDE+FGHLK SDFL YALK++ Q + P +   F+ T  EFDSF D+  LYEGG
Sbjct  240   SLDIYVPRDERFGHLKLSDFLAYALKAVSQFIKPGLEELFEGTPGEFDSFQDVLDLYEGG  299

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               +  GL  E I++N    + KE+ R+DGE LFKFP PQVI   ++AWRTDEEF RE+LA
Sbjct  300   FPVPEGLF-EAIRENIAAPLLKEIFRTDGERLFKFPLPQVIKEDRSAWRTDEEFGREILA  358

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I RLQVFPP S LDP+VYGD  S IT+EHI DKLDGLTVE+AI  NR+FILD H
Sbjct  359   GVNPVVIRRLQVFPPTSKLDPEVYGDQNSKITKEHIIDKLDGLTVEEAIKRNRLFILDPH  418

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y RRIN  T  K YA+RT+LFL++DGTL+P+AIELSL +P GD+FG VS ++ PA
Sbjct  419   DSLMPYLRRIN-TTSTKTYASRTILFLKEDGTLKPLAIELSLRNPQGDRFGAVSKIFFPA  477

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             EQGVE SIWQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNRQLS LHPIYKLLHP
Sbjct  478   EQGVESSIWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPIYKLLHP  537

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INA  RQ+L NA G++E +  P KY+MEMSAVLYK+W+FP  +LP DLI RGM
Sbjct  538   HFRDTMNINAFARQILINAGGILEATVFPAKYSMEMSAVLYKDWIFPEQALPADLIKRGM  597

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             A+ D +SPHG+RL+IEDYPYAVDGLEIW+AIKTWVT+YC+FYYK D  V  D ELQ+WW 
Sbjct  598   AIEDSNSPHGLRLVIEDYPYAVDGLEIWSAIKTWVTDYCSFYYKTDETVQNDLELQSWWK  657

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ +KGH DKKDEPWWP++ +   LI+TCT +IWI+SALHAAVNFGQY YAGY P RPT+
Sbjct  658   ELREKGHGDKKDEPWWPKMQNVEELIETCTIVIWIASALHAAVNFGQYPYAGYLPNRPTI  717

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SRKFMPE G+ +YEEL++NP+KA L+TITA  QTLLG+SLIEILSRH+SDE+YLGQR+ P
Sbjct  718   SRKFMPEKGTPEYEELESNPEKAFLRTITAQLQTLLGVSLIEILSRHSSDEVYLGQRDSP  777

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT DKE LEAFE+FGKKL  IE+ I+K NGD +LKNR GPV VPYTLL+PTGEEGLSGK
Sbjct  778   EWTTDKEPLEAFEKFGKKLAEIEDGIIKRNGDLRLKNRVGPVVVPYTLLYPTGEEGLSGK  837

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  838   GIPNSVSI  845



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score =  1052 bits (2720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/856 (63%), Positives = 641/856 (75%), Gaps = 24/856 (3%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
             H +  KKIKG VVL K N     D GA I+D++ +F G+ VS QLISA + DP     GK
Sbjct  28    HNNTKKKIKGTVVLRKTN-----DFGALILDRVHEFFGRGVSLQLISAVHGDPDNGNRGK  82

Query  2618  RSKPAFLE-DWGKLTS-LVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED  2445
               K   LE     +TS L A E+A+++TF+W E++G PGA I++N+  ++FYLKT+TLED
Sbjct  83    LGKAVHLERSITTITSVLSAVEAAFNITFDWDEAMGFPGAFIIRNHRHSQFYLKTVTLED  142

Query  2444  -GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGE  2268
               G   + F+C SWVYPA +YNYDR+FFSN+ +LP  TP PLR +RE EL  LRG+G+G 
Sbjct  143   IPGHGQLLFICNSWVYPAHRYNYDRIFFSNKTFLPCNTPEPLRYYREQELIGLRGNGSGM  202

Query  2267  RKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
              KEWDRVYDY YYNDLG PD G    RP+LGG+  YPYPRRGRT R  T+ DP  ESRLP
Sbjct  203   LKEWDRVYDYAYYNDLGMPDKGPEYARPVLGGSKTYPYPRRGRTDRPPTEADPNIESRLP  262

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
             LL +  IYVPRDE+F  +K SDFL  ALKS+GQV+   I + FD T NEFD+F D+ +LY
Sbjct  263   LLGL-NIYVPRDERFSPVKMSDFLACALKSVGQVLPAEIVALFDKTPNEFDTFQDVLNLY  321

Query  1913  EGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             E G  L    LL  I++    EI KE++RSDGE LFKFP P VI   K+AWR DEEFARE
Sbjct  322   ERGVKLPNRALLNKIREYIPCEILKELVRSDGERLFKFPMPDVIKEDKSAWRKDEEFARE  381

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAGVNPV I  LQ FPP S LDP +YG+ TST+TRE I   ++GLTV++AI +N++FIL
Sbjct  382   MLAGVNPVVIRGLQEFPPASKLDPIIYGNQTSTVTREQIEKNMNGLTVDKAIKNNKLFIL  441

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD +M Y RRIN  T  K YA+RTLL LQ DGTL+P+AIELSLPHP GD+ G  S V+
Sbjct  442   DHHDALMPYLRRINT-TSTKTYASRTLLLLQDDGTLKPLAIELSLPHPQGDQHGATSQVF  500

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TPAE G+EGS+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNRQLS LHPIYKL
Sbjct  501   TPAEHGIEGSVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPIYKL  560

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRDTM+INAL RQ+L NA GV+E +  P KYAMEMS+ +YKNW F    LP++L+ 
Sbjct  561   LHPHFRDTMYINALARQILINAGGVLEKTVFPAKYAMEMSSFVYKNWNFTEQGLPSELLK  620

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D   P+G+RLLIEDYPYAVDGLEIW+AI+TWV EYC+FYY  D  V  D+ELQ 
Sbjct  621   RGVAVRDSRQPYGLRLLIEDYPYAVDGLEIWSAIETWVREYCSFYYSTDESVQGDSELQL  680

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+  +GH DKKDE WWP +  R  LI TCT IIW++SALHAAVNFGQY YAGY P R
Sbjct  681   WWIELRNEGHGDKKDEAWWPEMQGRAQLIQTCTIIIWVASALHAAVNFGQYPYAGYLPNR  740

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SR+FMPEPG+ +Y EL++NP+ A LKTITA  QTLLG+SLIEILSRHA+DEIYLGQR
Sbjct  741   PTISRRFMPEPGTREYAELESNPESAFLKTITAQFQTLLGVSLIEILSRHATDEIYLGQR  800

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE--  306
             E P+WT D + LEAFERF  +LV IE RI++ N D + KNR GPV VPYTLL+P+  +  
Sbjct  801   ESPDWTSDAQPLEAFERFRMQLVQIEHRIVQRNNDKRWKNRFGPVKVPYTLLYPSTSDSI  860

Query  305   ---GLSGKGIPNSISI  267
                GLSG GIPNS+SI
Sbjct  861   RASGLSGMGIPNSVSI  876



>gb|AGH13205.1| lipoxygenase [Salvia miltiorrhiza]
Length=856

 Score =  1052 bits (2720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/839 (62%), Positives = 638/839 (76%), Gaps = 15/839 (2%)
 Frame = -1

Query  2744  LMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLI-------SAENDDPGKRSKPAFLEDW-  2589
             LMKKN L + +V AS+VD++ +F+G+KV+ QLI       SA     GK  K A+LEDW 
Sbjct  20    LMKKNVLGVNNVAASVVDRVDEFLGRKVALQLIGTAAHPDSAAESCRGKLGKKAYLEDWI  79

Query  2588  GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCF  2412
              K+T + A  + Y+VTFEW + +G PGA  + N H +EFYLKTLTLED  G   V F+C 
Sbjct  80    TKITPMTAA-ATYNVTFEWSKEMGYPGAFTITNFHHSEFYLKTLTLEDVPGHGRVHFICN  138

Query  2411  SWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDY  2232
             SWVY A+ Y  DR+FF+NQ YLPSQTP PLR +RE EL+NLRG GTG+ +EWDRVYDYD 
Sbjct  139   SWVYHAECYKKDRIFFANQTYLPSQTPPPLRGYREEELENLRGTGTGKLEEWDRVYDYDI  198

Query  2231  YNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRD  2058
             YNDLGDPD G    RPILGG+ EYPYPRRGRTGR +  +DP+ ESR+P      IYVPRD
Sbjct  199   YNDLGDPDKGPEHERPILGGSTEYPYPRRGRTGRPLASSDPRTESRIPAYNSLSIYVPRD  258

Query  2057  EKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLL  1884
             E+F HLK SDF+ YALKS+ Q ++P +   FD T +EFDSF+D+  LY+G   +S   +L
Sbjct  259   ERFSHLKMSDFVAYALKSLFQFLVPVLKDLFDKTPDEFDSFEDVLRLYDGATEVSNVTML  318

Query  1883  EHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISR  1704
             E I+++  LE  +E+LRSDGE  + FP P VI   K AWR+DEEF REMLAG+NPV I  
Sbjct  319   EKIRQHIPLETIRELLRSDGEKTYNFPLPHVIKEDKDAWRSDEEFGREMLAGINPVIIQC  378

Query  1703  LQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARR  1524
             LQ FPP S L+P++YG  +S I+ EHI   L+GLTV +AI +N+++ILDHHD +M Y RR
Sbjct  379   LQEFPPTSKLNPELYGRQSSKISEEHIIHNLEGLTVAEAIRNNKLYILDHHDSLMPYLRR  438

Query  1523  INANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIW  1344
             IN  T  K YATRT+LFL++DGTLRPIAIELSLPHP GD +G VS V TPAE GVEG+IW
Sbjct  439   IN-TTAAKTYATRTILFLKEDGTLRPIAIELSLPHPEGDHYGAVSRVCTPAEDGVEGTIW  497

Query  1343  QLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHIN  1164
              +AKAY A +DSG HQLISHWLNTHA IEP IIATNRQLS LHPI+KLL PHFRDTM+IN
Sbjct  498   LMAKAYVAVDDSGYHQLISHWLNTHASIEPFIIATNRQLSVLHPIHKLLQPHFRDTMNIN  557

Query  1163  ALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPH  984
             AL RQ L  A G +E++  PGKY++EMS+++YK+WVFP  +LP DLI RG+A+ D S PH
Sbjct  558   ALARQALICAGGFVEMTVFPGKYSLEMSSMVYKDWVFPEQALPGDLIKRGVAIKDSSCPH  617

Query  983   GVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHED  804
             GVRLLIEDYP+AVDGLEIW AIKTWV +YCN YYK+D MV  D ELQAWWTE+ +KGH D
Sbjct  618   GVRLLIEDYPFAVDGLEIWGAIKTWVQDYCNLYYKSDEMVQEDPELQAWWTEIREKGHGD  677

Query  803   KKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPG  624
             KKDEPWWP + S   LI++CTTIIW++SALHAA+NFGQY Y GY P RP  SR+F+P+ G
Sbjct  678   KKDEPWWPTMQSCEELIESCTTIIWVASALHAALNFGQYPYGGYLPNRPATSRRFIPDIG  737

Query  623   SADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEAL  444
             +  YEE+K NP+KA LKTIT   Q +LGISL+EILSRH+SDEIYLGQR+ PEWT D EA 
Sbjct  738   TPAYEEMKLNPEKAYLKTITPQMQGVLGISLVEILSRHSSDEIYLGQRDSPEWTADTEAR  797

Query  443   EAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNSISI  267
             +AFERFG +L   E++ + +N D + +NR+GPV +PYTLL+P+ E GL+G+GIPNSISI
Sbjct  798   KAFERFGDRLRETEQKFIDLNNDKRWRNRSGPVKMPYTLLYPSSEIGLTGRGIPNSISI  856



>emb|CAC19365.1| lipoxygenase [Arabidopsis thaliana]
Length=854

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/855 (61%), Positives = 654/855 (76%), Gaps = 24/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP     G+  K A 
Sbjct  2     KIEGEVVVMKKNLLDFKDVMASLLDRVNELLGRRVSLHLISSHQPDPANEKRGRLGKAAH  61

Query  2600  LEDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE-----DG  2442
             LE W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL      +G
Sbjct  62    LEKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPDGEG  121

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ER  2265
             GA  + F+C SW+YP  +Y  DRVFFSN+AYLPS+TP  ++  RE ELKNLRG+  G E 
Sbjct  122   GATAIHFICNSWIYPNHRYRSDRVFFSNKAYLPSETPELIKELREEELKNLRGNEKGGEF  181

Query  2264  KEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLG PD G    RP+LGG+PE PYPRRG+TGRK TK+DPK ESRL L
Sbjct  182   KEWDRVYDYAYYNDLGAPDKGPDSVRPVLGGSPELPYPRRGKTGRKSTKSDPKSESRLAL  241

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L +  IYVPRDE+F H+K SDFL YALKS+ QV++P IAS  D T NEFDSF+D+  LY+
Sbjct  242   LNL-NIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASVCDKTINEFDSFEDVFHLYD  300

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             G   L+ G  +  ++     E+ +E++R+DGE   K+P P ++  S++AWRTDEEFAREM
Sbjct  301   GSIKLANGHTISKLRDVIPWEMFRELVRNDGERFLKYPLPDILKESRSAWRTDEEFAREM  360

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++GL V++A+  N+++ILD
Sbjct  361   LAGLNPVVISRLQEFPPKSCLDSAKYGNQHSSIRTEHIESNMNGLNVQEALEQNKLYILD  420

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y  RIN+ T+ K YATRTLL LQ DGTL+P+AIELSLPH  G+ +G VS V+T
Sbjct  421   HHDALMPYLTRINS-TNTKTYATRTLLLLQADGTLKPLAIELSLPHAQGESYGSVSKVFT  479

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE+GVEGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPI+KLL
Sbjct  480   PAEKGVEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIHKLL  539

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL R +L N+DGV+E +  P +YAMEMS+ +YKNWVF   +LP DL+ R
Sbjct  540   HPHFRDTMNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKNWVFTEQALPKDLLKR  599

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D +S +GV+LLIEDYP+AVDGLEIW+AIKTWVTEYC FYY ND  V TDTE+Q+W
Sbjct  600   GVAVEDPNSDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCTFYYNNDKTVQTDTEIQSW  659

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+  KGH DK+ E WWP + +R  LI+TCT IIWI+SALHAAVNFGQY YAG+ P RP
Sbjct  660   WTELRTKGHGDKRHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLPNRP  719

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +Y EL+ + D A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+
Sbjct  720   TVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRD  779

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              P WT D E LEAF+RFGK+L  IE  I++ N D + KNRTGPVN+PYTLL+P     T 
Sbjct  780   SPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTDYTR  839

Query  311   EEGLSGKGIPNSISI  267
             E G++GKGIPNS+SI
Sbjct  840   EGGITGKGIPNSVSI  854



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/856 (62%), Positives = 653/856 (76%), Gaps = 21/856 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             D  K++KGRVVLMKK+ LD  D+ A+++D+I +F+G+ VS QLISA   DP     GK  
Sbjct  5     DHKKEVKGRVVLMKKSLLDFHDIKANLLDRIHEFLGKGVSLQLISATTPDPEKGLRGKHG  64

Query  2612  KPAFLEDW-GKLTSLV-AGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
             K A+LE W   ++SL  A E+ + VTF+W  E +GVPGA I+ NNH ++FYLKT+T+ED 
Sbjct  65    KVAYLERWISSISSLTTATETEFSVTFDWDHEKMGVPGAFIITNNHHSQFYLKTVTIEDI  124

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G A + FVC SWVYPA +Y + RVFF+N+AYLPS+TP  LR  RE EL  LRG G G+ 
Sbjct  125   PGHAPITFVCNSWVYPAHRYTHQRVFFTNKAYLPSETPESLRKLREEELVALRGKGVGKL  184

Query  2264  KEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
              EWDRVYDY  YNDLG PD+G    RP++GG+  +PYPRRGRT R  TKTDPK ESRL L
Sbjct  185   NEWDRVYDYACYNDLGTPDDGIDYARPVIGGSLNFPYPRRGRTSRPHTKTDPKTESRLHL  244

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L +  IYVPRDE+FGH+K SDFL YALKS+ QV++P + S  D T NEFD+F D+  +YE
Sbjct  245   LNL-NIYVPRDEQFGHVKFSDFLAYALKSVAQVLLPELRSLCDKTINEFDTFQDVLDIYE  303

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             G   L  G LL  I++    EI +E++R+DGE   KFP P +I AS+TAWRTDEEF REM
Sbjct  304   GSFKLPTGPLLTKIRELIPYEILRELVRNDGEKFLKFPVPDIIKASQTAWRTDEEFGREM  363

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I RLQ FPP S LDP +YGD  S+I  +HI + LDGLT+++A+  ++++ILD
Sbjct  364   LAGVNPVIIRRLQEFPPLSKLDPNLYGDQNSSIQAKHIENSLDGLTIDEALQRDKLYILD  423

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y  RIN+ T+ K YATRT+LFLQ DGTL+P+AIELSLPHP G++ G VS V+T
Sbjct  424   HHDALMPYLSRINS-TNTKTYATRTVLFLQDDGTLKPLAIELSLPHPQGEQHGAVSKVFT  482

Query  1376  PAEQG-VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
              + Q  V  ++WQLAKAYAA NDSG HQL+SHWL THAVIEP IIAT+RQLSFLHPI+KL
Sbjct  483   SSSQEEVAATVWQLAKAYAAVNDSGYHQLVSHWLCTHAVIEPFIIATHRQLSFLHPIHKL  542

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             L PHF+DTMHINAL R  L NA GV+E +  PGKYA+EMSAV+YKNWVF   +LP DL+ 
Sbjct  543   LKPHFKDTMHINALARHTLINAGGVLEKTVFPGKYALEMSAVVYKNWVFTEQALPADLLK  602

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RGMAV D ++PHG++L+IEDYP+AVDGLEIW AI+TWV+EYCN+YY +D MV  D ELQ 
Sbjct  603   RGMAVADSNNPHGLKLMIEDYPFAVDGLEIWEAIETWVSEYCNYYYTSDDMVENDNELQC  662

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW EV  +GH D KD+ WWP++ +R  LI +CT IIW++SA HAAVNFGQY YAGY P R
Sbjct  663   WWKEVRTEGHGDLKDKSWWPQMKTRVELIQSCTIIIWVASAFHAAVNFGQYPYAGYLPNR  722

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PTVSR+FMPEPG+ +YEELKT+P+ A LKTITA  QTLLG+SLIE+LSRH+++EIYLGQR
Sbjct  723   PTVSRRFMPEPGTPEYEELKTDPELAFLKTITAQFQTLLGVSLIEVLSRHSTEEIYLGQR  782

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----T  315
             E+P+WT D E L AFERF +KL+ IE+ I+K N D  LKNR GPV +PYTLLFP     +
Sbjct  783   ENPDWTLDAEPLAAFERFSQKLLKIEDNIMKRNKDPSLKNRNGPVKLPYTLLFPNTSDYS  842

Query  314   GEEGLSGKGIPNSISI  267
              E GL+GKGIPNSISI
Sbjct  843   REGGLTGKGIPNSISI  858



>ref|NP_188879.2| lipoxygenase 5 [Arabidopsis thaliana]
 sp|Q9LUW0.2|LOX5_ARATH RecName: Full=Linoleate 9S-lipoxygenase 5, chloroplastic; AltName: 
Full=Lipoxygenase 5; Short=AtLOX5 [Arabidopsis thaliana]
 gb|AEE76630.1| lipoxygenase 5 [Arabidopsis thaliana]
Length=886

 Score =  1051 bits (2717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/855 (61%), Positives = 654/855 (76%), Gaps = 24/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP     G+  K A 
Sbjct  34    KIEGEVVVMKKNLLDFKDVMASLLDRVNELLGRRVSLHLISSHQPDPANEKRGRLGKAAH  93

Query  2600  LEDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE-----DG  2442
             LE W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL      +G
Sbjct  94    LEKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPDGEG  153

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ER  2265
             GA  + F+C SW+YP  +Y  DRVFFSN+AYLPS+TP  ++  RE ELKNLRG+  G E 
Sbjct  154   GATAIHFICNSWIYPNHRYRSDRVFFSNKAYLPSETPELIKELREEELKNLRGNEKGGEF  213

Query  2264  KEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLG PD G    RP+LGG+PE PYPRRG+TGRK TK+DPK ESRL L
Sbjct  214   KEWDRVYDYAYYNDLGAPDKGPDSVRPVLGGSPELPYPRRGKTGRKSTKSDPKSESRLAL  273

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L +  IYVPRDE+F H+K SDFL YALKS+ QV++P IAS  D T NEFDSF+D+  LY+
Sbjct  274   LNL-NIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASVCDKTINEFDSFEDVFHLYD  332

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             G   L+ G  +  ++     E+ +E++R+DGE   K+P P ++  S++AWRTDEEFAREM
Sbjct  333   GSIKLANGHTISKLRDVIPWEMFRELVRNDGERFLKYPLPDILKESRSAWRTDEEFAREM  392

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++GL V++A+  N+++ILD
Sbjct  393   LAGLNPVVISRLQEFPPKSCLDSAKYGNQHSSIRTEHIESNMNGLNVQEALEQNKLYILD  452

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y  RIN+ T+ K YATRTLL LQ DGTL+P+AIELSLPH  G+ +G VS V+T
Sbjct  453   HHDALMPYLTRINS-TNTKTYATRTLLLLQADGTLKPLAIELSLPHAQGESYGSVSKVFT  511

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE+GVEGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPI+KLL
Sbjct  512   PAEKGVEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIHKLL  571

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL R +L N+DGV+E +  P +YAMEMS+ +YKNWVF   +LP DL+ R
Sbjct  572   HPHFRDTMNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKNWVFTEQALPKDLLKR  631

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D +S +GV+LLIEDYP+AVDGLEIW+AIKTWVTEYC FYY ND  V TDTE+Q+W
Sbjct  632   GVAVEDPNSDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCTFYYNNDKTVQTDTEIQSW  691

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+  KGH DK+ E WWP + +R  LI+TCT IIWI+SALHAAVNFGQY YAG+ P RP
Sbjct  692   WTELRTKGHGDKRHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLPNRP  751

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +Y EL+ + D A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+
Sbjct  752   TVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRD  811

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              P WT D E LEAF+RFGK+L  IE  I++ N D + KNRTGPVN+PYTLL+P     T 
Sbjct  812   SPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTDYTR  871

Query  311   EEGLSGKGIPNSISI  267
             E G++GKGIPNS+SI
Sbjct  872   EGGITGKGIPNSVSI  886



>ref|XP_006472029.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Citrus sinensis]
Length=808

 Score =  1050 bits (2716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/801 (65%), Positives = 631/801 (79%), Gaps = 10/801 (1%)
 Frame = -1

Query  2651  LISAEND-DPGKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHAN  2478
             +I+ EN    GK  K A +E W  K T L AGESA++VTFEW E +GVPGA +++NNH +
Sbjct  12    VITQENGLQAGKIGKLAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHS  71

Query  2477  EFYLKTLTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAE  2301
             EFYLKTLTLED  G   V FVC SWVYPA  YN DR+FF+N+ YLP+QTP PLR +RE E
Sbjct  72    EFYLKTLTLEDVPGEGRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQE  131

Query  2300  LKNLRGDGTGERKEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmt  2127
             L NLRGDGT E +E DRVYDY YYNDLGDP  GK   RP+LGG+ +YPYPRRGRTGRK+ 
Sbjct  132   LVNLRGDGTTELQEHDRVYDYAYYNDLGDPKKGKKFERPVLGGSADYPYPRRGRTGRKLA  191

Query  2126  kTDPKYESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNE  1947
             + D K ESRL ++    IYVPRDE+FGHLK SDFL +ALKSI QV+ P + S  D++ NE
Sbjct  192   E-DSKSESRLSIVYSLNIYVPRDERFGHLKMSDFLAFALKSIAQVIKPALES-LDSSPNE  249

Query  1946  FDSFDDMNSLYEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTA  1770
             FDSFDD+  LYEGG+     LL+ I+K+   E+ KE+ R+DG+ L KFP PQVI   ++A
Sbjct  250   FDSFDDILKLYEGGIDLPNNLLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIKEDESA  308

Query  1769  WRTDEEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQ  1590
             WRTDEEF REMLAG+NPV I  L+ FPP S L+P++YG+  STIT+  I + LDGLTV++
Sbjct  309   WRTDEEFTREMLAGLNPVIICCLKEFPPTSKLNPELYGNQRSTITQNDIENNLDGLTVDE  368

Query  1589  AIWSNRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLG  1410
             AI  N++FILDHHD +M Y RRIN  T  K YA+RT+LFL+ DGTL+P+AIELSLPHP G
Sbjct  369   AIEKNKLFILDHHDSLMTYLRRINT-TSTKTYASRTILFLKADGTLKPVAIELSLPHPDG  427

Query  1409  DKFGCVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQ  1230
             D++G VS VYTP+E GV+GSIWQLAKAY A NDSG HQLISHWLNTHA IEP +IATNRQ
Sbjct  428   DQYGAVSKVYTPSEDGVKGSIWQLAKAYVAVNDSGHHQLISHWLNTHAAIEPFVIATNRQ  487

Query  1229  LSFLHPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFP  1050
             LS LHPIYKLLHPHFRDTM+INA  RQ+L NA GV+E++  PGKYAME+S+ LYK+W FP
Sbjct  488   LSVLHPIYKLLHPHFRDTMNINAFARQILINAGGVLEITVFPGKYAMELSSALYKSWSFP  547

Query  1049  NHSLPNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDI  870
               +LP DL  RG+AV D +SPHG+RLLIEDYPYAVDGLEIW +IK WV +YC FYYKND 
Sbjct  548   EQALPEDLKKRGVAVEDPNSPHGLRLLIEDYPYAVDGLEIWASIKKWVQDYCYFYYKNDD  607

Query  869   MVWTDTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQ  690
             MV  D+ELQ+WW E+ ++GH DKKDEPWWP++ +R  LID+CT IIW++SALHAA+NFGQ
Sbjct  608   MVKEDSELQSWWKELREEGHGDKKDEPWWPKMQNREELIDSCTIIIWVASALHAAINFGQ  667

Query  689   YAYAGYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRH  510
             Y YAGY P RPT+SR+FMPE G+ +Y+EL++NPDK  LKTITA  QT+LGISLIEILSRH
Sbjct  668   YPYAGYLPNRPTISRRFMPEEGTPEYDELESNPDKVFLKTITAQLQTILGISLIEILSRH  727

Query  509   ASDEIYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYT  330
             ++DE+YLGQR+ PEWT D+  L+AF+ FGKKL  +EE+I+  N +  LKNR GPV +PYT
Sbjct  728   STDEVYLGQRDTPEWTSDEAPLQAFDEFGKKLAEVEEKIISRNHNKNLKNRVGPVKMPYT  787

Query  329   LLFPTGEEGLSGKGIPNSISI  267
             LL PT E GL+GKGIPNS+SI
Sbjct  788   LLVPTSEGGLTGKGIPNSVSI  808



>gb|AGI16415.1| lipoxygenase [Malus domestica]
Length=868

 Score =  1050 bits (2716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/851 (61%), Positives = 640/851 (75%), Gaps = 13/851 (2%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
             H +E KKIKGRVVLMKK  LD+ D+ ASI+D++ + +G+ VS +LIS+ N DP     GK
Sbjct  19    HKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGK  78

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE+W   +  L AGE+A+DVTF+W + +GVPGA +V+N H +EFYLKTLTLED 
Sbjct  79    VGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDV  138

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--G  2271
              G   V FVC SWVYPADKY  DRVFFSN+ YL S TP PL+ FRE EL NLRGD    G
Sbjct  139   PGEGRVHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERG  198

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRG+TGR  TKTDP  ESRL
Sbjct  199   ELQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRL  258

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
              L+ +  +YVPRDE+FG +K SD L Y LKSI QV+ P I       ++EF+S +++  L
Sbjct  259   KLIQILNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKL  318

Query  1916  YEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             YEGGL     +L++I  +T  EI KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  319   YEGGLELPDGILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  378

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             +LAGVNPV I RLQ FPP S LD +VYGD TS IT+EHI   L+GLT+++AI +N++FIL
Sbjct  379   LLAGVNPVTIRRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFIL  438

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             +HHD  M Y RRIN  T  K YA+RTLLFL  DGTL+PIAIELSLPHP GD+FGC+S VY
Sbjct  439   NHHDAWMPYLRRINT-TSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGDQFGCISKVY  497

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQ AK YA  NDSG HQL SHWL  HAV EP +IA NRQLS LHPI+KL
Sbjct  498   TPSSQGVESSIWQFAKGYALVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPIHKL  557

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFR TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI 
Sbjct  558   LHPHFRGTMNANASARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPADLIK  617

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D S+ HGVRLLIEDYPYA DGLE+WTAIKTWV +YC+FYYKND MV  D+ELQ+
Sbjct  618   RGVAVEDSSASHGVRLLIEDYPYAADGLELWTAIKTWVKDYCSFYYKNDQMVQNDSELQS  677

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ + GH DKK+EPWWP++ +   LI++CTTII+I+SA HAA+N+GQY+  G+ P R
Sbjct  678   WWKELREVGHSDKKEEPWWPKMQTCDELIESCTTIIYIASAHHAAINYGQYSTGGFVPNR  737

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SR+FMPE G+ +YEEL+TNPDKA LKT      TLLG++ +EILSRH +DE+YLGQR
Sbjct  738   PTLSRRFMPEEGTPEYEELRTNPDKAFLKTFAPQLPTLLGMATVEILSRHPTDELYLGQR  797

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL
Sbjct  798   DTAEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGL  857

Query  299   SGKGIPNSISI  267
             + KG+P SI+I
Sbjct  858   TNKGVPTSINI  868



>gb|AGI16414.1| lipoxygenase [Malus domestica]
Length=868

 Score =  1050 bits (2715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/851 (61%), Positives = 640/851 (75%), Gaps = 13/851 (2%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
             H +E KKIKGRVVLMKK  LD+ D+ ASI+D++ + +G+ VS +LIS+ N DP     GK
Sbjct  19    HKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGK  78

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE+W   +  L AGE+A+DVTF+W + +GVPGA +V+N H +EFYLKTLTLED 
Sbjct  79    VGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDV  138

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--G  2271
              G   V FVC SWVYPADKY  DRVFFSN+ YL S TP PL+ FRE EL NLRGD    G
Sbjct  139   PGEGRVHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERG  198

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRG+TGR  TKTDP  ESRL
Sbjct  199   ELQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRL  258

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
              L+ +  +YVPRDE+FG +K SD L Y LKSI QV+ P I       ++EF+S +++  L
Sbjct  259   KLIQILNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKL  318

Query  1916  YEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             YEGGL     +L++I  +T  EI KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  319   YEGGLELPDGILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  378

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             +LAGVNPV I RLQ FPP S LD +VYGD TS IT+EHI   L+GLT+++AI +N++FIL
Sbjct  379   LLAGVNPVTIRRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFIL  438

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             +HHD  M Y RRIN  T  K YA+RTLLFL  DGTL+PIAIELSLPHP GD+FGC+S VY
Sbjct  439   NHHDAWMPYLRRIN-RTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGDQFGCISKVY  497

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQ AK YA  NDSG HQL SHWL  HAV EP +IA NRQLS LHPI+KL
Sbjct  498   TPSSQGVESSIWQFAKGYALVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPIHKL  557

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFR TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI 
Sbjct  558   LHPHFRGTMNANASARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPADLIK  617

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D S+ HGVRLLIEDYPYA DGLE+WTAIKTWV +YC+FYYKND MV  D+ELQ+
Sbjct  618   RGVAVEDSSASHGVRLLIEDYPYAADGLELWTAIKTWVKDYCSFYYKNDQMVQNDSELQS  677

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ + GH DKK+EPWWP++ +   LI++CTTII+I+SA HAA+N+GQY+  G+ P R
Sbjct  678   WWKELREVGHSDKKEEPWWPKMQTCDELIESCTTIIYIASAHHAAINYGQYSTGGFVPNR  737

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SR+FMPE G+ +YEEL+TNPDKA LKT      TLLG++ +EILSRH +DE+YLGQR
Sbjct  738   PTLSRRFMPEEGTPEYEELRTNPDKAFLKTFAPQLPTLLGMATVEILSRHPTDELYLGQR  797

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL
Sbjct  798   DTAEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGL  857

Query  299   SGKGIPNSISI  267
             + KG+P SI+I
Sbjct  858   TNKGVPTSINI  868



>ref|NP_001281022.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGI16411.1| lipoxygenase [Malus domestica]
 gb|AGI16412.1| lipoxygenase [Malus domestica]
 gb|AGK82792.1| lipoxygenase [Malus domestica]
Length=868

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/851 (61%), Positives = 639/851 (75%), Gaps = 13/851 (2%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
             H +E KKIKGRVVLMKK  LD+ D+ ASI+D++ + +G+ VS +LIS+ N DP     GK
Sbjct  19    HKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGK  78

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE+W   +  L AGE+A+DVTF+W + +GVPGA +V+N H +EFYLKTLTLED 
Sbjct  79    VGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDV  138

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--G  2271
              G   V FVC SWVYPADKY  DRVFFSN+ YL S TP PL+ FRE EL NLRGD    G
Sbjct  139   PGEGRVHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERG  198

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRG+TGR  TKTDP  ESRL
Sbjct  199   ELQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRL  258

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
              L+ +  +YVPRDE+FG +K SD L Y LKSI QV+ P I       ++EF+S +++  L
Sbjct  259   KLIQILNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKL  318

Query  1916  YEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             YEGGL     +L++I  +T  EI KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  319   YEGGLELPDGILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  378

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             +LAGVNPV I RLQ FPP S LD +VYGD TS IT+EHI   L+GLT+++AI +N++FIL
Sbjct  379   LLAGVNPVTIRRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFIL  438

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             +HHD  M Y RRIN  T  K YA+RTLLFL  DGTL+PIAIELSLPHP GD+FGC+S VY
Sbjct  439   NHHDAWMPYLRRINT-TSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGDQFGCISKVY  497

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQ AK YA  NDSG HQL SHWL  HAV EP +IA NRQLS LHPI+KL
Sbjct  498   TPSSQGVESSIWQFAKGYALVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPIHKL  557

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFR TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI 
Sbjct  558   LHPHFRGTMNANASARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPADLIK  617

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D S+ HGVRLLIEDYPYA DGLE+WTAIKTWV +YC+FYYKND MV  D+ELQ+
Sbjct  618   RGVAVEDSSASHGVRLLIEDYPYAADGLELWTAIKTWVKDYCSFYYKNDQMVQNDSELQS  677

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+   GH DKK+EPWWP++ +   LI++CTTII+I+SA HAA+N+GQY+  G+ P R
Sbjct  678   WWKELRGVGHSDKKEEPWWPKMQTCDELIESCTTIIYIASAHHAAINYGQYSIGGFVPNR  737

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SR+FMPE G+ +YEEL+TNPDKA LKT      TLLG++ +EILSRH +DE+YLGQR
Sbjct  738   PTLSRRFMPEEGTPEYEELRTNPDKAFLKTFAPQLPTLLGMATVEILSRHPTDELYLGQR  797

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL
Sbjct  798   DTAEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGL  857

Query  299   SGKGIPNSISI  267
             + KG+P SI+I
Sbjct  858   TNKGVPTSINI  868



>ref|XP_003556040.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006606050.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Glycine max]
Length=858

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/854 (61%), Positives = 647/854 (76%), Gaps = 19/854 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGK---RSK  2610
              +  K++KGRVVLMKK  LD  D+ A+++D++ + +G+ VS QLISA   DP K   R K
Sbjct  8     VERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPAKGLLRGK  67

Query  2609  PAFLEDW--GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED--G  2442
              A LE W     +     ++ + VTFEW ES+GVPGA I++NNH ++FYLKTLT+ED  G
Sbjct  68    VANLERWVSTITSLTSTTDTEFSVTFEWDESMGVPGAFIIRNNHHSQFYLKTLTIEDIPG  127

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
                 V FVC SWVYPA +Y +DRVFF+N+AYLP  TP PLR FRE ELK L G G G+  
Sbjct  128   HDGPVNFVCNSWVYPAHRYAHDRVFFANKAYLPCHTPEPLRKFREQELKTLCGKGFGKLN  187

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLG PD+G    RP+LGG+ ++PYPRRGRT R   KTDPK ESRL LL
Sbjct  188   EWDRVYDYAYYNDLGLPDDGPDYARPVLGGS-QFPYPRRGRTSRPHCKTDPKTESRLHLL  246

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
              +  +YVPRDE+FGH+K SDFL Y+LKS+ QV++P I S  D T NEFD+F D+  +YEG
Sbjct  247   NL-NVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFQDVLDIYEG  305

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
                L  G L   ++K    E+ +E++R+DGE   KFP P VI  SKTAWRTDEEFAREML
Sbjct  306   SIKLPSGPLTSKLRKLVPYELLRELIRNDGERFLKFPVPDVIKVSKTAWRTDEEFAREML  365

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LDP VYGD TS+I   HI + LDGLT+++AI + R+FILDH
Sbjct  366   AGVNPVIIRRLQEFPPASKLDPSVYGDQTSSIRATHIENSLDGLTIDEAIQNMRLFILDH  425

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y  RIN+ T+ K YA+RTLLFLQ DGTL+P+AIELSLPHP G++ G VS V+TP
Sbjct  426   HDSLMPYISRINS-TNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGEQHGAVSKVFTP  484

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A++GV  S+WQLAKAYAA NDSG HQL+SHWL THAVIEP IIATNRQLS LHPI+KLL 
Sbjct  485   AQEGVSASVWQLAKAYAAVNDSGYHQLVSHWLYTHAVIEPFIIATNRQLSILHPIHKLLK  544

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTMHINAL R  L NA GV+E++  PGK+A+EMS+V+YK+WVF   +LP DL+ RG
Sbjct  545   PHFRDTMHINALARHTLINAGGVLEITVFPGKFALEMSSVIYKSWVFTEQALPADLLKRG  604

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             MA+ D SS HG+RL+IEDYP+AVDG+EIW AI+TWVTEYCNFYY ++ MV  D+ELQ+WW
Sbjct  605   MAIPDSSSRHGLRLVIEDYPFAVDGIEIWDAIETWVTEYCNFYYTSNDMVEEDSELQSWW  664

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              EV  +GH D KD  WWP + ++  LI +CT IIW++SA HAAVNFGQY +AGY P RPT
Sbjct  665   KEVRNEGHGDLKDRHWWPDMKTKEELIHSCTIIIWLASAFHAAVNFGQYPFAGYLPNRPT  724

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPE G+ +YEELK++P+ A LKTITA  QTL+G+SLIE+LSRH+++E+YLGQ E+
Sbjct  725   VSRRFMPEQGTPEYEELKSDPELAFLKTITAQFQTLVGVSLIEVLSRHSTEEVYLGQCEN  784

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGE  309
             PEWT D E L AFERF +KL+ IE  I++ N D + KNR GPV +PYTLL+P     + E
Sbjct  785   PEWTLDAEPLAAFERFRQKLLEIENNIMERNKDKRFKNRNGPVKMPYTLLYPNTSDYSRE  844

Query  308   EGLSGKGIPNSISI  267
              GL+GKGIPNSISI
Sbjct  845   GGLTGKGIPNSISI  858



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =  1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/843 (62%), Positives = 636/843 (75%), Gaps = 13/843 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             K+KG VVLMKKN LD  D  AS +D++ +F+G +V+ QLIS++  DP     GK  K A 
Sbjct  17    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNRVTLQLISSDLSDPENGAKGKLGKAAH  76

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LEDW   +TSL AGESA+ VTF++ +  G PGA +++N+H +EFYLK+LTLED  G   V
Sbjct  77    LEDWITTITSLTAGESAFKVTFDYDKDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              +VC SWVYPA  Y  DRVFFSN+ YLP +TP  L  +RE EL +LRG G GE KEWDRV
Sbjct  137   HYVCNSWVYPAKNYTKDRVFFSNKTYLPHETPEGLLKYREEELLSLRGTGEGELKEWDRV  196

Query  2246  YDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYV  2067
             YDY YYNDLG P    PRP+LGG  EYPYPRRGRTGRK T+ DP+ ESRLP+    +IYV
Sbjct  197   YDYAYYNDLGVPPKN-PRPVLGGTQEYPYPRRGRTGRKPTEEDPQTESRLPITSSLDIYV  255

Query  2066  PRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRG  1893
             PRDE+FGHLK SDFL YALK+I Q++ P + + FD T  EFDSF+D+  +YE G  L   
Sbjct  256   PRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDETPKEFDSFEDVLKIYEEGIDLPNQ  315

Query  1892  LLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
              +++ I KN  LE+ KE+ R+DG+   K+P PQVI   KTAWRTDEEFAREMLAG+NPV 
Sbjct  316   AMIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVV  375

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I  LQ FPP+S LD + YG+  STIT+ HI   LDGLTVE+A+   R+FILDHHD +M Y
Sbjct  376   IQLLQEFPPKSKLDSETYGNQNSTITKSHIEQSLDGLTVEEALEKERLFILDHHDTLMPY  435

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEG  1353
               RIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPHP GDKFG VS VYTP E GV+ 
Sbjct  436   LGRINT-TGNKTYASRTLLFLKDDGTLKPLVIELSLPHPDGDKFGAVSEVYTPGE-GVDD  493

Query  1352  SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTM  1173
             S+WQLAKAY   NDSG HQLISHWL THA IEP +IATNRQLS LHP++KLL PH+RDTM
Sbjct  494   SLWQLAKAYVGVNDSGNHQLISHWLQTHASIEPFVIATNRQLSVLHPVFKLLEPHYRDTM  553

Query  1172  HINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVDL  996
             +INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D 
Sbjct  554   NINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGMAVEDP  613

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
              +PHG+RL I+DYPYAVDGLEIW AI++WV +Y +FYYK D  V  DTELQAWW EV ++
Sbjct  614   DAPHGLRLRIKDYPYAVDGLEIWYAIESWVQDYISFYYKTDEDVQIDTELQAWWKEVREE  673

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH DKK EPWWP++ +R  L ++CT IIW++SALHAAVNFGQY  AGY P RPT+SR+FM
Sbjct  674   GHGDKKSEPWWPKMQTREELTESCTIIIWVASALHAAVNFGQYPIAGYLPNRPTISRQFM  733

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             P+  + ++EEL+ NPDK  LKTITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  +
Sbjct  734   PKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAAE  793

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNS  276
             KEALEAFE+FG+K+  IE++I + N D  LKNRTGPV +PYT LFPT E G++G+GIPNS
Sbjct  794   KEALEAFEKFGEKVKEIEKKIDERNEDENLKNRTGPVKMPYTSLFPTSEGGVTGRGIPNS  853

Query  275   ISI  267
             +SI
Sbjct  854   VSI  856



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =  1047 bits (2707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/843 (62%), Positives = 636/843 (75%), Gaps = 13/843 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             K+KG VVLMKKN LD  D  AS +D++ +F+G KV+ +LIS++  DP     GK  K A 
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LEDW   +TSL AGESA+ VTF++ +  G PGA +++N+H +EFYLK+LTLED  G   V
Sbjct  78    LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              ++C SWVYPA +Y  DRVFFSN+ YLP +TP  L  +RE EL +LRG G GE KEWDRV
Sbjct  138   HYICNSWVYPAKRYTKDRVFFSNKTYLPHETPEALLKYREEELVSLRGTGEGELKEWDRV  197

Query  2246  YDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYV  2067
             YDY YYNDLG P    PRP+LGG+ EYPYPRRGRTGRK T  DP+ ESRLP+    +IYV
Sbjct  198   YDYAYYNDLGVPPKN-PRPVLGGSQEYPYPRRGRTGRKPTTEDPETESRLPVTSSLDIYV  256

Query  2066  PRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRG  1893
             PRDE+FGHLK SDFL YALK+I Q++ P + S FD T  EFDSF+D+  +YE G  L   
Sbjct  257   PRDERFGHLKMSDFLAYALKAIAQIIQPALESVFDETPKEFDSFEDVLKIYEEGIDLPNQ  316

Query  1892  LLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
              L++ I KN  LE+ KE+ R+DG+   K+P PQVI   KTAWRTDEEFAREMLAG+NPV 
Sbjct  317   ALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVV  376

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I  L+ FPP+S L+ + YGD  STIT+ HI + LDGLTVE+A+   R+FILDHHD +M Y
Sbjct  377   IQLLKEFPPKSKLERETYGDQNSTITKSHIEESLDGLTVEEALEKERLFILDHHDTLMPY  436

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEG  1353
               RIN  T  K+YA+RTLLFL+ DGTL+P+ IELSLPHP GD FG VS VYTP E GV  
Sbjct  437   VGRINT-TGNKVYASRTLLFLKDDGTLKPLVIELSLPHPDGDSFGAVSEVYTPGE-GVYD  494

Query  1352  SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTM  1173
             S+WQLAKAY   NDSG HQLISHWL THA IEP +IATNRQLS LHP++KLL PH+RDTM
Sbjct  495   SLWQLAKAYVGVNDSGNHQLISHWLQTHASIEPFVIATNRQLSVLHPVFKLLEPHYRDTM  554

Query  1172  HINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVDL  996
             +INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D 
Sbjct  555   NINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGMAVEDP  614

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
              +PHG+RL IEDYPYAVDGLE+W AI++WV +Y   YYK+D  V  DTELQAWW EV ++
Sbjct  615   EAPHGLRLRIEDYPYAVDGLEVWYAIESWVQDYIPLYYKSDEDVQNDTELQAWWKEVREE  674

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH DKK EPWWP++ +R  LID+CT IIW++SALHAAVNFGQY  AGY P RPT+SR+FM
Sbjct  675   GHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAVNFGQYPIAGYLPNRPTISRQFM  734

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             P+  + ++EEL+ NPDK  LKTITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  +
Sbjct  735   PKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAAE  794

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNS  276
             KEALEAFE+FG K+  IE++I + N D  LKNRTGPV +PYT LFPT E G++G+GIPNS
Sbjct  795   KEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVKMPYTSLFPTSEGGVTGRGIPNS  854

Query  275   ISI  267
             +SI
Sbjct  855   VSI  857



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =  1047 bits (2707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/848 (61%), Positives = 640/848 (75%), Gaps = 13/848 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKRSK  2610
             E +KIKG VVLMKKN LD +D+ AS  D+  +  G KVS QLISA     END+ GK  K
Sbjct  55    EMEKIKGSVVLMKKNLLDFSDLVASAADRFDEIRGNKVSLQLISAVNGDPENDNRGKVGK  114

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             PA+LEDW  K   L A + A+++TFEW  E +G+PGA I+KN+H NEFYL+TLTLED  G
Sbjct  115   PAYLEDWFTKFDPLTAADVAFNITFEWNEEEIGLPGAFIIKNSHHNEFYLRTLTLEDVPG  174

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + F+C SWVYP   Y  DRVFF+NQ YLPS+TP+PLR +RE ELK LRG+GTG+ +E
Sbjct  175   HGRIHFICNSWVYPHQYYKKDRVFFTNQTYLPSKTPSPLRHYREEELKTLRGNGTGKLEE  234

Query  2258  WDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDYD YNDL +P+ G    RPILGG+ +YPYPRRGRTGR   + DP+YESRLPLL 
Sbjct  235   WDRVYDYDLYNDLSEPEKGPKYIRPILGGSTKYPYPRRGRTGRPPAEADPRYESRLPLLK  294

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
                IYVPRDE+F HLK SD L Y LKS+ Q ++P + S  D+  NEF+  +DM  LYE G
Sbjct  295   SLNIYVPRDERFSHLKFSDVLAYGLKSLFQFLLPEVESIIDSAPNEFNKLEDMLDLYEAG  354

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L     LE I+KN   +  KE+LR+DGE  F+FP P VI   K AWRTDEEFAREMLA
Sbjct  355   IKLPDWPFLESIRKNIPSQTLKEILRTDGERAFRFPVPLVIKEDKHAWRTDEEFAREMLA  414

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV I RL+ FPP S L+PK Y +  +T T+E+I   L+GLTV++A+  N++FILD+H
Sbjct  415   GLNPVVIHRLREFPPSSKLNPKSYNNEGNTKTKENIEKNLEGLTVDEALKENKLFILDYH  474

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y R IN  T  K+YATRTLLFL+ DGTLRP+AIELSLP+P+ D  G VS VYTPA
Sbjct  475   DVLMPYLRGIN-KTFTKLYATRTLLFLKSDGTLRPLAIELSLPNPIEDDSGEVSEVYTPA  533

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E G EG+IWQLAKAY A NDSG HQLI HWLNTHA IEP IIATNR LS LHPI+KLLHP
Sbjct  534   EHGAEGTIWQLAKAYVAVNDSGYHQLICHWLNTHASIEPFIIATNRNLSVLHPIHKLLHP  593

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM++NAL RQ L NA G++E +  P KYAMEM+AV Y++W FP  +LP DL+ RGM
Sbjct  594   HFRDTMNVNALARQTLINAGGLLEKTLFPSKYAMEMTAVAYRDWTFPEQALPADLVKRGM  653

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  SPHGVRLL+EDYPYAVDGLEIW+AIKTWV +YC+ YY  D  +  D+ELQ WW 
Sbjct  654   AVEDSKSPHGVRLLVEDYPYAVDGLEIWSAIKTWVEDYCSIYYPTDDKLLEDSELQTWWK  713

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ +KGH DKKDEPWWP + +R  L++TCT IIW++SALHAA+NFGQY Y GY P RP +
Sbjct  714   ELREKGHADKKDEPWWPEMQTRKELVETCTIIIWVASALHAALNFGQYPYGGYLPNRPAM  773

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+F+P+ G+ +Y+EL+++P+KA LKT+T    ++LGISL+EILSRH SDE++LG+R+  
Sbjct  774   SRRFIPKQGTPEYDELESDPEKAFLKTVTPQMLSILGISLVEILSRHTSDEVFLGKRDTA  833

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EWT D+EA++AF +FG+KL  IE+RI++MN D + +NR GP  +PYTLL PT   GL+G+
Sbjct  834   EWTADEEAVKAFGKFGEKLAGIEDRIIRMNSDEEWRNRVGPAKMPYTLLIPTSGVGLTGR  893

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  894   GIPNSVSI  901



>ref|XP_010934565.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Elaeis guineensis]
Length=885

 Score =  1046 bits (2706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/845 (61%), Positives = 646/845 (76%), Gaps = 15/845 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             +KG VVLMKKN LD TD GA+++D + + +GQ VS QL+SA   DP     G   +PA+L
Sbjct  43    VKGTVVLMKKNVLDFTDFGATLLDDVHELLGQGVSLQLVSATVGDPNNGNRGIVGEPAYL  102

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDG-GAAGVQ  2424
             E +   L S+ AGES + VTF+W E+ G+PGAVIVKN H+ +F+LKT+TLE+  G   + 
Sbjct  103   ESYITSLPSIAAGESTFTVTFDWNENHGIPGAVIVKNQHSAQFFLKTVTLENFLGKGRIH  162

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER-KEWDRV  2247
             FVC SWVYP DKY Y+R+FF+N  YLP  TP+PLRP+RE EL++LRG+G  E  +EWDRV
Sbjct  163   FVCDSWVYPVDKYKYNRIFFANNTYLPGDTPSPLRPYREDELRHLRGEGETETLQEWDRV  222

Query  2246  YDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             Y+Y YYNDLG+PD G    RP+LGG+ EYPYPRRGRT R  TKTDP  ESRL L    +I
Sbjct  223   YNYAYYNDLGNPDAGPEMARPVLGGSAEYPYPRRGRTNRPPTKTDPNSESRLIL--GLDI  280

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS--  1899
             YVPRDE+FGH+K SDFL Y++K++ Q + P + +    T+NEFDSF+++  LYEGGL   
Sbjct  281   YVPRDERFGHVKMSDFLIYSIKALIQSLKPILDAILAQTRNEFDSFEEVFRLYEGGLPVP  340

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDG-ENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                LL+ +++    E+ KE+LR++G + L KFP P V    K AW++DEEFAREMLAGVN
Sbjct  341   NVPLLDELRERIPFEMVKEMLRTEGNQRLLKFPLPHVNRVDKYAWQSDEEFAREMLAGVN  400

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             P+ ISRLQVFPP S LDP  YG+ TS+IT  HI   LDGLTV+QA+ SNR+FILDHHD +
Sbjct  401   PLMISRLQVFPPTSKLDPNKYGNQTSSITAAHIQKNLDGLTVDQALESNRLFILDHHDTL  460

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             M Y  RIN+NT  K YATRTLLFL++D TL+P+AIELSLPHP G++ G +S V+TPA++G
Sbjct  461   MPYINRINSNTSNKAYATRTLLFLKEDQTLKPVAIELSLPHPDGEQHGIISRVFTPADKG  520

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             +EGSIWQLAKAY   NDS  H+LISHWLNTHA++EP ++ATNR LS +HPIYKLL PH+R
Sbjct  521   LEGSIWQLAKAYVCVNDSAYHELISHWLNTHAIMEPFVLATNRHLSVVHPIYKLLSPHYR  580

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ L NA G+IE    PGKYAMEMSAV+YK+W F   +LP DL+ RG+AV 
Sbjct  581   DTMNINALARQALINAGGIIESIVFPGKYAMEMSAVIYKSWNFTEQALPADLLKRGVAVE  640

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D +SP+ +RLLI DYPYAVDGL +W+AI+ WV EYC+ YY +D +V TD ELQAWW E+ 
Sbjct  641   DPTSPNKIRLLIRDYPYAVDGLAVWSAIEAWVNEYCSIYYPSDTVVRTDAELQAWWKEIR  700

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKKDEPWWP++ +   LI TCTTIIW++SALH AVNFGQY Y GY P RP +SR+
Sbjct  701   EVGHGDKKDEPWWPKMQTVGELISTCTTIIWVASALHTAVNFGQYPYFGYIPNRPMLSRR  760

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPGSA+YE LKT P+KA ++   +  QT++G+ ++EILS HASDE+YLGQR+ PEWT
Sbjct  761   FMPEPGSAEYEMLKTEPEKAFMRCTMSQVQTIMGVGILEILSSHASDEVYLGQRDTPEWT  820

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
             KD++ LEAF RFG++L  IE +IL MN D  LKNR GPV +PYTLLFPTGE+G++ KGIP
Sbjct  821   KDQKTLEAFHRFGERLKKIEAKILAMNEDPSLKNRKGPVMMPYTLLFPTGEKGITAKGIP  880

Query  281   NSISI  267
             NSISI
Sbjct  881   NSISI  885



>ref|XP_008449553.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=881

 Score =  1046 bits (2706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/848 (62%), Positives = 641/848 (76%), Gaps = 16/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRS---KPAFL  2598
             K+I+G VV+MKK  LD  DV AS++D++ +F G+ V+ +LIS+     G+     K A L
Sbjct  36    KRIRGTVVIMKKCVLDFKDVRASVLDRVHEFFGKGVTIELISSNPPQSGRLGAVGKGANL  95

Query  2597  EDWGKLT--SLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             E W      SL A +    + FEW E +GVPGA +++NNH N+FYLKT+TL D  G   V
Sbjct  96    EQWISTVKPSLTADDIELTIFFEWEERMGVPGAFMIRNNHPNQFYLKTVTLHDVPGYGSV  155

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA +Y YDRVFFSN++YLPS+TP  LR +RE EL NLRG+  GE KEWDRV
Sbjct  156   HFVCNSWVYPAHRYTYDRVFFSNKSYLPSETPESLRKYREEELVNLRGNDKGELKEWDRV  215

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY  YNDLG PD+GK   R  LGG+ E+PYPRRGRTGRK  K DP  E RLPLL + +I
Sbjct  216   YDYACYNDLGMPDSGKKYVRTSLGGSKEFPYPRRGRTGRKPAKADPSCEHRLPLLSL-DI  274

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSRG  1893
             YVPRDE+F +LK SDFL Y++KSI Q ++P I S  D T NEFDSF D+  LYEGG++  
Sbjct  275   YVPRDERFRNLKLSDFLAYSVKSIVQSLLPEIKSLCDKTINEFDSFQDVLDLYEGGMTLP  334

Query  1892  L-LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               +L  +++    ++ +E++RSDG    KFP P VI  +KTAWRTDEEF REMLAGVNPV
Sbjct  335   TEILATLRELVPWQLLRELMRSDGRQFLKFPVPDVIKENKTAWRTDEEFGREMLAGVNPV  394

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I RL  FPP S LDPK YG   S+IT EHIA  L+GLT++QA+  N++FILDHHD +M 
Sbjct  395   IIRRLLEFPPVSKLDPKTYGKQNSSITEEHIAAHLNGLTIDQALEMNKLFILDHHDALMP  454

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y  RIN+ T  K YATRTLL LQ +G L+P+AIELSLPHP GD  G VS V+TPAE GVE
Sbjct  455   YISRINS-TATKTYATRTLLLLQDNGILKPLAIELSLPHPQGDHHGSVSKVFTPAEHGVE  513

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
             GS+WQLAKAY A NDSG HQLISHWLNTHAVIEP II TNRQLS +HPIYKLLHPHFRDT
Sbjct  514   GSVWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFIIGTNRQLSVVHPIYKLLHPHFRDT  573

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDL  996
             M+INA+ RQ+L NA G++E +  PGKYA+EMSAVLYKNWVF + +LP DLI RG+A+ D 
Sbjct  574   MNINAMARQVLINAGGILETTVFPGKYALEMSAVLYKNWVFTDQALPADLIKRGVAIPDP  633

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
             SSPHG++LLIEDYP+AVDGLEIW+AI+ WV +Y   YYK+D MV  DTE+Q+WWTE+   
Sbjct  634   SSPHGLKLLIEDYPFAVDGLEIWSAIEKWVRDYSYLYYKSDEMVQEDTEIQSWWTEIRTV  693

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH D KDEPWWP++ +R  L+ +CT IIWI+SALHAAVNFGQY YAGY P RPTVSR+FM
Sbjct  694   GHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTVSRRFM  753

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             PEPG+ ++ EL+T+P+ A LKTITA  QT+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD
Sbjct  754   PEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLGQRDTPEWTKD  813

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLSGK  291
             +EAL AFERFG +L  IEE+I++MN + K +NR GPV +PYT LFP       EEGL+ +
Sbjct  814   EEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSNYYEEEGLNAR  873

Query  290   GIPNSISI  267
             GIPNSISI
Sbjct  874   GIPNSISI  881



>gb|AHI86055.1| lipoxygenase, partial [Cucumis melo var. makuwa]
Length=880

 Score =  1046 bits (2706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/848 (62%), Positives = 641/848 (76%), Gaps = 16/848 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRS---KPAFL  2598
             K+I+G VV+MKK  LD  DV AS++D++ +F G+ V+ +LIS+     G+     K A L
Sbjct  35    KRIRGTVVIMKKCVLDFKDVRASVLDRVHEFFGKGVTIELISSNPPQSGRLGAVGKGANL  94

Query  2597  EDWGKLT--SLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             E W      SL A +    + FEW E +GVPGA +++NNH N+FYLKT+TL D  G   V
Sbjct  95    EQWISTVKPSLTADDIELTIFFEWEERMGVPGAFMIRNNHPNQFYLKTVTLHDVPGYGSV  154

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA +Y YDRVFFSN++YLPS+TP  LR +RE EL NLRG+  GE KEWDRV
Sbjct  155   HFVCNSWVYPAHRYTYDRVFFSNKSYLPSETPESLRKYREEELVNLRGNDKGELKEWDRV  214

Query  2246  YDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             YDY  YNDLG PD+GK   R  LGG+ E+PYPRRGRTGRK  K DP  E RLPLL + +I
Sbjct  215   YDYACYNDLGMPDSGKKYVRTSLGGSKEFPYPRRGRTGRKPAKADPSCEHRLPLLSL-DI  273

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSRG  1893
             YVPRDE+F +LK SDFL Y++KSI Q ++P I S  D T NEFDSF D+  LYEGG++  
Sbjct  274   YVPRDERFRNLKLSDFLAYSVKSIVQSLLPEIKSLCDKTINEFDSFQDVLDLYEGGMTLP  333

Query  1892  L-LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               +L  +++    ++ +E++RSDG    KFP P VI  +KTAWRTDEEF REMLAGVNPV
Sbjct  334   TEILATLRELVPWQLLRELMRSDGRQFLKFPVPDVIKENKTAWRTDEEFGREMLAGVNPV  393

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I RL  FPP S LDPK YG   S+IT EHIA  L+GLT++QA+  N++FILDHHD +M 
Sbjct  394   IIRRLLEFPPVSKLDPKTYGKQNSSITEEHIAAHLNGLTIDQALEMNKLFILDHHDALMP  453

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y  RIN+ T  K YATRTLL LQ +G L+P+AIELSLPHP GD  G VS V+TPAE GVE
Sbjct  454   YISRINS-TATKTYATRTLLLLQDNGILKPLAIELSLPHPQGDHHGSVSKVFTPAEHGVE  512

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
             GS+WQLAKAY A NDSG HQLISHWLNTHAVIEP II TNRQLS +HPIYKLLHPHFRDT
Sbjct  513   GSVWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFIIGTNRQLSVVHPIYKLLHPHFRDT  572

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDL  996
             M+INA+ RQ+L NA G++E +  PGKYA+EMSAVLYKNWVF + +LP DLI RG+A+ D 
Sbjct  573   MNINAMARQVLINAGGILETTVFPGKYALEMSAVLYKNWVFTDQALPADLIKRGVAIPDP  632

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
             SSPHG++LLIEDYP+AVDGLEIW+AI+ WV +Y   YYK+D MV  DTE+Q+WWTE+   
Sbjct  633   SSPHGLKLLIEDYPFAVDGLEIWSAIEKWVRDYSYLYYKSDEMVQEDTEIQSWWTEIRTV  692

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH D KDEPWWP++ +R  L+ +CT IIWI+SALHAAVNFGQY YAGY P RPTVSR+FM
Sbjct  693   GHGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTVSRRFM  752

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             PEPG+ ++ EL+T+P+ A LKTITA  QT+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD
Sbjct  753   PEPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLGQRDTPEWTKD  812

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLSGK  291
             +EAL AFERFG +L  IEE+I++MN + K +NR GPV +PYT LFP       EEGL+ +
Sbjct  813   EEALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSNYYEEEGLNAR  872

Query  290   GIPNSISI  267
             GIPNSISI
Sbjct  873   GIPNSISI  880



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =  1046 bits (2704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/844 (61%), Positives = 638/844 (76%), Gaps = 11/844 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKRSKPA  2604
             +KIKG+V+L++ N LD  ++ +S++D I +F G KVSFQLIS+EN D      GK  K  
Sbjct  18    QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKKT  77

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +L +W  K+  +  GE+ + ++F W E +G+PGA I++NNH  +F+LK+LTLED    G 
Sbjct  78    YLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVGR  137

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + F C SW+YP+ KY  DR+FF N+AY+P++TP PLR +R+ ELKNLRGDGTGER+EWDR
Sbjct  138   IHFDCNSWIYPSGKYKNDRIFFINKAYIPNETPEPLRKYRQDELKNLRGDGTGERQEWDR  197

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDL DP +G    RP+LGG+ +YPYPRRGRTGR  +K D KYESRL       
Sbjct  198   IYDYDVYNDLEDPSSGSTYIRPVLGGSTQYPYPRRGRTGRSPSKKDKKYESRLSSSLSLN  257

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
              YVPRDE+FGHLK+SDFL Y LKS+ Q + P +   F     EFDSF D+ +LYEGG S 
Sbjct  258   TYVPRDERFGHLKESDFLAYTLKSVAQSIKPALDELFSRNPGEFDSFQDVLNLYEGGFSL  317

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                LLE  ++N    + KE+ R+DGEN  KFP PQVI  +K+ WRTDEEFAREMLAGVNP
Sbjct  318   PKSLLEKFRQNIPAPLLKEIFRTDGENFLKFPLPQVIQDNKSGWRTDEEFAREMLAGVNP  377

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             + I RLQ FPP S LDP VYGD  S I+ EHI + LDGLTV++AI  N+++ILDHHD +M
Sbjct  378   IIIRRLQEFPPSSKLDPNVYGDQNSKISEEHIINSLDGLTVQEAIEQNKLYILDHHDALM  437

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y  RIN+ T  K YATRTLLFL  DGTLRP+ IELSLP    D+ G  S +Y PAE GV
Sbjct  438   PYLNRINS-TSTKTYATRTLLFLNGDGTLRPLVIELSLPQSQKDELGATSKLYFPAEDGV  496

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A ND+G HQ++SHWLNTHAV+EP +IATNRQLS LHPI+KLL PH+RD
Sbjct  497   ESSIWQLAKAYVAVNDAGYHQVVSHWLNTHAVMEPFVIATNRQLSVLHPIHKLLVPHYRD  556

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA  RQ L NADG++E +    KY+ME+S+ +YK+WVF + +LP DLI RGMAV D
Sbjct  557   TMNINAFARQTLVNADGILESTHFQSKYSMELSSYIYKDWVFTDQALPRDLIKRGMAVED  616

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SP+G++LLIEDYP+AVDGLEIW AIKTWV +YC+ YYK+DIMV  D ELQ+WW E+ +
Sbjct  617   SNSPYGLKLLIEDYPFAVDGLEIWFAIKTWVKDYCSSYYKDDIMVHDDVELQSWWKELKE  676

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             KGH D KD+PWWP++ +  +LI+TCT IIWISSALHAAVNFGQY Y GY P RPT+SR+F
Sbjct  677   KGHVDLKDKPWWPKMETLEVLIETCTIIIWISSALHAAVNFGQYPYGGYLPNRPTISRRF  736

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+  Y EL+++P+K  L+TI +  QTLLGISL+EILSRH+SDEIYLG+RE  EW  
Sbjct  737   MPEKGTPQYIELESDPEKGFLRTINSQVQTLLGISLVEILSRHSSDEIYLGKRESLEWIS  796

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D+ ALEAFE+FGK+L  IE  I+K N D K+KNR GP+NVPYT L+PT  EGL+GKGIPN
Sbjct  797   DQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPINVPYTSLYPTSNEGLTGKGIPN  856

Query  278   SISI  267
             SISI
Sbjct  857   SISI  860



>ref|XP_008777614.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Phoenix dactylifera]
Length=885

 Score =  1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/845 (61%), Positives = 643/845 (76%), Gaps = 15/845 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             ++G VVLMKKN LD+TD GA+++D + + +GQ VS QL+SA   DP     G   KPA+L
Sbjct  43    VEGTVVLMKKNVLDITDFGATLLDDVHELLGQGVSLQLVSATVGDPNNGNRGIVGKPAYL  102

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDG-GAAGVQ  2424
             E +   L SL AGES + VTF+W E+ G+PGAVIVKN H+ +F+LKT+TLE+  G   + 
Sbjct  103   ESYITSLPSLAAGESTFSVTFDWNENHGIPGAVIVKNQHSAQFFLKTVTLENFLGKGRIH  162

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER-KEWDRV  2247
             FVC SWVYP DKY YDR+FF+N  YLP  TPAPLRP+RE EL++LRG+   E  +EWDRV
Sbjct  163   FVCNSWVYPVDKYKYDRIFFANSTYLPGDTPAPLRPYREDELRHLRGEDVTETLQEWDRV  222

Query  2246  YDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEI  2073
             Y+Y +YNDLG+PD G    RP+LGG+ EYPYPRRGRT R  TKTDP  ESRL L    +I
Sbjct  223   YNYAHYNDLGNPDAGPEMARPVLGGSAEYPYPRRGRTNRAPTKTDPNSESRLIL--GLDI  280

Query  2072  YVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS--  1899
             YVPRDE+FGH+K SDFL Y++K++ Q + P + +    T+NEFDSF+++  LYEGGL   
Sbjct  281   YVPRDERFGHVKMSDFLTYSIKALIQSLKPILDAILGQTRNEFDSFEEVFRLYEGGLPVP  340

Query  1898  RGLLLEHIQKNTNLEITKEVLRSDG-ENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                LL+ I++    E+ KE+LR++G + L KFP P V    K AW++DEEFAREMLAGVN
Sbjct  341   NVPLLDEIRERIPFEMVKEMLRTEGNQRLLKFPLPHVTQVEKFAWQSDEEFAREMLAGVN  400

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             P+ ISRL VFPP S LDP  YG+ TS+IT  HI   LDGLTV+QA+ SN++FILD HD +
Sbjct  401   PLMISRLHVFPPTSKLDPNKYGNQTSSITAAHIEKNLDGLTVDQALESNKLFILDLHDAL  460

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y  RIN+NT  K YATRTLLFL+ D TL+P+AIELSLPHP G++ G +S V+TPA++G
Sbjct  461   IPYINRINSNTSNKTYATRTLLFLKGDQTLKPVAIELSLPHPDGEQHGIISRVFTPADKG  520

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             +EGSIWQLAKAY   NDSG H+LISHWLNTHA++EP ++ATNR LS +HPIYKLL PH+R
Sbjct  521   IEGSIWQLAKAYVCVNDSGYHELISHWLNTHAIMEPFVLATNRHLSVVHPIYKLLSPHYR  580

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ L NA G+IE    PGKYAMEMSAV+YK+W F   +LP DL+ RG+AV 
Sbjct  581   DTMNINALARQALINAGGIIESIVFPGKYAMEMSAVIYKSWNFSEQALPADLLKRGVAVE  640

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             DL+SP  +RLLI+DYPYAVDGL +W+AI+ WV EYC+ YY  D +V  D ELQAWW E+ 
Sbjct  641   DLTSPDKIRLLIKDYPYAVDGLAVWSAIEAWVNEYCSIYYPGDAVVQADAELQAWWKEIR  700

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
             + GH DKKDEPWWP++ +   L+ TCTTIIW++SALH AVNFGQY Y GY P RP +SR+
Sbjct  701   EVGHGDKKDEPWWPKMQTVGELMSTCTTIIWVASALHTAVNFGQYPYFGYIPNRPMLSRR  760

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPGSA+YE LKT P+KA ++   +  QT++G++++EILS HASDE+YLGQR+ PEWT
Sbjct  761   FMPEPGSAEYEMLKTEPEKAFMRCTMSQVQTIMGVAILEILSTHASDEVYLGQRDAPEWT  820

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIP  282
              D++ALEAF RFG++L  IE RIL MN D  LKNR GPV +PYTLLFPTGE G+S KGIP
Sbjct  821   TDQKALEAFRRFGERLKEIEARILAMNDDPSLKNRKGPVFMPYTLLFPTGERGISAKGIP  880

Query  281   NSISI  267
             NSISI
Sbjct  881   NSISI  885



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score =  1045 bits (2702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/850 (61%), Positives = 645/850 (76%), Gaps = 20/850 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPG---KRSKPAFL  2598
             KK++G VVLM++  LDLT+VGAS++D+  + +G+ VS QLISA++ +PG   K  KPAFL
Sbjct  31    KKVRGTVVLMEEECLDLTNVGASLLDRFHEVIGKGVSLQLISADHAEPGCTGKLGKPAFL  90

Query  2597  EDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQ  2424
             E W   LTS+ AG++ ++VTF+W ES+GVPGA I+KN H ++FYL+T+ LED  G   + 
Sbjct  91    EKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGELH  150

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVY  2244
             FVC SWVYPA +Y YDRVFF+N+ YLPS TP PLRP+RE EL +LRG G+G+ KEWDRVY
Sbjct  151   FVCNSWVYPAHRYKYDRVFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDRVY  210

Query  2243  DYDYYNDLGDPDNGKP--RPILGGNPEYPYPr---rgrtgrkmtkTDPKYESRLPLLPVA  2079
             DY +YNDLG PD G    RP+LGG+ EYPYPR     R   K    DP  ESRLP L + 
Sbjct  211   DYRFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTGFADPMSESRLPPLGL-  269

Query  2078  EIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLS  1899
             +IY PRDE+F  +K SDFL YA+KS+GQV+IP IA+ FD T NEFD+F+D+  LYEGG+ 
Sbjct  270   DIYAPRDERFTPVKLSDFLAYAVKSLGQVLIPEIAALFDKTINEFDNFEDVLKLYEGGIK  329

Query  1898  R-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVN  1722
                  L+ +++    E+ KE++RSDGE   KFP P VI   ++AWRTDEEF REMLAGVN
Sbjct  330   LPDHHLKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVN  389

Query  1721  PVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGI  1542
             PV I RLQ FPP S LDP+VYG+ TS+I REHI   +DGLTV++AI  NR+FILDHHD +
Sbjct  390   PVIIRRLQEFPPASKLDPEVYGNQTSSIKREHIEKNMDGLTVDEAIECNRLFILDHHDAL  449

Query  1541  MLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQG  1362
             + Y RRIN  T  K YATRTLL+LQ +GTLRP+AIELSLPHP GDK G  S V+TPA++G
Sbjct  450   LPYLRRINT-TKTKTYATRTLLYLQDNGTLRPLAIELSLPHPQGDKHGATSLVFTPADEG  508

Query  1361  VEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFR  1182
             VEG++WQLAKAYAA NDSG HQLISHWLNTHA IEP +IAT R LS LHPI+KLL PHFR
Sbjct  509   VEGTVWQLAKAYAAVNDSGYHQLISHWLNTHATIEPFVIATIRHLSVLHPIFKLLQPHFR  568

Query  1181  DTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVV  1002
             DTM+INAL RQ+L NA G++ L+  PGKYAMEMS+++YKNWVF    L    + RG+AV+
Sbjct  569   DTMYINALARQILINAGGILALTVFPGKYAMEMSSIVYKNWVFTEQGLLLIFL-RGVAVL  627

Query  1001  DLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVV  822
             D S P+ ++LLIEDYP+AVDGLE+W AI+ WV +Y  FYY  D M+  DTELQ+WW EV 
Sbjct  628   DSSQPYALKLLIEDYPFAVDGLEVWAAIEAWVDDYV-FYYSTDDMIRDDTELQSWWMEVR  686

Query  821   QKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRK  642
              +GH D KDEPWWP++ +R  L++ CT IIW++SALHAAVNFGQY Y+G    RPTVSR+
Sbjct  687   NEGHGDLKDEPWWPQMQTRAELVEACTIIIWVASALHAAVNFGQYPYSGLTSNRPTVSRR  746

Query  641   FMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWT  462
             FMPEPG+ +Y EL++NPD A LKTITA  QTLLG+SLIEILSR ASDEIYLGQRE+PEWT
Sbjct  747   FMPEPGTPEYAELESNPDVAYLKTITAQFQTLLGVSLIEILSRTASDEIYLGQRENPEWT  806

Query  461   KDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLS  297
              D E  ++F+RF  KLV +E +I++ N D + KNR GPV VPY LL+P       E GL+
Sbjct  807   SDVEPRQSFQRFHDKLVDVENKIVERNNDSRWKNRNGPVKVPYMLLYPNASGDNSESGLT  866

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  867   GKGIPNSVSI  876



>dbj|BAB01777.1| lipoxygenase [Arabidopsis thaliana]
Length=882

 Score =  1045 bits (2701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/855 (61%), Positives = 652/855 (76%), Gaps = 28/855 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP     G+  K A 
Sbjct  34    KIEGEVVVMKKNLLDFKDVMASLLDRVNELLGRRVSLHLISSHQPDPANEKRGRLGKAAH  93

Query  2600  LEDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE-----DG  2442
             LE W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL      +G
Sbjct  94    LEKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPDGEG  153

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ER  2265
             GA  + F+C SW+YP  +Y  DRVFFSN+AYLPS+TP  ++  RE ELKNLRG+  G E 
Sbjct  154   GATAIHFICNSWIYPNHRYRSDRVFFSNKAYLPSETPELIKELREEELKNLRGNEKGGEF  213

Query  2264  KEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY YYNDLG PD G    RP+LGG+PE PYPRRG+TGRK TK+DPK ESRL L
Sbjct  214   KEWDRVYDYAYYNDLGAPDKGPDSVRPVLGGSPELPYPRRGKTGRKSTKSDPKSESRLAL  273

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L +  IYVPRDE+F H+K SDFL YALKS+ QV++P IAS  D T NEFDSF+D+  LY+
Sbjct  274   LNL-NIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASVCDKTINEFDSFEDVFHLYD  332

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             G   L+ G  +  ++     E+ +E++R+DGE   K+P P ++  S++AWRTDEEFAREM
Sbjct  333   GSIKLANGHTISKLRDVIPWEMFRELVRNDGERFLKYPLPDILKESRSAWRTDEEFAREM  392

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++GL V++    N+++ILD
Sbjct  393   LAGLNPVVISRLQEFPPKSCLDSAKYGNQHSSIRTEHIESNMNGLNVQE----NKLYILD  448

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y  RIN+ T+ K YATRTLL LQ DGTL+P+AIELSLPH  G+ +G VS V+T
Sbjct  449   HHDALMPYLTRINS-TNTKTYATRTLLLLQADGTLKPLAIELSLPHAQGESYGSVSKVFT  507

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE+GVEGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPI+KLL
Sbjct  508   PAEKGVEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIHKLL  567

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL R +L N+DGV+E +  P +YAMEMS+ +YKNWVF   +LP DL+ R
Sbjct  568   HPHFRDTMNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKNWVFTEQALPKDLLKR  627

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D +S +GV+LLIEDYP+AVDGLEIW+AIKTWVTEYC FYY ND  V TDTE+Q+W
Sbjct  628   GVAVEDPNSDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCTFYYNNDKTVQTDTEIQSW  687

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+  KGH DK+ E WWP + +R  LI+TCT IIWI+SALHAAVNFGQY YAG+ P RP
Sbjct  688   WTELRTKGHGDKRHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLPNRP  747

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +Y EL+ + D A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+
Sbjct  748   TVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRD  807

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              P WT D E LEAF+RFGK+L  IE  I++ N D + KNRTGPVN+PYTLL+P     T 
Sbjct  808   SPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTDYTR  867

Query  311   EEGLSGKGIPNSISI  267
             E G++GKGIPNS+SI
Sbjct  868   EGGITGKGIPNSVSI  882



>gb|KHN15782.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=858

 Score =  1044 bits (2700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/854 (61%), Positives = 647/854 (76%), Gaps = 19/854 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGK---RSK  2610
              +  K++KGRVVLMKK  LD  D+ A+++D++ + +G+ VS QLISA   DP K   R K
Sbjct  8     VERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPAKGLLRGK  67

Query  2609  PAFLEDW--GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED--G  2442
              A LE W     +     ++ + VTFEW ES+GVPGA I++NNH ++FYLKTLT+ED  G
Sbjct  68    VANLERWVSTITSLTSTTDTEFSVTFEWDESMGVPGAFIIRNNHHSQFYLKTLTIEDIPG  127

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
                 V FVC SWVYPA +Y +DRVFF+N+AYLP  TP PLR FRE ELK L G G G+  
Sbjct  128   HDGPVNFVCNSWVYPAHRYAHDRVFFANKAYLPCHTPEPLRKFREQELKTLCGKGFGKLN  187

Query  2261  EWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY YYNDLG PD+G    RP+LGG+ ++PYPRRGRT R   KTDPK ESRL LL
Sbjct  188   EWDRVYDYAYYNDLGLPDDGPDYARPVLGGS-QFPYPRRGRTSRPHCKTDPKTESRLHLL  246

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
              +  +YVPRDE+FGH+K SDFL Y+LKS+ QV++P I S  D T NEFD+F D+  +YEG
Sbjct  247   NL-NVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFQDVLDIYEG  305

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
                L  G L   ++K    E+ +E++R+DGE   KFP P VI  SKTAWRTDEEFAREML
Sbjct  306   SIKLPSGPLTSKLRKLVPYELLRELIRNDGERFLKFPVPDVIKVSKTAWRTDEEFAREML  365

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LDP+VYGD TS+I   HI + LDGLT+++AI + R+FILDH
Sbjct  366   AGVNPVIIRRLQEFPPASKLDPRVYGDQTSSIRATHIENSLDGLTIDEAIQNMRLFILDH  425

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y  RIN+ T+ K YA+RTLLFLQ DGTL+P+AIELSLPHP G++ G VS V+TP
Sbjct  426   HDSLMPYISRINS-TNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGEQHGAVSKVFTP  484

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             A++GV  S+WQLAKAYAA NDSG HQL+SHWL THAVIEP IIAT+RQLS LHPI+KLL 
Sbjct  485   AQEGVSASVWQLAKAYAAVNDSGYHQLVSHWLYTHAVIEPFIIATHRQLSILHPIHKLLK  544

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTMHINAL R  L NA GV+E++  PGK+A+EMS+V+YK+WVF   +LP DL+ RG
Sbjct  545   PHFRDTMHINALARHTLINAGGVLEITVFPGKFALEMSSVIYKSWVFTEQALPADLLKRG  604

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             MA+ D SS  G+RL+IEDYP+AVDG+EIW AI+TWVTEYCNFYY ++ MV  D+ELQ+WW
Sbjct  605   MAIPDSSSRRGLRLVIEDYPFAVDGIEIWDAIETWVTEYCNFYYTSNDMVEEDSELQSWW  664

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
              EV  +GH D KD  WWP + ++  LI +CT IIW++SA HAAVNFGQY +AGY P RPT
Sbjct  665   KEVRNEGHGDLKDRHWWPDMKTKEELIHSCTIIIWLASAFHAAVNFGQYPFAGYLPNRPT  724

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPE G+ +YEELK++P+ A LKTITA  QTL+G+SLIE+LSRH+++E+YLGQ E+
Sbjct  725   VSRRFMPEQGTPEYEELKSDPELAFLKTITAQFQTLVGVSLIEVLSRHSTEEVYLGQCEN  784

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGE  309
             PEWT D E L AFERF +KL+ IE  I++ N D + KNR GPV +PYTLL+P     + E
Sbjct  785   PEWTLDAEPLAAFERFRQKLLEIENNIMERNKDKRFKNRNGPVKMPYTLLYPNTSDYSRE  844

Query  308   EGLSGKGIPNSISI  267
              GL+GKGIPNSISI
Sbjct  845   GGLTGKGIPNSISI  858



>ref|XP_006406169.1| hypothetical protein EUTSA_v10020023mg [Eutrema salsugineum]
 gb|ESQ47622.1| hypothetical protein EUTSA_v10020023mg [Eutrema salsugineum]
Length=888

 Score =  1044 bits (2700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/852 (62%), Positives = 654/852 (77%), Gaps = 22/852 (3%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             I+G +V+MKKN LD  D  AS++D+I + +G++VS  LIS+   DP     G+  K A+L
Sbjct  39    IEGELVVMKKNLLDFKDAMASLLDRIHELLGRRVSLHLISSLQPDPANEKRGRLGKAAYL  98

Query  2597  EDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED--GGAAG  2430
             E W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL +  GG +G
Sbjct  99    EKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRNFPGGESG  158

Query  2429  -VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERKEW  2256
              + FVC SW+YP  +Y  DRVFFSN+AYLPS+TP  ++  RE ELKNLRG+  G E KEW
Sbjct  159   PIHFVCNSWIYPNHRYRSDRVFFSNKAYLPSETPELVKELREEELKNLRGNEKGGELKEW  218

Query  2255  DRVYDYDYYNDLGDPDN--GKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD      RP+LGG+PE PYPRRG+TGRK TKTDPK ESRL LL +
Sbjct  219   DRVYDYAYYNDLGAPDKCLDSARPVLGGSPELPYPRRGKTGRKPTKTDPKSESRLALLNL  278

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               IYVPRDE+F H+K SDFL YALKS+ QV++P IAS  D T NEFDSF+D+  LY+G  
Sbjct  279   -NIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASVCDKTINEFDSFEDVFHLYDGSI  337

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L+ G  +  ++     E+ +E++R+DGE   KFP P V+  S++AWRTDEEFAREMLAG
Sbjct  338   KLANGQTISKLRDVIPWEMFRELVRNDGERFLKFPLPDVLKESRSAWRTDEEFAREMLAG  397

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++GL V++A+  N+++ILDHHD
Sbjct  398   LNPVVISRLQEFPPKSNLDFSKYGNQHSSIREEHIEQNMNGLNVQEALEQNKLYILDHHD  457

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS V+TPAE
Sbjct  458   ALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKVFTPAE  516

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             +GVEGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPIYKLLHPH
Sbjct  517   KGVEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVIHPIYKLLHPH  576

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INAL R +L NADGV+E +  P +YAMEMS+ +YK+WVF + +LP DL+ RG+A
Sbjct  577   FRDTMNINALARHILINADGVLERTVFPSRYAMEMSSSIYKSWVFTDQALPKDLLKRGVA  636

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D S  +GV+LLIEDYP+AVDGLEIW+AIKTWVT+YC+FYYKND  V TDTE+Q+WWTE
Sbjct  637   VEDPSRDNGVKLLIEDYPFAVDGLEIWSAIKTWVTDYCSFYYKNDKTVQTDTEIQSWWTE  696

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             +  +GH D + E WWP + +   LI+TCT IIWI+SALHAAVNFGQY YAG+ P RPTVS
Sbjct  697   LRTEGHGDIQHESWWPSMQTLDELIETCTIIIWIASALHAAVNFGQYPYAGFLPNRPTVS  756

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPEPG+A+Y EL  + D A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+ P 
Sbjct  757   RRFMPEPGTAEYTELAEDEDVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRDSPN  816

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEG  303
             WT D EALEAF+RFGK L  IE  I++ NGD + KNRTGPVN+PYTLL+P     T E G
Sbjct  817   WTADDEALEAFKRFGKTLEMIENNIIRRNGDKRFKNRTGPVNIPYTLLYPNTTDYTREGG  876

Query  302   LSGKGIPNSISI  267
             L+GKGIPNS+SI
Sbjct  877   LTGKGIPNSVSI  888



>gb|AGI16413.1| lipoxygenase [Malus domestica]
Length=868

 Score =  1044 bits (2700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/851 (61%), Positives = 639/851 (75%), Gaps = 13/851 (2%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGK  2619
             H +E KKIKGRVVLMKK  LD+ D+ ASI+D++ + +G+ VS +LIS+     EN+  GK
Sbjct  19    HKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGAPENELKGK  78

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE+W   +  L AGE+A+DVTF+W + +GVPGA +V+N H +EFYLKTLTLED 
Sbjct  79    VGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDV  138

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--G  2271
              G   V FVC SWVYPADKY  DRVFFSN+ YL S TP PL+ FRE EL NLRGD    G
Sbjct  139   PGEGRVHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERG  198

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRG+TGR  TKTDP  ESRL
Sbjct  199   ELQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRL  258

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
              L+ +  +YVPRDE+FG +K SD L Y LKSI QV+ P I       ++EF+S +++  L
Sbjct  259   KLIQILNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKL  318

Query  1916  YEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             YEGGL     +L++I  +T  EI KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  319   YEGGLELPDGILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  378

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             +LAGVNPV I RLQ FPP S LD +VYGD TS IT+EHI   L+GLT+++AI +N++FIL
Sbjct  379   LLAGVNPVTIRRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFIL  438

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             +HHD  M Y RRIN  T  K YA+RTLLFL  DGTL+PIAIELSLPHP GD+FGC+S VY
Sbjct  439   NHHDAWMPYLRRIN-RTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGDQFGCISKVY  497

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QGVE SIWQ AK YA  NDSG HQL SHWL  HAV EP +IA NRQLS LHPI+KL
Sbjct  498   TPSSQGVESSIWQFAKGYALVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPIHKL  557

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFR TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI 
Sbjct  558   LHPHFRGTMNANASARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPADLIK  617

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D S+ HGVRLLIEDYPYA DGLE+WTAIKTWV +YC+FYYKND MV  D+ELQ+
Sbjct  618   RGVAVEDSSASHGVRLLIEDYPYAADGLELWTAIKTWVKDYCSFYYKNDQMVQNDSELQS  677

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+   GH DKK+EPWWP++ +   LI++CTTII+I+SA HAA+N+GQY+  G+ P R
Sbjct  678   WWKELRGVGHSDKKEEPWWPKMQTCDELIESCTTIIYIASAHHAAINYGQYSTGGFVPNR  737

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SR+FMPE G+ +YEEL+TNPDKA L+T      TLLG++ +EILSRH +DE+YLGQR
Sbjct  738   PTLSRRFMPEEGTPEYEELRTNPDKAFLQTFAPQLPTLLGMATVEILSRHPTDELYLGQR  797

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL
Sbjct  798   DTAEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGL  857

Query  299   SGKGIPNSISI  267
             + KG+P SI+I
Sbjct  858   TNKGVPTSINI  868



>ref|NP_001267584.1| probable linoleate 9S-lipoxygenase 5-like [Cucumis sativus]
 emb|CAB83038.1| lipoxygenase-9 [Cucumis sativus]
Length=881

 Score =  1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/847 (62%), Positives = 638/847 (75%), Gaps = 16/847 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRS---KPAFLE  2595
             +I+G VV+MKK  LD  DV AS++D++ +F G+ V+ QLIS+     G+     K A LE
Sbjct  37    RIRGTVVIMKKCVLDFKDVKASVLDRVHEFFGKGVTIQLISSNPPQSGRLGAVGKAANLE  96

Query  2594  DWGKLT--SLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQ  2424
              W      SL A +    + FEW E +GVPGA  ++N+H N+FYLKT+TL D  G   V 
Sbjct  97    QWISTVKPSLTADDIELTIFFEWEERMGVPGAFTIRNHHPNQFYLKTVTLHDVPGYGSVH  156

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVY  2244
             FVC SWVYPA +Y YDRVFFSN++YLPS+TP  LR +RE EL NLRGD  GE KEWDRVY
Sbjct  157   FVCNSWVYPAHRYTYDRVFFSNKSYLPSETPESLRKYREEELVNLRGDNRGELKEWDRVY  216

Query  2243  DYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             DY  YNDLG PD+GK   R  LGG  E+PYPRRGRTGRK  K DP  E RLPLL + +IY
Sbjct  217   DYACYNDLGMPDSGKKYVRTSLGGTREFPYPRRGRTGRKPAKADPSCEHRLPLLSL-DIY  275

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSRGL  1890
             VPRDE+F +LK SDFL Y++KS+ Q ++P I S  D T NEFD F D+  LYEGG+S   
Sbjct  276   VPRDERFRNLKLSDFLAYSVKSVVQSLLPEIKSLCDKTINEFDCFQDVLDLYEGGMSLPT  335

Query  1889  -LLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
              +L  +++    ++ +E++RSDG    KFP P VI  +KTAWRTDEEF REMLAGVNPV 
Sbjct  336   EVLGTLRELVPWQLFRELMRSDGRQFLKFPVPDVIKENKTAWRTDEEFGREMLAGVNPVI  395

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I RL  FPP S LDPK YG   S+IT EHIA+ L+GLT++QA+  N++FILDHHD +M Y
Sbjct  396   IRRLLEFPPVSKLDPKTYGKQNSSITEEHIAEHLNGLTIDQALEMNKLFILDHHDALMPY  455

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEG  1353
               RIN+ T  K YATRTLL LQ +G L+P+AIELSLPHP G+  G VS V+TPAE GVEG
Sbjct  456   ISRINS-TSTKTYATRTLLLLQDNGILKPLAIELSLPHPQGEHHGSVSKVFTPAEHGVEG  514

Query  1352  SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTM  1173
             S+WQLAKAY A NDSG HQLISHWLNTHAVIEP II TNRQLS +HPIYKLLHPHFRDTM
Sbjct  515   SVWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFIIGTNRQLSVVHPIYKLLHPHFRDTM  574

Query  1172  HINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLS  993
             +INA+ RQ+L NA G++E +  PGKYA+EMSAV+YKNWVF + + P DLI RG+A+ D S
Sbjct  575   NINAMARQVLINAGGILETTVFPGKYALEMSAVIYKNWVFTDQAHPADLIKRGVAIPDSS  634

Query  992   SPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKG  813
             SPHG++LLIEDYPYAVDGLEIW+AI+ WV +Y  FYYK+D MV  DTE+Q+WWTE+   G
Sbjct  635   SPHGLKLLIEDYPYAVDGLEIWSAIEKWVRDYSYFYYKSDEMVQKDTEIQSWWTEIRTVG  694

Query  812   HEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMP  633
             H D KDEPWWP++ +R  L+ +CT IIWI+SALHAAVNFGQY YAGY P RPTVSR+FMP
Sbjct  695   HGDLKDEPWWPKMNTREDLVQSCTIIIWIASALHAAVNFGQYPYAGYLPNRPTVSRRFMP  754

Query  632   EPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDK  453
             EPG+ ++ EL+T+P+ A LKTITA  QT+LG+SLIE LSRH+ DEIYLGQR+ PEWTKD+
Sbjct  755   EPGTPEFRELETDPELAYLKTITAQLQTILGVSLIESLSRHSVDEIYLGQRDTPEWTKDE  814

Query  452   EALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTG-----EEGLSGKG  288
             EAL AFERFG +L  IEE+I++MN + K +NR GPV +PYT LFP       EEGL+ +G
Sbjct  815   EALAAFERFGDRLREIEEKIMRMNNEEKWRNRVGPVKMPYTFLFPNTSNYYEEEGLNARG  874

Query  287   IPNSISI  267
             IPNSISI
Sbjct  875   IPNSISI  881



>gb|EYU41500.1| hypothetical protein MIMGU_mgv1a001165mg [Erythranthe guttata]
Length=874

 Score =  1043 bits (2697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/862 (61%), Positives = 643/862 (75%), Gaps = 27/862 (3%)
 Frame = -1

Query  2777  DEP----KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----  2625
             DEP    KK+KG VVLMKKN +D+TD G+SI+D+  +  G+ VS QL+S+ N D      
Sbjct  15    DEPIVELKKVKGTVVLMKKNVMDVTDFGSSILDRFHELFGKGVSLQLVSSVNGDSANENK  74

Query  2624  GKRSKPAFLEDW-GKLTSLVA-GESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTL  2451
             GK  K AFLE+W  K+TSL A  E+++DV F W ES G+PGA I+KN+H ++FYLK+LTL
Sbjct  75    GKLGKEAFLENWISKITSLNAKDEASFDVVFNWDESHGIPGAFIIKNHHHSQFYLKSLTL  134

Query  2450  ED--GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGD-  2280
             ED       + F C SWVYP  +Y YDRVFF+N+ YL   TP PLR +R  ELKNLRG+ 
Sbjct  135   EDFPSHEGPIHFDCNSWVYPTHRYKYDRVFFTNKTYLFDDTPQPLRFYRNQELKNLRGEE  194

Query  2279  --GTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPK  2112
                 G  KEWDRVYDY YYNDLG P+ GK   RP LGGN +YPYPRR +TGRK  K DP 
Sbjct  195   ISSGGMLKEWDRVYDYAYYNDLGSPEKGKDYARPSLGGNSDYPYPRRAKTGRKPNKKDPN  254

Query  2111  YESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFD  1932
              E+RL LL ++ IYVPRDEKF  +K SDF+GYA+KSIGQV +P I + FD T NEFD+F 
Sbjct  255   SETRLFLLSLS-IYVPRDEKFNQVKFSDFIGYAIKSIGQVFVPEIKAVFDKTINEFDTFQ  313

Query  1931  DMNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTD  1758
             D+ +LYEGG  L  G  L+ I+ +   E+ KE++RSDGE   KFPTP VI   KTAWRTD
Sbjct  314   DVLNLYEGGVRLPEGQTLDKIRAHVPWELLKELIRSDGERFLKFPTPDVIKEDKTAWRTD  373

Query  1757  EEFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWS  1578
             EEF REMLAGVNPV I RLQ FPP S LDP+ YGD  STI REH+   ++GL+V++A+  
Sbjct  374   EEFGREMLAGVNPVIIRRLQEFPPISKLDPQQYGDQDSTIRREHLEKNMNGLSVDEAMEK  433

Query  1577  NRVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFG  1398
             N++FILDHHD +M Y RRIN  T  K YA+RT+L LQ++GTL+P+AIELSLPH  GD+ G
Sbjct  434   NKLFILDHHDALMTYLRRINTTT-TKTYASRTILLLQENGTLKPLAIELSLPHEEGDERG  492

Query  1397  CVSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFL  1218
              VS V+TP + GVE SIWQLAKAY A NDSG HQLISHWLNTHAVIEP IIATNRQLS +
Sbjct  493   AVSKVFTPCDDGVENSIWQLAKAYVAVNDSGYHQLISHWLNTHAVIEPFIIATNRQLSIV  552

Query  1217  HPIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSL  1038
             HPI+KLL PHFRDT+HINAL RQ+L NA GV+E +  PGKYAMEMS+ +YKNW F   +L
Sbjct  553   HPIHKLLKPHFRDTIHINALARQILINAGGVLERTVFPGKYAMEMSSAVYKNWNFTEQAL  612

Query  1037  PNDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWT  858
             P DLI RG+A+ D S PHG++L+IEDYP+AVDGLEIW AI++WV EYC FYY  D +V  
Sbjct  613   PEDLIKRGIAIPDSSEPHGLKLVIEDYPFAVDGLEIWYAIESWVKEYCCFYYPTDDVVKG  672

Query  857   DTELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYA  678
             DTEL+ WW EV ++GH D K++PWWP++ ++  LI TCT IIW++SALHAAVNFGQY YA
Sbjct  673   DTELKEWWKEVREEGHGDLKEKPWWPKMETQSELIQTCTIIIWVASALHAAVNFGQYPYA  732

Query  677   GYNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDE  498
             GY P RPTVSR++MPE GSA+Y EL+ +PD A LKTITA  QTLLG+SLIEILSRH++DE
Sbjct  733   GYLPNRPTVSRRYMPEVGSAEYAELEKDPDLAFLKTITAQFQTLLGVSLIEILSRHSTDE  792

Query  497   IYLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP  318
             +YLGQR+   WT D   L AFERF   LV IE RI + N D  L+NR GPV VPYTLL+P
Sbjct  793   VYLGQRDTVGWTTDDRPLAAFERFSAALVEIETRITERNDDVALRNRVGPVKVPYTLLYP  852

Query  317   TGEE-----GLSGKGIPNSISI  267
             +  +     GL+GKGIPNS+SI
Sbjct  853   STSDTSRVGGLTGKGIPNSVSI  874



>gb|KFK39531.1| hypothetical protein AALP_AA3G256400 [Arabis alpina]
Length=882

 Score =  1042 bits (2694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/853 (61%), Positives = 652/853 (76%), Gaps = 22/853 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI+G VV+MKKN LD  D  AS++D++ + +G++VS QLIS+   DP     G+  K A 
Sbjct  32    KIEGEVVVMKKNVLDFKDAMASLLDRVHELLGRRVSLQLISSLQPDPANEKRGRLGKAAH  91

Query  2600  LEDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             LE W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN H ++FYLK+LTL D  GA G
Sbjct  92    LEKWVTKIKTSVTAEETAFAVTFDWDESMGPPAAFVIKNYHHSQFYLKSLTLRDFPGAQG  151

Query  2429  --VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERKE  2259
               + FVC SW+YP  +Y  DRVFFSN+AYLPS+TP  ++  RE ELKNLRG+  G E KE
Sbjct  152   GPIHFVCNSWIYPNHRYRSDRVFFSNKAYLPSETPELVKELREEELKNLRGNEKGGEFKE  211

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             WDRVYDY YYNDLG PD G    RP++GG+ E+PYPRRG+TGRK TK+DPK ESRL L+ 
Sbjct  212   WDRVYDYAYYNDLGAPDKGPDSARPVIGGSHEFPYPRRGKTGRKPTKSDPKSESRLALIN  271

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
             +  IYVPRDE+F H+K SDFL YALK++ QV++P +AS  D T NEFDSF+D+  LY+G 
Sbjct  272   L-NIYVPRDERFSHVKFSDFLAYALKAVTQVLVPELASVCDKTINEFDSFEDVFHLYDGS  330

Query  1904  --LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
               L  G  +  ++     E+ +E++R+DGE   KFP P V+  S++AWRTDEEFAREMLA
Sbjct  331   IKLPNGHTISKLRDVVPWEMFRELIRNDGEQFLKFPLPDVLKESRSAWRTDEEFAREMLA  390

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPV ISRLQ FPP+S LD   YG+  S I  EHI   ++GL VE+A+  N+++ILDHH
Sbjct  391   GLNPVVISRLQEFPPKSNLDSAKYGNQDSAIRVEHIEPNMNGLNVEEALEQNKLYILDHH  450

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS V+TPA
Sbjct  451   DALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGEVHGSVSKVFTPA  509

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E+GVEGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPI+KLLHP
Sbjct  510   EKGVEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIHKLLHP  569

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL R +L NADG++E +  P +YAMEMS+ +YKNWVF + +LP DL+ RG+
Sbjct  570   HFRDTMNINALARHILINADGILERTVFPSRYAMEMSSSVYKNWVFTDQALPKDLLKRGV  629

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
              + D  + +GV+LLIEDYP+AVDGLEIW+AIKTWVTEYC+FYYKND  V  DTE+Q+WWT
Sbjct  630   IIEDPRNDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCSFYYKNDKTVQNDTEIQSWWT  689

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+  +GH DK+ E WWP + +R  LI+TCTTIIWI+SALHAAVNFGQY+YAG+ P RPTV
Sbjct  690   ELRTEGHGDKQHEAWWPLMQTRDDLIETCTTIIWIASALHAAVNFGQYSYAGFLPNRPTV  749

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+ +Y EL  N D A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+ P
Sbjct  750   SRRFMPEPGTDEYTELSENVDLAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRDSP  809

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEE  306
              WT D EALEAF+RFGK L  IE  I++ N D + KNRTGPVN+PYTLL+P     T E 
Sbjct  810   NWTADDEALEAFKRFGKNLELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTDFTREG  869

Query  305   GLSGKGIPNSISI  267
             GL+GKGIPNS+SI
Sbjct  870   GLTGKGIPNSVSI  882



>ref|XP_006344836.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=845

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/848 (62%), Positives = 634/848 (75%), Gaps = 22/848 (3%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDK-IQDFVGQKVSFQLISAENDDPGKRSK----  2610
             E KKI G VVL+KK  L+L  V + +V +   + +G KV  QLIS+ N D GK +K    
Sbjct  8     ESKKINGTVVLVKKRALEL--VPSEVVQQQTYEILGDKVILQLISSVNGDSGKENKGKLG  65

Query  2609  -PAFLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE----D  2445
              P  L D  K    V  ES + VTF+  E  G PGA I+KN + +EF+LK LTLE    D
Sbjct  66    NPTHLRDESK----VGNESKFSVTFDLDEEFGAPGAFIIKNFNPSEFFLKKLTLEVEVDD  121

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
                 G+ FVC SWVYPA+KY  DR+FF NQA+LPS+TP  LR +RE EL NLRG+G G+ 
Sbjct  122   PSHGGMHFVCNSWVYPAEKYKSDRIFFVNQAWLPSETPVKLRWYREEELLNLRGNGIGKL  181

Query  2264  KEWDRVYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLGDP+ G    RPILGG+ +YPYPRRGRT R  TKTDP  ESRLPL
Sbjct  182   EEWDRVYDYAYYNDLGDPEKGSTYVRPILGGSTKYPYPRRGRTSRPPTKTDPNSESRLPL  241

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L    IYVPRDEKF  LK +DF+  ALK I Q+++P + S  +   NEF+SF+D+  +Y 
Sbjct  242   LMSFGIYVPRDEKFAPLKMTDFIRIALKVIVQLLVPELESLGNINLNEFNSFEDILKIYG  301

Query  1910  GGLSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             GG++   L E + + ++ E+ KE ++S G+   K+P PQVI   K+AWRTDEEFAREMLA
Sbjct  302   GGIN---LPEDVLQRSSTEMIKEFIQSSGQEFLKYPMPQVIKEDKSAWRTDEEFAREMLA  358

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             G+NPVCI  L+ FPP S LDPKVYGD TS ITREHI ++LDGLT+E+AI +N++FIL+HH
Sbjct  359   GINPVCICGLKEFPPTSKLDPKVYGDQTSNITREHIQNQLDGLTIEEAIKANQLFILNHH  418

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D  M Y R+IN  T  KIYA+RTLLFLQKDGTL+ + IELSLPHP GD+ G +S V+TP 
Sbjct  419   DTFMPYMRQINM-TSTKIYASRTLLFLQKDGTLKLLGIELSLPHPDGDQHGFISKVFTPQ  477

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E G E SIWQLAKAY A NDSGVHQLISHWL+THA IEPI+IATNRQLS  HP+YKLLHP
Sbjct  478   EYGTEASIWQLAKAYVAVNDSGVHQLISHWLHTHATIEPIVIATNRQLSVFHPMYKLLHP  537

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTMHINAL RQ L NA G++E +  P KYAMEM++  YK+WVFP  +LP DLI RG+
Sbjct  538   HFRDTMHINALARQTLLNAGGILEQTVFPTKYAMEMTSAAYKDWVFPEQALPADLIKRGV  597

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             A+ D  S  G+RLLI+DYPYAVDGLEIW+AIK+WV EYC  YYK D M+  DTELQAWW 
Sbjct  598   AIEDPESEKGIRLLIQDYPYAVDGLEIWSAIKSWVQEYCTIYYKTDDMIQKDTELQAWWK  657

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+ ++GH DKKDEPWWP++ +   L D+CT IIWI+SALHAA+NFGQY Y GY P RP++
Sbjct  658   ELQEEGHGDKKDEPWWPKMQTLKELTDSCTIIIWIASALHAAINFGQYPYGGYLPNRPSM  717

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SRK MPEPGS +YEELKTNP+K  L TIT   QTL+GIS IEILS H+SDEIYLGQR+ P
Sbjct  718   SRKLMPEPGSPEYEELKTNPEKGYLSTITPQLQTLIGISAIEILSTHSSDEIYLGQRDTP  777

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             +WT DKE L+A ERFGKKL  IEE+I+KMN D K KNR GP+ +PYTLL+P  E GL+GK
Sbjct  778   KWTNDKEPLQALERFGKKLTEIEEKIIKMNNDKKWKNRMGPIKMPYTLLYPISEPGLTGK  837

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  838   GIPNSVSI  845



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/844 (60%), Positives = 636/844 (75%), Gaps = 11/844 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKRSKPA  2604
             +KIKG+V+L++ N LD  ++ +S++D I +F G KVSFQLIS+EN D      GK  K  
Sbjct  18    QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKXT  77

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +L +W  K+  +  GE+ + ++F W E +G+PGA I++NNH  +F+LK+LTLED    G 
Sbjct  78    YLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVGR  137

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + F C SW+Y + KY  DR+FF N+AY+P++TP PLR +R+ ELKNLRGDGTGER+EWDR
Sbjct  138   IHFDCNSWIYSSGKYKNDRIFFINKAYIPNETPEPLRKYRQDELKNLRGDGTGERQEWDR  197

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDL DP +G    RP+LGG+ +YPYPRRGRTGR  +K D KYESRL       
Sbjct  198   IYDYDVYNDLEDPSSGSTYIRPVLGGSTQYPYPRRGRTGRSPSKKDKKYESRLSSSLSLN  257

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
              YVPRDE+FGHLK+SDFL Y LKS+ Q + P +   F     EFDSF D+ +LYEGG S 
Sbjct  258   TYVPRDERFGHLKESDFLAYTLKSVAQSIKPALDELFSRNPGEFDSFQDVLNLYEGGFSL  317

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                LLE  ++N    + KE+ R+DGEN  KFP PQVI  +K+ WRTDEEFAREMLAGVNP
Sbjct  318   PKSLLEKFRQNIPAPLLKEIFRTDGENFLKFPLPQVIQDNKSGWRTDEEFAREMLAGVNP  377

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             + I RLQ FPP S LDP VYGD  S I+ EHI + LDGLTV++AI  N+++ILDHHD +M
Sbjct  378   IIIRRLQEFPPSSKLDPNVYGDQNSKISEEHIINSLDGLTVQEAIEQNKLYILDHHDALM  437

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y  RIN+ T  K YATRTL FL  DGTLRP+ IELSLP    D+ G  S +Y PAE GV
Sbjct  438   PYLNRINS-TSTKTYATRTLXFLNGDGTLRPLVIELSLPQSQKDELGATSKLYFPAEDGV  496

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A ND+G HQ++SHWLNTHAV+EP +IATNRQLS LHPI+KLL PH+RD
Sbjct  497   ESSIWQLAKAYVAVNDAGYHQVVSHWLNTHAVMEPFVIATNRQLSVLHPIHKLLVPHYRD  556

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA  RQ L NADG++E +    KY+ME+S+ +YK+WVF + +LP DLI RGMAV D
Sbjct  557   TMNINAFARQTLVNADGILESTHFQSKYSMELSSYIYKDWVFTDQALPRDLIKRGMAVED  616

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SP+G++LLIEDYP+AVDGLEIW AIKTWV +YC+ YYK+DIMV  D ELQ+WW E+ +
Sbjct  617   SNSPYGLKLLIEDYPFAVDGLEIWFAIKTWVKDYCSSYYKDDIMVHDDVELQSWWKELKE  676

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             KGH D KD+PWWP++ +  +LI+TCT IIWISSALHAAVNFGQY Y GY P RPT+SR+F
Sbjct  677   KGHVDLKDKPWWPKMETLEVLIETCTIIIWISSALHAAVNFGQYPYGGYLPNRPTISRRF  736

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+  Y EL+++P+K  L+TI +  QTLLGISL+EILSRH+SDEIYLG+RE  EW  
Sbjct  737   MPEKGTPQYIELESDPEKGFLRTINSQVQTLLGISLVEILSRHSSDEIYLGKRESLEWIS  796

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D+ ALEAFE+FGK+L  IE  I+K N D K+KNR GP+NVPYT L+PT  EGL+GKGIPN
Sbjct  797   DQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPINVPYTSLYPTSNEGLTGKGIPN  856

Query  278   SISI  267
             SISI
Sbjct  857   SISI  860



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =  1041 bits (2692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/844 (61%), Positives = 636/844 (75%), Gaps = 11/844 (1%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDD-----PGKRSKPA  2604
             +KIKG+V+L++ N LD  ++ +S++D I +F G KVSFQLIS+EN D      GK  K  
Sbjct  16    QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKKT  75

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAG-  2430
             +L +W  K+  +  GE+ + ++F+W E +G+PGA +++NNH  +F+LK+LTLED    G 
Sbjct  76    YLGNWMTKMVPVSPGETVFKISFDWDEDIGIPGAFLIRNNHFTKFFLKSLTLEDVPFVGR  135

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + F C SW+YP+ KY  DR+FF N+AY+P++TP PLR +RE ELKNLRGDGTGER+EWDR
Sbjct  136   IHFDCNSWIYPSGKYKNDRIFFINKAYIPNETPEPLRKYREDELKNLRGDGTGERQEWDR  195

Query  2249  VYDYDYYNDLGDP--DNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             +YDYD YNDL DP  D+   RP+LGG+ +YPYPRRGRTGR  +K D  YESRL       
Sbjct  196   IYDYDVYNDLEDPSSDSTYVRPVLGGSTQYPYPRRGRTGRSPSKKDKNYESRLSSSLSLN  255

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDE+FGHLK+SDFL Y LKS+ Q + P +   F     EFDSF D+  LYEGG S 
Sbjct  256   IYVPRDERFGHLKESDFLAYTLKSVAQSIKPALDELFSRNPGEFDSFQDVLKLYEGGFSL  315

Query  1895  -GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNP  1719
                LLE  +++    + KE+ R+DGE   KFP PQVI  +K+ WRTDEEFAREMLAGVNP
Sbjct  316   PKSLLEKFRQSIPAPLLKEIFRTDGEKFLKFPLPQVIQDNKSGWRTDEEFAREMLAGVNP  375

Query  1718  VCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIM  1539
             + I RLQ FPP S LDP VYGD  S I+ EHI + LDGLTV++A+  N+++ILDHHD +M
Sbjct  376   IIIRRLQEFPPSSKLDPNVYGDQNSKISEEHIINSLDGLTVQEALKQNKLYILDHHDALM  435

Query  1538  LYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGV  1359
              Y  RIN+ T  K YATRTLLFL  DGTLRP+ IELSLP    D+ G  S +Y PAE GV
Sbjct  436   PYLNRINS-TSTKTYATRTLLFLNGDGTLRPLVIELSLPQSQKDELGATSKLYFPAEDGV  494

Query  1358  EGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRD  1179
             E SIWQLAKAY A ND+G HQ+ISHWLNTHAV+EP +IATNRQLS LHPI+KLL PH+RD
Sbjct  495   ESSIWQLAKAYVAVNDAGYHQVISHWLNTHAVMEPFVIATNRQLSVLHPIHKLLVPHYRD  554

Query  1178  TMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVD  999
             TM+INA  RQ L NADG++E +    KY+ME+S+ +YK+WVF + +LP DLI RGMAV D
Sbjct  555   TMNINAFARQTLVNADGILESTHFQSKYSMELSSYIYKDWVFTDQALPRDLIKRGMAVED  614

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
              +SP+G++LLIEDYP+AVDGLEIW AIKTWV +YC+ YYKNDIMV  D ELQ+WW E+ +
Sbjct  615   SNSPYGLKLLIEDYPFAVDGLEIWFAIKTWVKDYCSSYYKNDIMVHDDIELQSWWKELKE  674

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             KGH D KD+PWWP++ +   LI+TCT IIWISSALHAAVNFGQY Y GY P RPT+SR+F
Sbjct  675   KGHVDLKDKPWWPKMETLEELIETCTIIIWISSALHAAVNFGQYPYGGYLPNRPTISRRF  734

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MPE G+  Y EL+++P+K  L+TI +  QTLLGISLIEILSRH+SDEIYLG+RE  EW  
Sbjct  735   MPEKGTPQYVELESDPEKGFLRTINSQVQTLLGISLIEILSRHSSDEIYLGKRESLEWIS  794

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             D+ ALEAFE+FGK+L  IE  I+K N D K+KNR GP+NVPYT L+PT  EGL+GKGIPN
Sbjct  795   DQPALEAFEKFGKRLEEIEYEIVKRNRDPKMKNRVGPINVPYTSLYPTSNEGLTGKGIPN  854

Query  278   SISI  267
             SISI
Sbjct  855   SISI  858



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =  1041 bits (2691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/843 (61%), Positives = 638/843 (76%), Gaps = 13/843 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-----NDDPGKRSKPAF  2601
             K+KG VVLMKKN LD  D  AS +D++ +F+G KV+ +LIS++     N   GK  KPA 
Sbjct  20    KVKGTVVLMKKNVLDFNDFNASFLDRLTEFLGNKVTLRLISSDVADSGNGSKGKLGKPAH  79

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LE+W   +T L AGESA+ VTF++    G PGA  ++N+H +EFYLK+LTLED  G   V
Sbjct  80    LEEWITTITPLTAGESAFKVTFDYENGFGFPGAFAIRNDHFSEFYLKSLTLEDVPGHGRV  139

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              F+C SWVYP+  Y  DRVFFSN+ YLPSQTP PL  +RE EL +LRG G GE KE DRV
Sbjct  140   HFLCNSWVYPSHTYEKDRVFFSNKTYLPSQTPEPLVQYREKELVSLRGTGKGELKEGDRV  199

Query  2246  YDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYV  2067
             YDY YYNDLGDP    PRP+LGG+ EYPYPRRGRTGRK TK DP  ESRLP+     +YV
Sbjct  200   YDYAYYNDLGDPPK-NPRPVLGGSEEYPYPRRGRTGRKPTKEDPNTESRLPITSSLNVYV  258

Query  2066  PRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRG  1893
             PRDE+FGHLK SDFL +ALKSI Q+V P + + FD + NEFDSF+D+  +YE G  L   
Sbjct  259   PRDERFGHLKMSDFLVFALKSIVQIVQPALEAVFDKSPNEFDSFEDVLKIYEEGIDLPNQ  318

Query  1892  LLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
                ++I+ N  LE+ +E+ R+DG  L K+P PQ+I   K+AWRTDEEFAREMLAG+NPV 
Sbjct  319   SFFDNIRNNIPLELLREIFRTDGAKLLKYPEPQIIKEDKSAWRTDEEFAREMLAGLNPVV  378

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I  L+ FPP+S LD ++YG+ TSTIT+ HI   L+GL VE+A+   R+FILDHHD +M Y
Sbjct  379   IRLLEEFPPKSKLDSQMYGNQTSTITKTHIEHNLEGLNVEEALEKARLFILDHHDTLMPY  438

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEG  1353
              RR+N  T  K YATRTLLFL++DGTL+P+ IELSLPHP GD+FG +S VYTP + GV+ 
Sbjct  439   LRRVNM-TGTKTYATRTLLFLKEDGTLKPLVIELSLPHPDGDRFGALSEVYTPGD-GVQD  496

Query  1352  SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTM  1173
             S+WQLAKAY   NDSG HQLISHWLNTHAVIEP +IATNRQLS LHP+YKLL PH+RDTM
Sbjct  497   SLWQLAKAYVGVNDSGNHQLISHWLNTHAVIEPFVIATNRQLSALHPVYKLLQPHYRDTM  556

Query  1172  HINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVDL  996
             +INA  RQ+L N  G++E +  P KYAMEMS+ +YK+ W FP+ +LP DL  RGMA+ D 
Sbjct  557   NINAFARQILINGGGILETTVYPAKYAMEMSSFIYKHYWTFPDQALPADLKKRGMAIEDP  616

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
              +P G+RL ++DYPYAVDGLEIW+AI++WV +Y +FYYK D  V  DTELQ WW E+ ++
Sbjct  617   EAPQGLRLRVKDYPYAVDGLEIWSAIESWVRDYISFYYKTDDDVRNDTELQTWWKEIREE  676

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH DKK E WWP++ +R  LID+CT IIWI+SALHA+VNFGQY  AGY P RPT+SR+FM
Sbjct  677   GHGDKKSELWWPKMQTRKELIDSCTIIIWIASALHASVNFGQYPIAGYMPNRPTISRQFM  736

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             PE G+ ++EEL+ NPDK  L+TITA  QTLLGIS+IEILSRH+SDE+YLGQR+  EWT +
Sbjct  737   PEKGTREFEELEKNPDKVFLRTITAQIQTLLGISIIEILSRHSSDEVYLGQRDSNEWTTE  796

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNS  276
              EALEAF RFG++L  IE +I++ N D  LKNR GPV +PYTL+FPT E G++GKGIPNS
Sbjct  797   NEALEAFSRFGERLAEIERKIVERNDDVSLKNRNGPVKMPYTLMFPTSEGGITGKGIPNS  856

Query  275   ISI  267
             +SI
Sbjct  857   VSI  859



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =  1040 bits (2689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/843 (61%), Positives = 632/843 (75%), Gaps = 13/843 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             K+KG VVLMKKN LD  D  AS +D++ +F+G KV+ +LIS++  DP     GK  K A 
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LEDW   +TSL AGESA+ VTF++ +  G PGA +++N+H +EFYLK+LTLED  G   V
Sbjct  78    LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              ++C SWVYPA +Y  DRVFFSN+ YLP +TP PL  +RE EL +LRG G GE KEWDRV
Sbjct  138   HYICNSWVYPAKRYTKDRVFFSNKTYLPRETPEPLLKYREEELVSLRGTGEGELKEWDRV  197

Query  2246  YDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYV  2067
             YDY YYNDLG P    PRP+LGG+ EYPYPRRGRTGRK T  DP+ ESRLP+    +IYV
Sbjct  198   YDYAYYNDLGVPPKN-PRPVLGGSQEYPYPRRGRTGRKPTTEDPETESRLPVTSSLDIYV  256

Query  2066  PRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRG  1893
             PRDE+FGHLK SDFL YALK+I Q++ P + S FD T  EFDSF+D+  +YE G  L   
Sbjct  257   PRDERFGHLKMSDFLAYALKAIAQIIQPALESVFDETPKEFDSFEDVLKIYEEGIDLPNQ  316

Query  1892  LLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
              L++ I KN  LE+ KE+ R+DG+   K+P PQVI   KTAWRTDEEFAREMLAG+NPV 
Sbjct  317   ALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVV  376

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I  L+ FPP+S LD + YG   ST T+ HI   LDGLTVE+A+   R+FILDHHD +M Y
Sbjct  377   IQLLKEFPPKSKLDRETYGGQNSTFTKSHIEQSLDGLTVEEALEKERLFILDHHDTLMPY  436

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEG  1353
               RIN  T  K+YA+RTLLFL+ DGTL+P+ IELSLPHP GD FG VS VYTP E GV  
Sbjct  437   LGRINT-TGNKVYASRTLLFLKDDGTLKPLVIELSLPHPDGDSFGAVSEVYTPGE-GVYD  494

Query  1352  SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTM  1173
             S+WQLAKAY   NDSG HQLISHWL THA IEP +IATNRQ S LHP++KLL PH+RDTM
Sbjct  495   SLWQLAKAYVGVNDSGNHQLISHWLQTHASIEPFVIATNRQPSVLHPVFKLLEPHYRDTM  554

Query  1172  HINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVDL  996
             +INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D 
Sbjct  555   NINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGMAVEDP  614

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
              +PHG+RL IEDYPYAVDGLE+W AI++WV +Y   YYK D  V  DTELQAWW EV ++
Sbjct  615   EAPHGLRLRIEDYPYAVDGLEVWYAIESWVQDYIPLYYKTDEDVQNDTELQAWWKEVREE  674

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH DKK EPWWP++ +R  LID+CT IIW++SALHAAV+FGQY  AGY P RPT+SR+FM
Sbjct  675   GHGDKKSEPWWPKMQTRKELIDSCTIIIWVASALHAAVSFGQYPIAGYLPNRPTISRQFM  734

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             P+  + ++EEL+ NPDK  LK+ITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  +
Sbjct  735   PKENTPEFEELEKNPDKVFLKSITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAAE  794

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNS  276
             KEALEAFE+FG K+  IE++I + N D  LKNRTGPV +PYT LFPT E G++G+GIPNS
Sbjct  795   KEALEAFEKFGDKVKEIEKKIDERNLDENLKNRTGPVKMPYTSLFPTSEGGVTGRGIPNS  854

Query  275   ISI  267
             +SI
Sbjct  855   VSI  857



>ref|NP_001280815.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82793.1| lipoxygenase [Malus domestica]
Length=885

 Score =  1040 bits (2689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/850 (61%), Positives = 632/850 (74%), Gaps = 24/850 (3%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK++G VVLMKKN L+L D+ AS+ D+  +  G++V  QLIS+ N DP     GK  KPA
Sbjct  44    KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW  K+T L A E+A+DVTF+W E +GVPGA I++N H NEFYLK+LTLED  G   
Sbjct  104   YLEDWITKITPLTAEETAFDVTFDWDEEIGVPGAFIIRNEHHNEFYLKSLTLEDVPGEGR  163

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE---  2259
             V FVC SWVYP +KY  DRVFF+N+ Y+ S TP PL+ FRE ELKNLRGD   E++E   
Sbjct  164   VHFVCNSWVYPTEKYKKDRVFFANKTYISSDTPVPLQKFREEELKNLRGDDDDEKRELQE  223

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL-L  2088
             WDRVY Y YY+DLG P  G    RP LGG+ ++PYPRR + GR+ T      E   P+ L
Sbjct  224   WDRVYGYAYYDDLGKPYKGLEYERPTLGGSSDFPYPRRVKIGRQAT------EKASPMML  277

Query  2087  PV-AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             PV   +YVPRDEKFGHLK SD + YALKSI Q+V P   +   A+QNEF S +D+  LYE
Sbjct  278   PVNIFVYVPRDEKFGHLKTSDAIAYALKSISQIVKPDELATLVASQNEFGSLNDVLKLYE  337

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  GLL + ++ N  LE  KE+ R DGEN  KFP PQVI   K+AWRTDEEFAREM
Sbjct  338   GGIRLPEGLL-KSVRDNIPLETIKELFRLDGENFLKFPVPQVIREDKSAWRTDEEFAREM  396

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I  L+ FPP S LD K YGD TS IT+E+IA  L GL++++AI +N++FILD
Sbjct  397   LAGINPVAIRLLKEFPPASKLDRKAYGDQTSLITKENIAHNLKGLSIDEAIDNNKLFILD  456

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD IM Y RRIN  T  K YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FGC   VYT
Sbjct  457   HHDSIMPYLRRINT-TSTKTYASRTLLFLQDDGTLKPLAIELSLPHPNGDQFGCTGKVYT  515

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P+ QGVE SIWQLAKAY A ND+G HQLISHWL THAV+EP IIATNRQLS LHP++KLL
Sbjct  516   PSSQGVESSIWQLAKAYVAVNDTGYHQLISHWLRTHAVMEPFIIATNRQLSVLHPVHKLL  575

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRD M++NAL RQ+L NA G++E +  P K++ME S+ +YKNWVFP  +LP DL  R
Sbjct  576   HPHFRDNMNVNALARQVLINASGILETTVFPAKFSMEWSSAMYKNWVFPEQALPVDLTKR  635

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D SS HGVRLLIEDYPYA DGLEIW AIKTWV +YC+FYYK D  V  D+ELQ+W
Sbjct  636   GMAVEDSSSSHGVRLLIEDYPYAADGLEIWFAIKTWVKDYCSFYYKTDETVQKDSELQSW  695

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +R  LI++CT IIWI+SA HAA+NFGQY Y GY P RP
Sbjct  696   WKELREEGHGDKKDEPWWPKMQTREELIESCTIIIWIASAYHAAINFGQYPYGGYLPNRP  755

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             + SR+FMPE G+ +YEELKTNP+KA LKT T   QTLLG++ IEILSRH  DE+YLG R+
Sbjct  756   STSRRFMPEEGTPEYEELKTNPEKAFLKTFTPELQTLLGMATIEILSRHTVDEVYLGHRD  815

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
               EWT D + L+A + F  KL  IEE I + N D +LKNRTGP  +PYTLL+P+ + GL+
Sbjct  816   TAEWTTDADILQASKNFRNKLKEIEECIKRKNKDKRLKNRTGPAKMPYTLLYPSSDPGLT  875

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  876   GKGIPNSVSI  885



>ref|XP_008388961.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=922

 Score =  1038 bits (2684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/847 (62%), Positives = 629/847 (74%), Gaps = 15/847 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KKIKGRVVLMKK  LDL D+ ASI+D++ + +G+ VS +LIS+ N DP     GK  KPA
Sbjct  78    KKIKGRVVLMKKIVLDLNDLKASILDRVHELLGKAVSLRLISSVNSDPENESTGKVGKPA  137

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LE+W   +T L AGE+A+DVTF+W E +GVPGA IV+N H +EFYLKT+TLED  G   
Sbjct  138   YLENWVTTITPLTAGETAFDVTFDWDEEIGVPGAFIVRNYHHSEFYLKTVTLEDVPGEGR  197

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--GERKEW  2256
             V FVC SWVYPADKY  DRVFF N  YLP  TP  L+ FRE EL NLRGD    GE +EW
Sbjct  198   VHFVCNSWVYPADKYKKDRVFFXNXTYLPGDTPKSLQKFREEELVNLRGDDEERGELQEW  257

Query  2255  DRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRGRTGR  TKTDP  ESRL L+  
Sbjct  258   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGRTGRPATKTDPNTESRLKLIQR  317

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               +YVPRDE+FG LK SD L Y LKSI QV+ P I +     +NEF++ +D+  LYEGG 
Sbjct  318   LNVYVPRDERFGPLKMSDLLAYVLKSIPQVLKPEIXALLLGNKNEFETMEDVLKLYEGGX  377

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L  G+L +HI  +   E+ KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE+LAG
Sbjct  378   ELPDGIL-KHISDSIPEEMFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAG  436

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             VNPV I RLQ FPP S LD + YGD TS IT+EHI   L+GL++++AI + ++FILDHHD
Sbjct  437   VNPVTIRRLQEFPPASKLDREAYGDQTSQITKEHIEHNLNGLSIDEAIKNKQLFILDHHD  496

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
               M Y RRIN  T  K YA+RTLLFL+ DGTL+PIAIELSLPH  GD+FGC+S VYTP+ 
Sbjct  497   AWMPYLRRINT-TSTKAYASRTLLFLKNDGTLKPIAIELSLPHLDGDQFGCISKVYTPSS  555

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             QG+E SIWQLAKAYA  NDSG HQL SHWL  HAV EP +IA NRQLS LHPI KLLHPH
Sbjct  556   QGIESSIWQLAKAYALVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPINKLLHPH  615

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FR+TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI RGMA
Sbjct  616   FRETMNANAAARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPTDLIKRGMA  675

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D S  HGVRLLIEDYPYA DGLE+W+AIKTWV +YC+FYYKND  V  D+ELQ+WW E
Sbjct  676   VEDSSXXHGVRLLIEDYPYAADGLELWSAIKTWVKDYCSFYYKNDQTVQNDSELQSWWKE  735

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             + + GH DKKDEPWWP++ +R  LI++CTTII+I+SA HAA+N+GQY+  G+ P RPT S
Sbjct  736   LREVGHXDKKDEPWWPKMQTRDELIESCTTIIYIASAHHAAINYGQYSXGGFVPNRPTJS  795

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPE G+ +YEEL+ NPDKA L T      TLLG++ +EILSRH  DE+YLGQR+  E
Sbjct  796   RRFMPEEGTPEYEELRXNPDKAFLXTFAPQLPTLLGMATVEILSRHPXDELYLGQRDTAE  855

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKG  288
             WT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL+ KG
Sbjct  856   WTTDADILQASEDFKKXLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGLTNKG  915

Query  287   IPNSISI  267
              P SI+I
Sbjct  916   XPTSINI  922



>gb|AGI16416.1| lipoxygenase [Malus domestica]
Length=868

 Score =  1038 bits (2684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/851 (61%), Positives = 636/851 (75%), Gaps = 13/851 (2%)
 Frame = -1

Query  2783  HADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GK  2619
             H +E KKIKGRVVLMKK  LD+ D+ ASI+D++ + +G+ VS +LIS+ N DP     GK
Sbjct  19    HKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKVVSLRLISSVNGDPENELKGK  78

Query  2618  RSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
               KPA+LE+W   +  L AGE+A+DVTF+W + +GVPGA +V+N H +EFYLKTLTLED 
Sbjct  79    VGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDV  138

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGT--G  2271
              G   V FVC SWVYPADKY  DRVFFSN+ Y+ S TP PL+ FRE EL NLRGD    G
Sbjct  139   PGEGRVHFVCNSWVYPADKYKKDRVFFSNKTYISSDTPKPLQKFREEELVNLRGDDEERG  198

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E +EWDRVYDY YYNDLG+PD G    RP+LGG+ EYPYPRRG+TGR  TKTDP  ESRL
Sbjct  199   ELQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRL  258

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
              L+ +  +YVPRDE+FG +K SD L Y LKSI QV+ P I       ++EF+S +++  L
Sbjct  259   KLIQILNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKL  318

Query  1916  YEGGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             YEGGL     +L++I  +T  EI KE+ R+DGE   KFP PQVI   K+AWRTDEEFARE
Sbjct  319   YEGGLELPDGILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARE  378

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             +LAGVNPV I RLQ FPP S LD + YGD TS IT+EHI   L+GLT+++AI +N++FIL
Sbjct  379   LLAGVNPVTIRRLQEFPPSSELDREAYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFIL  438

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             +HHD  M Y RRIN  T  K YA+RTLLFL  DGTL+PIAIELSLPHP GD+FGC+S VY
Sbjct  439   NHHDAWMPYLRRINT-TSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGDQFGCISKVY  497

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TP+ QG E S+WQ AK Y   NDSG HQL SHWL  HAV EP +IA NRQLS LHPI+KL
Sbjct  498   TPSSQGFESSLWQFAKGYVLVNDSGCHQLFSHWLRAHAVTEPFVIAANRQLSVLHPIHKL  557

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFR TM+ NA  RQ+LTNA GVIE      K++ME S+ +YK+W FP+ +LP DLI 
Sbjct  558   LHPHFRGTMNANASARQVLTNAGGVIEEIIFASKFSMEWSSAMYKDWTFPDQALPADLIK  617

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D S+ HGVRLLIEDYPYA DGLE+WTAIKTWV +YC+FYYKND MV  D+ELQ+
Sbjct  618   RGVAVEDSSASHGVRLLIEDYPYAADGLELWTAIKTWVKDYCSFYYKNDQMVQNDSELQS  677

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WW E+ + GH DK +EPWWP++ +   LI++CTTII+I+SA HAA+N+GQY+  G+ P R
Sbjct  678   WWKELREVGHGDKNEEPWWPKMQTCDELIESCTTIIYIASAHHAAINYGQYSTGGFVPNR  737

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PT+SR+FMPE G+ +YEEL+TNPDKA LKT      TLLG++ +EILSRH +DE+YLGQR
Sbjct  738   PTLSRRFMPEEGTPEYEELRTNPDKAFLKTFAPQLPTLLGMATVEILSRHPTDELYLGQR  797

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGL  300
             +  EWT D + L+A E F K L AIE +I KMN D +LKNR GP  +PYTLL+P+ E GL
Sbjct  798   DTAEWTTDADILQASEDFKKNLEAIEAKIEKMNKDERLKNRFGPAKIPYTLLYPSSEPGL  857

Query  299   SGKGIPNSISI  267
             + KG+P SI+I
Sbjct  858   TNKGVPTSINI  868



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =  1037 bits (2682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/844 (61%), Positives = 633/844 (75%), Gaps = 13/844 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-----NDDPGKRSKPA  2604
             KK+KG VVLMKKN LD  D  AS +D++ +F+G K++ +LIS++     N   GK  K A
Sbjct  20    KKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLGKAA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
              LEDW  ++TSL AGESA+ VTF++    G PGA +++N+H +EF+LK+LTLED  G   
Sbjct  80    HLEDWITRITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V ++C SW+YPA  Y  DRVFFSN+ YLP +TPA L  +RE EL +LRG G GE KEWDR
Sbjct  140   VHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVDLRGTGEGELKEWDR  199

Query  2249  VYDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             VYDY YYNDLG P    PRP+LGG  EYPYPRRGRTGRK TK DP+ ESRLP+     IY
Sbjct  200   VYDYAYYNDLGVPPKN-PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITSSLNIY  258

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSR  1896
             VPRDE+FGHLK SDFL YALK+I Q++ P + + FD T NEFDSF+D+  +YE G  L  
Sbjct  259   VPRDERFGHLKMSDFLTYALKAIAQIIQPALEAVFDVTPNEFDSFEDVLKIYEEGIDLPN  318

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               L++ I KN  LE+ KE+ R+DG+   K+P PQVI   KTAWRTDEEFAREMLAG+NPV
Sbjct  319   QALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPV  378

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I  LQ FPP+S LD ++YG+  STIT+ HI   LDGLTVE+A+   R+FILDHHD +M 
Sbjct  379   VIQLLQEFPPKSKLDSELYGNQNSTITKSHIEKSLDGLTVEEALEKERLFILDHHDTLMP  438

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y RRIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPHP GDKFG VS VYTP E GV 
Sbjct  439   YLRRINTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHPDGDKFGAVSEVYTPGE-GVY  496

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
              S+WQLAKA+   NDSG HQLISHW  THA IEP +IATNRQLS LHPI+KLL PHFRDT
Sbjct  497   DSLWQLAKAFVGVNDSGNHQLISHWTQTHASIEPFVIATNRQLSVLHPIFKLLEPHFRDT  556

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVD  999
             M+INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D
Sbjct  557   MNINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGMAVDD  616

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
               +PHG+RL I DYPYAVDGLE+W AI++WV +Y + +YK D  +  DTELQAWW EV +
Sbjct  617   PEAPHGLRLRINDYPYAVDGLEVWYAIESWVRDYISLFYKTDEDIQRDTELQAWWKEVRE  676

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK EPWWP++ +R  L+++CT IIW++SALHAAVNFGQY  AGY P RPT+SR+F
Sbjct  677   EGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAVNFGQYPIAGYLPNRPTISRQF  736

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MP+  + ++ EL+ NPDK   KTITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  
Sbjct  737   MPKENTPEFAELEKNPDKVFFKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAA  796

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             +KEAL+AFE+FG+K+  IE+ + + N D  LKNRTG V +PYTLLFPT E G++G+GIPN
Sbjct  797   EKEALDAFEKFGEKVKEIEKNMDERNDDVNLKNRTGLVKMPYTLLFPTSEGGVTGRGIPN  856

Query  278   SISI  267
             S+SI
Sbjct  857   SVSI  860



>ref|XP_008340970.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Malus 
domestica]
Length=850

 Score =  1037 bits (2682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/800 (64%), Positives = 634/800 (79%), Gaps = 16/800 (2%)
 Frame = -1

Query  2624  GKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE  2448
             GK  + A+LE W    TSL AGE+++ ++ +W ES GVPGA++++N+H ++FYLKT+TLE
Sbjct  53    GKLGEVAYLEKWVTTTTSLSAGEASFSISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  112

Query  2447  D-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG  2271
             D  G   + FVC SWVYPA +Y Y+R+FF N+AYLPS+TP  L P+RE EL NLRG G+G
Sbjct  113   DVPGHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSETPELLHPYREDELVNLRGSGSG  172

Query  2270  ERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRL  2097
             E KEWDRVYDY YYNDLG PD G    RP+LGG+ EYPYPRRGRTGR+ TKTDP  ESRL
Sbjct  173   EXKEWDRVYDYAYYNDLGSPDKGPEYARPVLGGSNEYPYPRRGRTGREPTKTDPNSESRL  232

Query  2096  PLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSL  1917
             PLL + +IYVP+DE+FGH+K SDFL Y LKS+ Q+++P + S  D T NEFD+F+D+ +L
Sbjct  233   PLLSL-DIYVPKDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFEDVLNL  291

Query  1916  YEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAR  1743
             Y+GG  L  G  L+ I++    E+ KE++RSDGE   KFP P VI   ++AWRTDEEFAR
Sbjct  292   YDGGIKLPNGPTLKKIRECIPWELLKELIRSDGERFLKFPMPDVIKRDRSAWRTDEEFAR  351

Query  1742  EMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFI  1563
             EMLAGVNPV I+RLQ FPP S LDPKVYG+  S+I  EHIA  ++GLTV +AI SNR+FI
Sbjct  352   EMLAGVNPVNITRLQEFPPVSKLDPKVYGNQNSSIREEHIASNMNGLTVNEAIESNRLFI  411

Query  1562  LDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNV  1383
             LDHHD +  Y RRIN+ T  K YATRTLL LQ+DGTL+P+AIELSLPHP GD+ GCVS V
Sbjct  412   LDHHDALXXYLRRINS-THTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGDRHGCVSTV  470

Query  1382  YTPAEQGVEG---SIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHP  1212
             + P  QG +G   S+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IAT+RQLS LHP
Sbjct  471   FNPPGQGKKGXEESVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATHRQLSELHP  530

Query  1211  IYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPN  1032
             I+KLLHPHFRDTM+INAL RQ+L NADGV+E +  PG+++MEMSAV+YK+WVF + +LP 
Sbjct  531   IHKLLHPHFRDTMNINALARQILINADGVLEKTVFPGRFSMEMSAVIYKSWVFTDQALPA  590

Query  1031  DLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDT  852
             DL  RGMAV+D + PHG+RLLIEDYP+AVDGLEIW+AI+TWV EYC  YY++D  V  D+
Sbjct  591   DLCKRGMAVLDKTCPHGLRLLIEDYPFAVDGLEIWSAIQTWVDEYCCLYYESDDAVQVDS  650

Query  851   ELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGY  672
             ELQ WWTE+   GH DKK+EPWWP++ +R  LI++CT IIW++SALHAAVNFGQY+YAGY
Sbjct  651   ELQDWWTELRNVGHGDKKNEPWWPKMQTRDELIESCTIIIWVASALHAAVNFGQYSYAGY  710

Query  671   NPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIY  492
              P RPTVSR+FMPE G+A+Y EL++NPD A LKTITA  QTLLG+SLIE+LSRH++DE+Y
Sbjct  711   LPNRPTVSRRFMPEAGTAEYAELESNPDAAFLKTITAQLQTLLGVSLIEVLSRHSTDEVY  770

Query  491   LGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP--  318
             LGQ + PEWT D EAL AF RFG+KL+ IE+ I + N D +LKNR GPV++PYTLL+P  
Sbjct  771   LGQNDTPEWTSDAEALAAFARFGEKLMDIEKGINERNKDMRLKNRVGPVDMPYTLLYPNT  830

Query  317   ---TGEEGLSGKGIPNSISI  267
                + E GL+GKGIPNS+SI
Sbjct  831   SDTSREGGLTGKGIPNSVSI  850



>ref|XP_007143236.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
 gb|ESW15230.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
Length=855

 Score =  1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/855 (61%), Positives = 650/855 (76%), Gaps = 21/855 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             +  K++KGRVVLMKK  LD  D+ A+++D++ + +G+ VS QLISA + DP     GK  
Sbjct  4     ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSIQLISATSPDPAKGLLGKHG  63

Query  2612  KPAFLEDW-GKLTSLV-AGESAYDVTFEW-RESLGVPGAVIVKNNHANEFYLKTLTLED-  2445
             + ++LE W   ++SL  A ++ + VTF+W  E +GVPGA I++N+H ++FYLKT+T+ED 
Sbjct  64    EESYLERWVSTISSLTSASDTEFWVTFDWDHEKMGVPGAFIIRNHHKSQFYLKTVTIEDI  123

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGER  2265
              G   V FVC SWVYPA +Y +DRVFFSN+AYLP QTP PLR  RE EL+ LRG G G+ 
Sbjct  124   PGHGPVNFVCNSWVYPAHRYTHDRVFFSNKAYLPCQTPGPLRKLREQELEVLRGKGVGKL  183

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
              EWDRVYDY YYNDLG PD+G    RP+LGG+  +PYPRRGRTGR  TKTDPK ESRL L
Sbjct  184   NEWDRVYDYAYYNDLGTPDDGPHYTRPVLGGS-NFPYPRRGRTGRPHTKTDPKTESRLHL  242

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L +  +YVPRDE+FGH+K SDFL YALKS+ QV++P I S  D T NEFD+F+D+ S+YE
Sbjct  243   LNL-NVYVPRDEQFGHVKFSDFLAYALKSVAQVLVPEIKSLCDKTINEFDTFEDVLSIYE  301

Query  1910  GGLS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             G +    G L   +++    EI +E++RSDGE   KFP P VI A+KTAWRTD+EFAREM
Sbjct  302   GSIKMPSGPLAVKLRELVPYEIVRELIRSDGEKFLKFPVPDVIKANKTAWRTDDEFAREM  361

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAGVNPV I RLQ FPP S LDPK+YGD TS+I   HI + L+GLT+++AI   R+FILD
Sbjct  362   LAGVNPVIIRRLQEFPPASKLDPKLYGDQTSSIREVHIENSLNGLTIDEAIQKMRLFILD  421

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y  RIN+ T+ K YA+RTLLFLQ DGTL+P+AIELSLPHP G++ G VS V+T
Sbjct  422   HHDALMPYISRINS-TNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGEQHGAVSKVFT  480

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PA +GV  S+WQLAKAYAA NDSG HQL+SHWL THAVIEP IIAT+RQLS LHPI+KLL
Sbjct  481   PAREGVSASVWQLAKAYAAVNDSGYHQLVSHWLYTHAVIEPFIIATHRQLSILHPIHKLL  540

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
              PHFRDTMHINAL R  L NA GV+E +  PGK+A+EMSA++YK+WVF   +LP DL+ R
Sbjct  541   KPHFRDTMHINALARHTLINAGGVLEKTVFPGKFALEMSAIIYKSWVFTEQALPADLLKR  600

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+AV D S  HG+RL+IEDYP+AVDGLEIW AI+TWV EYCN YY ++ MV  D ELQ W
Sbjct  601   GIAVPDSSCRHGIRLVIEDYPFAVDGLEIWDAIETWVREYCNVYYTSNDMVEGDDELQNW  660

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W +V  +GH D KD  WW  + ++  LI++CT IIW++SA HAAVNFGQY +AGY P RP
Sbjct  661   WKDVRNEGHGDLKDRKWWSEMKTKEELIESCTIIIWLASAFHAAVNFGQYPFAGYLPNRP  720

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +YEELK++PD A LKTITA  QTLLG+SLIE+LSRH+++E+YLGQ E
Sbjct  721   TVSRRFMPEPGTPEYEELKSDPDLAFLKTITAQFQTLLGVSLIEVLSRHSTEEVYLGQCE  780

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
             +PEWT D E L AFERF + L+ IE  I++ N D +LKNR G V VPYTLL+P     + 
Sbjct  781   NPEWTLDAEPLAAFERFRQNLLKIENNIMERNKDKRLKNRNGEVKVPYTLLYPNTSDYSK  840

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNSISI
Sbjct  841   EGGLTGKGIPNSISI  855



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score =  1036 bits (2678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/801 (64%), Positives = 619/801 (77%), Gaps = 13/801 (2%)
 Frame = -1

Query  2636  NDDPGKRSKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKT  2460
             N+  G+  K A+LE W   +T L A E+ + +TF+W E++GVPGA I++N+H ++FYLKT
Sbjct  5     NELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKT  64

Query  2459  LTLED-GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRG  2283
             +TLED  G   + FVC SWVYP  +Y YDRVFFSN+ YLP QTP PLR +R  EL NLRG
Sbjct  65    VTLEDVPGHGRIHFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRG  124

Query  2282  DGTGERKEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKY  2109
             +G GE KEWDRVYDY +YNDLG+PD G    RP+LGG+ EYPYPRRGRTGRK TKTDP  
Sbjct  125   NGKGELKEWDRVYDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNS  184

Query  2108  ESRLPLLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDD  1929
             E RLPL+ + +IYVPRDE+FGHLK SDFL YALKS+ Q+++P I S  D T NEFDSFDD
Sbjct  185   ERRLPLISL-DIYVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDD  243

Query  1928  MNSLYEGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDE  1755
             + +LYEGG  L     +  I+     E+ KE++R+DGE   KFP P VI   ++AWRTDE
Sbjct  244   VLNLYEGGIKLPNSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDE  303

Query  1754  EFAREMLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSN  1575
             EFAREMLAGVNPV ISRLQ FPP S LDPKVYG+  S+ITR  I   ++ LT+++AI + 
Sbjct  304   EFAREMLAGVNPVIISRLQEFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENK  363

Query  1574  RVFILDHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGC  1395
             ++F LDHHD +M Y RRIN+ T+ K YA+RTLL LQ DGTL+P+AIELSLPHP GD  G 
Sbjct  364   KLFTLDHHDALMPYLRRINS-TNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGDHHGA  422

Query  1394  VSNVYTPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLH  1215
             VS V+TPAE GVEGS+WQLAKAYAA NDSG HQL+SHWL+THAVIEP +IATNRQLS LH
Sbjct  423   VSKVFTPAENGVEGSVWQLAKAYAAVNDSGYHQLVSHWLDTHAVIEPFVIATNRQLSVLH  482

Query  1214  PIYKLLHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLP  1035
             PIYKLLHPHFRDTM+INAL RQ+L NA GV+E +  P KYAMEMSAV YKNWVF   +LP
Sbjct  483   PIYKLLHPHFRDTMNINALARQILINAGGVLENTVFPAKYAMEMSAVSYKNWVFTEQALP  542

Query  1034  NDLINRGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTD  855
              DL+ RG+A  D S PHG++LLIEDYPYAVDGLEIW AI+TWV EYC+FYY  D ++  D
Sbjct  543   ADLLKRGVAEPDTSQPHGIKLLIEDYPYAVDGLEIWAAIETWVKEYCSFYYPRDHLIQGD  602

Query  854   TELQAWWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAG  675
              ELQ+WW E+   GH DK+DEPWWP + ++  L+ TCT IIW++SALHAAVNFGQY YAG
Sbjct  603   NELQSWWEELRNVGHGDKRDEPWWPEMQTQAELVQTCTIIIWVASALHAAVNFGQYPYAG  662

Query  674   YNPCRPTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEI  495
             Y P RPTVSR+FMPEPG+ +Y EL+ NPD A LKTITA  QTLLG+SLIEILSRH++DE+
Sbjct  663   YLPNRPTVSRRFMPEPGTPEYAELEKNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEV  722

Query  494   YLGQREHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-  318
             YLGQR+ PEWT D E L AFERFG +L+ IE RIL+MN D + KNR G V VPYTLL+P 
Sbjct  723   YLGQRDTPEWTLDNEPLAAFERFGNRLLEIENRILEMNNDKRWKNRVGAVKVPYTLLYPN  782

Query  317   ----TGEEGLSGKGIPNSISI  267
                 + E GL+GKGIPNS+SI
Sbjct  783   TSDYSREGGLTGKGIPNSVSI  803



>emb|CDY46325.1| BnaC01g31590D [Brassica napus]
Length=882

 Score =  1035 bits (2677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/848 (61%), Positives = 650/848 (77%), Gaps = 18/848 (2%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             I+G VV+MKKN LD  D  AS++D+I + +G++VS  LIS+   DP     G+  K A L
Sbjct  37    IEGEVVVMKKNLLDFKDTMASLLDRIHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  96

Query  2597  EDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLEDGGAAGVQ  2424
             E W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN H ++FYLK+LTL +     + 
Sbjct  97    EKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNQHRSQFYLKSLTLRNSQGGAIH  156

Query  2423  FVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVY  2244
             FVC SW+YP+ +Y  DRVFFSNQAYLPS+TP  ++  RE ELKNLRG+  GE KEWDRVY
Sbjct  157   FVCNSWIYPSHRYRSDRVFFSNQAYLPSETPELVKELREEELKNLRGNEKGELKEWDRVY  216

Query  2243  DYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             DY YYNDLG PD G    RP+LGG+PE+PYPRRG+TGRK TK+DPK ESRL LL +  IY
Sbjct  217   DYAYYNDLGAPDKGPDSARPVLGGSPEFPYPRRGKTGRKPTKSDPKSESRLALLNL-NIY  275

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSR  1896
             VPRDE+F H+K SDFL YALKS+ QV++P IAS  D T NEFDSF+D+  LY+G   L+ 
Sbjct  276   VPRDERFSHVKFSDFLAYALKSVTQVIVPEIASLCDKTINEFDSFEDVFHLYDGSIRLAN  335

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
             G  +  ++     E+ +E++R+DGE   KFP P V+  S++AWRTDEEFAREMLAG+NPV
Sbjct  336   GHTISKLRDIIPWEMFRELIRNDGERFLKFPLPDVLKQSRSAWRTDEEFAREMLAGLNPV  395

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              ISRL+ FPP+S LD   YG+  S+I   HI   ++G +V++A+  N++F+LDHHD +M 
Sbjct  396   VISRLKDFPPKSNLDSAKYGNQNSSIREGHIEPHMNGTSVQEALEQNKLFLLDHHDALMP  455

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS ++TP+E+GVE
Sbjct  456   YLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKIFTPSEKGVE  514

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
             G++WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPIYKLLHPHFRDT
Sbjct  515   GTVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIYKLLHPHFRDT  574

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDL  996
             M+INAL R +L N+DGV+E +  P +YAMEMS+ +YK+WVF + +LP DL+ RG+AV D 
Sbjct  575   MNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKSWVFTDQALPMDLLKRGVAVEDP  634

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
             SS +GV+LLIEDYP+AVDGLEIW+AIKTWVTEYC+ YYKND  V TDTE+Q+WWTE+  +
Sbjct  635   SSDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCSIYYKNDRTVQTDTEIQSWWTELRTE  694

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH D + E WWP + +R  L++TCT IIWI+SALHAAVNFGQY YAG+ P RPTVSR+FM
Sbjct  695   GHGDIQHESWWPSMQTRDDLMETCTIIIWIASALHAAVNFGQYPYAGFLPNRPTVSRRFM  754

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             PEPG+ +Y EL+ N + A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+ P WT D
Sbjct  755   PEPGTKEYTELEENEEVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRDSPNWTAD  814

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEGLSGK  291
              E LEAF+RFGK L  IE  I++ N D KLKNR+GPVN+PYTLL+P     T E GL+GK
Sbjct  815   DEPLEAFKRFGKSLEVIENNIIRRNNDKKLKNRSGPVNIPYTLLYPNTTDYTREGGLTGK  874

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  875   GIPNSVSI  882



>ref|XP_008359870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=885

 Score =  1035 bits (2677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/850 (61%), Positives = 629/850 (74%), Gaps = 24/850 (3%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPA  2604
             KK++G VVLMKKN L+L D+ AS+ D+  +  G++V  QLIS+ N DP     GK  KPA
Sbjct  44    KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
             +LEDW  K+T L A E+A+DVTF+W E +GVPGA I++N H NEFYLK+LTLED  G   
Sbjct  104   YLEDWITKITPLTAEETAFDVTFDWDEEIGVPGAFIIRNEHHNEFYLKSLTLEDVPGEGR  163

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE---  2259
             V F C SWVYP  KY  DRVFF+N+ Y+ S TP PL+ FRE ELKNLRGD   E++E   
Sbjct  164   VHFXCNSWVYPXXKYKKDRVFFANKTYISSDTPVPLQKFREEELKNLRGDDDDEKRELQE  223

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL-L  2088
             WDRVY Y YY+DLG P  G    RP LGG+ ++PYPRR + GR+ T      E   P+ L
Sbjct  224   WDRVYGYAYYDDLGKPYKGLEYERPTLGGSSDFPYPRRVKIGRQAT------EKASPMML  277

Query  2087  PV-AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             PV   +YVPRDEKFGHLK SD + YALKSI Q+V P   +   A+QNEF S +D+  LYE
Sbjct  278   PVNIFVYVPRDEKFGHLKTSDAIAYALKSISQIVKPDELATLVASQNEFGSLNDVLKLYE  337

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             GG  L  GLL + ++ N  LE  KE+ R DGEN  KFP PQVI   K+AWRTDEEFAREM
Sbjct  338   GGIRLPEGLL-KSVRDNIPLETIKELFRLDGENFLKFPVPQVIREDKSAWRTDEEFAREM  396

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV I  L+ FPP S LD K YGD TS IT+E+IA  L GL++++AI + ++FILD
Sbjct  397   LAGINPVAIRLLKEFPPASKLDRKAYGDQTSLITKENIAHNLKGLSIDEAIDNXKLFILD  456

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD IM Y RRIN  T  K YA+RTLLFLQ DGTL+P+AIELSLPHP GD+FGC   VYT
Sbjct  457   HHDSIMPYLRRINT-TSTKTYASRTLLFLQDDGTLKPLAIELSLPHPNGDQFGCTGKVYT  515

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             P+ QGVE SIWQLAKAY A ND+G HQLISHWL THAV+EP IIATNRQLS LHP++KLL
Sbjct  516   PSSQGVESSIWQLAKAYVAVNDTGYHQLISHWLRTHAVMEPFIIATNRQLSVLHPVHKLL  575

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRD M++NAL RQ+L NA G++E +  P K++ME S+ +YKNWVFP  +LP DL  R
Sbjct  576   HPHFRDNMNVNALARQVLINASGILETTVFPAKFSMEWSSAMYKNWVFPEQALPVDLTKR  635

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             GMAV D SS HGVRLLIEDYPYA DGLEIW AIKTWV +YC+FYYK D  V  D+ELQ+W
Sbjct  636   GMAVEDSSSSHGVRLLIEDYPYAADGLEIWFAIKTWVKDYCSFYYKTDETVQKDSELQSW  695

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             W E+ ++GH DKKDEPWWP++ +R  LI++CT IIWI+SA HAA+NFGQY Y GY P RP
Sbjct  696   WKELREEGHGDKKDEPWWPKMQTREELIESCTIIIWIASAYHAAINFGQYPYGGYXPNRP  755

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             + SR+FMPE G+ +YEELKTNP+KA LKT T   QTLLG++ IEILSRH  DE+YLG R+
Sbjct  756   STSRRFMPEEGTPEYEELKTNPZKAFLKTFTPELQTLLGMATIEILSRHTVDEVYLGHRD  815

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLS  297
               EWT D + L+A + F  KL  IEE I + N D +LKNRTGP  +PYTLL+P+ + GL+
Sbjct  816   TAEWTTDADILQASKNFRNKLKEIEECIKRKNKDKRLKNRTGPAKMPYTLLYPSSDPGLT  875

Query  296   GKGIPNSISI  267
             GKGIPNS+SI
Sbjct  876   GKGIPNSVSI  885



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =  1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/844 (61%), Positives = 629/844 (75%), Gaps = 13/844 (2%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKRSKPAF  2601
             K+KG VVLMKKN LD  D  AS +D + +F+G KV+ +LIS+     EN   GK  KPA 
Sbjct  20    KVKGMVVLMKKNVLDFNDFNASFLDHLHEFLGNKVTLRLISSDVADSENGSKGKLGKPAH  79

Query  2600  LEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGV  2427
             LEDW   +T L  GESA+ VTF+     G PGA  ++NNH +EFYLK+LTLED  G   V
Sbjct  80    LEDWITTVTPLTVGESAFKVTFDCENGFGFPGAFTIRNNHFSEFYLKSLTLEDVPGHGTV  139

Query  2426  QFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRV  2247
              FVC SWVYPA  Y  DRVFF N+ YLPSQTP PL  +RE EL  LRG G GE KEWDRV
Sbjct  140   HFVCNSWVYPAKNYKKDRVFFCNKTYLPSQTPEPLLTYREEELVALRGTGEGELKEWDRV  199

Query  2246  YDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYV  2067
             YDY YYNDLG P    PRP+LGG+ EYPYPRRGRTGRK TK DP  ES+LP+     +YV
Sbjct  200   YDYAYYNDLGVPPKN-PRPVLGGSEEYPYPRRGRTGRKPTKEDPNTESKLPITSSLNVYV  258

Query  2066  PRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRG  1893
             PRDE+FGHLK SDFL + LK+I Q++ P + + FD T  EFDSF+D+  +YE G  L   
Sbjct  259   PRDERFGHLKMSDFLAFNLKAIVQIIQPALEAVFDETPKEFDSFEDVLEIYEKGIDLPNQ  318

Query  1892  LLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVC  1713
                + I+ N   E+ +E+ R+DG    K+P PQ+I   KTAWRTDEEF REMLAG+NPV 
Sbjct  319   SFFDEIRNNIPFELLREIFRTDGAKFLKYPKPQIIKEDKTAWRTDEEFTREMLAGLNPVV  378

Query  1712  ISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLY  1533
             I  L+ FPP+S LD   YG+  STI + HI   LDGL VE+A+   R+FILDHHD +M Y
Sbjct  379   IRLLEEFPPKSKLDIGKYGNQNSTIAKTHIEHNLDGLNVEEALQKERLFILDHHDTLMPY  438

Query  1532  ARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE-QGVE  1356
              RR+N  T  K YA+RTLLFL++DGTL+P+AIELSLPHP GD++G VS VYTPA  +GV+
Sbjct  439   LRRVNGTT-TKTYASRTLLFLKEDGTLKPLAIELSLPHPDGDEYGAVSEVYTPASGEGVD  497

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
              S+WQLAKAYAA NDSG HQLISHWLNTHA IEP +IATNRQLS LHP+YKLL PH+RDT
Sbjct  498   DSLWQLAKAYAAVNDSGNHQLISHWLNTHAAIEPFVIATNRQLSALHPVYKLLDPHYRDT  557

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVD  999
             M+INA  RQ+L N  G++E +  P KYAMEMS+ +YK+ W FP+ +LP DL  RGMAV D
Sbjct  558   MNINAFARQILINGGGILENTVYPAKYAMEMSSFIYKHYWTFPDQALPADLKKRGMAVED  617

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
               +P+G+RL I+DYPYAVDGLEIW+AI++WV +Y +FYYK +  V  DTELQ+WW EV +
Sbjct  618   PEAPNGLRLRIKDYPYAVDGLEIWSAIESWVRDYISFYYKTNEDVLNDTELQSWWKEVRE  677

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK EPWWP++ +   LID+CT IIWI+SALHAAVNFGQY  AGY P RPTVSR+F
Sbjct  678   EGHGDKKSEPWWPKMQTCEELIDSCTIIIWIASALHAAVNFGQYPIAGYLPNRPTVSRRF  737

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MP  GS ++EEL+ NP+K  L+TITA  QTLLG+S+IE+LSRH++DE+YLGQR+  EWT 
Sbjct  738   MPRKGSKEFEELEKNPEKVFLRTITAQIQTLLGVSIIEVLSRHSTDEVYLGQRDSKEWTA  797

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             + EALEAF RFG++LV IE++I++ N D  LKNR GPV +PYTLLFPT E G++GKGIPN
Sbjct  798   ENEALEAFSRFGERLVEIEKKIVERNEDVSLKNRNGPVKMPYTLLFPTSEGGITGKGIPN  857

Query  278   SISI  267
             S+SI
Sbjct  858   SVSI  861



>ref|XP_010511287.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic isoform 
X1 [Camelina sativa]
Length=886

 Score =  1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/852 (61%), Positives = 647/852 (76%), Gaps = 22/852 (3%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             I+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP     G+  K A L
Sbjct  37    IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  96

Query  2597  EDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE---DGGAA  2433
             E W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL    +G   
Sbjct  97    EKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPEGEGG  156

Query  2432  GVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERKEW  2256
              + F+C SW+YP  +Y  DR FFSN+AYLPS+TP  ++  RE EL NLRG+  G E KEW
Sbjct  157   PIHFICNSWIYPNHRYRSDRFFFSNKAYLPSKTPELVKELREEELMNLRGNEKGGELKEW  216

Query  2255  DRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY  YNDLG P+ G    R +LGG+PE PYPRRG+TGRK  K DPK ESRL  L +
Sbjct  217   DRVYDYACYNDLGAPEKGPHSVRLVLGGSPELPYPRRGKTGRKPNKADPKSESRLAFLNL  276

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               IYVPRDE+F H+K SDFL YALK++ QV++P I+S  D T NEFDSF+++  LY+G  
Sbjct  277   -NIYVPRDERFSHVKFSDFLAYALKAVTQVLVPEISSVCDKTINEFDSFENVFHLYDGSI  335

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L+ G  +  +++    E+ +E++R+DGE   KFP P ++  S++AWRTDEEFAREMLAG
Sbjct  336   KLANGHTISKLREIIPWEMFRELVRNDGERFLKFPLPDILKESRSAWRTDEEFAREMLAG  395

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++GL+V++A+  N+++ILDHHD
Sbjct  396   LNPVVISRLQEFPPKSNLDSTKYGNQNSSIREEHIESYMNGLSVQEALEHNKLYILDHHD  455

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS V+TPAE
Sbjct  456   ALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKVFTPAE  514

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              G+EGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPIYKLLHPH
Sbjct  515   TGIEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIYKLLHPH  574

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INAL R +L N+DGV+E +  PG+YAME+S+ +YKNWVF + +LP DL+ RG+A
Sbjct  575   FRDTMNINALARHVLINSDGVLERTVFPGRYAMELSSSIYKNWVFTDQALPKDLLKRGLA  634

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D SS +GV+LLIEDYPYAVDGLEIW+AIKTWVTEYC+FYYKND  V TD E+Q+WWTE
Sbjct  635   VEDPSSDNGVKLLIEDYPYAVDGLEIWSAIKTWVTEYCSFYYKNDKTVQTDIEIQSWWTE  694

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             +  KGH DK+ E WWP + +R  LI++CT IIWI+SALHAAVNFGQY YAG+ P RPTVS
Sbjct  695   LRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAVNFGQYPYAGFLPNRPTVS  754

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPEPG+ +Y EL  + D A LKTIT   QTLLGIS+IE LS H++DEIYLGQRE P 
Sbjct  755   RRFMPEPGTVEYTELAEDTDVAFLKTITPQLQTLLGISIIETLSMHSTDEIYLGQRESPN  814

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEG  303
             WT D EALEAF+RFGK+L  IE  I+K N D + KNRTGPVN+PYTLL+P     T E G
Sbjct  815   WTADDEALEAFKRFGKELELIENNIIKRNNDKRFKNRTGPVNIPYTLLYPNTTDYTREGG  874

Query  302   LSGKGIPNSISI  267
             L+GKGIPNS+SI
Sbjct  875   LTGKGIPNSVSI  886



>ref|XP_004231274.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=841

 Score =  1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/843 (61%), Positives = 631/843 (75%), Gaps = 16/843 (2%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA---ENDDPGKRSKPA  2604
             E KKI G VV++KK  L+L D    +  ++ + +G KV+ QLIS+   ++++ GK   PA
Sbjct  8     ESKKINGTVVVVKKRALEL-DPSEVVPQRVYEILGDKVTLQLISSVSGDSENKGKLGNPA  66

Query  2603  FLEDWGKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE--DGGAAG  2430
              L D  K    V  ES + VTF+  E  G PGA I+KN + NEF+LKTLTLE  D    G
Sbjct  67    HLRDENK----VGDESKFSVTFDLDEEFGAPGAFIIKNFNPNEFFLKTLTLEVDDPSHGG  122

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             + FVC SWVYPA+ Y  DR+FF NQA+LPS+TP  L  +RE EL NLRG+G G+ +EWDR
Sbjct  123   MHFVCNSWVYPAENYKSDRIFFVNQAWLPSETPVKLCWYREEELLNLRGNGIGKLEEWDR  182

Query  2249  VYDYDYYNDLGDPDNGKP--RPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAE  2076
             VYDY YYNDLG+P+ G    RPILGG+ +YPYPRRGRT R  TKTDP  ESRLPLL    
Sbjct  183   VYDYAYYNDLGEPEKGSAYVRPILGGSTKYPYPRRGRTSRPPTKTDPNSESRLPLLMSFG  242

Query  2075  IYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGGLSR  1896
             IYVPRDEKF  LK +DF+G ALK I Q+++P + S  +   NEF+SF+D+  +Y GG++ 
Sbjct  243   IYVPRDEKFAPLKMTDFIGIALKVIVQLLVPELESLGNINLNEFNSFEDILKIYGGGVN-  301

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               L   + + ++ E+ K+ ++S G    K+P PQVI   K+AWRTDEEFAREMLAG+NPV
Sbjct  302   --LPNDVLQRSSAEMLKKFIQSSGHEFLKYPMPQVIKEDKSAWRTDEEFAREMLAGINPV  359

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
             CI  L+ FPP S LDPKVYG+ TS I+REHI ++LDGLT+E+ I  N++FILDHHD +M 
Sbjct  360   CICGLKEFPPISKLDPKVYGNQTSKISREHIQNQLDGLTIEEVIKGNQLFILDHHDTLMP  419

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y R+IN  T  KIYA+RTL FLQKDGTL+P+ IELSLPHP GD+ G +S V+TP E G+E
Sbjct  420   YMRQINM-TSTKIYASRTLFFLQKDGTLKPLGIELSLPHPDGDQHGFISKVFTPQEDGIE  478

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
              SIWQLAKAY A NDSGVHQLISHWL+THA+IEPI+IATNRQLS LHPIYKLLHPHFRDT
Sbjct  479   ASIWQLAKAYVAVNDSGVHQLISHWLHTHAIIEPIVIATNRQLSVLHPIYKLLHPHFRDT  538

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDL  996
             MHINAL RQ L NA G++E +  P KYAMEM++  YK+WVFP  +LP DLI RG+A+ D 
Sbjct  539   MHINALARQTLLNAGGILEQTVFPTKYAMEMTSAAYKDWVFPEQALPADLIKRGVAIEDP  598

Query  995   SSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQK  816
              S  GVRLLI+DYPYAVDGLEIWTAIK+WV EYC  YYK D M+  DTELQAWW E+ ++
Sbjct  599   ESEKGVRLLIQDYPYAVDGLEIWTAIKSWVQEYCTIYYKTDDMIQKDTELQAWWKELQEE  658

Query  815   GHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFM  636
             GH DKKDEPWWP++ +   L D+CT IIWI+SALHAA+NFGQY Y GY P RP++SR+ M
Sbjct  659   GHGDKKDEPWWPKMQTLKELTDSCTIIIWIASALHAAINFGQYPYGGYLPNRPSMSRRLM  718

Query  635   PEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKD  456
             PEPGS +YEELK NP+K  L+TIT   QTL+GIS IEILS H+SDEIYLGQR+ PEWT D
Sbjct  719   PEPGSPEYEELKRNPEKVYLRTITPQLQTLIGISAIEILSTHSSDEIYLGQRDTPEWTND  778

Query  455   KEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPNS  276
             K  L+A ERFGKKL  I E+I+KMN D K KNR GP  +PYTLL+   E GL+GKGIPNS
Sbjct  779   KAPLQALERFGKKLAEIAEKIIKMNNDKKWKNRMGPTKMPYTLLYHISEPGLTGKGIPNS  838

Query  275   ISI  267
             +SI
Sbjct  839   VSI  841



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =  1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/848 (61%), Positives = 632/848 (75%), Gaps = 13/848 (2%)
 Frame = -1

Query  2780  ADEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKR  2616
              +E KK+KG VVLMKKN LD  D  AS +D++ +F+G K++ +LIS+     EN   GK 
Sbjct  13    GNETKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSENGSKGKL  72

Query  2615  SKPAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-G  2442
              K A LEDW   +TSL AGESA+ VTF++  + G PGA ++KN+H +EF L++LTLED  
Sbjct  73    GKAAHLEDWITTITSLTAGESAFKVTFDYESNFGYPGAFLIKNSHFSEFLLRSLTLEDVP  132

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERK  2262
             G   V ++C SW+YPA  Y  DRVFFSN+ YLP +TPA L  +RE EL +LRG G GE K
Sbjct  133   GHGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELK  192

Query  2261  EWDRVYDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             EWDRVYDY YYNDLG P    PRP+LGG  EYPYPRRGRTGRK TK DP+ ESRLP+   
Sbjct  193   EWDRVYDYAYYNDLGVPPKN-PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITSS  251

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
              +IYVPRDE+FGHLK SDFL YALK+I Q + P + + FD T  EFDSF+D+  +YE G 
Sbjct  252   LDIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDSFEDVLKIYEEGI  311

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L    L++ I KN  LE+ KE+ R+DG+   KFP PQVI   KTAWRTDEEFAREMLAG
Sbjct  312   DLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIKEDKTAWRTDEEFAREMLAG  371

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV I  LQ FPP+S LD + YG+  STIT+ HI   LDGLTVE+A+   R+FILDHHD
Sbjct  372   LNPVVIQLLQEFPPKSKLDSESYGNQNSTITKSHIEHNLDGLTVEEALEKERLFILDHHD  431

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y  RIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPHP GDKFG VS VYTP E
Sbjct  432   TLMPYLGRINT-TPTKTYASRTLLFLKDDGTLKPLVIELSLPHPNGDKFGAVSEVYTPGE  490

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
              GV  S+WQLAKA+   NDSG HQLISHW  THA IEP +IA NRQLS LHP++KLL PH
Sbjct  491   -GVYDSLWQLAKAFVGVNDSGNHQLISHWTQTHASIEPFVIAANRQLSVLHPVFKLLEPH  549

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGM  1011
             FRDTM+INAL RQ+L N  G+ E +  P KYAMEMS+ +YKN W FP+ +LP +L  RGM
Sbjct  550   FRDTMNINALARQILINGGGIFETTVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGM  609

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D  +PHG+RL I+DYP+AVDGLE+W AI++WV +Y + YYK +  + +DTELQAWW 
Sbjct  610   AVEDPEAPHGLRLRIKDYPFAVDGLEVWYAIESWVRDYISLYYKTEEDIQSDTELQAWWK  669

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             EV ++GH DKK EPWWP++ +R  L+++CT IIW++SALHAAVNFGQY  AGY P RPT+
Sbjct  670   EVREEGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAAVNFGQYPVAGYLPNRPTI  729

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMP+  + ++EEL+ NPDK  LKTITA  QTLLGISLIEILS H+SDE+YLGQR+  
Sbjct  730   SRQFMPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSK  789

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGK  291
             EW  +KEALEAF +FG+K+  IE+ I + N D  LKNRTG V +PYTLLFPT E G++G+
Sbjct  790   EWAAEKEALEAFAKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPTSEGGVTGR  849

Query  290   GIPNSISI  267
             GIPNS+SI
Sbjct  850   GIPNSVSI  857



>ref|XP_010466519.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=889

 Score =  1032 bits (2668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/856 (61%), Positives = 647/856 (76%), Gaps = 25/856 (3%)
 Frame = -1

Query  2765  KIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAF  2601
             KI+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP     GK  K A 
Sbjct  36    KIEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGKLGKAAH  95

Query  2600  LEDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE------D  2445
             LE W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL       +
Sbjct  96    LEKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPEGPE  155

Query  2444  GGAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-E  2268
             G    + F+C SW+YP  +Y  DR FFSN+AYLPS+TP  ++  RE EL NLRG+  G E
Sbjct  156   GEGGPIHFICNSWIYPNHRYRSDRFFFSNKAYLPSKTPELMKELREEELMNLRGNEKGGE  215

Query  2267  RKEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLP  2094
              KEWDRVYDY YYNDLG P+ G    RP+LGG+PE PYPRRG+TGRK  K DPK ESRL 
Sbjct  216   LKEWDRVYDYAYYNDLGAPEKGPNSVRPVLGGSPELPYPRRGKTGRKPNKADPKSESRLA  275

Query  2093  LLPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLY  1914
              L +  IYVPRDE+F H+K SDFL YALK++ QV++P IAS  D T NEFDSF+D+  LY
Sbjct  276   FLNL-NIYVPRDERFSHVKFSDFLAYALKALTQVLVPEIASVCDKTINEFDSFEDVFHLY  334

Query  1913  EGG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFARE  1740
             +G   L+ G  +  ++     E+ +E++R+DGE   KFP P ++  S++AWRTDEEFARE
Sbjct  335   DGSIKLANGHTISKLRDIIPWEMFRELVRNDGEGFLKFPLPDILKESRSAWRTDEEFARE  394

Query  1739  MLAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFIL  1560
             MLAG+NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++GL V+ A+  N+++IL
Sbjct  395   MLAGLNPVVISRLQEFPPKSNLDSAKYGNQDSSIREEHIEAYMNGLNVQDALEQNKLYIL  454

Query  1559  DHHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVY  1380
             DHHD +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS V+
Sbjct  455   DHHDALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKVF  513

Query  1379  TPAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKL  1200
             TPAE GVEGS+WQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPIYKL
Sbjct  514   TPAETGVEGSVWQLAKAYAAVNDSGYHQLISHWLETHAVIEPFIIASNRQLSVVHPIYKL  573

Query  1199  LHPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLIN  1020
             LHPHFRDTM+INAL R +L ++DG++E +  PG+YAME+S+ +YKNWVF + +LP DL+ 
Sbjct  574   LHPHFRDTMNINALARHVLISSDGILERTVFPGRYAMELSSSIYKNWVFTDQALPKDLLK  633

Query  1019  RGMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQA  840
             RG+AV D +S +GV+LLIEDYPYAVDGLEIW+AIKTWVTEYC+FYYKND  V  DTE+Q+
Sbjct  634   RGLAVEDPNSDNGVKLLIEDYPYAVDGLEIWSAIKTWVTEYCSFYYKNDKTVQNDTEIQS  693

Query  839   WWTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCR  660
             WWTE+  KGH DK+ E WWP + +R+ LI++CT IIWI+SALHAAVNFGQY YAG+ P R
Sbjct  694   WWTELRTKGHGDKQHESWWPSMQTRYDLIESCTIIIWIASALHAAVNFGQYPYAGFLPNR  753

Query  659   PTVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQR  480
             PTVSR+FMPEPG+ +Y EL  + D A LKTIT   QTLLGIS+IE LS H++DE+YLGQR
Sbjct  754   PTVSRRFMPEPGTVEYAELAEDIDVAFLKTITPQLQTLLGISIIETLSMHSTDEVYLGQR  813

Query  479   EHPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----T  315
             E P WT D EALEAF RF K+L  IE  I++ N D +LKNRTGPVN+PYTLL+P     T
Sbjct  814   ESPNWTADDEALEAFRRFEKELELIENNIIRRNNDKRLKNRTGPVNIPYTLLYPNTTDYT  873

Query  314   GEEGLSGKGIPNSISI  267
              E GL+GKGIPNS+SI
Sbjct  874   REGGLTGKGIPNSVSI  889



>ref|XP_010488263.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=890

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/855 (60%), Positives = 645/855 (75%), Gaps = 25/855 (3%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP------GKRSKPAF  2601
             I+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP      G+  K A 
Sbjct  38    IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPAANEKRGRLGKAAH  97

Query  2600  LEDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE-----DG  2442
             LE W  K+ TS+ AGE+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL      +G
Sbjct  98    LEKWVTKIKTSVTAGETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPESEG  157

Query  2441  GAAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ER  2265
                 + F+C SW+YP  +Y  DR FFSN+AYLPS+TP  ++  RE EL NLRGD  G E 
Sbjct  158   EGGPIHFICNSWIYPNHRYRSDRFFFSNKAYLPSKTPELMKELREEELMNLRGDKKGGEL  217

Query  2264  KEWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             KEWDRVYDY  YNDLG P+ G    RP+LGG+PE PYPRRG+TGRK  K DPK ESRL  
Sbjct  218   KEWDRVYDYACYNDLGAPEKGPDSVRPVLGGSPELPYPRRGKTGRKPNKADPKSESRLAF  277

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             L +  IYVPRDE+F H+K SDFL YALK++ QV+ P IAS  D T NEFDSF+D+  LY+
Sbjct  278   LNL-NIYVPRDERFSHVKFSDFLAYALKAVTQVLFPEIASVCDKTINEFDSFEDVFHLYD  336

Query  1910  GG--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREM  1737
             G   L+ G  +  ++     E+ +E++R+DGE   KFP P ++  S++AWRTDEEF+REM
Sbjct  337   GSIKLANGHTIAKLRDIIPWEMFRELVRNDGERFLKFPLPDILKESRSAWRTDEEFSREM  396

Query  1736  LAGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILD  1557
             LAG+NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++ L+V++A+  N+++ILD
Sbjct  397   LAGLNPVVISRLQEFPPKSNLDSAKYGNQDSSIREEHIDAYMNRLSVQEALEHNKLYILD  456

Query  1556  HHDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYT  1377
             HHD +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS V+T
Sbjct  457   HHDALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKVFT  515

Query  1376  PAEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLL  1197
             PAE GVEGS+WQLAKAYA  NDSG HQLISHWL THAVIEP IIATNRQLS +HPIYKLL
Sbjct  516   PAETGVEGSVWQLAKAYAGVNDSGYHQLISHWLQTHAVIEPFIIATNRQLSVVHPIYKLL  575

Query  1196  HPHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINR  1017
             HPHFRDTM+INAL R +L ++DG++E +  PG+YAME+S+ +YKNWVF + +LP DL+ R
Sbjct  576   HPHFRDTMNINALARHVLISSDGILERTVFPGRYAMELSSSIYKNWVFTDQALPKDLLKR  635

Query  1016  GMAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAW  837
             G+A+ D +S +GV+LLIEDYPYAVDGLEIW+AIKTWVTEYC+FYYKND  V TD E+Q+W
Sbjct  636   GLAMEDPNSDNGVKLLIEDYPYAVDGLEIWSAIKTWVTEYCSFYYKNDKTVQTDIEIQSW  695

Query  836   WTEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRP  657
             WTE+  KGH DK+ E WWP + +R  LI++CT IIWI+SALHAAVNFGQY YAG+ P RP
Sbjct  696   WTELRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAVNFGQYPYAGFLPNRP  755

Query  656   TVSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQRE  477
             TVSR+FMPEPG+ +Y EL  + D A LKTIT   QTLLGIS+IE LS H++DEIYLGQRE
Sbjct  756   TVSRRFMPEPGTVEYTELVEDTDVAFLKTITPQLQTLLGISIIETLSMHSTDEIYLGQRE  815

Query  476   HPEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TG  312
              P WT D EALEAF+RFGK+L  IE  I+K N D K KNRTGPVN+PYTLL+P     T 
Sbjct  816   SPNWTADDEALEAFKRFGKELELIENNIIKRNNDKKFKNRTGPVNIPYTLLYPNTTDYTR  875

Query  311   EEGLSGKGIPNSISI  267
             E GL+GKGIPNS+SI
Sbjct  876   EGGLTGKGIPNSVSI  890



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =  1031 bits (2667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/844 (61%), Positives = 632/844 (75%), Gaps = 13/844 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKRSKPA  2604
             KK+KG VVLMKKN LD  D  AS +D++ +F+G K++ +L+S+     EN   GK  K A
Sbjct  19    KKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLGKAA  78

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
              LEDW   +TSL AGESA+ VTF++    G PGA +++N+H +EF LK+LTLED  G   
Sbjct  79    HLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPGHGR  138

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V ++C SW+YPA  Y  DRVFFSN+ YLP +TPA L  +RE EL +LRG G GE KEWDR
Sbjct  139   VHYICNSWIYPAKHYTTDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKEWDR  198

Query  2249  VYDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             VYDY YYNDLG P    PRP+LGG  EYPYPRRGRTGRK TK DP+ ESRLP+    +IY
Sbjct  199   VYDYAYYNDLGVPPKN-PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITSSLDIY  257

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSR  1896
             VPRDE+FGHLK SDFL YALK+I Q + P + + FD T  EFDSF+D+  +YE G  L  
Sbjct  258   VPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDSFEDVLKIYEEGIDLPN  317

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               L++ I KN  LE+ KE+ R+DG+   KFP PQVI   KTAWRTDEEFAREMLAG+NPV
Sbjct  318   QALIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIKEDKTAWRTDEEFAREMLAGLNPV  377

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I  L+ FPP+S LD + YG+  STIT+ HI   LDGLTVE+A+   R+FILDHHD +M 
Sbjct  378   VIQLLKEFPPKSKLDSESYGNQNSTITKSHIEHNLDGLTVEEALEKERLFILDHHDTLMP  437

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y  R+N  T  K YA+RTLLFL+ DGTL+P+ IELSLPHP GDKFG VS VYTP E GV 
Sbjct  438   YLGRVNTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHPNGDKFGAVSEVYTPGE-GVY  495

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
              S+WQLAKA+   NDSG HQLISHW+ THA IEP +IATNRQLS LHP++KLL PHFRDT
Sbjct  496   DSLWQLAKAFVGVNDSGNHQLISHWMQTHASIEPFVIATNRQLSVLHPVFKLLEPHFRDT  555

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVD  999
             M+INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D
Sbjct  556   MNINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGMAVED  615

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
               +PHG+RL I+DYPYAVDGLE+W AI++WV +Y   +YK +  + TDTELQAWW EV +
Sbjct  616   PEAPHGLRLRIKDYPYAVDGLEVWYAIESWVRDYIFLFYKIEEDIQTDTELQAWWKEVRE  675

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK EPWWP++ +R  L+++CT IIW++SALHAAVNFGQY  AGY P RPT+SR++
Sbjct  676   EGHGDKKSEPWWPKMQTREELVESCTIIIWVASALHAAVNFGQYPVAGYLPNRPTISRQY  735

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MP+  + ++EEL+ NPDK  LKTITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  
Sbjct  736   MPKENTPEFEELEKNPDKVFLKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAA  795

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             +KEALEAFE+FG+K+  IE+ I + N D  LKNRTG V +PYTLLFP+ E G++G+GIPN
Sbjct  796   EKEALEAFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPSSEGGVTGRGIPN  855

Query  278   SISI  267
             S+SI
Sbjct  856   SVSI  859



>ref|XP_010488264.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=889

 Score =  1031 bits (2666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/854 (61%), Positives = 645/854 (76%), Gaps = 24/854 (3%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSKPAFL  2598
             I+G VV+MKKN LD  DV AS++D++ + +G++VS  LIS+   DP     G+  K A L
Sbjct  38    IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  97

Query  2597  EDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLE-----DGG  2439
             E W  K+ TS+ AGE+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL      +G 
Sbjct  98    EKWVTKIKTSVTAGETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPESEGE  157

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERK  2262
                + F+C SW+YP  +Y  DR FFSN+AYLPS+TP  ++  RE EL NLRGD  G E K
Sbjct  158   GGPIHFICNSWIYPNHRYRSDRFFFSNKAYLPSKTPELMKELREEELMNLRGDKKGGELK  217

Query  2261  EWDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLL  2088
             EWDRVYDY  YNDLG P+ G    RP+LGG+PE PYPRRG+TGRK  K DPK ESRL  L
Sbjct  218   EWDRVYDYACYNDLGAPEKGPDSVRPVLGGSPELPYPRRGKTGRKPNKADPKSESRLAFL  277

Query  2087  PVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEG  1908
              +  IYVPRDE+F H+K SDFL YALK++ QV+ P IAS  D T NEFDSF+D+  LY+G
Sbjct  278   NL-NIYVPRDERFSHVKFSDFLAYALKAVTQVLFPEIASVCDKTINEFDSFEDVFHLYDG  336

Query  1907  G--LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
                L+ G  +  ++     E+ +E++R+DGE   KFP P ++  S++AWRTDEEF+REML
Sbjct  337   SIKLANGHTIAKLRDIIPWEMFRELVRNDGERFLKFPLPDILKESRSAWRTDEEFSREML  396

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AG+NPV ISRLQ FPP+S LD   YG+  S+I  EHI   ++ L+V++A+  N+++ILDH
Sbjct  397   AGLNPVVISRLQEFPPKSNLDSAKYGNQDSSIREEHIDAYMNRLSVQEALEHNKLYILDH  456

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS V+TP
Sbjct  457   HDALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKVFTP  515

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             AE GVEGS+WQLAKAYA  NDSG HQLISHWL THAVIEP IIATNRQLS +HPIYKLLH
Sbjct  516   AETGVEGSVWQLAKAYAGVNDSGYHQLISHWLQTHAVIEPFIIATNRQLSVVHPIYKLLH  575

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFRDTM+INAL R +L ++DG++E +  PG+YAME+S+ +YKNWVF + +LP DL+ RG
Sbjct  576   PHFRDTMNINALARHVLISSDGILERTVFPGRYAMELSSSIYKNWVFTDQALPKDLLKRG  635

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             +A+ D +S +GV+LLIEDYPYAVDGLEIW+AIKTWVTEYC+FYYKND  V TD E+Q+WW
Sbjct  636   LAMEDPNSDNGVKLLIEDYPYAVDGLEIWSAIKTWVTEYCSFYYKNDKTVQTDIEIQSWW  695

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
             TE+  KGH DK+ E WWP + +R  LI++CT IIWI+SALHAAVNFGQY YAG+ P RPT
Sbjct  696   TELRTKGHGDKQHESWWPSMQTRDDLIESCTIIIWIASALHAAVNFGQYPYAGFLPNRPT  755

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             VSR+FMPEPG+ +Y EL  + D A LKTIT   QTLLGIS+IE LS H++DEIYLGQRE 
Sbjct  756   VSRRFMPEPGTVEYTELVEDTDVAFLKTITPQLQTLLGISIIETLSMHSTDEIYLGQRES  815

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGE  309
             P WT D EALEAF+RFGK+L  IE  I+K N D K KNRTGPVN+PYTLL+P     T E
Sbjct  816   PNWTADDEALEAFKRFGKELELIENNIIKRNNDKKFKNRTGPVNIPYTLLYPNTTDYTRE  875

Query  308   EGLSGKGIPNSISI  267
              GL+GKGIPNS+SI
Sbjct  876   GGLTGKGIPNSVSI  889



>ref|XP_007143238.1| hypothetical protein PHAVU_007G055800g [Phaseolus vulgaris]
 gb|ESW15232.1| hypothetical protein PHAVU_007G055800g [Phaseolus vulgaris]
Length=856

 Score =  1031 bits (2665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/840 (61%), Positives = 636/840 (76%), Gaps = 14/840 (2%)
 Frame = -1

Query  2747  VLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDPGKRSKPAFLEDW-GKLTSL  2571
             ++MKK FLD  D+ A+++D++ + +G+ VS QLISA + +PG   + A+LE W   ++SL
Sbjct  18    IVMKKGFLDFHDIKANVLDRVHELLGRGVSLQLISANSPNPGPIGEVAYLEKWVSTISSL  77

Query  2570  V--AGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAGVQFVCFSWVY  2400
                A    + +TFEW ES+GVPGA I+KN+H ++FYLKTL +E   G   V+F+C SW+Y
Sbjct  78    TTPATHVEFSITFEWDESMGVPGAFIIKNHHHSQFYLKTLDIEHIPGHGPVKFLCNSWIY  137

Query  2399  PADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDRVYDYDYYNDL  2220
             P  +Y  DRVFF+N+AYLP QTP PLR FRE EL  LRG G G  KEWDRVYDY YYNDL
Sbjct  138   PVHRYANDRVFFANKAYLPCQTPEPLRRFREQELIVLRGKGFGRLKEWDRVYDYAYYNDL  197

Query  2219  GDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIYVPRDEKFG  2046
             G PDNG    RP+LGG  E+PYPRRGRTGR+ TKTD K ESRL +L V ++YVPRDE+FG
Sbjct  198   GSPDNGPNNARPVLGGGSEFPYPRRGRTGRRHTKTDAKTESRLHILCVKKVYVPRDEQFG  257

Query  2045  HLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSRGLLLEHIQ  1872
             H+K SDFL YA+KS+ QV++P I S  D T NEFD+F D+ ++Y+G   L  G   + ++
Sbjct  258   HVKFSDFLAYAVKSVSQVLLPGITSLCDKTPNEFDTFKDVLNIYKGCIKLPSGPAAKKLR  317

Query  1871  KNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPVCISRLQVF  1692
             +    E+ +E++R+DGE   KFP P VI  SK+AWRTDEEFAREMLAGVNPV I RLQ F
Sbjct  318   ELVPFEVMRELIRNDGERFLKFPMPDVIKESKSAWRTDEEFAREMLAGVNPVIIQRLQEF  377

Query  1691  PPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIMLYARRINAN  1512
             PP S LDPKVYGD  S+I   HI + LDG T+ +AI   R+FILDHHD +M Y  RIN+ 
Sbjct  378   PPVSKLDPKVYGDQASSIRAIHIENSLDGFTINEAIQEMRLFILDHHDALMPYISRINS-  436

Query  1511  TDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVEGSIWQLAK  1332
             T+ K YA+RTLLFLQ DGTL+P+AIELSLPHP G++ G VS V  PA++G+  S+WQLAK
Sbjct  437   TNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGNQHGAVSKVIVPAKEGIAASVWQLAK  496

Query  1331  AYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDTMHINALGR  1152
             AY A NDSG HQL+SHWL++HAVIEP IIAT+RQLS LHPI+KLL PHF+DTMHINAL R
Sbjct  497   AYVAVNDSGYHQLVSHWLHSHAVIEPFIIATHRQLSILHPIHKLLKPHFKDTMHINALAR  556

Query  1151  QLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMAVVDLSSPHGVRL  972
               L NA GV+E +  PGK++MEMSAV+YK+WVFP  +LP DL+ RGMAV + S  HG++L
Sbjct  557   HTLINAGGVLEKTVFPGKFSMEMSAVIYKSWVFPEQALPADLLKRGMAVPNSSYRHGLKL  616

Query  971   LIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQKGHEDKKDE  792
             +IEDYP+AVDGLEIW AI+TWVTEYCNFYY ++ MV  D ELQ WW EV  +GH D KD 
Sbjct  617   VIEDYPFAVDGLEIWEAIETWVTEYCNFYYTSNEMVEEDYELQNWWNEVRNEGHGDLKDR  676

Query  791   PWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKFMPEPGSADY  612
             PWW  +  R  LI +CT IIW++SA HAAVNFGQY YAGY P RPTVSR+FMPE G+ +Y
Sbjct  677   PWWSEMKCREELIQSCTIIIWLASAFHAAVNFGQYPYAGYLPNRPTVSRRFMPESGTPEY  736

Query  611   EELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTKDKEALEAFE  432
             EE+K+NP+ A LKTITA  QTLLG+SLIEILSRH+++E+YLGQ E+ EWT D E L+AF 
Sbjct  737   EEIKSNPELAFLKTITAQLQTLLGVSLIEILSRHSTEEVYLGQSENTEWTLDDEPLKAFA  796

Query  431   RFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEGLSGKGIPNSISI  267
             RF +KL+ IE  I++ N D +LKNR+GPV +PYTLL+P     + E GL+GKGIPNSISI
Sbjct  797   RFSEKLLEIENNIMERNKDKRLKNRSGPVKMPYTLLYPNTSDYSKEGGLTGKGIPNSISI  856



>ref|XP_009108895.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic [Brassica 
rapa]
Length=889

 Score =  1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/852 (61%), Positives = 655/852 (77%), Gaps = 22/852 (3%)
 Frame = -1

Query  2762  IKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISA-----ENDDPGKRSKPAFL  2598
             I+G +V+MKKN LD  D  AS++D+I + +G++VS  LIS+      N+  G+  K A L
Sbjct  40    IEGEIVVMKKNLLDFKDTMASLLDRIHELLGRRVSLHLISSLQPDLANEKRGRLGKAAHL  99

Query  2597  EDW-GKL-TSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED--GGAAG  2430
             E W  K+ TS+ A E+A+ VTF+W ES+G P A ++KN+H ++FYLK+LTL +  GG  G
Sbjct  100   EKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHRSQFYLKSLTLRNFPGGEGG  159

Query  2429  -VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTG-ERKEW  2256
              + FVC SW+YP+ +Y  DRVFFSNQAYLPS+TP  ++  RE ELKNLRG+  G E KEW
Sbjct  160   AIHFVCNSWIYPSHRYRSDRVFFSNQAYLPSETPELVKELREQELKNLRGEEKGGELKEW  219

Query  2255  DRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPV  2082
             DRVYDY YYNDLG PD G    RP+LGG+ E+PYPRRG+TGRK TK+DP+ ESRL LL +
Sbjct  220   DRVYDYAYYNDLGAPDKGPDSARPVLGGSLEFPYPRRGKTGRKPTKSDPRSESRLALLNL  279

Query  2081  AEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG-  1905
               IYVPRDE+F H+K SDFL YALKS+ QV++P IAS  D T NEFDSF+D+  LY+G  
Sbjct  280   -NIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASLCDKTINEFDSFEDVFHLYDGSI  338

Query  1904  -LSRGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAG  1728
              L+ G  +  ++     E+ +E++R+DGE   KFP P V+  S++AWRTDEEFAREMLAG
Sbjct  339   KLANGHTISKLRDIIPWEMFRELVRNDGERFLKFPLPDVLKQSRSAWRTDEEFAREMLAG  398

Query  1727  VNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHD  1548
             +NPV ISRL+ FPP+S LD   YG+  S+I  EHI   ++G +V++A+  N++FILDHHD
Sbjct  399   LNPVVISRLKDFPPKSNLDSAKYGNQNSSIREEHIEPHMNGTSVQEALEQNKLFILDHHD  458

Query  1547  GIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAE  1368
              +M Y  RIN+ T+ K YATRTLL LQ+DGTL+P+AIELSLPH  G+  G VS ++TP+E
Sbjct  459   ALMPYLTRINS-TNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGSVSKIFTPSE  517

Query  1367  QGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPH  1188
             +GVEG+IWQLAKAYAA NDSG HQLISHWL THAVIEP IIA+NRQLS +HPIYKLLHPH
Sbjct  518   KGVEGTIWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQLSVVHPIYKLLHPH  577

Query  1187  FRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGMA  1008
             FRDTM+INAL R +L N+DGV+E +  P +YAMEMS+ +YK+WVF + +LP DL+ RG+A
Sbjct  578   FRDTMNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKSWVFTDQALPKDLLKRGVA  637

Query  1007  VVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTE  828
             V D SS +GV+LLIEDYP+AVDGLEIW+AIKTWVTEYC+FYYKND  V TDTE+Q+WWTE
Sbjct  638   VEDPSSDNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCSFYYKNDRTVQTDTEIQSWWTE  697

Query  827   VVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVS  648
             +  +GH D + E WWP + +R  LI+TCT IIWI+SALHAAVNFGQY YAG+ P RPTVS
Sbjct  698   LRTEGHGDIQHESWWPSMQTRDDLIETCTIIIWIASALHAAVNFGQYPYAGFLPNRPTVS  757

Query  647   RKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPE  468
             R+FMPEPG+ +Y EL+ + + A LKTIT   QTLLGIS+IEILS H++DEIYLGQR+ P 
Sbjct  758   RRFMPEPGTKEYTELEESEEVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRDSPN  817

Query  467   WTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFP-----TGEEG  303
             WT D E LEAF+RFGK L  IE  I++ N D +LKNRTGPVN+PYTLL+P     T E G
Sbjct  818   WTADDEPLEAFKRFGKSLEVIENNIIRRNNDKRLKNRTGPVNIPYTLLYPNTTDYTREGG  877

Query  302   LSGKGIPNSISI  267
             L+GKGIPNS+SI
Sbjct  878   LTGKGIPNSVSI  889



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =  1029 bits (2660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/844 (61%), Positives = 629/844 (75%), Gaps = 13/844 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-----NDDPGKRSKPA  2604
             KK+KG VVLMKKN LD  D  AS +D++ +F+G K++ +LIS++     N   GK  K A
Sbjct  20    KKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLGKTA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
              LEDW   +TSL AGESA+ VTF++    G PGA +++N+H +EF+LK+LTLED  G   
Sbjct  80    HLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V ++C SW+YPA  Y  DRVFFSN+ YLP +TPA L  +RE EL  LRG G GE KEWDR
Sbjct  140   VHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVELRGTGEGELKEWDR  199

Query  2249  VYDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             VYDY YYNDLG P    PRP+LGG  EYPYPRRGRTGRK TK DP+ ESRLP+     IY
Sbjct  200   VYDYAYYNDLGVPPKN-PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITSSLNIY  258

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSR  1896
             VPRDE+FGHLK SDFL YALK+I Q++ P + + FD T NEFDSF+D+  +YE G  L  
Sbjct  259   VPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDKTPNEFDSFEDVLKIYEEGIDLPN  318

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               L++ I KN  LE+ KE+ R+DG+   K+P PQVI   KTAWRTDEEFAREMLAG+NPV
Sbjct  319   QALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPV  378

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I  LQ FPP+S LD ++YG+  STIT+ HI   LDGLTVE+A+   R+FILDHHD +M 
Sbjct  379   VIQLLQEFPPKSKLDSELYGNQNSTITKSHIEKSLDGLTVEEALEKERLFILDHHDTLMP  438

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y  RIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPHP GDKFG VS VYTP E GV 
Sbjct  439   YLGRINTTT-TKTYASRTLLFLKNDGTLKPLVIELSLPHPDGDKFGAVSEVYTPGE-GVY  496

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
              S+WQLAKA+   NDSG HQLISHW  THA IEP +IATNRQLS LHP++KLL PHFRDT
Sbjct  497   DSLWQLAKAFVGVNDSGNHQLISHWTQTHASIEPFVIATNRQLSVLHPVFKLLEPHFRDT  556

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVD  999
             M+INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D
Sbjct  557   MNINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPAELKKRGMAVDD  616

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
               +PHG+RL I+DYPYAVDGLE+W AI+ WV +Y + +YK D  +  DTELQAWW EV +
Sbjct  617   PEAPHGLRLRIKDYPYAVDGLEVWYAIEYWVRDYISLFYKTDEDIQRDTELQAWWKEVRE  676

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK EPWWP++ +R  L+++CT IIW++SALHAAVNFGQY  AGY P RPT+SR+F
Sbjct  677   EGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAVNFGQYPIAGYLPNRPTISRQF  736

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MP+  + ++ EL+ NPDK   KTITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  
Sbjct  737   MPKENTPEFAELEKNPDKVFFKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAA  796

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             +KEA +AFE+FG+K+  IE+ + + N D  LKNRTG V +PYTLLFPT E G++G+GIPN
Sbjct  797   EKEASDAFEKFGEKIKEIEKNMDERNDDVNLKNRTGLVKMPYTLLFPTSEGGVTGRGIPN  856

Query  278   SISI  267
             S+SI
Sbjct  857   SVSI  860



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =  1028 bits (2659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/844 (60%), Positives = 630/844 (75%), Gaps = 13/844 (2%)
 Frame = -1

Query  2768  KKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAE-----NDDPGKRSKPA  2604
             KK+KG VVLMKKN LD  D  AS +D++ +F+G K++ +LIS++     N   GK  K A
Sbjct  20    KKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLGKAA  79

Query  2603  FLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGAAG  2430
              LEDW   +TSL AGESA+ VTF++    G PGA +++N+H +EF+LK+LTLED  G   
Sbjct  80    HLEDWITPITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPGHGR  139

Query  2429  VQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKEWDR  2250
             V ++C SW+YPA  Y  DRVFFSN+ YLP +TPA L  +RE EL  LRG G GE KEWDR
Sbjct  140   VHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVELRGTGEGELKEWDR  199

Query  2249  VYDYDYYNDLGDPDNGKPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLPVAEIY  2070
             VYDY YYNDLG P    PRP+LGG  EYPYPRRGRTGRK T  DP+ ESRLP+     IY
Sbjct  200   VYDYAYYNDLGVPPKN-PRPVLGGTQEYPYPRRGRTGRKPTNEDPQTESRLPITSSLNIY  258

Query  2069  VPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG--LSR  1896
             VPRDE+FGHLK SDFL YALK+I Q++ P + + FD T NEFDSF+D+  +YE G  L  
Sbjct  259   VPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDKTPNEFDSFEDVLKIYEEGIDLPN  318

Query  1895  GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLAGVNPV  1716
               L++ I KN  LE+ KE+ R+DG+   K+P PQVI   KTAWRTDEEFAREMLAG+NPV
Sbjct  319   QALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPV  378

Query  1715  CISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHHDGIML  1536
              I  LQ FPP+S LD ++YG+  STIT+ HI   LDGLTV++A+   R+FILDHHD +M 
Sbjct  379   VIQLLQEFPPKSKLDSELYGNQNSTITKSHIEKSLDGLTVDEALEKERLFILDHHDTLMP  438

Query  1535  YARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPAEQGVE  1356
             Y RRIN  T  K YA+RTLLFL+ DGTL+P+ IELSLPHP GDK G +S VYTP E GV 
Sbjct  439   YLRRINTTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHPDGDKLGALSEVYTPGE-GVY  496

Query  1355  GSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHPHFRDT  1176
              S+WQLAKA+   NDSG HQLISHW  THA IEP +IATNRQLS LHP++KLL PHFRDT
Sbjct  497   DSLWQLAKAFVGVNDSGNHQLISHWTQTHASIEPFVIATNRQLSVLHPVFKLLEPHFRDT  556

Query  1175  MHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKN-WVFPNHSLPNDLINRGMAVVD  999
             M+INAL RQ+L N  G+ E++  P KYAMEMS+ +YKN W FP+ +LP +L  RGMAV D
Sbjct  557   MNINALARQILINGGGIFEITVFPSKYAMEMSSFIYKNHWTFPDQALPTELKKRGMAVDD  616

Query  998   LSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWTEVVQ  819
               +PHG+RL I+DYPYAVDGLE+W AI++WV +Y + +YK D  +  D+ELQAWW EV +
Sbjct  617   PEAPHGLRLRIKDYPYAVDGLEVWYAIESWVRDYISLFYKTDEDIQRDSELQAWWKEVRE  676

Query  818   KGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTVSRKF  639
             +GH DKK EPWWP++ +R  L+++CT IIW++SALHAAVNFGQY  AGY P RPT+SR+F
Sbjct  677   EGHGDKKSEPWWPKMQNREELVESCTIIIWVASALHAAVNFGQYPIAGYLPNRPTISRQF  736

Query  638   MPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHPEWTK  459
             MP+  + ++ +L+ NPDK   KTITA  QTLLGISLIEILS H+SDE+YLGQR+  EW  
Sbjct  737   MPKENTPEFAQLEKNPDKVFFKTITAQLQTLLGISLIEILSTHSSDEVYLGQRDSKEWAA  796

Query  458   DKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSGKGIPN  279
             +KEAL+AFE+FG+K+  IE+ + + N D  LKNRTG V +PYTLLFPT E G++G+GIPN
Sbjct  797   EKEALDAFEKFGEKVKEIEKNMDERNDDVNLKNRTGLVKMPYTLLFPTSEGGVTGRGIPN  856

Query  278   SISI  267
             S+SI
Sbjct  857   SVSI  860



>ref|XP_002278007.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=876

 Score =  1028 bits (2658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/853 (61%), Positives = 639/853 (75%), Gaps = 20/853 (2%)
 Frame = -1

Query  2777  DEPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRS  2613
             DE +KI+GRVVLMKKN +DL D  AS++D + + VG+ VS QLISA + DP     GK  
Sbjct  28    DESQKIEGRVVLMKKNVMDLNDSKASLIDSVYELVGKHVSLQLISATHADPENNLGGKIG  87

Query  2612  KPAFLEDWGKLT-SLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GG  2439
             K   L+ W     ++ A E+ + VTF+W E +GVPGA+ V N+H +EFYL ++TLED  G
Sbjct  88    KATCLQKWNCTGPAITARETEFAVTFDWEEGMGVPGALRVSNHHHSEFYLSSVTLEDVPG  147

Query  2438  AAGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDGTGERKE  2259
                + FVC SWV+P  +Y  +RVFFSN+AYLP  TP PLR +RE EL  LRG+G GERK 
Sbjct  148   QGRIHFVCNSWVFPV-RYTNERVFFSNKAYLPCHTPEPLRQYREEELVKLRGNGQGERKT  206

Query  2258  WDRVYDYDYYNDLGDPDNG--KPRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPLLP  2085
             W+R+YDYD YNDLG+PD G    RPILGG+ +YPYPRRGRTGR+ TKTDP  E RL LL 
Sbjct  207   WERIYDYDVYNDLGNPDKGPSHARPILGGSEDYPYPRRGRTGRERTKTDPCSEKRLSLLR  266

Query  2084  VAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYEGG  1905
             + +IYVPRDE+F  +K SD L YA+KS+ QV+IP I S FD T NEFDSF D+ ++YE G
Sbjct  267   L-DIYVPRDERFSQVKFSDVLAYAVKSLVQVLIPEIRSLFDKTVNEFDSFQDVLNIYEVG  325

Query  1904  LS--RGLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREMLA  1731
             ++   G     ++   + E  +E+  SD     KFP P VI  + TAWRTDEEF REMLA
Sbjct  326   INGQNGGTHGTVRDCISWEFIRELAHSD-VGFHKFPMPDVIKENTTAWRTDEEFGREMLA  384

Query  1730  GVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDHH  1551
             GVNPV I RL+ FPP S LD   YG+ TSTIT+EHI   ++GLTV+QAI ++++FILD+H
Sbjct  385   GVNPVIIRRLEEFPPVSKLDINKYGNQTSTITKEHIEKNMNGLTVDQAIKNDKLFILDYH  444

Query  1550  DGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTPA  1371
             D +M +  RIN+ T  K YATRTLLFL++DGTL+P+AIELSLPHP G+ +G  S VYTPA
Sbjct  445   DALMPFLSRINS-TSTKTYATRTLLFLKEDGTLKPLAIELSLPHPQGESYGATSQVYTPA  503

Query  1370  EQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLHP  1191
             E GVEGS+WQLAKAYAA NDSG HQLISHWLNTHAVIEP +IATNRQLS LHPIYKLLHP
Sbjct  504   EDGVEGSVWQLAKAYAAVNDSGYHQLISHWLNTHAVIEPFVIATNRQLSVLHPIYKLLHP  563

Query  1190  HFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRGM  1011
             HFRDTM+INAL R +L NA G +E++  PGKYA+EMSAV+YKNW F    LP DL+ RG+
Sbjct  564   HFRDTMNINALARHILINAGGFLEMTVFPGKYALEMSAVIYKNWNFTEQGLPADLLKRGV  623

Query  1010  AVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWWT  831
             AV D +  HG+RLLIEDYPYAVDGLE+W+AI+TWVTEYC+FYY  D ++  DTELQ+WW 
Sbjct  624   AVEDPNYRHGLRLLIEDYPYAVDGLEVWSAIETWVTEYCSFYYPTDDLIQCDTELQSWWM  683

Query  830   EVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPTV  651
             E+  KGH DKKDEPWW  + +   L  TCT IIW++SALHAAVNFGQY YAGY P RPT+
Sbjct  684   ELRNKGHGDKKDEPWWSEMQTLVDLTKTCTIIIWVASALHAAVNFGQYPYAGYLPNRPTI  743

Query  650   SRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREHP  471
             SR+FMPEPG+ +Y+EL+ NPD A LKTITA  QTLLG+SLIEILSRH++DEIYLGQR+ P
Sbjct  744   SRRFMPEPGTPEYQELERNPDLAFLKTITAQLQTLLGVSLIEILSRHSTDEIYLGQRDTP  803

Query  470   EWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEE-----  306
             EWT D E L AFERFG +L  IE RI +MN D +  NR GPV + YTLL+P   +     
Sbjct  804   EWTSDAEPLAAFERFGSRLRGIETRINQMNQDRRWNNRFGPVEMQYTLLYPNTSDYSRQG  863

Query  305   GLSGKGIPNSISI  267
             GL+GKGIPNS+SI
Sbjct  864   GLAGKGIPNSVSI  876



>ref|XP_008246452.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=896

 Score =  1028 bits (2657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/849 (61%), Positives = 632/849 (74%), Gaps = 41/849 (5%)
 Frame = -1

Query  2774  EPKKIKGRVVLMKKNFLDLTDVGASIVDKIQDFVGQKVSFQLISAENDDP-----GKRSK  2610
             E  KIKGRVVLMKKN LDL D+ AS++D++++ VG+ VS QLIS+ N DP     GK  K
Sbjct  76    EGMKIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGK  135

Query  2609  PAFLEDW-GKLTSLVAGESAYDVTFEWRESLGVPGAVIVKNNHANEFYLKTLTLED-GGA  2436
             PA+LE+W   +T L AG+SA+D+TF+W E +GVPGA I++N+H +EFYLKTLTLED  G 
Sbjct  136   PAYLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGE  195

Query  2435  AGVQFVCFSWVYPADKYNYDRVFFSNQAYLPSQTPAPLRPFREAELKNLRGDG---TGER  2265
               + FVC SWVYPADKY  DR+FF+N+ YL S TP PL+ FRE EL NLRGD    T E 
Sbjct  196   GQIHFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTREL  255

Query  2264  KEWDRVYDYDYYNDLGDPDNGK--PRPILGGNPEYPYPrrgrtgrkmtkTDPKYESRLPL  2091
             +EWDRVYDY YYNDLG+PD G+   RP+LGG+ E+PYPRRGRTGR  T+TDP  ES+L L
Sbjct  256   QEWDRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTETDPNTESQLKL  315

Query  2090  LPVAEIYVPRDEKFGHLKQSDFLGYALKSIGQVVIPFIASRFDATQNEFDSFDDMNSLYE  1911
             +    IYVPRDE+FG LK SD L Y LK+I QV+ P +A+    + NEF++  ++  LYE
Sbjct  316   IMSLNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEVLKLYE  375

Query  1910  GGLSR-GLLLEHIQKNTNLEITKEVLRSDGENLFKFPTPQVIGASKTAWRTDEEFAREML  1734
             GG+     +L++I+ + + E+ KE+ R+DGE   KFP PQVI  +K+AWRTDEEFAREML
Sbjct  376   GGIELPDGILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQDNKSAWRTDEEFAREML  435

Query  1733  AGVNPVCISRLQVFPPRSTLDPKVYGDHTSTITREHIADKLDGLTVEQAIWSNRVFILDH  1554
             AGVNPV I RLQ FPP S LD K YGD TS IT+EHI   L GL++++AI +N++FILDH
Sbjct  436   AGVNPVAIRRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDH  495

Query  1553  HDGIMLYARRINANTDRKIYATRTLLFLQKDGTLRPIAIELSLPHPLGDKFGCVSNVYTP  1374
             HD +M Y RRIN  T  K Y++RTLLFL+ DGTL+P+AIELSLPHP GD+FGC+S VYTP
Sbjct  496   HDELMPYLRRINT-TSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGDQFGCISKVYTP  554

Query  1373  AEQGVEGSIWQLAKAYAATNDSGVHQLISHWLNTHAVIEPIIIATNRQLSFLHPIYKLLH  1194
             + QGVE SIWQLAKAY   NDSG HQLISHWL THAVIEP +IA NRQLS LHPI+KLLH
Sbjct  555   SSQGVESSIWQLAKAYVNVNDSGHHQLISHWLKTHAVIEPFVIAANRQLSVLHPIHKLLH  614

Query  1193  PHFRDTMHINALGRQLLTNADGVIELSCLPGKYAMEMSAVLYKNWVFPNHSLPNDLINRG  1014
             PHFR+TM+ NA+ R++LTNA G+IE +  P K++ME S+V+YKNWVFP  +LP DLI RG
Sbjct  615   PHFRETMNANAIAREVLTNAGGIIEETVFPAKFSMEWSSVMYKNWVFPEQALPVDLIKRG  674

Query  1013  MAVVDLSSPHGVRLLIEDYPYAVDGLEIWTAIKTWVTEYCNFYYKNDIMVWTDTELQAWW  834
             MAV D  S H VRLLIEDYPYA DGLEIW+AIKTWV EYC+FY+                
Sbjct  675   MAVEDPKSSHSVRLLIEDYPYAADGLEIWSAIKTWVKEYCSFYH----------------  718

Query  833   TEVVQKGHEDKKDEPWWPRIVSRHLLIDTCTTIIWISSALHAAVNFGQYAYAGYNPCRPT  654
                        KDEPWWP++ +   LI++CT +IW+SSA HAA+N+GQY+  GY P RPT
Sbjct  719   -----------KDEPWWPKMRTCEELIESCTIVIWLSSAYHAAINYGQYSIGGYVPNRPT  767

Query  653   VSRKFMPEPGSADYEELKTNPDKALLKTITALPQTLLGISLIEILSRHASDEIYLGQREH  474
             +S  FMPE G+ +YEELKTNPDKA LKT T   QTLLG++ IEILSRH  DE+YLGQR  
Sbjct  768   ISLHFMPEEGTPEYEELKTNPDKAFLKTFTPQLQTLLGMASIEILSRHPVDELYLGQRGT  827

Query  473   PEWTKDKEALEAFERFGKKLVAIEERILKMNGDGKLKNRTGPVNVPYTLLFPTGEEGLSG  294
             PEWT D   L+A E F KKL  IE+RI+KMN D KLKNR GP  +PYTLL+P+ E GL+G
Sbjct  828   PEWTTDANMLQASEDFRKKLEGIEKRIIKMNKDEKLKNRVGPAKIPYTLLYPSSEPGLTG  887

Query  293   KGIPNSISI  267
             KGIPNS++I
Sbjct  888   KGIPNSVNI  896



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =  1027 bits (2656),  Expect = 0.0, Method: Compositional matrix adjust.
 Iden