BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20971_g1_i2 len=1399 path=[1:0-821 2975:822-837 839:838-876
2708:877-915 917:916-941 2885:942-969 971:970-1007 3405:1008-1398]

Length=1399
                                                                      Score     E

ref|XP_011092647.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    600   0.0      
dbj|BAP47505.1|  O-acetylserine (thiol)lyase                            587   0.0      
ref|XP_009783358.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    586   0.0      
ref|XP_009626848.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    582   0.0      
gb|KHG16843.1|  Cysteine synthase, chloroplastic/chromoplastic          582   0.0      
emb|CAN62383.1|  hypothetical protein VITISV_028023                     582   0.0      Vitis vinifera
ref|XP_002276013.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    581   0.0      Vitis vinifera
ref|XP_007051769.1|  Cysteine synthase C1                               577   0.0      
emb|CDP08794.1|  unnamed protein product                                574   0.0      
ref|XP_003534555.1|  PREDICTED: l-3-cyanoalanine synthase 1, mito...    573   0.0      
gb|EYU32144.1|  hypothetical protein MIMGU_mgv1a008503mg                573   0.0      
gb|AIA22208.1|  beta-cyanoalanine synthase                              573   0.0      
ref|XP_006445004.1|  hypothetical protein CICLE_v10020662mg             572   0.0      
ref|XP_004138495.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    572   0.0      
ref|XP_006364148.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    571   0.0      
gb|KHM99361.1|  Cysteine synthase, chloroplastic/chromoplastic          572   0.0      
sp|Q76MX2.1|CAS1_SOLTU  RecName: Full=Bifunctional L-3-cyanoalani...    570   0.0      Solanum tuberosum [potatoes]
gb|KHN29341.1|  Cysteine synthase, chloroplastic/chromoplastic          571   0.0      
ref|XP_003623996.1|  Cysteine synthase                                  571   0.0      
ref|NP_001235117.1|  OAS-TL3 cysteine synthase                          571   0.0      
ref|XP_008458207.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    570   0.0      
ref|XP_010326974.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    569   0.0      
ref|XP_007139815.1|  hypothetical protein PHAVU_008G061100g             570   0.0      
ref|XP_004492762.1|  PREDICTED: l-3-cyanoalanine synthase 1, mito...    568   0.0      
ref|XP_010055111.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    568   0.0      
ref|XP_009797225.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    566   0.0      
ref|XP_002301362.1|  beta-cyanoalanine synthase family protein          565   0.0      Populus trichocarpa [western balsam poplar]
gb|AFK37031.1|  unknown                                                 564   0.0      
ref|XP_010087942.1|  Cysteine synthase                                  564   0.0      
gb|KDP28610.1|  hypothetical protein JCGZ_14381                         563   0.0      
gb|AAN86822.1|  beta-cyanoalanine synthase                              561   0.0      Betula pendula [white birch]
ref|XP_011023311.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    562   0.0      
ref|XP_004306760.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    562   0.0      
gb|AAP41851.1|  beta-cyanoalanine synthase                              561   0.0      Hevea brasiliensis [jebe]
ref|NP_001280949.1|  L-3-cyanoalanine synthase 1, mitochondrial         561   0.0      
ref|XP_011036588.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    561   0.0      
gb|AAP41852.1|  beta-cyanoalanine synthase                              560   0.0      Hevea brasiliensis [jebe]
gb|ADO78230.1|  mitochondrial beta-cyanoalanine synthase                559   0.0      
ref|NP_001280751.1|  L-3-cyanoalanine synthase 2, mitochondrial         558   0.0      
ref|XP_008244657.1|  PREDICTED: L-3-cyanoalanine synthase 1, mito...    557   0.0      
ref|XP_009367811.1|  PREDICTED: L-3-cyanoalanine synthase 2, mito...    556   0.0      
ref|XP_007218145.1|  hypothetical protein PRUPE_ppa007292mg             556   0.0      
ref|XP_009628115.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    554   0.0      
ref|XP_010523763.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    553   0.0      
ref|XP_010544747.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    553   0.0      
gb|KFK42134.1|  hypothetical protein AALP_AA2G215500                    552   0.0      
gb|ABY64889.1|  beta-cyanoalanine synthase                              553   0.0      Manihot esculenta [manioc]
ref|XP_010275651.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    552   0.0      
ref|XP_010413402.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    551   0.0      
ref|XP_002518986.1|  cysteine synthase, putative                        550   0.0      Ricinus communis
ref|XP_002320141.2|  hypothetical protein POPTR_0014s08210g             549   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009138771.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    549   0.0      
ref|XP_010512491.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    548   0.0      
ref|XP_004229909.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    546   0.0      
emb|CDY43932.1|  BnaC04g21780D                                          544   0.0      
ref|XP_006402480.1|  hypothetical protein EUTSA_v10006044mg             544   0.0      
ref|NP_191703.1|  cysteine synthase C1                                  543   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116808.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    542   0.0      
pdb|3VBE|A  Chain A, Crystal Structure Of Beta-Cyanoalanine Synth...    541   0.0      
ref|NP_001275044.1|  bifunctional L-3-cyanoalanine synthase/cyste...    541   0.0      
ref|XP_002876613.1|  beta-substituted ala synthase 3_1                  541   0.0      
gb|KHG16844.1|  Cysteine synthase, chloroplastic/chromoplastic          541   0.0      
emb|CDX71737.1|  BnaC08g31370D                                          540   0.0      
pdb|3VC3|A  Chain A, Crystal Structure Of Beta-Cyanoalanine Synth...    539   0.0      
ref|XP_010670142.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    536   0.0      
ref|XP_002511880.1|  cysteine synthase, putative                        536   0.0      Ricinus communis
gb|KEH23373.1|  cysteine synthase/L-3-cyanoalanine synthase             529   0.0      
ref|XP_010467018.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    526   0.0      
sp|Q43153.1|CYSC_SPIOL  RecName: Full=Bifunctional L-3-cyanoalani...    525   0.0      Spinacia oleracea
ref|XP_010413401.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    520   2e-179   
ref|XP_002883653.1|  beta-substituted ala synthase 3_1                  513   2e-177   
ref|XP_006827554.1|  hypothetical protein AMTR_s00009p00219590          502   9e-173   
ref|NP_001052135.1|  Os04g0165700                                       493   6e-169   Oryza sativa Japonica Group [Japonica rice]
gb|AAV48542.1|  beta-cyanoalanine synthase                              493   7e-169   Oryza sativa Indica Group [Indian rice]
ref|XP_009401845.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    489   8e-168   
ref|XP_008801328.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    489   1e-167   
ref|XP_010918745.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    488   3e-167   
ref|XP_004138496.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    479   9e-165   
ref|XP_004975070.1|  PREDICTED: l-3-cyanoalanine synthase 2, mito...    481   2e-164   
gb|ABR17848.1|  unknown                                                 481   3e-164   Picea sitchensis
gb|KCW71586.1|  hypothetical protein EUGRSUZ_E00118                     477   3e-164   
ref|XP_006653160.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    480   5e-164   
ref|XP_002447473.1|  hypothetical protein SORBIDRAFT_06g001610          479   2e-163   Sorghum bicolor [broomcorn]
gb|EAZ29717.1|  hypothetical protein OsJ_13780                          479   2e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579777.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    478   3e-163   
ref|XP_003623997.1|  Cysteine synthase                                  474   4e-163   
gb|ADG60234.1|  beta-cyanoalanine synthase                              478   5e-163   
dbj|BAJ98194.1|  predicted protein                                      476   3e-162   
gb|EMT13011.1|  Cysteine synthase, chloroplastic/chromoplastic          476   4e-162   
gb|ACG34624.1|  cysteine synthase                                       473   5e-161   Zea mays [maize]
ref|XP_008667338.1|  PREDICTED: cysteine synthase isoform X1            472   8e-161   
gb|EMS53577.1|  Cysteine synthase, chloroplastic/chromoplastic          470   1e-160   
gb|AEA86281.1|  chloroplast cysteine synthase                           463   7e-159   
gb|ADG60235.1|  beta-cyanoalanine synthase                              464   9e-158   
ref|XP_008244658.1|  PREDICTED: L-3-cyanoalanine synthase 1, mito...    460   2e-157   
gb|ABK23130.1|  unknown                                                 461   2e-157   Picea sitchensis
gb|KDO86225.1|  hypothetical protein CISIN_1g021775mg                   449   9e-153   
ref|XP_006291669.1|  hypothetical protein CARUB_v10017827mg             433   4e-147   
ref|XP_010413403.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    432   1e-146   
ref|XP_008343406.1|  PREDICTED: LOW QUALITY PROTEIN: L-3-cyanoala...    432   3e-146   
ref|NP_001078324.1|  cysteine synthase C1                               430   7e-146   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48919.1|  BnaA09g39180D                                          411   9e-138   
ref|XP_002301363.2|  hypothetical protein POPTR_0002s16220g             407   1e-136   Populus trichocarpa [western balsam poplar]
ref|XP_010488706.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    405   4e-136   
ref|XP_001764851.1|  predicted protein                                  402   6e-133   
ref|XP_001755364.1|  predicted protein                                  396   2e-131   
ref|XP_010242705.1|  PREDICTED: cysteine synthase-like                  395   1e-130   
ref|XP_008800744.1|  PREDICTED: cysteine synthase-like                  395   2e-130   
ref|XP_009416025.1|  PREDICTED: cysteine synthase-like                  395   2e-130   
emb|CAA47329.1|  cysteine synthase                                      394   3e-130   Spinacia oleracea
dbj|BAG72098.1|  chloroplast cysteine synthase                          394   4e-130   Spinacia oleracea
ref|XP_009768645.1|  PREDICTED: cysteine synthase, chloroplastic/...    393   1e-129   
gb|AGT40331.1|  O-acetylserine thiol-lyase                              393   1e-129   
ref|XP_010930274.1|  PREDICTED: cysteine synthase                       392   2e-129   
dbj|BAP47504.1|  O-acetylserine (thiol)lyase                            392   3e-129   
ref|XP_006492781.1|  PREDICTED: cysteine synthase, chloroplastic/...    392   3e-129   
ref|NP_001190152.1|  cysteine synthase C1                               386   4e-129   
ref|XP_006442164.1|  hypothetical protein CICLE_v10020519mg             391   5e-129   
emb|CAJ32461.1|  putative chloroplast cysteine synthase 1 precursor     390   6e-129   Nicotiana tabacum [American tobacco]
ref|XP_009401140.1|  PREDICTED: cysteine synthase-like                  391   7e-129   
ref|XP_010672447.1|  PREDICTED: cysteine synthase, chloroplastic/...    391   7e-129   
ref|XP_009592252.1|  PREDICTED: cysteine synthase, chloroplastic/...    391   7e-129   
gb|AHL84159.1|  cysteine synthase                                       390   9e-129   
gb|AAX07221.1|  chloroplast cysteine synthase GCS2                      390   1e-128   Allium sativum
sp|P32260.2|CYSKP_SPIOL  RecName: Full=Cysteine synthase, chlorop...    390   2e-128   Spinacia oleracea
gb|AIL49301.1|  cysteine synthase isoform 1                             390   2e-128   
dbj|BAA03542.1|  cysteine synthase                                      390   2e-128   Spinacia oleracea
ref|XP_002277485.1|  PREDICTED: cysteine synthase, chloroplastic/...    389   4e-128   Vitis vinifera
sp|O81155.1|CYSKP_SOLTU  RecName: Full=Cysteine synthase, chlorop...    389   4e-128   Solanum tuberosum [potatoes]
ref|XP_002974389.1|  hypothetical protein SELMODRAFT_232271             385   5e-128   
dbj|BAB20862.1|  plastidic cysteine synthase 1                          389   6e-128   Solanum tuberosum [potatoes]
ref|XP_004244764.1|  PREDICTED: cysteine synthase, chloroplastic/...    388   7e-128   
ref|XP_010526597.1|  PREDICTED: cysteine synthase, chloroplastic/...    389   9e-128   
ref|XP_009138900.1|  PREDICTED: cysteine synthase, mitochondrial        389   1e-127   
ref|XP_009394263.1|  PREDICTED: cysteine synthase                       385   2e-127   
ref|XP_006351051.1|  PREDICTED: cysteine synthase isoform X1            387   2e-127   
gb|ABK23255.1|  unknown                                                 384   5e-127   Picea sitchensis
gb|ABK23421.1|  unknown                                                 387   5e-127   Picea sitchensis
ref|XP_010532551.1|  PREDICTED: cysteine synthase                       383   7e-127   
ref|XP_002949438.1|  hypothetical protein VOLCADRAFT_89892              385   8e-127   
ref|XP_010256041.1|  PREDICTED: cysteine synthase                       383   9e-127   
ref|XP_011073980.1|  PREDICTED: cysteine synthase, chloroplastic/...    386   9e-127   
gb|KHG11750.1|  Cysteine synthase, chloroplastic/chromoplastic          386   1e-126   
ref|XP_003082455.1|  plastidic cysteine synthase 1 (ISS)                384   1e-126   
emb|CEF99986.1|  Cysteine synthase K/M                                  384   1e-126   
ref|XP_002524867.1|  cysteine synthase, putative                        386   1e-126   Ricinus communis
emb|CDY45790.1|  BnaC04g22760D                                          386   1e-126   
ref|XP_010512249.1|  PREDICTED: cysteine synthase, mitochondrial        387   1e-126   
emb|CDP08001.1|  unnamed protein product                                385   2e-126   
ref|XP_010039322.1|  PREDICTED: cysteine synthase                       385   4e-126   
emb|CDX89032.1|  BnaA04g01540D                                          385   5e-126   
gb|KFK35189.1|  hypothetical protein AALP_AA5G251700                    385   5e-126   
ref|XP_010917723.1|  PREDICTED: cysteine synthase                       381   7e-126   
gb|EYU36679.1|  hypothetical protein MIMGU_mgv1a007743mg                384   7e-126   
dbj|BAJ91393.1|  predicted protein                                      383   1e-125   
ref|XP_006290351.1|  hypothetical protein CARUB_v10017296mg             384   1e-125   
ref|XP_006284124.1|  hypothetical protein CARUB_v10005256mg             380   2e-125   
ref|XP_006402661.1|  hypothetical protein EUTSA_v10005989mg             384   2e-125   
ref|XP_002868245.1|  O-acetylserine (thiol) lyase (oas-tl) isofor...    380   2e-125   
ref|XP_009107806.1|  PREDICTED: cysteine synthase                       380   2e-125   
sp|O23733.1|CYSK1_BRAJU  RecName: Full=Cysteine synthase; Short=C...    380   2e-125   Brassica juncea [brown mustard]
ref|XP_007033723.1|  O-acetylserine lyase B isoform 1                   382   3e-125   
ref|XP_002982693.1|  hypothetical protein SELMODRAFT_234035             378   4e-125   
ref|NP_001045577.1|  Os01g0978100                                       381   5e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010524184.1|  PREDICTED: cysteine synthase, chloroplastic/...    382   5e-125   
ref|NP_193224.1|  O-acetylserine (thiol) lyase (OAS-TL) isoform A1      379   6e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CAA58893.1|  cysteine synthase                                      379   6e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006604835.1|  PREDICTED: cysteine synthase-like isoform X2       379   6e-125   
ref|XP_004309642.1|  PREDICTED: cysteine synthase, chloroplastic/...    381   6e-125   
ref|XP_008373398.1|  PREDICTED: cysteine synthase-like                  381   8e-125   
ref|XP_006414628.1|  hypothetical protein EUTSA_v10025734mg             377   1e-124   
gb|ACX70136.1|  O-acetylserine(thiol)lyase isoform A6                   377   2e-124   Brassica rapa subsp. chinensis [bok-choy]
gb|EPS66048.1|  cysteine synthase                                       377   2e-124   
ref|XP_001691935.1|  cysteine synthase                                  378   2e-124   Chlamydomonas reinhardtii
ref|XP_009372595.1|  PREDICTED: cysteine synthase-like                  380   2e-124   
pdb|2ISQ|A  Chain A, Crystal Structure Of O-Acetylserine Sulfhydr...    377   2e-124   
ref|XP_008797336.1|  PREDICTED: cysteine synthase                       377   3e-124   
ref|XP_001691936.1|  cysteine synthase                                  378   3e-124   Chlamydomonas reinhardtii
ref|XP_010413649.1|  PREDICTED: cysteine synthase, mitochondrial-...    380   3e-124   
ref|XP_007227711.1|  hypothetical protein PRUPE_ppa006674mg             379   3e-124   
pdb|1Z7Y|A  Chain A, Crystal Structure Of The Arabidopsis Thalian...    376   4e-124   
ref|XP_002981222.1|  hypothetical protein SELMODRAFT_233668             375   4e-124   
emb|CDY42795.1|  BnaC01g22710D                                          376   4e-124   
gb|KDP40178.1|  hypothetical protein JCGZ_02176                         376   4e-124   
ref|XP_009383903.1|  PREDICTED: cysteine synthase                       376   4e-124   
ref|NP_001276178.1|  cysteine synthase-like                             376   6e-124   
ref|XP_010469278.1|  PREDICTED: cysteine synthase, mitochondrial-...    380   6e-124   
ref|XP_006376449.1|  hypothetical protein POPTR_0013s13150g             379   6e-124   
ref|NP_191535.2|  cysteine synthase C                                   380   7e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851022.1|  cysteine synthase C                                   379   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006664222.1|  PREDICTED: cysteine synthase-like                  375   1e-123   
ref|XP_011037378.1|  PREDICTED: cysteine synthase                       378   1e-123   
emb|CAB71290.1|  O-acetylserine (thiol) lyase                           377   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397550.1|  hypothetical protein EUTSA_v10001481mg             378   1e-123   
ref|XP_003568980.1|  PREDICTED: cysteine synthase-like                  377   1e-123   
gb|KDP35151.1|  hypothetical protein JCGZ_10685                         378   1e-123   
ref|NP_001140754.1|  uncharacterized protein LOC100272829               378   1e-123   Zea mays [maize]
ref|XP_011032482.1|  PREDICTED: cysteine synthase-like                  375   1e-123   
ref|XP_010041625.1|  PREDICTED: cysteine synthase-like isoform X2       375   2e-123   
ref|NP_001235628.1|  cysteine synthase                                  375   2e-123   
ref|XP_009148046.1|  PREDICTED: cysteine synthase                       375   2e-123   
sp|Q00834.1|CYSK_SPIOL  RecName: Full=Cysteine synthase; AltName:...    375   2e-123   Spinacia oleracea
gb|KHN31018.1|  Cysteine synthase, chloroplastic/chromoplastic          377   2e-123   
emb|CDY09039.1|  BnaC08g09930D                                          374   2e-123   
ref|XP_001420867.1|  O-acetylserinethiol lyase/cysteine synthase        374   2e-123   Ostreococcus lucimarinus CCE9901
gb|AAC27794.1|  putative O-acetylserine(thiol)lyase precursor           375   3e-123   Chlamydomonas reinhardtii
ref|XP_010041618.1|  PREDICTED: cysteine synthase-like isoform X1       375   3e-123   
emb|CDY23400.1|  BnaC04g49280D                                          377   3e-123   
emb|CDY30438.1|  BnaA04g25390D                                          377   3e-123   
ref|XP_010534505.1|  PREDICTED: cysteine synthase, mitochondrial-...    377   3e-123   
ref|XP_009142968.1|  PREDICTED: cysteine synthase, chloroplastic/...    377   3e-123   
ref|XP_006295957.1|  hypothetical protein CARUB_v10025099mg             376   4e-123   
ref|XP_006655669.1|  PREDICTED: cysteine synthase, chloroplastic/...    377   4e-123   
gb|EMT06609.1|  Cysteine synthase, chloroplastic/chromoplastic          376   4e-123   
ref|XP_004167180.1|  PREDICTED: cysteine synthase, chloroplastic/...    376   4e-123   
ref|XP_004135335.1|  PREDICTED: cysteine synthase, chloroplastic/...    376   4e-123   
emb|CDX79804.1|  BnaA05g03520D                                          376   4e-123   
gb|KHG07476.1|  Cysteine synthase                                       374   4e-123   
emb|CDY17914.1|  BnaC04g03050D                                          376   4e-123   
ref|XP_010551723.1|  PREDICTED: cysteine synthase-like                  374   4e-123   
ref|XP_009142225.1|  PREDICTED: cysteine synthase, chloroplastic/...    376   5e-123   
ref|XP_004967885.1|  PREDICTED: cysteine synthase, chloroplastic/...    376   5e-123   
gb|ABQ02253.1|  O-acetylserine (thiol)lyase                             374   6e-123   Glycine soja [wild soybean]
sp|O23735.1|CYSK2_BRAJU  RecName: Full=Cysteine synthase; Short=C...    373   6e-123   Brassica juncea [brown mustard]
ref|NP_001146719.1|  cysteine synthase1                                 376   7e-123   Zea mays [maize]
emb|CDM81371.1|  unnamed protein product                                376   7e-123   
ref|XP_010508379.1|  PREDICTED: cysteine synthase, chloroplastic/...    376   7e-123   
gb|KHN32353.1|  Cysteine synthase, chloroplastic/chromoplastic          374   9e-123   
ref|XP_010517954.1|  PREDICTED: cysteine synthase, chloroplastic/...    375   9e-123   
ref|XP_010506279.1|  PREDICTED: cysteine synthase, chloroplastic/...    375   9e-123   
ref|XP_010466525.1|  PREDICTED: putative inactive cysteine syntha...    373   1e-122   
ref|XP_003518876.1|  PREDICTED: cysteine synthase, chloroplastic/...    375   1e-122   
gb|ACU19896.1|  unknown                                                 375   2e-122   Glycine max [soybeans]
ref|XP_008446019.1|  PREDICTED: cysteine synthase                       375   2e-122   
ref|XP_010435053.1|  PREDICTED: cysteine synthase 1-like                372   2e-122   
ref|XP_002881929.1|  hypothetical protein ARALYDRAFT_903778             375   2e-122   
ref|XP_004299115.1|  PREDICTED: cysteine synthase-like                  372   2e-122   
ref|XP_010277228.1|  PREDICTED: cysteine synthase                       372   2e-122   
gb|KDP23623.1|  hypothetical protein JCGZ_23456                         372   2e-122   
gb|AFK33382.1|  unknown                                                 372   2e-122   
ref|XP_002499947.1|  predicted protein                                  373   3e-122   Micromonas commoda
ref|XP_004247562.1|  PREDICTED: cysteine synthase                       372   3e-122   
gb|KHN31439.1|  Cysteine synthase                                       372   3e-122   
ref|XP_008223611.1|  PREDICTED: cysteine synthase-like                  374   3e-122   
ref|XP_002457554.1|  hypothetical protein SORBIDRAFT_03g009260          374   4e-122   Sorghum bicolor [broomcorn]
gb|ACL54626.1|  unknown                                                 371   4e-122   Zea mays [maize]
ref|XP_010449974.1|  PREDICTED: cysteine synthase 1-like                371   4e-122   
dbj|BAF02052.1|  cytosolic O-acetylserine(thiol)lyase                   377   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181903.1|  O-acetylserine (thiol) lyase (OAS-TL) isoform oasB    374   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238392.1|  cysteine synthase                                  371   4e-122   
ref|XP_004505148.1|  PREDICTED: cysteine synthase, mitochondrial-...    374   4e-122   
ref|NP_001051262.1|  Os03g0747800                                       371   4e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010550162.1|  PREDICTED: cysteine synthase isoform X1            371   5e-122   
gb|AAK76499.1|  putative cytosolic O-acetylserine(thiol)lyase           371   5e-122   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ21283.1|  hypothetical protein OsJ_36936                          371   5e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008388647.1|  PREDICTED: cysteine synthase                       371   6e-122   
ref|XP_005650235.1|  cysteine synthase                                  372   7e-122   
ref|XP_007034764.1|  Cysteine synthase                                  370   8e-122   
gb|ACC86121.1|  O-acetylserine(thiol)lyase                              372   9e-122   Knorringia sibirica
ref|XP_010440376.1|  PREDICTED: cysteine synthase 1                     370   9e-122   
gb|EPS57758.1|  cysteine synthase                                       367   9e-122   
ref|XP_010024285.1|  PREDICTED: cysteine synthase                       370   1e-121   
gb|EAY83966.1|  hypothetical protein OsI_39190                          373   1e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_003608090.1|  Cysteine synthase                                  372   1e-121   
ref|XP_006360789.1|  PREDICTED: cysteine synthase isoform X1            370   1e-121   
gb|AAD23907.1|AF073695_1  cysteine synthase                             370   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067319.1|  Os12g0625000                                       370   1e-121   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99438.2|  Cysteine synthase, putative, expressed                  373   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004511361.1|  PREDICTED: cysteine synthase-like isoform X1       370   1e-121   
ref|XP_010488274.1|  PREDICTED: putative inactive cysteine syntha...    370   1e-121   
gb|AGV54667.1|  cysteine synthase                                       370   1e-121   
ref|XP_006576133.1|  PREDICTED: cysteine synthase isoform X1            370   1e-121   
ref|XP_009418947.1|  PREDICTED: cysteine synthase-like                  370   2e-121   
ref|XP_004963252.1|  PREDICTED: cysteine synthase-like isoform X3       370   2e-121   
ref|XP_008353283.1|  PREDICTED: cysteine synthase                       370   2e-121   
ref|XP_009369846.1|  PREDICTED: cysteine synthase-like                  369   3e-121   
gb|KHN15751.1|  Cysteine synthase                                       369   3e-121   
ref|XP_010090922.1|  Cysteine synthase                                  369   4e-121   
ref|XP_008455731.1|  PREDICTED: cysteine synthase isoform X2            369   4e-121   
ref|NP_001235131.1|  OAS-TL4 cysteine synthase                          371   4e-121   
gb|KFK37199.1|  hypothetical protein AALP_AA4G226800                    371   4e-121   
gb|AGI97002.1|  O-acetylserine (thiol)-lyase                            371   5e-121   
ref|XP_008370676.1|  PREDICTED: cysteine synthase-like                  368   7e-121   
ref|XP_004495779.1|  PREDICTED: cysteine synthase-like                  368   7e-121   
ref|XP_010511384.1|  PREDICTED: putative inactive cysteine syntha...    368   7e-121   
ref|XP_008390894.1|  PREDICTED: cysteine synthase-like                  368   8e-121   
ref|XP_006382750.1|  hypothetical protein POPTR_0005s05040g             368   8e-121   
ref|XP_009610466.1|  PREDICTED: cysteine synthase                       368   1e-120   
ref|XP_003610723.1|  Cysteine synthase                                  368   1e-120   
gb|EMT25722.1|  Cysteine synthase                                       367   1e-120   
ref|XP_011071587.1|  PREDICTED: cysteine synthase                       367   1e-120   
ref|XP_007147139.1|  hypothetical protein PHAVU_006G099100g             367   1e-120   
sp|P31300.1|CYSKP_CAPAN  RecName: Full=Cysteine synthase, chlorop...    369   2e-120   
ref|NP_001274978.1|  cysteine synthase                                  367   2e-120   
ref|XP_011032499.1|  PREDICTED: cysteine synthase-like isoform X1       367   2e-120   
ref|XP_008455725.1|  PREDICTED: cysteine synthase isoform X1            369   2e-120   
ref|XP_011032502.1|  PREDICTED: cysteine synthase-like isoform X2       367   2e-120   
ref|XP_002311629.1|  O-acetylserine (thiol)lyase family protein         367   2e-120   
ref|XP_010674891.1|  PREDICTED: cysteine synthase                       367   2e-120   
ref|NP_001105469.1|  cysteine synthase precursor                        367   2e-120   
emb|CAB75795.1|  cysteine synthase                                      371   2e-120   
ref|NP_001275189.1|  cysteine synthase, chloroplastic/chromoplastic     368   3e-120   
emb|CAA57344.1|  cysteine synthase                                      369   4e-120   
sp|P38076.1|CYSK_WHEAT  RecName: Full=Cysteine synthase; AltName:...    366   4e-120   
gb|KFM23526.1|  Cysteine synthase, chloroplastic/chromoplastic          366   5e-120   
gb|KDD74825.1|  pyridoxal-phosphate dependent enzyme                    365   6e-120   
ref|XP_003608087.1|  Cysteine synthase                                  367   6e-120   
ref|XP_002517133.1|  cysteine synthase, putative                        365   7e-120   
ref|XP_006650579.1|  PREDICTED: cysteine synthase-like isoform X1       365   8e-120   
ref|XP_004302008.1|  PREDICTED: cysteine synthase-like                  365   8e-120   
gb|AFK39569.1|  unknown                                                 365   1e-119   
ref|XP_002512253.1|  cysteine synthase, putative                        365   1e-119   
ref|XP_004496722.1|  PREDICTED: cysteine synthase-like                  365   1e-119   
emb|CDY29778.1|  BnaA01g18880D                                          364   2e-119   
ref|XP_011090730.1|  PREDICTED: cysteine synthase                       364   2e-119   
ref|XP_008224312.1|  PREDICTED: cysteine synthase-like                  364   2e-119   
gb|AAX07222.1|  cysteine synthase GCS3                                  364   2e-119   
ref|XP_009398530.1|  PREDICTED: cysteine synthase                       364   3e-119   
ref|XP_003591034.1|  Cysteine synthase                                  364   3e-119   
ref|XP_006382748.1|  O-acetylserine (thiol)lyase family protein         364   3e-119   
ref|NP_001238411.1|  cysteine synthase                                  364   3e-119   
ref|XP_008218185.1|  PREDICTED: cysteine synthase                       364   3e-119   
ref|XP_011073981.1|  PREDICTED: cysteine synthase, chloroplastic/...    366   4e-119   
gb|EYU41484.1|  hypothetical protein MIMGU_mgv1a010001mg                363   6e-119   
ref|XP_007143261.1|  hypothetical protein PHAVU_007G057600g             363   7e-119   
ref|XP_007222677.1|  hypothetical protein PRUPE_ppa008606mg             363   8e-119   
ref|XP_007205548.1|  hypothetical protein PRUPE_ppa008600mg             363   8e-119   
ref|NP_001291337.1|  cysteine synthase                                  363   9e-119   
sp|O81154.1|CYSK_SOLTU  RecName: Full=Cysteine synthase; AltName:...    363   9e-119   
ref|XP_010090277.1|  Cysteine synthase                                  362   1e-118   
gb|KHG02272.1|  Cysteine synthase                                       362   1e-118   
gb|KEH43875.1|  O-acetylserine (thiol) lyase                            362   1e-118   
gb|AGI97003.1|  O-acetylserine (thiol)-lyase                            362   1e-118   
gb|KDO53280.1|  hypothetical protein CISIN_1g020528mg                   362   1e-118   
ref|XP_006433058.1|  hypothetical protein CICLE_v10001835mg             362   1e-118   
ref|XP_007030649.1|  Cysteine synthase isoform 1                        362   2e-118   
ref|XP_002275990.1|  PREDICTED: cysteine synthase                       362   2e-118   
ref|XP_003591038.1|  Cysteine synthase                                  362   2e-118   
dbj|BAP47503.1|  O-acetylserine (thiol)lyase                            362   2e-118   
gb|AFK42468.1|  unknown                                                 362   2e-118   
dbj|BAA93051.1|  cysteine synthase                                      362   2e-118   
ref|XP_007157127.1|  hypothetical protein PHAVU_002G045200g             362   3e-118   
ref|XP_011003785.1|  PREDICTED: cysteine synthase-like isoform X1       361   3e-118   
emb|CAE45017.1|  putative o-acetylserine thiol lyase                    360   3e-118   
sp|Q43317.1|CYSK_CITLA  RecName: Full=Cysteine synthase; Short=CS...    361   3e-118   
dbj|BAK38374.1|  cysteine synthase                                      361   4e-118   
gb|EYU36680.1|  hypothetical protein MIMGU_mgv1a007743mg                363   6e-118   
ref|XP_003633659.1|  PREDICTED: cysteine synthase                       360   9e-118   
ref|XP_002512257.1|  cysteine synthase, putative                        360   9e-118   
gb|AAA16973.1|  O-acetylserine-(thiol)-lyase                            362   1e-117   
ref|XP_002512256.1|  cysteine synthase, putative                        360   1e-117   
ref|XP_004302011.1|  PREDICTED: cysteine synthase-like                  360   1e-117   
emb|CAN76754.1|  hypothetical protein VITISV_031201                     360   1e-117   
ref|XP_003055210.1|  predicted protein                                  358   2e-117   
ref|XP_010906459.1|  PREDICTED: cysteine synthase isoform X1            359   3e-117   
ref|XP_008796758.1|  PREDICTED: cysteine synthase                       358   4e-117   
gb|EMS62090.1|  Cysteine synthase                                       359   4e-117   
ref|XP_011003782.1|  PREDICTED: cysteine synthase                       358   5e-117   
ref|XP_010236985.1|  PREDICTED: cysteine synthase                       358   7e-117   
ref|XP_006389317.1|  O-acetylserine (thiol)lyase family protein         358   8e-117   
ref|XP_009784384.1|  PREDICTED: cysteine synthase isoform X2            358   8e-117   
ref|XP_009784383.1|  PREDICTED: cysteine synthase isoform X1            361   9e-117   
gb|AAR18402.1|  cysteine synthase                                       357   9e-117   
ref|XP_004302010.1|  PREDICTED: cysteine synthase-like                  357   9e-117   
gb|KDO74567.1|  hypothetical protein CISIN_1g020501mg                   358   9e-117   
ref|XP_004139216.1|  PREDICTED: cysteine synthase-like                  358   9e-117   
ref|XP_006419940.1|  hypothetical protein CICLE_v10005422mg             357   1e-116   
gb|KCW46033.1|  hypothetical protein EUGRSUZ_L00009                     360   1e-116   
ref|XP_003633660.1|  PREDICTED: cysteine synthase isoform X3            357   1e-116   
ref|XP_008218181.1|  PREDICTED: cysteine synthase-like isoform X2       357   2e-116   
ref|XP_008218180.1|  PREDICTED: cysteine synthase-like isoform X1       357   2e-116   
ref|XP_011026557.1|  PREDICTED: cysteine synthase                       356   3e-116   
ref|XP_011016616.1|  PREDICTED: cysteine synthase-like isoform X1       356   3e-116   
ref|XP_010025073.1|  PREDICTED: cysteine synthase-like isoform X2       357   3e-116   
ref|NP_188885.3|  O-acetylserine (thiol) lyase (OAS-TL) isoform A2      355   3e-116   
tpg|DAA53924.1|  TPA: hypothetical protein ZEAMMB73_955287              355   5e-116   
ref|XP_006588424.1|  PREDICTED: uncharacterized protein LOC100775...    356   5e-116   
ref|XP_007511301.1|  cysteine synthase                                  357   6e-116   
ref|NP_001242884.1|  uncharacterized protein LOC100775420               355   6e-116   
ref|XP_002883369.1|  cysteine synthase                                  355   6e-116   
ref|XP_006433065.1|  hypothetical protein CICLE_v10001821mg             355   8e-116   
ref|XP_006605279.1|  PREDICTED: cysteine synthase isoform X1            355   1e-115   
gb|EMS61355.1|  Cysteine synthase, chloroplastic/chromoplastic          372   1e-115   
ref|XP_004495780.1|  PREDICTED: cysteine synthase-like                  354   2e-115   
ref|XP_010025072.1|  PREDICTED: cysteine synthase-like isoform X1       356   3e-115   
ref|XP_006382742.1|  O-acetylserine (thiol)lyase family protein         353   3e-115   
ref|XP_010025068.1|  PREDICTED: cysteine synthase-like isoform X1       353   4e-115   
ref|XP_007030657.1|  Cysteine synthase D1 isoform 1                     353   4e-115   
ref|XP_011032479.1|  PREDICTED: cysteine synthase-like                  353   7e-115   
ref|XP_010659934.1|  PREDICTED: cysteine synthase                       352   1e-114   
ref|XP_010025075.1|  PREDICTED: cysteine synthase                       352   1e-114   
ref|XP_006347804.1|  PREDICTED: cysteine synthase-like isoform X1       352   1e-114   
emb|CDO99063.1|  unnamed protein product                                351   2e-114   
ref|XP_003546824.1|  PREDICTED: cysteine synthase-like isoform X1       351   3e-114   
ref|XP_010025069.1|  PREDICTED: cysteine synthase-like isoform X2       351   3e-114   
emb|CBI34221.3|  unnamed protein product                                352   3e-114   
ref|XP_010041577.1|  PREDICTED: cysteine synthase-like isoform X2       351   3e-114   
ref|XP_010041572.1|  PREDICTED: cysteine synthase-like isoform X1       351   5e-114   
ref|XP_006347807.1|  PREDICTED: cysteine synthase-like isoform X1       350   7e-114   
ref|XP_008355808.1|  PREDICTED: cysteine synthase-like isoform X2       350   8e-114   
ref|XP_006858785.1|  hypothetical protein AMTR_s00066p00160090          351   1e-113   
emb|CAN71717.1|  hypothetical protein VITISV_017301                     349   1e-113   
ref|XP_001703301.1|  cysteine synthase                                  352   1e-113   
ref|NP_001235267.1|  cysteine synthase                                  349   2e-113   
ref|XP_006471745.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    349   3e-113   
gb|KCW61661.1|  hypothetical protein EUGRSUZ_H04394                     348   4e-113   
ref|XP_004230129.1|  PREDICTED: cysteine synthase                       348   4e-113   
gb|KCW84894.1|  hypothetical protein EUGRSUZ_B01722                     352   4e-113   
gb|KDP23621.1|  hypothetical protein JCGZ_23454                         348   5e-113   
ref|XP_008370666.1|  PREDICTED: cysteine synthase-like                  348   6e-113   
ref|XP_002275778.1|  PREDICTED: cysteine synthase                       348   7e-113   
ref|XP_002512254.1|  cysteine synthase, putative                        347   8e-113   
ref|XP_003633662.1|  PREDICTED: cysteine synthase isoform X1            347   1e-112   
ref|NP_001238426.1|  cysteine synthase                                  347   1e-112   
ref|XP_007144802.1|  hypothetical protein PHAVU_007G185200g             347   1e-112   
ref|XP_010659943.1|  PREDICTED: cysteine synthase isoform X2            347   2e-112   
ref|XP_002946965.1|  hypothetical protein VOLCADRAFT_79370              349   2e-112   
ref|XP_006347860.1|  PREDICTED: cysteine synthase-like                  347   2e-112   
ref|XP_010695544.1|  PREDICTED: cysteine synthase                       349   2e-112   
dbj|BAD19048.1|  beta-cyanoalanine synthase                             342   3e-112   
gb|KDD75333.1|  pyridoxal-phosphate dependent enzyme                    345   3e-112   
ref|XP_010025071.1|  PREDICTED: cysteine synthase-like                  346   3e-112   
ref|XP_003579734.1|  PREDICTED: cysteine synthase-like                  346   4e-112   
gb|KHN86194.1|  Cysteine synthase                                       346   4e-112   
ref|XP_003556488.1|  PREDICTED: cysteine synthase-like isoform X1       345   4e-112   
gb|ERG83036.1|  cysteine synthase                                       346   5e-112   
gb|EEE59927.1|  hypothetical protein OsJ_12564                          374   5e-112   
ref|XP_006588353.1|  PREDICTED: cysteine synthase isoform X1            345   5e-112   
ref|XP_008370667.1|  PREDICTED: cysteine synthase-like                  345   5e-112   
dbj|BAD19047.1|  beta-cyanoalanine synthase                             341   5e-112   
tpg|DAA47611.1|  TPA: hypothetical protein ZEAMMB73_019937              345   6e-112   
gb|EEC76175.1|  hypothetical protein OsI_13501                          375   8e-112   
ref|XP_006433061.1|  hypothetical protein CICLE_v10001793mg             344   2e-111   
gb|KHN43214.1|  Cysteine synthase                                       343   3e-111   
ref|XP_004302009.1|  PREDICTED: cysteine synthase-like                  343   3e-111   
ref|XP_009774322.1|  PREDICTED: cysteine synthase-like isoform X1       343   6e-111   
ref|XP_010089187.1|  putative cysteine synthase                         344   6e-111   
ref|XP_006826284.1|  hypothetical protein AMTR_s00004p00055080          343   7e-111   
ref|XP_010906464.1|  PREDICTED: cysteine synthase                       342   1e-110   
ref|XP_009597796.1|  PREDICTED: cysteine synthase-like                  342   1e-110   
emb|CDY50768.1|  BnaAnng10750D                                          341   2e-110   
ref|XP_009134799.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    341   2e-110   
ref|XP_010101369.1|  Cysteine synthase                                  344   3e-110   
emb|CDY41911.1|  BnaC05g46930D                                          341   3e-110   
gb|KHN14732.1|  Cysteine synthase                                       342   3e-110   
ref|XP_005645450.1|  cysteine synthase                                  343   5e-110   
ref|XP_010485883.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    343   5e-110   
ref|XP_002878288.1|  O-acetylserine (thiol) lyase isoform C             344   5e-110   
ref|XP_010550942.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    341   9e-110   
ref|XP_008669424.1|  PREDICTED: cysteine synthase-like                  340   1e-109   
ref|XP_010420329.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    339   1e-109   
ref|XP_010550943.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    339   1e-109   
gb|ABF58693.1|  beta-cyanoalinine synthase                              334   1e-109   
ref|XP_010463983.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    339   2e-109   
ref|XP_007030659.1|  Cysteine synthase D1 isoform 3                     338   2e-109   
ref|XP_008450767.1|  PREDICTED: cysteine synthase-like isoform X1       338   2e-109   
ref|XP_007144801.1|  hypothetical protein PHAVU_007G185100g             338   3e-109   
ref|XP_010469279.1|  PREDICTED: cysteine synthase, mitochondrial-...    342   4e-109   
gb|AAM65212.1|  putative cysteine synthase                              338   5e-109   
ref|XP_010546614.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    338   5e-109   
emb|CAA57343.1|  cysteine synthase                                      337   7e-109   
ref|XP_010922897.1|  PREDICTED: cysteine synthase-like isoform X1       339   1e-108   
ref|XP_006471742.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    337   1e-108   
ref|NP_851023.1|  cysteine synthase C                                   340   1e-108   
ref|XP_003591035.1|  Cysteine synthase                                  336   2e-108   
gb|AES90286.2|  O-acetylserine (thiol) lyase                            337   2e-108   
ref|XP_002882385.1|  hypothetical protein ARALYDRAFT_896550             336   2e-108   
ref|NP_566243.1|  cysteine synthase D1                                  336   3e-108   
emb|CDX74160.1|  BnaA03g28870D                                          335   3e-108   
ref|XP_011032485.1|  PREDICTED: bifunctional L-3-cyanoalanine syn...    335   4e-108   
ref|XP_006408132.1|  hypothetical protein EUTSA_v10021151mg             335   4e-108   
ref|XP_006829807.1|  hypothetical protein AMTR_s00119p00070790          335   5e-108   
ref|XP_007033724.1|  O-acetylserine lyase B isoform 2                   338   6e-108   
ref|XP_010550178.1|  PREDICTED: cysteine synthase isoform X2            334   6e-108   
ref|XP_006433064.1|  hypothetical protein CICLE_v10001821mg             335   8e-108   
gb|EJK53101.1|  hypothetical protein THAOC_27524                        335   1e-107   
gb|KGN66164.1|  hypothetical protein Csa_1G574810                       334   1e-107   
ref|XP_003521872.2|  PREDICTED: probable S-sulfocysteine synthase...    335   2e-107   
gb|EYU40936.1|  hypothetical protein MIMGU_mgv1a011348mg                332   2e-107   
gb|AAG51407.1|AC009465_7  putative cysteine synthase; 39489-37437       336   3e-107   
gb|EEC71697.1|  hypothetical protein OsI_04195                          335   3e-107   
ref|XP_008450764.1|  PREDICTED: cysteine synthase-like                  333   3e-107   
ref|XP_004963250.1|  PREDICTED: cysteine synthase-like isoform X1       333   4e-107   
ref|XP_006644896.1|  PREDICTED: probable S-sulfocysteine synthase...    335   4e-107   
ref|NP_001136599.1|  cysteine synthase                                  332   4e-107   
tpg|DAA47605.1|  TPA: hypothetical protein ZEAMMB73_019937              333   7e-107   
gb|KHN34626.1|  Putative cysteine synthase, chloroplastic               334   7e-107   
gb|KCW61659.1|  hypothetical protein EUGRSUZ_H04391                     331   7e-107   
ref|XP_010674895.1|  PREDICTED: cysteine synthase-like                  332   8e-107   
ref|XP_004166332.1|  PREDICTED: cysteine synthase-like                  332   8e-107   
emb|CAA57498.1|  cysteine synthase                                      335   1e-106   
gb|KFM24464.1|  Cysteine synthase, chloroplastic/chromoplastic          333   1e-106   
gb|AHG97874.1|  Cy-O-acetylserine thiol lyase                           332   1e-106   
ref|XP_003554061.1|  PREDICTED: probable S-sulfocysteine synthase...    333   2e-106   
ref|XP_005843968.1|  hypothetical protein CHLNCDRAFT_27694              331   3e-106   
ref|XP_009353050.1|  PREDICTED: probable S-sulfocysteine synthase...    332   3e-106   
ref|XP_005539314.1|  O-acetylserine (thiol)-lyase 1                     333   4e-106   
ref|WP_011522898.1|  cysteine synthase                                  330   5e-106   
gb|ACN29139.1|  unknown                                                 328   7e-106   
ref|NP_001044611.1|  Os01g0814800                                       332   8e-106   



>ref|XP_011092647.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Sesamum indicum]
Length=372

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/373 (87%), Positives = 342/373 (92%), Gaps = 7/373 (2%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFN---AGQPLAHS--FAQRLRDLPKDFPATNIKKETSQ  298
             AAL+NLMK+RS    SIF  +FF+   +  PL  S  FAQRLRDLPKD P TNIKKE SQ
Sbjct  2     AALSNLMKKRSHF--SIFKEKFFSTTASASPLVDSPSFAQRLRDLPKDLPGTNIKKEVSQ  59

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAEKKGLITPGKTTLI
Sbjct  60    LIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEKKGLITPGKTTLI  119

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKK
Sbjct  120   EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKK  179

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AY+LLESTP+ FMLQQFSNPANTQ+HFETTGPEIWEDT G VDIF+MGIGSGGTVSGVGQ
Sbjct  180   AYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTNGKVDIFIMGIGSGGTVSGVGQ  239

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NP+VKIYG+EP ESNILNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE+A
Sbjct  240   YLKSKNPDVKIYGLEPEESNILNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEDA  299

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             VNMARELALKEGLMVGISSGANTVAALRLA +PENKGKLIVTVHPSFGERYLSSVL+QEL
Sbjct  300   VNMARELALKEGLMVGISSGANTVAALRLARRPENKGKLIVTVHPSFGERYLSSVLFQEL  359

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  360   RNEAEKMQPVSVD  372



>dbj|BAP47505.1| O-acetylserine (thiol)lyase [Gentiana triflora]
Length=372

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/372 (85%), Positives = 336/372 (90%), Gaps = 5/372 (1%)
 Frame = +2

Query  131   AAALTNLMKRRSFLQPSIFNTRFFNAGQPLAH---SFAQRLRDLPKDFPATNIKKETSQL  301
             AAAL NL KR S    SIF TR F++ QPL     SF QRLRDLPKD P TNIKKE S L
Sbjct  3     AAALANLCKRNSS-NNSIFKTRLFSS-QPLVENSPSFIQRLRDLPKDLPGTNIKKEASLL  60

Query  302   IGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIE  481
             IG+TPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA+AM  DAEKKGLITPGKT LIE
Sbjct  61    IGKTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMFNDAEKKGLITPGKTILIE  120

Query  482   PTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKA  661
             PTSGNMGISMAFIAAMKGYKMVLTMPSYTS+ERRV+MR FGADL+LTDP KGMGGTVKKA
Sbjct  121   PTSGNMGISMAFIAAMKGYKMVLTMPSYTSLERRVSMRAFGADLILTDPTKGMGGTVKKA  180

Query  662   YDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQY  841
             YDLLESTPN FMLQQFSNPANTQ HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQY
Sbjct  181   YDLLESTPNAFMLQQFSNPANTQAHFETTGPEIWEDTNGKVDIFVMGIGSGGTVSGVGQY  240

Query  842   LKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAV  1021
             LKS+NPNVKIYG+EPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE++V
Sbjct  241   LKSKNPNVKIYGLEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEDSV  300

Query  1022  NMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELR  1201
              MARELA+KEGL VGISSGANTVAALRLA KPENKGKLIVT+HPSFGERYLSSVL++E+R
Sbjct  301   KMARELAVKEGLYVGISSGANTVAALRLAQKPENKGKLIVTIHPSFGERYLSSVLFEEIR  360

Query  1202  AEAEAMQPVPVD  1237
              EAE MQPV VD
Sbjct  361   KEAENMQPVSVD  372



>ref|XP_009783358.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nicotiana sylvestris]
Length=368

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/367 (86%), Positives = 335/367 (91%), Gaps = 6/367 (2%)
 Frame = +2

Query  149   LMKRRSFLQPSIFNTRFFNAGQPLA----HSFAQRLRDLPKDFPATNIKKETSQLIGRTP  316
              +KRRS +     N R F+  + LA     SF QRLRDLP+  P TNIK E SQLIG+TP
Sbjct  4     FLKRRS-IDVMKANNRLFST-EALATDSQSSFVQRLRDLPRHLPGTNIKSEVSQLIGKTP  61

Query  317   LVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGN  496
             LVYLNKV+EGCGAYIA KQEMMQPT+SIKDRPA AMI DAEKKGLI+PGKTTLIEPTSGN
Sbjct  62    LVYLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLISPGKTTLIEPTSGN  121

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
             MGISMAF+AAMKGYKMVLTMPSYTS+ERRV MR FGADLV+TDP KGMGGTVKKAYDLLE
Sbjct  122   MGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGADLVITDPTKGMGGTVKKAYDLLE  181

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
             STPN FMLQQFSNPANTQ+HFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKS+N
Sbjct  182   STPNAFMLQQFSNPANTQVHFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKSKN  241

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PNVKIYGIEPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEEAVNMARE
Sbjct  242   PNVKIYGIEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEEAVNMARE  301

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LALKEGLMVGISSGANTVAALRLA+KPEN+GKLIVT+HPSFGERYLSSVLYQELR EAE 
Sbjct  302   LALKEGLMVGISSGANTVAALRLANKPENRGKLIVTIHPSFGERYLSSVLYQELRKEAEN  361

Query  1217  MQPVPVD  1237
             MQPVPVD
Sbjct  362   MQPVPVD  368



>ref|XP_009626848.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nicotiana tomentosiformis]
Length=368

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/370 (85%), Positives = 336/370 (91%), Gaps = 6/370 (2%)
 Frame = +2

Query  140   LTNLMKRRSFLQPSIFNTRFFNAGQPLA----HSFAQRLRDLPKDFPATNIKKETSQLIG  307
             + + +KRR ++     N R F+  + LA     SFAQRLRDLPK  P TNIK E SQLIG
Sbjct  1     MASFLKRR-YIHVMKANNRLFST-ETLATDSESSFAQRLRDLPKYLPGTNIKTEVSQLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             +TPLVYLNKV+EGCGAYIA KQEMMQPT+SIKDRPA AMI DAEKKGLI+PG+TTLIEPT
Sbjct  59    KTPLVYLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLISPGETTLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRV MR FGADLV+TDP KGMGGTVKKAYD
Sbjct  119   SGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGADLVITDPTKGMGGTVKKAYD  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTPN FMLQQFSNPANTQ+HFETTGPEIWEDT+GNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  179   LLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTRGNVDIFVMGIGSGGTVSGVGQYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             S+NPNVKIYGIEPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEEAVNM
Sbjct  239   SKNPNVKIYGIEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEEAVNM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAALRLA KPEN+GKLIVT+HPSFGERYLSSVLYQELR E
Sbjct  299   ARELALKEGLMVGISSGANTVAALRLAKKPENRGKLIVTIHPSFGERYLSSVLYQELRKE  358

Query  1208  AEAMQPVPVD  1237
             AE MQPV VD
Sbjct  359   AENMQPVQVD  368



>gb|KHG16843.1| Cysteine synthase, chloroplastic/chromoplastic [Gossypium arboreum]
Length=371

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/370 (84%), Positives = 331/370 (89%), Gaps = 2/370 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPL--AHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             AAL + +++R      +  TR   + +P+  + SF QRLRDLPKD P T IK+E SQLIG
Sbjct  2     AALRSFLRKRCLTCNELMMTRRLISTEPIIDSSSFVQRLRDLPKDLPGTKIKREVSQLIG  61

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LNKVTEGCGAYIA KQEMMQPT+SIKDRPA AMI DAEKK LI+PGKTTLIEPT
Sbjct  62    RTPLVFLNKVTEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKNLISPGKTTLIEPT  121

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKMVLTMPSYTSIERRVTMR FGADL+LTDP KGMGGTVKKAYD
Sbjct  122   SGNMGISMAFMAAMKGYKMVLTMPSYTSIERRVTMRAFGADLILTDPTKGMGGTVKKAYD  181

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTPN FMLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLK
Sbjct  182   LLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTLGKVDIFVMGIGSGGTVSGVGQYLK  241

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             SQNPNV+IYG+EP ESN+LNGGKPGPHHITGNGVGFKPDILDMDVME+VL VSSE+AV M
Sbjct  242   SQNPNVQIYGVEPAESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDAVKM  301

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QELR E
Sbjct  302   ARELALKEGLMVGISSGANTVAALRLARMPENKGKLIVTVHPSFGERYLSSVLFQELRNE  361

Query  1208  AEAMQPVPVD  1237
             AE MQPV VD
Sbjct  362   AENMQPVAVD  371



>emb|CAN62383.1| hypothetical protein VITISV_028023 [Vitis vinifera]
Length=371

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/370 (83%), Positives = 339/370 (92%), Gaps = 2/370 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPL--AHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             AAL++  KR+S +  +    R + + QP+  + SF+QR+RDLPKD P TNIKKE SQLIG
Sbjct  2     AALSSFFKRKSSIPFTSLAIRRWFSTQPILDSPSFSQRIRDLPKDLPGTNIKKEVSQLIG  61

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             +TPLV+LNKVTEGCGAY+A KQEMMQPTASIKDRPA+AMI DAE K LITPGKT LIEPT
Sbjct  62    KTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAEBKQLITPGKTVLIEPT  121

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKAY+
Sbjct  122   SGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKKAYE  181

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTP+ FMLQQFSNPANTQ+HFETTGPEIWEDT+G VDIF+MGIGSGGTVSGVG+YLK
Sbjct  182   LLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMGIGSGGTVSGVGRYLK  241

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             SQNPNVKIYG+EPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE+AVNM
Sbjct  242   SQNPNVKIYGLEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEDAVNM  301

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             AR+LALKEGLMVGISSGANTVAALRLA +PENKGKLIVT+HPSFGERYLSSVL+QELR E
Sbjct  302   ARQLALKEGLMVGISSGANTVAALRLARRPENKGKLIVTIHPSFGERYLSSVLFQELRKE  361

Query  1208  AEAMQPVPVD  1237
             AE MQPV VD
Sbjct  362   AENMQPVSVD  371



>ref|XP_002276013.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Vitis vinifera]
 emb|CBI40395.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/370 (83%), Positives = 339/370 (92%), Gaps = 2/370 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPL--AHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             AAL++  KR+S +  +    R + + QP+  + SF+QR+RDLPKD P TNIKKE SQLIG
Sbjct  2     AALSSFFKRKSSIPFTSLAIRRWFSTQPILDSPSFSQRIRDLPKDLPGTNIKKEVSQLIG  61

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             +TPLV+LNKVTEGCGAY+A KQEMMQPTASIKDRPA+AMI DAE K LITPGKT LIEPT
Sbjct  62    KTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAEDKQLITPGKTVLIEPT  121

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKAY+
Sbjct  122   SGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKKAYE  181

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTP+ FMLQQFSNPANTQ+HFETTGPEIWEDT+G VDIF+MGIGSGGTVSGVG+YLK
Sbjct  182   LLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMGIGSGGTVSGVGRYLK  241

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             SQNPNVKIYG+EPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE+AVNM
Sbjct  242   SQNPNVKIYGLEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEDAVNM  301

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             AR+LALKEGLMVGISSGANTVAALRLA +PENKGKLIVT+HPSFGERYLSSVL+QELR E
Sbjct  302   ARQLALKEGLMVGISSGANTVAALRLARRPENKGKLIVTIHPSFGERYLSSVLFQELRKE  361

Query  1208  AEAMQPVPVD  1237
             AE MQPV VD
Sbjct  362   AENMQPVSVD  371



>ref|XP_007051769.1| Cysteine synthase C1 [Theobroma cacao]
 gb|EOX95926.1| Cysteine synthase C1 [Theobroma cacao]
Length=384

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/383 (81%), Positives = 332/383 (87%), Gaps = 15/383 (4%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPLAHS-FAQRLRDLPKDFPATNIKKETSQLIGR  310
             AAL + +K+RS     +   R   + +P+  S FAQRLRDLPKD P T IK+E SQLIGR
Sbjct  2     AALRSFLKKRSLTCNELMMARRLVSTEPIIESPFAQRLRDLPKDLPGTKIKREVSQLIGR  61

Query  311   TPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTS  490
             TPLV+LNKVTEGCGAYIA KQEMMQPTASIKDRPAMAMIADAEKK LI PGKTTLIEPTS
Sbjct  62    TPLVFLNKVTEGCGAYIAVKQEMMQPTASIKDRPAMAMIADAEKKNLIAPGKTTLIEPTS  121

Query  491   GNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDL  670
             GNMGISMAF+A MKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKAY+L
Sbjct  122   GNMGISMAFMATMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKKAYEL  181

Query  671   LESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKS  850
             LESTPN FMLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS
Sbjct  182   LESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTLGKVDIFVMGIGSGGTVSGVGQYLKS  241

Query  851   QNPNVKIYGIEPTESNILNGGKP--------------GPHHITGNGVGFKPDIldmdvme  988
             QNPNVKIYG+EP ESN+LNGGKP              GPHHITGNGVGFKPDILDMDVME
Sbjct  242   QNPNVKIYGVEPAESNVLNGGKPGKLFVDLTSMLFPSGPHHITGNGVGFKPDILDMDVME  301

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             +VL VSSE+AVNMARELALKEGLMVGISSGANTVAAL+LA  PENKGKLIVTVHPSFGER
Sbjct  302   KVLEVSSEDAVNMARELALKEGLMVGISSGANTVAALKLARLPENKGKLIVTVHPSFGER  361

Query  1169  YLSSVLYQELRAEAEAMQPVPVD  1237
             YLSSVL+QELR EAE MQPV VD
Sbjct  362   YLSSVLFQELRKEAENMQPVAVD  384



>emb|CDP08794.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/374 (84%), Positives = 342/374 (91%), Gaps = 6/374 (2%)
 Frame = +2

Query  134   AALTNLMKRRSFL--QPSIFNTRFFNAGQPLAH--SFAQRLRDLPKDFPATNIKKETSQL  301
             AAL++L KR+S +     I ++R F+    L +  SFAQRLRDLPKDFP TNI+KE SQL
Sbjct  2     AALSSLFKRKSSIPFNGLIRSSRLFSTETLLDNCPSFAQRLRDLPKDFPGTNIRKEASQL  61

Query  302   IGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDR-PA-MAMIADAEKKGLITPGKTTL  475
             IGRTP+VYLN+VTEGCGAYIAAKQEM QPTASIKDR PA  AMIADAEKKGLI+PG+TTL
Sbjct  62    IGRTPIVYLNRVTEGCGAYIAAKQEMFQPTASIKDRQPATFAMIADAEKKGLISPGETTL  121

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AA+KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVK
Sbjct  122   IEPTSGNMGISMAFMAALKGYKMVLTMPSYTSLERRVTMRTFGAELILTDPTKGMGGTVK  181

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KA  LLE TPNGFMLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  182   KADQLLEKTPNGFMLQQFSNPANTQVHFETTGPEIWEDTNGKVDIFVMGIGSGGTVSGVG  241

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NP+VKIYG+EPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVME+VLMVSSEE
Sbjct  242   QYLKSKNPDVKIYGVEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEQVLMVSSEE  301

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMARELALKEGLMVGISSGANTVAAL+LA KPENKGKLIVTVHPSFGERYLSSVL++E
Sbjct  302   AVNMARELALKEGLMVGISSGANTVAALQLAQKPENKGKLIVTVHPSFGERYLSSVLFEE  361

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPVPVD
Sbjct  362   LRKEAENMQPVPVD  375



>ref|XP_003534555.1| PREDICTED: l-3-cyanoalanine synthase 1, mitochondrial-like [Glycine 
max]
Length=373

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/373 (82%), Positives = 332/373 (89%), Gaps = 3/373 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFN---AGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+ ++ ++K+RS    S      F+   A    + S AQR+RDLPKD P TNIKK  SQ
Sbjct  1     MASLMSTILKQRSCSSSSHAGRLLFSTTTAAIVDSPSLAQRIRDLPKDLPGTNIKKHVSQ  60

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAE+K LITPGKTTLI
Sbjct  61    LIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTLI  120

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVKK
Sbjct  121   EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKK  180

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AY+LLE+TPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  181   AYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQ  240

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNGVGFKPDILD+DVME+VL VSSE+A
Sbjct  241   YLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVMEKVLEVSSEDA  300

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             VNMAR LALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QEL
Sbjct  301   VNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFGERYLSSVLFQEL  360

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  361   RQEAENMQPVAVD  373



>gb|EYU32144.1| hypothetical protein MIMGU_mgv1a008503mg [Erythranthe guttata]
Length=371

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/369 (83%), Positives = 330/369 (89%), Gaps = 7/369 (2%)
 Frame = +2

Query  149   LMKRRSFLQPSIFNTRFFNAGQ----PLAHS--FAQRLRDLPKDFPATNIKKETSQLIGR  310
             LMKR   L  S++   FF++      PL  S  FAQRLRDLPKD P T IKKE SQLIGR
Sbjct  4     LMKRSCKLS-SVYKCNFFSSTTAGTIPLVDSPSFAQRLRDLPKDLPGTKIKKEVSQLIGR  62

Query  311   TPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTS  490
             TPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAE+KGLITPGKTTLIEPTS
Sbjct  63    TPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAFAMITDAEEKGLITPGKTTLIEPTS  122

Query  491   GNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDL  670
             GNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKAY L
Sbjct  123   GNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVKKAYQL  182

Query  671   LESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKS  850
             LE+TP+ FMLQQFSNP NTQ+HFETTGPEIWEDT G VDIF+MGIGSGGTVSGVGQYLKS
Sbjct  183   LEATPDSFMLQQFSNPVNTQVHFETTGPEIWEDTNGKVDIFIMGIGSGGTVSGVGQYLKS  242

Query  851   QNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMA  1030
             +NP VKIYG+EP ESNILNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE+AV MA
Sbjct  243   KNPQVKIYGLEPEESNILNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSEDAVTMA  302

Query  1031  RELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEA  1210
             R+LALKEGLMVGISSGANTVAALRLA +PENKGKLIVT+HPSFGERYLSS+L++ELR EA
Sbjct  303   RQLALKEGLMVGISSGANTVAALRLARRPENKGKLIVTIHPSFGERYLSSILFEELRKEA  362

Query  1211  EAMQPVPVD  1237
             E MQPV VD
Sbjct  363   ENMQPVSVD  371



>gb|AIA22208.1| beta-cyanoalanine synthase [Lathyrus sativus]
Length=381

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/339 (88%), Positives = 318/339 (94%), Gaps = 0/339 (0%)
 Frame = +2

Query  221   AHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASI  400
             + SFAQR+RDLPKD P TNIKK  SQLIGRTPLVYLNKVTEGCGAYIA KQEMMQPTASI
Sbjct  43    SSSFAQRIRDLPKDLPGTNIKKHVSQLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASI  102

Query  401   KDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIER  580
             KDRPA+AM+ DAEKK LITPGKT LIEPTSGNMGIS+AF+AAMKGYKMVLTMPSYTS+ER
Sbjct  103   KDRPALAMMEDAEKKNLITPGKTVLIEPTSGNMGISLAFMAAMKGYKMVLTMPSYTSLER  162

Query  581   RVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEI  760
             RV MR FGA+LVLTDP KGMGGTVKKAYDLLESTP+ FMLQQFSNPANTQ+HFETTGPEI
Sbjct  163   RVCMRAFGAELVLTDPTKGMGGTVKKAYDLLESTPDAFMLQQFSNPANTQVHFETTGPEI  222

Query  761   WEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITG  940
             WEDT G VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITG
Sbjct  223   WEDTNGQVDIFVMGIGSGGTVSGVGQYLKSRNPNVKIYGVEPSESNVLNGGKPGPHHITG  282

Query  941   NGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPE  1120
             NGVGFKPDILDMDVME+VL VSSE+AVNMAR LA+KEGLMVGISSGANTVAALRLAS PE
Sbjct  283   NGVGFKPDILDMDVMEKVLEVSSEDAVNMARTLAVKEGLMVGISSGANTVAALRLASLPE  342

Query  1121  NKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             NKGKLIVTVHPSFGERYLSSVLYQ+LR EAE MQPV VD
Sbjct  343   NKGKLIVTVHPSFGERYLSSVLYQDLRTEAENMQPVSVD  381



>ref|XP_006445004.1| hypothetical protein CICLE_v10020662mg [Citrus clementina]
 ref|XP_006491140.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR58244.1| hypothetical protein CICLE_v10020662mg [Citrus clementina]
Length=373

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/373 (82%), Positives = 331/373 (89%), Gaps = 3/373 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPL---AHSFAQRLRDLPKDFPATNIKKETSQ  298
             MAAAL + +K+R+         R   + QP    + SFAQRLRDLPKD PATNIK++ SQ
Sbjct  1     MAAALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQ  60

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLV+LNKV+EGCGAYIA KQEM QPTASIKDRPA+AM+ DAE K LI+PGKTT+I
Sbjct  61    LIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTII  120

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPAKGMGGTVKK
Sbjct  121   EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKK  180

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             A +LLESTPN FMLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  181   AQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQ  240

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKSQNPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME+VL VSS++A
Sbjct  241   YLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDILDMDVMEKVLEVSSDDA  300

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             V MARELALKEGLMVGISSGANTVAALRLAS PENKGKLIVTVH SFGERYLSS L+QEL
Sbjct  301   VKMARELALKEGLMVGISSGANTVAALRLASMPENKGKLIVTVHASFGERYLSSALFQEL  360

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  361   RKEAENMQPVSVD  373



>ref|XP_004138495.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like isoform 
1 [Cucumis sativus]
 gb|KGN45669.1| hypothetical protein Csa_6G004600 [Cucumis sativus]
Length=375

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/373 (81%), Positives = 336/373 (90%), Gaps = 4/373 (1%)
 Frame = +2

Query  131   AAALTNLMKRRSFLQPSIFNT--RFFNAGQPL--AHSFAQRLRDLPKDFPATNIKKETSQ  298
             AAAL  L+K+++ +     +T  +FF+       + SFAQRLRDLPKD P T+++++ + 
Sbjct  3     AAALRTLVKQKAGISSDGCSTVRKFFSTQTVFESSSSFAQRLRDLPKDLPGTSVRRDAAH  62

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIG+TPLVYLNKVTEGCGAYIA KQEMMQPT+SIKDRPA AMI DAEKKGLITPGKTTLI
Sbjct  63    LIGKTPLVYLNKVTEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLI  122

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+A +KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKK
Sbjct  123   EPTSGNMGISMAFMATLKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKK  182

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLLESTP+GFMLQQF+NPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  183   AYDLLESTPDGFMLQQFANPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQ  242

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESN+LNGGKPGPHHITGNGVGFKPDILDMDVM++VL VSS++A
Sbjct  243   YLKSRNPNVKIYGVEPAESNVLNGGKPGPHHITGNGVGFKPDILDMDVMDKVLEVSSDDA  302

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             VNMARELA+KEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QEL
Sbjct  303   VNMARELAVKEGLMVGISSGANTVAALRLAKLPENKGKLIVTVHPSFGERYLSSVLFQEL  362

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  363   RNEAENMQPVSVD  375



>ref|XP_006364148.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial-like [Solanum tuberosum]
Length=351

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/353 (86%), Positives = 328/353 (93%), Gaps = 4/353 (1%)
 Frame = +2

Query  179   SIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAY  358
             S+   RF+++      SFAQRLRDLPK  P TNIK + SQLIG+TPLVYLNKV+EGCGAY
Sbjct  3     SLLRRRFYSS----ESSFAQRLRDLPKYLPGTNIKTQVSQLIGKTPLVYLNKVSEGCGAY  58

Query  359   IAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGY  538
             IA KQEMMQPT+SIKDRPA AMI DAEKKGLITPGKTTLIEPTSGNMGISMAF+AAMKGY
Sbjct  59    IAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGY  118

Query  539   KMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNP  718
             KM+LTMPSYTS+ERRVTMR FGADLV+TDP KGMGGT+KKAY+LLESTPN +MLQQFSNP
Sbjct  119   KMILTMPSYTSLERRVTMRAFGADLVITDPTKGMGGTIKKAYNLLESTPNAYMLQQFSNP  178

Query  719   ANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESN  898
             ANTQ HFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYGIEPTESN
Sbjct  179   ANTQAHFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGIEPTESN  238

Query  899   ILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSG  1078
             +LNGGKPGPH ITGNGVGFKPDILDMDVMEEVLMVSSEE+VNMARELALKEGLMVGISSG
Sbjct  239   VLNGGKPGPHEITGNGVGFKPDILDMDVMEEVLMVSSEESVNMARELALKEGLMVGISSG  298

Query  1079  ANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             ANTVAALRLA++PENKGKLIVT+HPSFGERYLSSVLY+++R EA+ MQPV VD
Sbjct  299   ANTVAALRLANRPENKGKLIVTIHPSFGERYLSSVLYEDIRKEAQNMQPVSVD  351



>gb|KHM99361.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=372

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/373 (82%), Positives = 333/373 (89%), Gaps = 4/373 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPL---AHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+ ++ ++ +RS    S+   R F+        + S AQR+RDLPKD P TNIKK  SQ
Sbjct  1     MASLMSTILMQRSS-STSLAAGRLFSTTTATIIDSPSLAQRIRDLPKDLPGTNIKKHVSQ  59

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAE+K LITPGKTTLI
Sbjct  60    LIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTLI  119

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMRVFGA+L+LTDPAKGMGGTVKK
Sbjct  120   EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRVFGAELILTDPAKGMGGTVKK  179

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AY+LLE+TPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  180   AYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQ  239

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNGVGFKPDILDMDVME+VL VSSE+A
Sbjct  240   YLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDA  299

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             VNMAR LALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QEL
Sbjct  300   VNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFGERYLSSVLFQEL  359

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  360   RQEAENMQPVAVD  372



>sp|Q76MX2.1|CAS1_SOLTU RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase 1, mitochondrial; Flags: Precursor [Solanum tuberosum]
 dbj|BAB18760.1| beta-cyanoalanine synthase [Solanum tuberosum]
Length=351

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/353 (86%), Positives = 326/353 (92%), Gaps = 4/353 (1%)
 Frame = +2

Query  179   SIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAY  358
             S+   RF+++      SFAQRLRDLPK  P TNIK + SQLIG+TPLVYLNKV+EGCGAY
Sbjct  3     SLLRRRFYSS----ESSFAQRLRDLPKYLPGTNIKTQVSQLIGKTPLVYLNKVSEGCGAY  58

Query  359   IAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGY  538
             IA KQEMMQPT+SIKDRPA AMI DAEKKGLITPGKTTLIEPTSGNMGISMAF+AAMKGY
Sbjct  59    IAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGY  118

Query  539   KMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNP  718
             KM+LTMPSYTS+ERRVTMR FGADLV TDP KGMGGT+KKAYDLLESTPN +MLQQFSNP
Sbjct  119   KMILTMPSYTSLERRVTMRAFGADLVTTDPTKGMGGTIKKAYDLLESTPNAYMLQQFSNP  178

Query  719   ANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESN  898
             ANTQ HFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYGIEPTESN
Sbjct  179   ANTQAHFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGIEPTESN  238

Query  899   ILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSG  1078
             +LNGG PGPH ITGNGVGFKPDILDMDVMEEVLMVSSEE+VNMARELALKEGLMVGISSG
Sbjct  239   VLNGGNPGPHEITGNGVGFKPDILDMDVMEEVLMVSSEESVNMARELALKEGLMVGISSG  298

Query  1079  ANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             ANTVAALRLA++PENKGKLIVT+HPSFGERYLSSVLY+++R EA+ MQPV VD
Sbjct  299   ANTVAALRLANRPENKGKLIVTIHPSFGERYLSSVLYEDIRKEAQNMQPVSVD  351



>gb|KHN29341.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=373

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/374 (82%), Positives = 331/374 (89%), Gaps = 5/374 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLA----HSFAQRLRDLPKDFPATNIKKETS  295
             MA+ ++ ++K+RS    S    R  +     A     S AQR+RDLPKD P TNIKK  S
Sbjct  1     MASLMSTILKQRS-CSSSSHAGRLLSPAATAAIVDSPSLAQRIRDLPKDLPGTNIKKHVS  59

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAE+K LITPGKTTL
Sbjct  60    QLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTL  119

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVK
Sbjct  120   IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVK  179

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAY+LLE+TPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  180   KAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVG  239

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNGVGFKPDILD+DVME+VL VSSE+
Sbjct  240   QYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVMEKVLEVSSED  299

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMAR LALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QE
Sbjct  300   AVNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFGERYLSSVLFQE  359

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  360   LRQEAENMQPVAVD  373



>ref|XP_003623996.1| Cysteine synthase [Medicago truncatula]
 gb|AES80214.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula]
Length=380

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/339 (88%), Positives = 317/339 (94%), Gaps = 0/339 (0%)
 Frame = +2

Query  221   AHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASI  400
             + SFAQR+RDLPKD P TNIKK  SQLIGRTPLVYLNKVTEGCGAYIA KQEMMQPTASI
Sbjct  42    SSSFAQRIRDLPKDLPGTNIKKHVSQLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASI  101

Query  401   KDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIER  580
             KDRPA+AM+ DAEKK LITPGKT LIEPTSGNMGIS+AF+AAMKGYKMVLTMPSYTS+ER
Sbjct  102   KDRPALAMMEDAEKKNLITPGKTILIEPTSGNMGISLAFMAAMKGYKMVLTMPSYTSLER  161

Query  581   RVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEI  760
             RV MR FGA+L+LTDP KGMGGTVKKAYDLLESTPN FMLQQFSNPANT++HFETTGPEI
Sbjct  162   RVCMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEI  221

Query  761   WEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITG  940
             WEDT G VDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYG+EP+ESN+LNGGKPGPH ITG
Sbjct  222   WEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPSESNVLNGGKPGPHQITG  281

Query  941   NGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPE  1120
             NGVGFKPDILDMDVME+VL VSSE+AVNMAR LALKEGLMVGISSGANTVAALRLAS PE
Sbjct  282   NGVGFKPDILDMDVMEKVLEVSSEDAVNMARTLALKEGLMVGISSGANTVAALRLASLPE  341

Query  1121  NKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             NKGKLIVTVHPSFGERYLSSVL+Q+LR EAE MQPV VD
Sbjct  342   NKGKLIVTVHPSFGERYLSSVLFQDLRTEAENMQPVSVD  380



>ref|NP_001235117.1| OAS-TL3 cysteine synthase [Glycine max]
 gb|ABQ88337.1| OAS-TL3 cysteine synthase [Glycine max]
 gb|ABQ88338.1| OAS-TL3 cysteine synthase [Glycine max]
Length=372

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/373 (82%), Positives = 333/373 (89%), Gaps = 4/373 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPL---AHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+ ++ ++ +RS    S+   R F+        + S AQR+RDLPKD P TNIKK  SQ
Sbjct  1     MASLMSTILMQRSS-STSLAAGRLFSTTTATIIDSPSLAQRIRDLPKDLPGTNIKKHVSQ  59

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAE+K LITPGKTTLI
Sbjct  60    LIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKNLITPGKTTLI  119

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMRVFGA+L+LTDPAKGMGGTVKK
Sbjct  120   EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRVFGAELILTDPAKGMGGTVKK  179

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AY+LLE+TPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  180   AYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQ  239

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP+ESN+LNGG+PGPHHITGNGVGFKPDILDMDVME+VL VSSE+A
Sbjct  240   YLKSKNPNVKIYGVEPSESNVLNGGRPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDA  299

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             VNMAR LALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QEL
Sbjct  300   VNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFGERYLSSVLFQEL  359

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  360   RQEAENMQPVAVD  372



>ref|XP_008458207.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Cucumis melo]
Length=379

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/377 (81%), Positives = 336/377 (89%), Gaps = 8/377 (2%)
 Frame = +2

Query  131   AAALTNLMKRRSFLQPS--------IFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKK  286
             AAAL +L+K+++ +           +F+T+        + SFAQRLRDLPKD P T++++
Sbjct  3     AAALRSLVKQKAGISSDGCSTTVRKLFSTQTVLDSSSSSSSFAQRLRDLPKDLPGTSVRR  62

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
             + + LIG+TPLVYLNKVTEGCGAYIA KQEMMQPT+SIKDRPA AMI DAEKKGLITPG+
Sbjct  63    DAAHLIGKTPLVYLNKVTEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGQ  122

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             TTLIEPTSGNMGISMAF+A +KGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGG
Sbjct  123   TTLIEPTSGNMGISMAFMATLKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGG  182

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
             TVKKAYDLLESTPNGFMLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVS
Sbjct  183   TVKKAYDLLESTPNGFMLQQFSNPANTQVHFETTGPEIWEDTNGLVDIFVMGIGSGGTVS  242

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvs  1006
             GVGQYLKS+NPNVKIYG+EP ESNILNGGKPGPHHITGNGVGFKPDILDMDVM++VL VS
Sbjct  243   GVGQYLKSRNPNVKIYGVEPAESNILNGGKPGPHHITGNGVGFKPDILDMDVMDKVLEVS  302

Query  1007  seeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVL  1186
             SE+AVNMARELA+KEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL
Sbjct  303   SEDAVNMARELAVKEGLMVGISSGANTVAALRLAKLPENKGKLIVTVHPSFGERYLSSVL  362

Query  1187  YQELRAEAEAMQPVPVD  1237
             +QELR EAE MQPV VD
Sbjct  363   FQELRKEAENMQPVSVD  379



>ref|XP_010326974.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Solanum lycopersicum]
Length=351

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/353 (86%), Positives = 326/353 (92%), Gaps = 4/353 (1%)
 Frame = +2

Query  179   SIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAY  358
             S+   RF+++      SF QRLRDLPK  P T IK + SQLIG+TPLVYLNKV+EGCGAY
Sbjct  3     SLVRRRFYSS----EASFVQRLRDLPKYLPGTKIKTQVSQLIGKTPLVYLNKVSEGCGAY  58

Query  359   IAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGY  538
             IA KQEMMQPT+SIKDRPA AMI DAEKKGLITPGKTTLIEPTSGNMGISMAF+AAMKGY
Sbjct  59    IAVKQEMMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMAAMKGY  118

Query  539   KMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNP  718
             KM+LTMPSYTS+ERRVTMR FGADLV+TDP KGMGGT+KKAYDLLESTPN +MLQQFSNP
Sbjct  119   KMILTMPSYTSLERRVTMRAFGADLVITDPTKGMGGTIKKAYDLLESTPNAYMLQQFSNP  178

Query  719   ANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESN  898
             ANTQ+HFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYGIEP ESN
Sbjct  179   ANTQVHFETTGPEIWEDTQGNVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGIEPAESN  238

Query  899   ILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSG  1078
             +LNGGKPGPH ITGNGVGFKPDILDMDVMEEVLMVSSEE+VNMARELALKEGLMVGISSG
Sbjct  239   VLNGGKPGPHEITGNGVGFKPDILDMDVMEEVLMVSSEESVNMARELALKEGLMVGISSG  298

Query  1079  ANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             ANTVAALRLA++PENKGKLIVT+HPSFGERYLSSVLY++LR EA+ MQPV VD
Sbjct  299   ANTVAALRLANRPENKGKLIVTIHPSFGERYLSSVLYEDLRKEAQNMQPVSVD  351



>ref|XP_007139815.1| hypothetical protein PHAVU_008G061100g [Phaseolus vulgaris]
 gb|ESW11809.1| hypothetical protein PHAVU_008G061100g [Phaseolus vulgaris]
Length=380

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/350 (86%), Positives = 321/350 (92%), Gaps = 2/350 (1%)
 Frame = +2

Query  194   RFFNAGQPLAHS--FAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAA  367
             RFF+    +  S   AQR+R+LPKD P TNIKK  SQLIGRTPLVYLNKVTEGCGAY+A 
Sbjct  31    RFFSTTATIVDSPSLAQRIRELPKDLPGTNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAV  90

Query  368   KQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMV  547
             KQEMMQPTASIKDRPA AMI DAEKK LI+PGKTTLIEPTSGNMGISMAF+AAMKGYKMV
Sbjct  91    KQEMMQPTASIKDRPAFAMITDAEKKNLISPGKTTLIEPTSGNMGISMAFMAAMKGYKMV  150

Query  548   LTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANT  727
             LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAY+LLE+TPN FMLQQFSNPANT
Sbjct  151   LTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYELLENTPNAFMLQQFSNPANT  210

Query  728   QIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILN  907
             Q+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP+ESN+LN
Sbjct  211   QVHFETTGPEIWEDTNGEVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLN  270

Query  908   GGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANT  1087
             GGKPGPHHITGNGVGFKPDILDMD+ME+VL VSSE+AVNMAR LALKEGLMVGISSGANT
Sbjct  271   GGKPGPHHITGNGVGFKPDILDMDIMEKVLEVSSEDAVNMARVLALKEGLMVGISSGANT  330

Query  1088  VAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             VAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QELR EAE MQPV VD
Sbjct  331   VAALRLAQLPENKGKLIVTVHPSFGERYLSSVLFQELRQEAENMQPVAVD  380



>ref|XP_004492762.1| PREDICTED: l-3-cyanoalanine synthase 1, mitochondrial-like [Cicer 
arietinum]
Length=386

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/337 (88%), Positives = 316/337 (94%), Gaps = 0/337 (0%)
 Frame = +2

Query  227   SFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKD  406
             SFAQR+RDLPKD P TNIKK  S LIGRTPLVYLNKVTEGCGAYIA KQEMMQPTASIKD
Sbjct  50    SFAQRIRDLPKDLPGTNIKKHVSHLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASIKD  109

Query  407   RPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRV  586
             RPA+AM+ DAEKK LI+PGKT LIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTS+ERRV
Sbjct  110   RPALAMMEDAEKKNLISPGKTILIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSLERRV  169

Query  587   TMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWE  766
             TMR FGA+L+LTDP KGMGGTVKKAYDLLESTPN FMLQQFSNPANTQ+HFETTGPEIWE
Sbjct  170   TMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWE  229

Query  767   DTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNG  946
             DT G VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNG
Sbjct  230   DTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNG  289

Query  947   VGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENK  1126
             VGFKPDILDMDVM++VL VSSE+AVNMAR LALKEGLMVGISSGANTVAAL LAS PENK
Sbjct  290   VGFKPDILDMDVMDKVLEVSSEDAVNMARILALKEGLMVGISSGANTVAALNLASLPENK  349

Query  1127  GKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             GKLIVT+HPSFGERYLSSVL+Q+LR EAE MQPV VD
Sbjct  350   GKLIVTIHPSFGERYLSSVLFQDLRTEAENMQPVSVD  386



>ref|XP_010055111.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Eucalyptus grandis]
 gb|KCW71585.1| hypothetical protein EUGRSUZ_E00118 [Eucalyptus grandis]
Length=375

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/377 (81%), Positives = 334/377 (89%), Gaps = 12/377 (3%)
 Frame = +2

Query  134   AALTNLMKRRS-------FLQP--SIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKK  286
             AAL   +KR S        L P  S+F+T   ++  P   SF QR+RDLPKD P T IK 
Sbjct  2     AALRICLKRSSQTHHGHELLLPLRSLFSTEAVSSDSP---SFTQRVRDLPKDLPGTKIKA  58

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
               SQL+GRTPLV+LNKVTEGCGAY+A KQEMMQPT+SIKDRPA+AMI DAEKK LI+PGK
Sbjct  59    HVSQLVGRTPLVFLNKVTEGCGAYVAVKQEMMQPTSSIKDRPALAMINDAEKKNLISPGK  118

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             TTLIEPTSGNMGISMAF+AAMKGYKM+LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGG
Sbjct  119   TTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMRAFGAELILTDPTKGMGG  178

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
             TVKKAYDLLESTPN  MLQQFSNPAN+Q+HFETTGPEIWEDT G VDIFVMGIGSGGTVS
Sbjct  179   TVKKAYDLLESTPNAHMLQQFSNPANSQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVS  238

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvs  1006
             GVGQYLKS+NPNVKIYG+EPTESN+LNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVS
Sbjct  239   GVGQYLKSKNPNVKIYGLEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVS  298

Query  1007  seeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVL  1186
             SE++VNMAR+LALKEGLMVGISSGANTVAALRLA +PENKGKLIVTVHPSFGERYLSSVL
Sbjct  299   SEDSVNMARQLALKEGLMVGISSGANTVAALRLAQRPENKGKLIVTVHPSFGERYLSSVL  358

Query  1187  YQELRAEAEAMQPVPVD  1237
             +QELR EA+ MQPV VD
Sbjct  359   FQELRDEAQKMQPVSVD  375



>ref|XP_009797225.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Nicotiana sylvestris]
Length=362

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/370 (83%), Positives = 332/370 (90%), Gaps = 11/370 (3%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSI-FNTRFFNAGQPLAHSFAQRLRDLPK-DFPATNIKKETSQLIG  307
             AAL+ L+KR  +   ++ F TR F+  QPL H+        PK   P TNIK E SQLIG
Sbjct  2     AALSRLLKRSRYCNSNVDFITRLFST-QPLVHT--------PKLQLPVTNIKTEVSQLIG  52

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             +TP+VYLNKVTEGCGA+IA KQEM QPT+SIKDRPA+AMI DAEKKGLI+P KTTLIEPT
Sbjct  53    KTPMVYLNKVTEGCGAHIAVKQEMFQPTSSIKDRPALAMIDDAEKKGLISPEKTTLIEPT  112

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADLVLTDP KGMGGTVKKAYD
Sbjct  113   SGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLVLTDPTKGMGGTVKKAYD  172

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTPN FMLQQFSNPANTQIHFETTGPEIWE+TQGNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  173   LLESTPNAFMLQQFSNPANTQIHFETTGPEIWEETQGNVDIFVMGIGSGGTVSGVGQYLK  232

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             S+NPNVKIYG+EPTESNILNGGKPGPHHITGNGVGFKPDILDMD+MEEVLMVSS++AVNM
Sbjct  233   SRNPNVKIYGVEPTESNILNGGKPGPHHITGNGVGFKPDILDMDIMEEVLMVSSDDAVNM  292

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELA+KEGLMVGISSGANTVAAL+LA KPENKGKLIVT+H SFGERYLSSVLYQ+LR E
Sbjct  293   ARELAVKEGLMVGISSGANTVAALQLAQKPENKGKLIVTIHASFGERYLSSVLYQDLRKE  352

Query  1208  AEAMQPVPVD  1237
             AE MQPV VD
Sbjct  353   AENMQPVSVD  362



>ref|XP_002301362.1| beta-cyanoalanine synthase family protein [Populus trichocarpa]
 gb|EEE80635.1| beta-cyanoalanine synthase family protein [Populus trichocarpa]
Length=375

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/350 (86%), Positives = 320/350 (91%), Gaps = 2/350 (1%)
 Frame = +2

Query  194   RFFNA--GQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAA  367
             R F+A      + SFAQRLRDLPKD P T IK   SQLIG+TPLVYLNKVTEGCGAYIA 
Sbjct  26    RLFSAEAATVASASFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCGAYIAV  85

Query  368   KQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMV  547
             KQEM QPT+SIKDRPA+AM+ +AEKK LI PGKTTLIEPTSGNMGISMAF+AAMKGYKM+
Sbjct  86    KQEMFQPTSSIKDRPALAMVEEAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMI  145

Query  548   LTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANT  727
             LTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVKKAY+LLESTPN FMLQQFSNPANT
Sbjct  146   LTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELLESTPNAFMLQQFSNPANT  205

Query  728   QIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILN  907
             Q+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYG+EP ESNILN
Sbjct  206   QVHFETTGPEIWEDTVGKVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILN  265

Query  908   GGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANT  1087
             GGKPGPHHITGNGVGFKPDILDMDVME+VL VSSE+AVNMAR+LAL+EGLMVGISSGANT
Sbjct  266   GGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDAVNMARKLALEEGLMVGISSGANT  325

Query  1088  VAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             VAALRLA  PENKGKLIVTVH SFGERYLSSVL+QELR EAE MQPVPVD
Sbjct  326   VAALRLARMPENKGKLIVTVHASFGERYLSSVLFQELRKEAENMQPVPVD  375



>gb|AFK37031.1| unknown [Lotus japonicus]
Length=374

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/373 (81%), Positives = 330/373 (88%), Gaps = 5/373 (1%)
 Frame = +2

Query  134   AALTNLMKRR--SF---LQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             A+L++ +K+R  S+      ++    F  A    + S AQ++RDLPKD P  NIKK  S+
Sbjct  2     ASLSSFLKQRPSSYAVACHHTLLRRLFSTATSADSPSLAQKIRDLPKDLPGNNIKKHVSE  61

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLVYLNKVTEGCGAYIA KQEMMQPT S+KDRPA+AMIADAEKK LITPGKT LI
Sbjct  62    LIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTTSVKDRPALAMIADAEKKNLITPGKTILI  121

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAFI A+KGYK+VLTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVKK
Sbjct  122   EPTSGNMGISMAFIGALKGYKVVLTMPSYTSMERRVTMRAFGAELILTDPAKGMGGTVKK  181

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLLESTPN FMLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  182   AYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQ  241

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNGVGFKPDILDMDVM++VL VSSE+A
Sbjct  242   YLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDMDVMDKVLEVSSEDA  301

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             V MAR LALKEGLMVGISSGANTVAALRLAS PENKGKLIVT+HPSFGERYL SVL+QEL
Sbjct  302   VKMARILALKEGLMVGISSGANTVAALRLASLPENKGKLIVTIHPSFGERYLPSVLFQEL  361

Query  1199  RAEAEAMQPVPVD  1237
             R EAE MQPV VD
Sbjct  362   RDEAEKMQPVSVD  374



>ref|XP_010087942.1| Cysteine synthase [Morus notabilis]
 gb|EXB30864.1| Cysteine synthase [Morus notabilis]
Length=372

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/374 (79%), Positives = 325/374 (87%), Gaps = 9/374 (2%)
 Frame = +2

Query  134   AALTNLMKRRSFLQP----SIFNTRFFNAGQPLAH--SFAQRLRDLPKDFPATNIKKETS  295
             AAL + ++R+  +      S+   + F+A   +    SF QRLRDLPKD P T I+KE S
Sbjct  2     AALRSFLRRKPAITACRGDSMLLKKLFSAQAVVDSPSSFTQRLRDLPKDLPGTRIRKEVS  61

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIG+TP+VYLNKVTEGCGAY+A KQEM QPT+SIKDRPA+AM+ DAEKK LITPGKTTL
Sbjct  62    QLIGKTPIVYLNKVTEGCGAYVAVKQEMFQPTSSIKDRPALAMLNDAEKKNLITPGKTTL  121

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVK
Sbjct  122   IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTVK  181

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTP+ FMLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  182   KAYDLLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVG  241

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNVKIYG+EP ESN+LNGGKPGPHHITGNGVGFKPDI     M+ +  VSSE+
Sbjct  242   QYLKSKNPNVKIYGVEPAESNVLNGGKPGPHHITGNGVGFKPDI---LDMDVMEKVSSED  298

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMAR+LALKEGLM+GISSGANTVAALRLA  PENKGKLIVT+HPSFGERYLSSVL+QE
Sbjct  299   AVNMARQLALKEGLMIGISSGANTVAALRLARMPENKGKLIVTIHPSFGERYLSSVLFQE  358

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  359   LRNEAENMQPVSVD  372



>gb|KDP28610.1| hypothetical protein JCGZ_14381 [Jatropha curcas]
Length=370

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 327/369 (89%), Gaps = 1/369 (0%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPL-AHSFAQRLRDLPKDFPATNIKKETSQLIGR  310
             AA  N +K+++     +   R F+    + + SFAQR+RDLPK  P T IK E SQLIGR
Sbjct  2     AAFRNFLKKKALTCNELPLRRLFSGEAAVDSSSFAQRVRDLPKKLPGTKIKTEVSQLIGR  61

Query  311   TPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTS  490
             TPLVYLN+VT+GCGAYIA KQEMMQPTASIKDRPA +MI DAE+K LITPGKTTLIEPTS
Sbjct  62    TPLVYLNRVTDGCGAYIAVKQEMMQPTASIKDRPAFSMINDAEQKNLITPGKTTLIEPTS  121

Query  491   GNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDL  670
             GNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAYDL
Sbjct  122   GNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYDL  181

Query  671   LESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKS  850
             LESTPN FMLQQF+NPANT+IHFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS
Sbjct  182   LESTPNAFMLQQFANPANTKIHFETTGPEIWEDTLGQVDIFVMGIGSGGTVSGVGQYLKS  241

Query  851   QNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMA  1030
             QNPNVKIYG+EP ESN+LNGGKPGPHHITGNGVGFKPDILDMDVME+VL VSSE+AVNMA
Sbjct  242   QNPNVKIYGVEPAESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDAVNMA  301

Query  1031  RELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEA  1210
             R LAL+EGLMVGISSGANTVAALRLA  PEN+GKLIVT+HPSFGERYLSSVL+QELR EA
Sbjct  302   RRLALEEGLMVGISSGANTVAALRLARMPENRGKLIVTIHPSFGERYLSSVLFQELRQEA  361

Query  1211  EAMQPVPVD  1237
             E MQP  VD
Sbjct  362   ENMQPGSVD  370



>gb|AAN86822.1| beta-cyanoalanine synthase [Betula pendula]
Length=352

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/345 (87%), Positives = 316/345 (92%), Gaps = 3/345 (1%)
 Frame = +2

Query  212   QPLAHS---FAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMM  382
             QPLA S   FAQR+RDLPK  P TNIK E SQLIGRTPLVYLNKVTEGCGAYIA KQEMM
Sbjct  8     QPLADSDPSFAQRIRDLPKHVPGTNIKNEVSQLIGRTPLVYLNKVTEGCGAYIAVKQEMM  67

Query  383   QPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPS  562
             QPTASIKDRPA AM+ DAEK+ LITPGKTTLIEPTSGNMGIS+AF+AAMKGYKMVLTMPS
Sbjct  68    QPTASIKDRPAYAMMMDAEKRNLITPGKTTLIEPTSGNMGISLAFMAAMKGYKMVLTMPS  127

Query  563   YTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFE  742
             YTS+ERRVTMR FGADLVLTDP KGMGGTVKKAYDLLESTPN FMLQQFSNP NTQ  FE
Sbjct  128   YTSLERRVTMRAFGADLVLTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPVNTQGAFE  187

Query  743   TTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPG  922
             TTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYG+EPTESN+LNGGKPG
Sbjct  188   TTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPTESNVLNGGKPG  247

Query  923   PHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALR  1102
             PH ITGNGVGFKPDILDMDVME VL VSSE++VNMAR+LALKEGL+VGISSGANT+AALR
Sbjct  248   PHQITGNGVGFKPDILDMDVMERVLEVSSEDSVNMARQLALKEGLLVGISSGANTIAALR  307

Query  1103  LASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             LA  PENKGKLIVTVHPSFGERYLSSVL++ELR EAE MQPV VD
Sbjct  308   LARMPENKGKLIVTVHPSFGERYLSSVLFEELRKEAENMQPVSVD  352



>ref|XP_011023311.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial-like [Populus euphratica]
Length=375

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/353 (85%), Positives = 318/353 (90%), Gaps = 1/353 (0%)
 Frame = +2

Query  182   IFNTRFFNAGQPLAHS-FAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAY  358
             +F   FF     +A S FAQRLRDLPKD P T IK   SQLIG+TPLVYLNKVTEGC AY
Sbjct  23    MFRRLFFAEAATVASSSFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCRAY  82

Query  359   IAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGY  538
             IA KQEM QPT+SIKDRPA+AM+ DAEKK LI PGKTTLIEPTSGNMGISMAF+AAMKGY
Sbjct  83    IAVKQEMFQPTSSIKDRPALAMVEDAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGY  142

Query  539   KMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNP  718
             KM+LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAY+LLESTPN FMLQQFSNP
Sbjct  143   KMILTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYELLESTPNAFMLQQFSNP  202

Query  719   ANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESN  898
             ANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYG+EP ESN
Sbjct  203   ANTQVHFETTGPEIWEDTLGKVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESN  262

Query  899   ILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSG  1078
             ILNGGKPGPHHITGNGVGFKPDILDMDVME+VL VSSE+AV+MAR LAL+EGLMVGISSG
Sbjct  263   ILNGGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDAVSMARSLALEEGLMVGISSG  322

Query  1079  ANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             ANTVAALRLA  PENKGKLIVTVH SFGERYLSSVL+QELR EAE MQPVPVD
Sbjct  323   ANTVAALRLARMPENKGKLIVTVHASFGERYLSSVLFQELRKEAENMQPVPVD  375



>ref|XP_004306760.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=375

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/376 (81%), Positives = 328/376 (87%), Gaps = 10/376 (3%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFN-----TRFFNA-GQPLAHS--FAQRLRDLPKDFPATNIKKE  289
             A+LT+ +K+RS L  S+ N      R F+   QP+A S  F +R+R+LPK  P T+IK E
Sbjct  2     ASLTSFLKKRSTL--SVCNEALRMKRLFSTTAQPIADSSSFVERIRNLPKALPGTHIKTE  59

Query  290   TSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKT  469
              SQLIGRTPLVYLNKVTEGCGAYIA KQEM QPTASIKDRPA+AM  DAEKKGLITPG T
Sbjct  60    VSQLIGRTPLVYLNKVTEGCGAYIAVKQEMFQPTASIKDRPALAMFNDAEKKGLITPGVT  119

Query  470   TLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGT  649
             TLIEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRV MR FGA+L+LTDP KGMGGT
Sbjct  120   TLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGAELILTDPTKGMGGT  179

Query  650   VKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsg  829
             VKKAYDLLESTPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSG
Sbjct  180   VKKAYDLLESTPNALMLQQFSNPANTQVHFETTGPEIWEDTDGKVDIFVMGIGSGGTVSG  239

Query  830   vgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvss  1009
             VGQYLKSQNP+ KIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL V S
Sbjct  240   VGQYLKSQNPDCKIYGVEPAESNILNGGKPGPHSITGNGVGFKPDILDMDVMERVLEVRS  299

Query  1010  eeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLY  1189
             E+AVNMAR+LALKEGLMVGISSGANTVAAL LA KPENKGKLIVT+H SFGERYLSSVL+
Sbjct  300   EDAVNMARQLALKEGLMVGISSGANTVAALELAKKPENKGKLIVTIHASFGERYLSSVLF  359

Query  1190  QELRAEAEAMQPVPVD  1237
             +ELR EAE MQPV VD
Sbjct  360   EELRKEAENMQPVSVD  375



>gb|AAP41851.1| beta-cyanoalanine synthase [Hevea brasiliensis]
Length=370

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 327/369 (89%), Gaps = 1/369 (0%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNA-GQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGR  310
             A L NL+K++S     +   RF ++     + SFAQR+RDLPK+ P T IK E SQLIGR
Sbjct  2     ATLRNLLKKKSLTSNELAIRRFVSSEAAAESPSFAQRIRDLPKNLPGTKIKTEVSQLIGR  61

Query  311   TPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTS  490
             TPLVYLNK++EGCGAYIA KQEMMQPTASIKDRPA +MI DAEKK LITPGKT LIEPTS
Sbjct  62    TPLVYLNKMSEGCGAYIAVKQEMMQPTASIKDRPAFSMINDAEKKNLITPGKTVLIEPTS  121

Query  491   GNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDL  670
             GNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTM+ FGA+L++TDP KGMGGTVKKAYDL
Sbjct  122   GNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMKAFGAELIVTDPTKGMGGTVKKAYDL  181

Query  671   LESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKS  850
             LESTPN FMLQQFSNPAN++IHFETTGPEIWEDT G+VDIFVMGIGSGGTVSGVGQYLKS
Sbjct  182   LESTPNAFMLQQFSNPANSKIHFETTGPEIWEDTLGHVDIFVMGIGSGGTVSGVGQYLKS  241

Query  851   QNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMA  1030
             QNPNVKIYG+EP ESN+LNGGKPGPH I GNGVGFKPDILDMDVME+VL VSSE+AV MA
Sbjct  242   QNPNVKIYGVEPAESNVLNGGKPGPHQIMGNGVGFKPDILDMDVMEKVLEVSSEDAVKMA  301

Query  1031  RELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEA  1210
             R LAL+EGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL++ELR EA
Sbjct  302   RRLALEEGLMVGISSGANTVAALRLARMPENKGKLIVTVHPSFGERYLSSVLFEELRNEA  361

Query  1211  EAMQPVPVD  1237
               MQPVPVD
Sbjct  362   ATMQPVPVD  370



>ref|NP_001280949.1| L-3-cyanoalanine synthase 1, mitochondrial [Malus domestica]
 sp|Q1KLZ2.1|CAS1_MALDO RecName: Full=L-3-cyanoalanine synthase 1, mitochondrial; Short=MdCAS1; 
Flags: Precursor [Malus domestica]
 gb|ABF13209.1| beta-cyanoalanine synthase 1 [Malus domestica]
Length=376

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/374 (79%), Positives = 327/374 (87%), Gaps = 4/374 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFN--AGQPLAHS--FAQRLRDLPKDFPATNIKKETS  295
             MAA  + L KR S L       + F+    QPL  S  FAQR+R+LPKD P T IK + S
Sbjct  1     MAALRSFLKKRSSVLCNGAMRRKLFSTEVSQPLTDSPSFAQRIRNLPKDLPGTQIKTQVS  60

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIGRTP+VYLNKVTEGCGAYIA KQEM QPTASIKDRPA++MI DAE+KGLITPG+T L
Sbjct  61    QLIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETIL  120

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AAM+GYKMVLTMPSYTS+ERRV MR FGADL+LTDP KGMGGTVK
Sbjct  121   IEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGGTVK  180

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTPN +MLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  181   KAYDLLESTPNAYMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVG  240

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNV+IYG+EP ESN+LNGGKPGPH I GNGVGFKPDILD+D++E V+ V+SE+
Sbjct  241   QYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSIMGNGVGFKPDILDLDMLERVIEVTSED  300

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMAR+LALKEGLMVGISSGANTVAA+ LA KPENKGKLIVTVHPSFGERYLSSVL+QE
Sbjct  301   AVNMARQLALKEGLMVGISSGANTVAAMELAKKPENKGKLIVTVHPSFGERYLSSVLFQE  360

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  361   LRQEAENMQPVAVD  374



>ref|XP_011036588.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Populus euphratica]
Length=373

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/372 (81%), Positives = 330/372 (89%), Gaps = 4/372 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPS----IFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQL  301
             AAL +L+K+ S   P+    +   R F++    + SFAQRLRDLPKD P T IK + SQL
Sbjct  2     AALRSLLKKNSSSIPTCNELVRIRRLFSSEAAASPSFAQRLRDLPKDLPGTKIKTQVSQL  61

Query  302   IGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIE  481
             IG+TP+VYLNKVTEGCGAYIAAKQEM QPT+SIKDRPA+AMI DAEKK LI PGKTTLIE
Sbjct  62    IGKTPIVYLNKVTEGCGAYIAAKQEMFQPTSSIKDRPALAMIEDAEKKNLIAPGKTTLIE  121

Query  482   PTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKA  661
             PTSGNMGISMAF+AAMKGYKM+LTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVKKA
Sbjct  122   PTSGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKA  181

Query  662   YDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQY  841
             Y+LLESTP  FMLQQFSNPANTQIHFETTGPEIWED+ G VDIFVMGIGSGGTVSGVG+Y
Sbjct  182   YELLESTPGAFMLQQFSNPANTQIHFETTGPEIWEDSLGKVDIFVMGIGSGGTVSGVGKY  241

Query  842   LKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAV  1021
             LKSQNPNVKIYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILDMDVME+VL VSSE+AV
Sbjct  242   LKSQNPNVKIYGVEPAESNVLNGGKPGPHDITGNGVGFKPDILDMDVMEKVLEVSSEDAV  301

Query  1022  NMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELR  1201
             NMAR LAL+EGLMVGISSGANTVAAL+LA  PENKGKLIVT+H SFGERYLSSVL+Q+LR
Sbjct  302   NMARRLALEEGLMVGISSGANTVAALKLARMPENKGKLIVTIHASFGERYLSSVLFQDLR  361

Query  1202  AEAEAMQPVPVD  1237
              EAE MQPV VD
Sbjct  362   KEAENMQPVAVD  373



>gb|AAP41852.1| beta-cyanoalanine synthase [Hevea brasiliensis]
Length=370

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 327/369 (89%), Gaps = 1/369 (0%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNA-GQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGR  310
             A L NL+K++S     +   RF ++     + SFAQR+RDLPK+ P T IK E SQLIGR
Sbjct  2     ATLRNLLKKKSLTSNELAIRRFVSSEAAAESPSFAQRIRDLPKNLPGTKIKTEVSQLIGR  61

Query  311   TPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTS  490
             TPLVYLNK++EGCGAYIA KQEMMQPTASIKDRPA +MI DAEKK LITPGKT LIEPTS
Sbjct  62    TPLVYLNKMSEGCGAYIAVKQEMMQPTASIKDRPAFSMINDAEKKNLITPGKTVLIEPTS  121

Query  491   GNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDL  670
             GNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTM+ FGA+L++TDP KGMGGTVKKAYDL
Sbjct  122   GNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMKAFGAELIVTDPTKGMGGTVKKAYDL  181

Query  671   LESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKS  850
             LESTPN FMLQQFSNPAN++IHFETTGPEIWEDT G+VDIFVMGIGSGGTVSGVGQYLKS
Sbjct  182   LESTPNAFMLQQFSNPANSKIHFETTGPEIWEDTLGHVDIFVMGIGSGGTVSGVGQYLKS  241

Query  851   QNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMA  1030
             QNPNVKIYG+EP ESN+LNGGKPGPH I GNGVGFKPDILDMDVME+VL VSSE+AV MA
Sbjct  242   QNPNVKIYGVEPAESNVLNGGKPGPHQIMGNGVGFKPDILDMDVMEKVLEVSSEDAVKMA  301

Query  1031  RELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEA  1210
             R LAL+EGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL++ELR EA
Sbjct  302   RRLALEEGLMVGISSGANTVAALRLARMPENKGKLIVTVHPSFGERYLSSVLFEELRYEA  361

Query  1211  EAMQPVPVD  1237
               MQPVPVD
Sbjct  362   ANMQPVPVD  370



>gb|ADO78230.1| mitochondrial beta-cyanoalanine synthase [Manihot esculenta]
Length=370

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 330/369 (89%), Gaps = 1/369 (0%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPL-AHSFAQRLRDLPKDFPATNIKKETSQLIGR  310
             A+L NL+K+ S    ++   RFF++   L + SFA ++RDLP + P   IK E SQLIG+
Sbjct  2     ASLRNLLKKNSLTSNNLPIRRFFSSEAALESPSFAHKIRDLPNNRPQAKIKPEVSQLIGK  61

Query  311   TPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTS  490
             TPLVYLNKVTEGCGA+IA KQEM+QPTASIKDRPA AMI DAEKK LI+PGKTTLIEPTS
Sbjct  62    TPLVYLNKVTEGCGAFIAVKQEMVQPTASIKDRPAFAMINDAEKKNLISPGKTTLIEPTS  121

Query  491   GNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDL  670
             GNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKA++L
Sbjct  122   GNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAFEL  181

Query  671   LESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKS  850
             LESTPN FMLQQFSNPANT+IHFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS
Sbjct  182   LESTPNAFMLQQFSNPANTKIHFETTGPEIWEDTLGQVDIFVMGIGSGGTVSGVGQYLKS  241

Query  851   QNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMA  1030
             QNP VKIYG+EPTESN+LNGGKPGPHHITGNGVGFKPDILD+DVME+VL VSSE+AVNMA
Sbjct  242   QNPAVKIYGVEPTESNVLNGGKPGPHHITGNGVGFKPDILDLDVMEKVLEVSSEDAVNMA  301

Query  1031  RELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEA  1210
             R LAL+EGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYL+SVL++ELR EA
Sbjct  302   RRLALEEGLMVGISSGANTVAALRLARMPENKGKLIVTVHPSFGERYLTSVLFEELRKEA  361

Query  1211  EAMQPVPVD  1237
               MQPVPVD
Sbjct  362   ANMQPVPVD  370



>ref|NP_001280751.1| L-3-cyanoalanine synthase 2, mitochondrial [Malus domestica]
 sp|Q1KLZ1.1|CAS2_MALDO RecName: Full=L-3-cyanoalanine synthase 2, mitochondrial; Short=MdCAS2; 
Flags: Precursor [Malus domestica]
 gb|ABF13210.1| beta-cyanoalanine synthase 2 [Malus domestica]
Length=375

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/374 (80%), Positives = 329/374 (88%), Gaps = 6/374 (2%)
 Frame = +2

Query  134   AALTNLMKRRS--FLQPSIFNTRFFNA--GQPL--AHSFAQRLRDLPKDFPATNIKKETS  295
             AAL + +K+RS           R F+A   QP+  + SFAQR+ +LPKD PAT IK + S
Sbjct  2     AALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIPDSPSFAQRIGNLPKDLPATQIKTQVS  61

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIGRTP+VYLNKVTEGCGA+IA KQEM QPTASIKDRPA++MI DAE+KGLITPG+TTL
Sbjct  62    QLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETTL  121

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRV MR FGADL+LTDP KGMGGTVK
Sbjct  122   IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGGTVK  181

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTPN FMLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  182   KAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVG  241

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNV+IYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILDMD+ME V+ V SE+
Sbjct  242   QYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVGFKPDILDMDMMERVIEVRSED  301

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMAR+LALKEGLMVGISSGANTVAA+ LA KPENKGKLIVTVH SFGERYLSSVL+Q+
Sbjct  302   AVNMARQLALKEGLMVGISSGANTVAAMELAKKPENKGKLIVTVHASFGERYLSSVLFQD  361

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  362   LRQEAENMQPVAVD  375



>ref|XP_008244657.1| PREDICTED: L-3-cyanoalanine synthase 1, mitochondrial isoform 
X1 [Prunus mume]
Length=374

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/374 (78%), Positives = 327/374 (87%), Gaps = 4/374 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFN--AGQPL--AHSFAQRLRDLPKDFPATNIKKETS  295
             MAA  + L KR + L       R F+    QP+  + SFAQR+R+LPKD P T++K E S
Sbjct  1     MAALRSFLKKRSTLLCNEAVRKRLFSTQVSQPINDSPSFAQRVRNLPKDLPGTHVKTEVS  60

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIGRTP+VYLNKVTEGCGAYIA KQEM QPT+SIKDRPA++MI DAEK+GLITPGKT L
Sbjct  61    QLIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTSSIKDRPALSMINDAEKRGLITPGKTVL  120

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             +EPTSGNMGISMAF+AAM+GYKMVLTMPSYTS+ERRV MR FGA+L+LTDPA+GMGGTVK
Sbjct  121   VEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRAFGAELILTDPARGMGGTVK  180

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  181   KAYDLLESTPNAHMLQQFSNPANTQVHFETTGPEIWEDTDGQVDIFVMGIGSGGTVSGVG  240

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNV+IYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILD+DVM+ V+ V S++
Sbjct  241   QYLKSKNPNVQIYGVEPAESNVLNGGKPGPHLITGNGVGFKPDILDLDVMDRVIEVKSDD  300

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AV MAR LAL+EGLMVGISSGANTVAA+ LA KPENKGKLIVTVHPSFGERYLSSVL++E
Sbjct  301   AVKMARRLALEEGLMVGISSGANTVAAIELAQKPENKGKLIVTVHPSFGERYLSSVLFEE  360

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  361   LRKEAENMQPVSVD  374



>ref|XP_009367811.1| PREDICTED: L-3-cyanoalanine synthase 2, mitochondrial [Pyrus 
x bretschneideri]
Length=375

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/374 (79%), Positives = 328/374 (88%), Gaps = 6/374 (2%)
 Frame = +2

Query  134   AALTNLMKRRS--FLQPSIFNTRFFNA--GQPL--AHSFAQRLRDLPKDFPATNIKKETS  295
             AAL + +K++S           R F+A   QP+  + SFAQR+ +LPKD PAT IK + S
Sbjct  2     AALRSFLKKKSSVLCNGGAVRHRLFSAQVAQPIPDSPSFAQRIGNLPKDLPATQIKTQVS  61

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIGRTP+VYLNKVTEGCGA+IA KQEM QPTASIKDRPA++MI DAE+KGLITPG+TTL
Sbjct  62    QLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETTL  121

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AAM+GYKMVLTMPSYTS+ERRV MR FGADL+LTDP KGMGGTVK
Sbjct  122   IEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRCFGADLILTDPTKGMGGTVK  181

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTPN FMLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  182   KAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVG  241

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNV+IYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILDMDVME  + V SE+
Sbjct  242   QYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVGFKPDILDMDVMERAIEVRSED  301

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMAR+LALKEGLMVGISSGANTVAA+ LA KPENKGKLIVTVH SFGERYLSSVL+Q+
Sbjct  302   AVNMARQLALKEGLMVGISSGANTVAAMELAKKPENKGKLIVTVHASFGERYLSSVLFQD  361

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  362   LRQEAENMQPVAVD  375



>ref|XP_007218145.1| hypothetical protein PRUPE_ppa007292mg [Prunus persica]
 gb|EMJ19344.1| hypothetical protein PRUPE_ppa007292mg [Prunus persica]
Length=374

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/374 (78%), Positives = 327/374 (87%), Gaps = 4/374 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFN--AGQPL--AHSFAQRLRDLPKDFPATNIKKETS  295
             MAA  + L KR + L       R F+    QP+  + SFAQR+R+LPKD P T++K E S
Sbjct  1     MAALRSFLKKRSTLLCNEAVRKRLFSTQVSQPIIDSPSFAQRVRNLPKDLPGTHVKTEVS  60

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIGRTP+VYLNKVTEGCGAYIA KQEM QPT+SIKDRPA++MI DAEKKGLITPGKT L
Sbjct  61    QLIGRTPIVYLNKVTEGCGAYIAVKQEMFQPTSSIKDRPALSMINDAEKKGLITPGKTVL  120

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             +EPTSGNMGISMAF+AAM+GYKMVLTMPSYTS+ERRV MR FGA+L+LTDPA+GMGGTVK
Sbjct  121   VEPTSGNMGISMAFMAAMRGYKMVLTMPSYTSLERRVCMRAFGAELILTDPARGMGGTVK  180

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTPN  MLQQFSNPANT++HFETTGPEIWEDT G VDIF+MGIGSGGTVSGVG
Sbjct  181   KAYDLLESTPNAHMLQQFSNPANTRVHFETTGPEIWEDTDGQVDIFIMGIGSGGTVSGVG  240

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNV+IYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILD+DVM+ V+ V S++
Sbjct  241   QYLKSKNPNVQIYGVEPAESNVLNGGKPGPHLITGNGVGFKPDILDLDVMDRVIEVKSDD  300

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AV MAR LAL+EGLMVGISSGANTVAA+ LA KPENKGKLIVTVHPSFGERYLSSVL++E
Sbjct  301   AVKMARRLALEEGLMVGISSGANTVAAIELAKKPENKGKLIVTVHPSFGERYLSSVLFEE  360

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  361   LRKEAENMQPVSVD  374



>ref|XP_009628115.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Nicotiana tomentosiformis]
Length=366

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/374 (81%), Positives = 329/374 (88%), Gaps = 15/374 (4%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSI-----FNTRFFNAGQPLAHSFAQRLRDLPK-DFPATNIKKETS  295
             A L+ L+KR  +   ++      +TR F+  +PL H+        PK   P TNIK E S
Sbjct  2     ATLSRLLKRSRYCNSNVDFIKVASTRLFST-EPLLHT--------PKLQLPVTNIKTEVS  52

Query  296   QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
             QLIG+TP+VYLNKVTEGCGA+IA KQEM QPT+SIKDRPA+AMI DAE KGLI+P KTTL
Sbjct  53    QLIGKTPMVYLNKVTEGCGAHIAVKQEMFQPTSSIKDRPALAMINDAENKGLISPEKTTL  112

Query  476   IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
             IEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADLVLTDP KGMGGTV 
Sbjct  113   IEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLVLTDPTKGMGGTVN  172

Query  656   KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
             KAYDLLESTPN FMLQQFSNPANTQIHFETTGPEIWE+TQGNVDIFVMGIGSGGTVSGVG
Sbjct  173   KAYDLLESTPNAFMLQQFSNPANTQIHFETTGPEIWEETQGNVDIFVMGIGSGGTVSGVG  232

Query  836   QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvssee  1015
             QYLKS+NPNVKIYGIEPTESN+LNGGKPGPHHITGNGVGFKPDILDMD+MEEVLMVSSE+
Sbjct  233   QYLKSKNPNVKIYGIEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDIMEEVLMVSSED  292

Query  1016  AVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQE  1195
             AVNMARELA+KEGLMVGISSGANTVAAL+LA KPENKGKLIVT+H SFGERYLSS+LYQ+
Sbjct  293   AVNMARELAVKEGLMVGISSGANTVAALQLAQKPENKGKLIVTIHASFGERYLSSILYQD  352

Query  1196  LRAEAEAMQPVPVD  1237
             LR EAE MQPV VD
Sbjct  353   LRKEAENMQPVSVD  366



>ref|XP_010523763.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Tarenaya hassleriana]
Length=368

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/373 (79%), Positives = 330/373 (88%), Gaps = 8/373 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTR---FFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MAAA   L++R     P   NT    F   G P   SFAQRLRDLPKDFP+TN K++ S 
Sbjct  1     MAAAFRRLLRREEI--PCSVNTMRKLFSTVGSP---SFAQRLRDLPKDFPSTNAKRDASL  55

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIG+TPLV+LNKVTEGCGAYIAAKQEM QPT+S+KDRPA+AM+ADAE K LITPGKTTLI
Sbjct  56    LIGKTPLVFLNKVTEGCGAYIAAKQEMFQPTSSVKDRPALAMVADAEAKNLITPGKTTLI  115

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAF+AAMKGY+M+LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKK
Sbjct  116   EPTSGNMGISMAFMAAMKGYRMILTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKK  175

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AY+LLE+TP+ +MLQQFSN ANTQ HFETTGPEIWEDT GNVDIFVMGIGSGGTV+GVGQ
Sbjct  176   AYELLENTPDSYMLQQFSNQANTQSHFETTGPEIWEDTLGNVDIFVMGIGSGGTVTGVGQ  235

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             +LKS+NPNV+IYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMD++E+VL VSSE+A
Sbjct  236   FLKSKNPNVEIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDILEKVLEVSSEDA  295

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             V MARELA+KEGLMVGISSGANTVAALRLA  PEN+GKLIVT+H SFGERYLSSVL++EL
Sbjct  296   VKMARELAVKEGLMVGISSGANTVAALRLAKMPENRGKLIVTLHASFGERYLSSVLFEEL  355

Query  1199  RAEAEAMQPVPVD  1237
             R EAE M+PVPVD
Sbjct  356   RKEAEKMEPVPVD  368



>ref|XP_010544747.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Tarenaya hassleriana]
Length=368

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/373 (79%), Positives = 330/373 (88%), Gaps = 8/373 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNT---RFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MAAA    ++R +   P   NT    F   G P   SFAQRLRDLPKDFP+TN K++ S 
Sbjct  1     MAAASRRFLRRETI--PGGANTVRKLFSTVGSP---SFAQRLRDLPKDFPSTNAKRDASL  55

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             L+G+TPLV+LNKVTEGCGAYIAAKQEM QPT+S+KDRPA+AMIADAE+K LI PGKTTLI
Sbjct  56    LVGKTPLVFLNKVTEGCGAYIAAKQEMFQPTSSVKDRPALAMIADAEQKNLIIPGKTTLI  115

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAFIAAMKGY+M+LTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVKK
Sbjct  116   EPTSGNMGISMAFIAAMKGYRMILTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKK  175

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AY+LLE+TP+  MLQQFSNPANTQ HFETTGPEIWEDT GNVDIFVMGIGSGGTV+GVGQ
Sbjct  176   AYELLENTPDAHMLQQFSNPANTQSHFETTGPEIWEDTLGNVDIFVMGIGSGGTVTGVGQ  235

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDIL+MD++E+VL VSS++A
Sbjct  236   YLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILEMDILEKVLEVSSDDA  295

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             V MARELALKEGLMVGISSGANTVAAL+LA  PEN+GKLIVT+H SFGERYLSSVL++EL
Sbjct  296   VKMARELALKEGLMVGISSGANTVAALKLAQMPENRGKLIVTLHASFGERYLSSVLFEEL  355

Query  1199  RAEAEAMQPVPVD  1237
             R EAE M+PV VD
Sbjct  356   RKEAEKMEPVSVD  368



>gb|KFK42134.1| hypothetical protein AALP_AA2G215500 [Arabis alpina]
Length=368

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/373 (79%), Positives = 328/373 (88%), Gaps = 8/373 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNT---RFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA   T L+KR +   P I +T    F   G P   SF +RLR+LPKDFP+TN K++ S 
Sbjct  1     MATVTTRLLKRNTI--PCISHTVRKLFSTVGSP---SFVERLRNLPKDFPSTNAKRDASL  55

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLV+LNKV+EGC AYIAAKQE  QPT SIKDRPA+AM+ADAEKK LITPGKT LI
Sbjct  56    LIGRTPLVFLNKVSEGCEAYIAAKQEHFQPTCSIKDRPALAMVADAEKKKLITPGKTVLI  115

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGISMAFIAAMKGY++++TMPSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKK
Sbjct  116   EPTSGNMGISMAFIAAMKGYRIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKK  175

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLLE+TP+ FMLQQF+NPANTQIHF+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQ
Sbjct  176   AYDLLENTPDAFMLQQFANPANTQIHFDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQ  235

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL V+S++A
Sbjct  236   YLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVTSDDA  295

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             + MARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSSVL+ EL
Sbjct  296   IKMARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDEL  355

Query  1199  RAEAEAMQPVPVD  1237
             R EAEAM+PV VD
Sbjct  356   RKEAEAMKPVSVD  368



>gb|ABY64889.1| beta-cyanoalanine synthase [Manihot esculenta]
Length=377

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/370 (80%), Positives = 324/370 (88%), Gaps = 2/370 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFF--NAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             A L NL  ++SF    +   RFF   A    A SFAQR+RDLPK+ PAT I+ E S LIG
Sbjct  8     ATLRNLFTKKSFASNELAMRRFFTPQAAAAEAPSFAQRVRDLPKNLPATKIRTEVSHLIG  67

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LNKV EGCGAYIA KQEMMQPTASIKDRPA +M  DAEKK LI+PGKT LIEPT
Sbjct  68    RTPLVFLNKVNEGCGAYIAVKQEMMQPTASIKDRPAFSMFNDAEKKNLISPGKTVLIEPT  127

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKM+LTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAYD
Sbjct  128   SGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYD  187

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLE+TPN +MLQQFSNPAN++IHFETTGPEIWEDT G VDIFVMGIGSGGTV+GVGQYLK
Sbjct  188   LLETTPNAYMLQQFSNPANSKIHFETTGPEIWEDTLGQVDIFVMGIGSGGTVTGVGQYLK  247

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             SQNPNVKIYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILDMDVME+VL VSSE+A+ M
Sbjct  248   SQNPNVKIYGVEPAESNVLNGGKPGPHQITGNGVGFKPDILDMDVMEKVLEVSSEDAIKM  307

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             AR LAL+EGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYL+SVL+++LR E
Sbjct  308   ARRLALEEGLMVGISSGANTVAALRLARMPENKGKLIVTVHPSFGERYLTSVLFEQLRNE  367

Query  1208  AEAMQPVPVD  1237
             A  MQPVPVD
Sbjct  368   AANMQPVPVD  377



>ref|XP_010275651.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nelumbo nucifera]
 ref|XP_010275652.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Nelumbo nucifera]
Length=371

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/336 (85%), Positives = 313/336 (93%), Gaps = 0/336 (0%)
 Frame = +2

Query  230   FAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDR  409
             F +++RDLPK+FP TN+KK+ SQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPT+SIKDR
Sbjct  36    FVEKIRDLPKEFPGTNVKKDVSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTSSIKDR  95

Query  410   PAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVT  589
             PA AMI DAE K LI PGKT LIEPTSGNMGISMAF+AA+KGYKMVLTMPSYTS+ERRVT
Sbjct  96    PAFAMITDAENKQLIAPGKTVLIEPTSGNMGISMAFMAALKGYKMVLTMPSYTSLERRVT  155

Query  590   MRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWED  769
             M+ FGA+L+LTDP KGMGGTVKKAY+LLESTP+ FMLQQF NPANTQ+HFETTGPEIWED
Sbjct  156   MKAFGAELILTDPTKGMGGTVKKAYELLESTPDAFMLQQFDNPANTQVHFETTGPEIWED  215

Query  770   TQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGV  949
             T G VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP ESN+LNGGKPGPHHITGNGV
Sbjct  216   TFGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPAESNVLNGGKPGPHHITGNGV  275

Query  950   GFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKG  1129
             GFKP+ILDMDVME+VL V+S++AV MARELALKEGLMVGISSGANTVAAL+LA  PENKG
Sbjct  276   GFKPNILDMDVMEKVLEVTSDDAVKMARELALKEGLMVGISSGANTVAALKLARMPENKG  335

Query  1130  KLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             KLIVTVHPSFGERYLSSVL+QELR EAE MQPV VD
Sbjct  336   KLIVTVHPSFGERYLSSVLFQELRQEAEKMQPVAVD  371



>ref|XP_010413402.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X2 [Camelina sativa]
 ref|XP_010469079.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X2 [Camelina sativa]
Length=368

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/373 (80%), Positives = 326/373 (87%), Gaps = 8/373 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTR---FFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+    L+KR +   P I NT    F   G P   SFAQRLRDLPKDFP+TN K++ S 
Sbjct  1     MASVSKRLLKRETI--PCISNTMRKLFSTVGSP---SFAQRLRDLPKDFPSTNAKRDASL  55

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLV+LN+VTEGC AYIAAKQE  QPT SIKDRPA+AMIADAEKK LI PGKTTLI
Sbjct  56    LIGRTPLVFLNRVTEGCEAYIAAKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLI  115

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGIS+AF+AA+KGYK+V+TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKK
Sbjct  116   EPTSGNMGISLAFMAALKGYKIVMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKK  175

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLL+STP+ FM QQF+NPANTQIH++TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQ
Sbjct  176   AYDLLDSTPDAFMCQQFANPANTQIHYDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQ  235

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A
Sbjct  236   YLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDA  295

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             + MARELALKEGLMVGISSGANTVAALRLA  PENKGKLIVT+H SFGERYLSSVL+ EL
Sbjct  296   IKMARELALKEGLMVGISSGANTVAALRLAKMPENKGKLIVTIHASFGERYLSSVLFDEL  355

Query  1199  RAEAEAMQPVPVD  1237
             R EAE M+PV VD
Sbjct  356   RKEAEEMKPVSVD  368



>ref|XP_002518986.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF43519.1| cysteine synthase, putative [Ricinus communis]
Length=364

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/360 (81%), Positives = 324/360 (90%), Gaps = 1/360 (0%)
 Frame = +2

Query  161   RSFLQP-SIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKV  337
             RSFL+  S+ +  FF+    +  S AQR+RDLPK+ P T IK + SQLIGRTPLVYLN+V
Sbjct  5     RSFLKKRSLKDLAFFSTEVSVDSSLAQRIRDLPKNLPGTKIKTQVSQLIGRTPLVYLNRV  64

Query  338   TEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAF  517
             TEGCGAYIA KQEM+QPT+SIKDRPA+AMI DAE+K LITPGKTTLIEPTSGNMGISMAF
Sbjct  65    TEGCGAYIAVKQEMVQPTSSIKDRPALAMINDAEQKNLITPGKTTLIEPTSGNMGISMAF  124

Query  518   IAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFM  697
             +AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTD  KGMGGTVKKAY+LLESTPN FM
Sbjct  125   MAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDHTKGMGGTVKKAYELLESTPNAFM  184

Query  698   LQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYG  877
             LQQFSNPANT+IHFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG++LK+QNPNVKIYG
Sbjct  185   LQQFSNPANTKIHFETTGPEIWEDTLGGVDIFVMGIGSGGTVSGVGKFLKTQNPNVKIYG  244

Query  878   IEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGL  1057
             +EP ESN+LNGGKPGPHHITG GVGFKP+ILDMDVME+VL V+S++AV+MAR LAL+EGL
Sbjct  245   VEPAESNVLNGGKPGPHHITGIGVGFKPEILDMDVMEKVLKVTSDDAVSMARRLALEEGL  304

Query  1058  MVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             MVGISSGANTVAALRLA   EN+GKLIVTVHPS GERYLSSVL+QELR EAE+MQPV VD
Sbjct  305   MVGISSGANTVAALRLARMTENRGKLIVTVHPSSGERYLSSVLFQELRKEAESMQPVSVD  364



>ref|XP_002320141.2| hypothetical protein POPTR_0014s08210g [Populus trichocarpa]
 gb|ABK95519.1| unknown [Populus trichocarpa]
 gb|EEE98456.2| hypothetical protein POPTR_0014s08210g [Populus trichocarpa]
Length=374

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/334 (87%), Positives = 311/334 (93%), Gaps = 0/334 (0%)
 Frame = +2

Query  236   QRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPA  415
             QRLRDLPKD P T IK + SQLIG+TP+VYL+KVTEGCGAYIAAKQEM QPT+SIKDRPA
Sbjct  41    QRLRDLPKDLPGTKIKTQVSQLIGKTPIVYLSKVTEGCGAYIAAKQEMFQPTSSIKDRPA  100

Query  416   MAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMR  595
             +AMI DAEKK LI PGKTTLIEPTSGNMGISMAF+AAMKGYKM+LTMPSYTS+ERRVTMR
Sbjct  101   LAMIEDAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTMPSYTSLERRVTMR  160

Query  596   VFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQ  775
              FGA+L+LTDPAKGMGGTVKKAY+LLESTP  FMLQQFSNPANTQIHFETTGPEIWED+ 
Sbjct  161   AFGAELILTDPAKGMGGTVKKAYELLESTPGAFMLQQFSNPANTQIHFETTGPEIWEDSL  220

Query  776   GNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGF  955
             G VDIFVMGIGSGGTVSGVG+YLKSQNPNVKIYG+EP ESN+LNGGKPGPH ITGNGVGF
Sbjct  221   GKVDIFVMGIGSGGTVSGVGKYLKSQNPNVKIYGVEPAESNVLNGGKPGPHDITGNGVGF  280

Query  956   KPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKL  1135
             KPDILDMDVME+VL VSSE+AVNMAR LAL+EGLMVGISSGANTVAALRLA  PENKGKL
Sbjct  281   KPDILDMDVMEKVLEVSSEDAVNMARRLALEEGLMVGISSGANTVAALRLARMPENKGKL  340

Query  1136  IVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             IVT+H SFGERYLSSVL+Q+LR EAE MQPVPVD
Sbjct  341   IVTIHASFGERYLSSVLFQDLRKEAENMQPVPVD  374



>ref|XP_009138771.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Brassica rapa]
 emb|CDX89116.1| BnaA04g00700D [Brassica napus]
Length=368

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/370 (79%), Positives = 324/370 (88%), Gaps = 2/370 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             MA     L+K  +  + S    + F+   P   SFA RLR+LPKDFP+T  K++ S LIG
Sbjct  1     MATVWRRLLKTETIPRISQSTRKLFSTDAP--SSFADRLRNLPKDFPSTQAKRDASLLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LN+VTEGC AYIAAKQE  QPT S+KDRPA+AM+ADAEKK LITPGKTTLIEPT
Sbjct  59    RTPLVFLNRVTEGCEAYIAAKQEHFQPTCSVKDRPALAMVADAEKKNLITPGKTTLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAFIAA+KGYK+++TMPSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKKAYD
Sbjct  119   SGNMGISMAFIAALKGYKIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYD  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTP+  MLQQF+NPANTQIHF+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  179   LLESTPDAHMLQQFANPANTQIHFDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             S+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A+ M
Sbjct  239   SKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDAIKM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSSVL+ ELR E
Sbjct  299   ARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDELRKE  358

Query  1208  AEAMQPVPVD  1237
             AEAM+PV VD
Sbjct  359   AEAMKPVSVD  368



>ref|XP_010512491.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial-like [Camelina sativa]
Length=369

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/373 (80%), Positives = 326/373 (87%), Gaps = 7/373 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTR---FFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+    L+ +R  + P I NT    F   G P   SFAQRLRDLPKDFP+TN K++ S 
Sbjct  1     MASVSKRLLLKRETI-PCISNTMRKLFSTVGSP---SFAQRLRDLPKDFPSTNAKRDASL  56

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLV+LN+VTEGC AYIAAKQE  QPT SIKDRPA+AMIADAEKK LI PGKTTLI
Sbjct  57    LIGRTPLVFLNRVTEGCEAYIAAKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLI  116

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGIS+AF+AA+KGYK+V+TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKK
Sbjct  117   EPTSGNMGISLAFMAALKGYKIVMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKK  176

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLL+STP+ FM QQF+NPANTQIH++TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQ
Sbjct  177   AYDLLDSTPDAFMCQQFANPANTQIHYDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQ  236

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A
Sbjct  237   YLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDA  296

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             + MARELALKEGLMVGISSGANTVAALRLA  PENKGKLIVT+H SFGERYLSSVL+ EL
Sbjct  297   IKMARELALKEGLMVGISSGANTVAALRLAKMPENKGKLIVTIHASFGERYLSSVLFDEL  356

Query  1199  RAEAEAMQPVPVD  1237
             R EAE M+PV VD
Sbjct  357   RKEAEEMKPVSVD  369



>ref|XP_004229909.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Solanum lycopersicum]
Length=357

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/368 (80%), Positives = 323/368 (88%), Gaps = 12/368 (3%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRT  313
             A+L+  +K+RS    ++           L  + + RL       P TNIK E SQLIG+T
Sbjct  2     ASLSRFLKKRSLDYNNV----------DLMRAASNRL--FSTQLPHTNIKSEVSQLIGKT  49

Query  314   PLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSG  493
             P+VYL KVTEGCGAYIA KQEM QPT+SIKDRPA+AMI DAEKKGLI+P KTTLIEPTSG
Sbjct  50    PMVYLKKVTEGCGAYIAVKQEMFQPTSSIKDRPALAMINDAEKKGLISPEKTTLIEPTSG  109

Query  494   NMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLL  673
             NMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKAYDLL
Sbjct  110   NMGISMAFMAAMKGYKMVLTMPSYTSMERRVTMRAFGADLILTDPTKGMGGTVKKAYDLL  169

Query  674   ESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQ  853
             ESTPN FMLQQFSNPANTQ+HF+TTGPEIWE++ GNVDIFVMGIGSGGTV+GVGQYLKS+
Sbjct  170   ESTPNAFMLQQFSNPANTQVHFDTTGPEIWEESLGNVDIFVMGIGSGGTVTGVGQYLKSK  229

Query  854   NPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMAR  1033
             NPNVKIYG+EPTESNILNGGKPGPHHITGNGVGFKPDILDMD+MEEVLMVSSE+AVNMAR
Sbjct  230   NPNVKIYGLEPTESNILNGGKPGPHHITGNGVGFKPDILDMDLMEEVLMVSSEDAVNMAR  289

Query  1034  ELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAE  1213
             ELA+KEGLMVGISSGANTVAALRLA KPENKGKLIVTVH SFGERYLSSVLYQ+LR EAE
Sbjct  290   ELAVKEGLMVGISSGANTVAALRLAQKPENKGKLIVTVHASFGERYLSSVLYQDLRKEAE  349

Query  1214  AMQPVPVD  1237
              MQP+ VD
Sbjct  350   NMQPISVD  357



>emb|CDY43932.1| BnaC04g21780D [Brassica napus]
Length=368

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/370 (78%), Positives = 323/370 (87%), Gaps = 2/370 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             MA     L+K  +  + S    + F+     + SFA RLR+LPKDFP+T  K++ S LIG
Sbjct  1     MATVWRRLLKTETIPRISQSTRKLFSTDA--SSSFADRLRNLPKDFPSTQAKRDASLLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LN+VTEGC AYIAAKQE  QPT S+KDRPA+AM+ DAEKK LITPGKTTLIEPT
Sbjct  59    RTPLVFLNRVTEGCEAYIAAKQEHFQPTCSVKDRPALAMVEDAEKKNLITPGKTTLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAFIAA+KGY++++TMPSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKKAYD
Sbjct  119   SGNMGISMAFIAALKGYRIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYD  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTP+  MLQQF+NPANTQIHF+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  179   LLESTPDAHMLQQFANPANTQIHFDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             S+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A+ M
Sbjct  239   SKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDAIKM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSSVL+ ELR E
Sbjct  299   ARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDELRKE  358

Query  1208  AEAMQPVPVD  1237
             AEAM+PV VD
Sbjct  359   AEAMKPVSVD  368



>ref|XP_006402480.1| hypothetical protein EUTSA_v10006044mg [Eutrema salsugineum]
 gb|ESQ43933.1| hypothetical protein EUTSA_v10006044mg [Eutrema salsugineum]
Length=368

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/370 (79%), Positives = 324/370 (88%), Gaps = 2/370 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             MA     L+KR +  + S    + F+   P   SF +RLR+LPKDFPAT  K++ S LIG
Sbjct  1     MATVSRRLLKRETIPRISQSTRKLFSTDGP--ASFLERLRNLPKDFPATYAKRDASLLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LN+VTEGC AYIAAKQE  QPT SIKDRPA+AM+ DAEK+GLI PGKTTLIEPT
Sbjct  59    RTPLVFLNRVTEGCEAYIAAKQEHFQPTCSIKDRPALAMVVDAEKRGLIAPGKTTLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAM+GYK+++TMPSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKKAYD
Sbjct  119   SGNMGISMAFMAAMRGYKIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYD  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLE+TP+  MLQQF+NPANTQIHF+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  179   LLENTPDAHMLQQFANPANTQIHFDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             S+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A+ M
Sbjct  239   SKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDAIKM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSSVL+ ELR E
Sbjct  299   ARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDELRKE  358

Query  1208  AEAMQPVPVD  1237
             AEAM+PV VD
Sbjct  359   AEAMKPVSVD  368



>ref|NP_191703.1| cysteine synthase C1 [Arabidopsis thaliana]
 sp|Q9S757.1|CYSC1_ARATH RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase C1, mitochondrial; AltName: Full=Beta-substituted 
Ala synthase 3;1; Short=ARAth-Bsas3;1; AltName: Full=Cysteine 
synthase C1; Short=AtCYSC1; AltName: Full=O-acetylserine (thiol)-lyase 
5; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA78560.1| cysteine synthase [Arabidopsis thaliana]
 emb|CAB54830.1| cysteine synthase [Arabidopsis thaliana]
 emb|CAB71074.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 gb|AAM13093.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 gb|AAM64764.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 gb|AAM91182.1| cysteine synthase AtcysC1 [Arabidopsis thaliana]
 dbj|BAE98719.1| cysteine synthase [Arabidopsis thaliana]
 gb|AEE80203.1| cysteine synthase C1 [Arabidopsis thaliana]
Length=368

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/373 (78%), Positives = 326/373 (87%), Gaps = 8/373 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNT---RFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+    L++R +   P   +T    F   G P   SFAQRLRDLPKDFP+TN K++ S 
Sbjct  1     MASVSRRLLRRETI--PCFSHTVRKLFSTVGSP---SFAQRLRDLPKDFPSTNAKRDASL  55

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIG+TPLV+LNKVTEGC AY+AAKQE  QPT SIKDRPA+AMIADAEKK LI PGKTTLI
Sbjct  56    LIGKTPLVFLNKVTEGCEAYVAAKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLI  115

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGIS+AF+AAMKGY++++TMPSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKK
Sbjct  116   EPTSGNMGISLAFMAAMKGYRIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKK  175

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLL+STP+ FM QQF+NPANTQIHF+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVG+
Sbjct  176   AYDLLDSTPDAFMCQQFANPANTQIHFDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGR  235

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP+ILDMDVME VL VSSE+A
Sbjct  236   YLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPEILDMDVMESVLEVSSEDA  295

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             + MARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSSVL+ EL
Sbjct  296   IKMARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDEL  355

Query  1199  RAEAEAMQPVPVD  1237
             R EAE M+PV VD
Sbjct  356   RKEAEEMKPVSVD  368



>ref|XP_009116808.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial [Brassica rapa]
Length=368

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/370 (78%), Positives = 325/370 (88%), Gaps = 2/370 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             MA+    L+K  +  + S    + F+     + SFA+RLR+LPK+FPAT  K + S LIG
Sbjct  1     MASVWRRLLKTETIPRISQSTRKLFSTDG--SSSFAERLRNLPKEFPATQAKGDASLLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LN+VTEGCGAYIAAKQE  QPT S+KDRPA+AM+ADAEKK LITPGKTTLIEPT
Sbjct  59    RTPLVFLNRVTEGCGAYIAAKQEHFQPTCSVKDRPALAMVADAEKKNLITPGKTTLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AA+KGYK+++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAYD
Sbjct  119   SGNMGISMAFMAALKGYKIIMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYD  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTP+  MLQQF+NPANTQIH++TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  179   LLESTPDAHMLQQFANPANTQIHYDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             S+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A+ M
Sbjct  239   SKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDAIKM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAA++LA  PENKGKLIVT+H SFGERYLSS+L+ ELR E
Sbjct  299   ARELALKEGLMVGISSGANTVAAIKLAKMPENKGKLIVTIHASFGERYLSSILFDELRKE  358

Query  1208  AEAMQPVPVD  1237
             AEAM+PV VD
Sbjct  359   AEAMKPVSVD  368



>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
 pdb|3VBE|B Chain B, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
 pdb|3VBE|C Chain C, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
 pdb|3VBE|D Chain D, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean
Length=344

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/323 (89%), Positives = 305/323 (94%), Gaps = 0/323 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             +TNIKK  SQLIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASIKDRPA AMI DAE+K 
Sbjct  22    STNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIKDRPAYAMITDAEEKN  81

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LITPGKTTLIEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP
Sbjct  82    LITPGKTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDP  141

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGMGGTVKKAY+LLE+TPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIG
Sbjct  142   AKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIG  201

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             SGGTVSGVGQYLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNGVGFKPDILD+DVME
Sbjct  202   SGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVME  261

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             +VL VSSE+AVNMAR LALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGER
Sbjct  262   KVLEVSSEDAVNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFGER  321

Query  1169  YLSSVLYQELRAEAEAMQPVPVD  1237
             YLSSVL+QELR EAE MQPV VD
Sbjct  322   YLSSVLFQELRQEAENMQPVAVD  344



>ref|NP_001275044.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial 
[Solanum tuberosum]
 sp|Q9FS29.1|CAS2_SOLTU RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase 2, mitochondrial; Flags: Precursor [Solanum tuberosum]
 dbj|BAB20032.1| beta-cyanoalanine synthase like protein [Solanum tuberosum]
Length=347

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/368 (79%), Positives = 318/368 (86%), Gaps = 22/368 (6%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRT  313
             A L+  +K+RS     +F+T+                       P TNIK E SQLIG+T
Sbjct  2     ATLSRFLKKRSLASNRLFSTQL----------------------PHTNIKSEVSQLIGKT  39

Query  314   PLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSG  493
             P+VYL KVTEGCGAYIA KQEM QPT+SIKDRPA+AMI DAEKKGLI+P KTTLIEPTSG
Sbjct  40    PMVYLKKVTEGCGAYIAVKQEMFQPTSSIKDRPALAMINDAEKKGLISPEKTTLIEPTSG  99

Query  494   NMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLL  673
             NMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDP KGMGGTVKKAY+LL
Sbjct  100   NMGISMAFMAAMKGYKMVLTMPSYTSMERRVTMRAFGADLILTDPTKGMGGTVKKAYELL  159

Query  674   ESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQ  853
             ESTPN FMLQQFSNPANTQ+HF+TTGPEIWE+T GNVDIFVMGIGSGGTV+GVG YLKS+
Sbjct  160   ESTPNAFMLQQFSNPANTQVHFDTTGPEIWEETLGNVDIFVMGIGSGGTVTGVGLYLKSK  219

Query  854   NPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMAR  1033
             NPNVKIYG+EPTESNILNGGKPGPHHITGNGVG KPDI+DMD+MEEVLMVSSE+AVNMAR
Sbjct  220   NPNVKIYGLEPTESNILNGGKPGPHHITGNGVGSKPDIVDMDLMEEVLMVSSEDAVNMAR  279

Query  1034  ELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAE  1213
             ELA+KEGLMVGISSGANTVAALRLA KPENKGKLIVTVH SFGERYLSSVLYQ+LR EAE
Sbjct  280   ELAVKEGLMVGISSGANTVAALRLAQKPENKGKLIVTVHASFGERYLSSVLYQDLRKEAE  339

Query  1214  AMQPVPVD  1237
              MQPV VD
Sbjct  340   NMQPVSVD  347



>ref|XP_002876613.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52872.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/347 (82%), Positives = 315/347 (91%), Gaps = 3/347 (1%)
 Frame = +2

Query  197   FFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQE  376
             F   G P   SFAQRLRDLPKDFP+TN K++ S LIG+TPLV+LNKVTEGC AYIAAKQE
Sbjct  25    FSTVGSP---SFAQRLRDLPKDFPSTNAKRDASLLIGKTPLVFLNKVTEGCEAYIAAKQE  81

Query  377   MMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTM  556
               QPT SIKDRPA+AMIADAEKK LI PGK+TLIEPTSGNMGIS+AF+AA+KGY++++TM
Sbjct  82    HFQPTCSIKDRPAIAMIADAEKKKLIIPGKSTLIEPTSGNMGISLAFMAALKGYRIIMTM  141

Query  557   PSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIH  736
             PSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKKAYDLLE+TP+ FM QQF+NPANTQIH
Sbjct  142   PSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLENTPDAFMCQQFANPANTQIH  201

Query  737   FETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGK  916
             F+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP ESNILNGGK
Sbjct  202   FDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPAESNILNGGK  261

Query  917   PGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAA  1096
             PGPH ITGNGVGFKP+ILDMDVME VL VSSE+A+ MARELALKEGLMVGISSGANTVAA
Sbjct  262   PGPHAITGNGVGFKPEILDMDVMESVLEVSSEDAIKMARELALKEGLMVGISSGANTVAA  321

Query  1097  LRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             +RLA  PENKGKLIVT+H SFGERYLSSVL+ ELR EAE M+PV VD
Sbjct  322   IRLAKMPENKGKLIVTIHASFGERYLSSVLFDELRKEAEEMKPVSVD  368



>gb|KHG16844.1| Cysteine synthase, chloroplastic/chromoplastic [Gossypium arboreum]
Length=371

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/370 (80%), Positives = 318/370 (86%), Gaps = 2/370 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPL--AHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             AAL + + +R      +  TR   + +P+  + SFAQRL DLP D   T IK E  QLIG
Sbjct  2     AALMSFLTKRCLTYNELMMTRRLVSTEPIIDSPSFAQRLGDLPTDLLDTKIKSEVYQLIG  61

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LNKVTEGCGAYIA KQEMM PTASIKDRPA +MI DAEKK LI+PGKTTLIEPT
Sbjct  62    RTPLVFLNKVTEGCGAYIAVKQEMMMPTASIKDRPAFSMITDAEKKNLISPGKTTLIEPT  121

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AA KGYKMVLTMPSYTS+ERRVTMR FGA LVLTDP KGM GTVKKA +
Sbjct  122   SGNMGISMAFMAATKGYKMVLTMPSYTSLERRVTMRAFGAGLVLTDPTKGMEGTVKKANE  181

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTPN FMLQQFSNPANTQ HFETTGP+IWEDT G VDIFV GIGSGGTVSGVGQYLK
Sbjct  182   LLESTPNAFMLQQFSNPANTQAHFETTGPKIWEDTLGKVDIFVTGIGSGGTVSGVGQYLK  241

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             SQNPNVKIYG+EP ESN+LNGGKPGPHHITGNGVGFKPDILDMDVME+VL VSSE+AVNM
Sbjct  242   SQNPNVKIYGVEPAESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEKVLEVSSEDAVNM  301

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGL+VGISSGAN +AALRLA  PENKGKLIVTV PSFGERYLSSVL+QELR E
Sbjct  302   ARELALKEGLLVGISSGANAIAALRLARMPENKGKLIVTVLPSFGERYLSSVLFQELRKE  361

Query  1208  AEAMQPVPVD  1237
             AE +QPV VD
Sbjct  362   AENLQPVAVD  371



>emb|CDX71737.1| BnaC08g31370D [Brassica napus]
Length=368

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/370 (78%), Positives = 323/370 (87%), Gaps = 2/370 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             MA     L+K  +  + S    + F+     + SFA RLR+LPK+FPAT  K++ S LIG
Sbjct  1     MATIWRRLLKTETIPRISQSTRKLFSTDG--SSSFADRLRNLPKEFPATQAKRDASLLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLV+LN+VTEGCGAYIAAKQE  QPT S+KDRPA+AM+ADAEKK LITPGKTTLIEPT
Sbjct  59    RTPLVFLNRVTEGCGAYIAAKQEHFQPTCSVKDRPALAMVADAEKKNLITPGKTTLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AA+KGYK+++TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKKAYD
Sbjct  119   SGNMGISMAFMAALKGYKIIMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKKAYD  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LLESTP+  MLQQF+NPANTQIH++TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQYLK
Sbjct  179   LLESTPDAHMLQQFANPANTQIHYDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
              +NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A+ M
Sbjct  239   FKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDAIKM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             ARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSS+L+ ELR E
Sbjct  299   ARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSILFDELRKE  358

Query  1208  AEAMQPVPVD  1237
             AEAM+PV VD
Sbjct  359   AEAMKPVSVD  368



>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|B Chain B, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|C Chain C, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|D Chain D, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|E Chain E, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
 pdb|3VC3|F Chain F, Crystal Structure Of Beta-Cyanoalanine Synthase K95a 
Mutant In Soybean
Length=344

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/323 (89%), Positives = 304/323 (94%), Gaps = 0/323 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             +TNIKK  SQLIGRTPLVYLNKVTEGCGAY+A KQEMMQPTASI DRPA AMI DAE+K 
Sbjct  22    STNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKN  81

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LITPGKTTLIEPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP
Sbjct  82    LITPGKTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDP  141

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGMGGTVKKAY+LLE+TPN  MLQQFSNPANTQ+HFETTGPEIWEDT G VDIFVMGIG
Sbjct  142   AKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPEIWEDTNGQVDIFVMGIG  201

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             SGGTVSGVGQYLKS+NPNVKIYG+EP+ESN+LNGGKPGPHHITGNGVGFKPDILD+DVME
Sbjct  202   SGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKPGPHHITGNGVGFKPDILDLDVME  261

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             +VL VSSE+AVNMAR LALKEGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGER
Sbjct  262   KVLEVSSEDAVNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFGER  321

Query  1169  YLSSVLYQELRAEAEAMQPVPVD  1237
             YLSSVL+QELR EAE MQPV VD
Sbjct  322   YLSSVLFQELRQEAENMQPVAVD  344



>ref|XP_010670142.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=368

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 320/371 (86%), Gaps = 7/371 (2%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNT---RFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLI  304
             A +++ M RRS     IF +   R F++    + + A         FP T IK   SQL+
Sbjct  2     ATVSSFMMRRSRTNSQIFKSAVVRCFSSSSDASQTVADSAFS---SFPPT-IKTHVSQLV  57

Query  305   GRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEP  484
             GRTPLV+LNKVTEGCGAYIA KQEMMQPT+S+KDRPA+AM+ DAEKKGLI+PGKT LIEP
Sbjct  58    GRTPLVFLNKVTEGCGAYIAVKQEMMQPTSSVKDRPALAMLEDAEKKGLISPGKTVLIEP  117

Query  485   TSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAY  664
             TSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAY
Sbjct  118   TSGNMGISMAFMAAMKGYKMVLTMPSYTSMERRVTMRAFGAELILTDPDKGMGGTVKKAY  177

Query  665   DLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYL  844
              LL+STP+GFMLQQFSNPANTQ+HFETTGPEIWEDTQG VDIFVMGIGSGGTVSGVGQYL
Sbjct  178   QLLDSTPDGFMLQQFSNPANTQVHFETTGPEIWEDTQGKVDIFVMGIGSGGTVSGVGQYL  237

Query  845   KSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVN  1024
             KSQNPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP+ILDMDVME VL V S++A+ 
Sbjct  238   KSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPEILDMDVMEAVLEVKSDDAIK  297

Query  1025  MARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRA  1204
             MAR+LALKEGLMVGISSGANTVAAL LA +PENKGKLIVT+HPSFGERYLSS L++ELR 
Sbjct  298   MARQLALKEGLMVGISSGANTVAALELAKRPENKGKLIVTIHPSFGERYLSSALFKELRE  357

Query  1205  EAEAMQPVPVD  1237
             EAE MQPVPV+
Sbjct  358   EAEQMQPVPVE  368



>ref|XP_002511880.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF50549.1| cysteine synthase, putative [Ricinus communis]
Length=355

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/368 (79%), Positives = 317/368 (86%), Gaps = 14/368 (4%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRT  313
             AAL + +K+RS    S+              SF+     L K+ PAT IK E +QLIG+T
Sbjct  2     AALRSFLKKRSLTCNSL-------------ASFSTEAA-LAKNLPATKIKTEVAQLIGKT  47

Query  314   PLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSG  493
             P+VYLNKVTEGCG Y+A KQEM QPT+SIKDRPA AMI DAE+K LI+PGKTTLIEPTSG
Sbjct  48    PIVYLNKVTEGCGGYVAVKQEMFQPTSSIKDRPAFAMITDAEQKNLISPGKTTLIEPTSG  107

Query  494   NMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLL  673
             NMGISMAF+AAMKGYKMVLTMPSYTS+ERRV MR FGADL+LTDP KGMGGTVKKAY+LL
Sbjct  108   NMGISMAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGADLILTDPTKGMGGTVKKAYELL  167

Query  674   ESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQ  853
             ESTP+ FMLQQFSNPANT+IHFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS+
Sbjct  168   ESTPDAFMLQQFSNPANTKIHFETTGPEIWEDTLGQVDIFVMGIGSGGTVSGVGQYLKSK  227

Query  854   NPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMAR  1033
             NPNVKIYG+EP ESN+LNGGKPGPH ITGNGVGFKPDILDMD+ME+VL VSSE+AVNMAR
Sbjct  228   NPNVKIYGVEPAESNVLNGGKPGPHQITGNGVGFKPDILDMDLMEKVLEVSSEDAVNMAR  287

Query  1034  ELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAE  1213
              LAL+EGLMVGISSGANTVAALRLA  PENKGKLIVTVHPSFGERYLSSVL+QELR EAE
Sbjct  288   RLALEEGLMVGISSGANTVAALRLARMPENKGKLIVTVHPSFGERYLSSVLFQELRQEAE  347

Query  1214  AMQPVPVD  1237
              MQPV VD
Sbjct  348   NMQPVSVD  355



>gb|KEH23373.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula]
Length=320

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/317 (89%), Positives = 298/317 (94%), Gaps = 0/317 (0%)
 Frame = +2

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
             E+  LIGRTPLVYLNKVTEGCGAYIA KQEMMQPTASIKDRPA+AM+ DAEKK LITPGK
Sbjct  4     ESLDLIGRTPLVYLNKVTEGCGAYIAVKQEMMQPTASIKDRPALAMMEDAEKKNLITPGK  63

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             T LIEPTSGNMGIS+AF+AAMKGYKMVLTMPSYTS+ERRV MR FGA+L+LTDP KGMGG
Sbjct  64    TILIEPTSGNMGISLAFMAAMKGYKMVLTMPSYTSLERRVCMRAFGAELILTDPTKGMGG  123

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
             TVKKAYDLLESTPN FMLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVS
Sbjct  124   TVKKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVS  183

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvs  1006
             GVGQYLKSQNPNVKIYG+EP+ESN+LNGGKPGPH ITGNGVGFKPDILDMDVME+VL VS
Sbjct  184   GVGQYLKSQNPNVKIYGVEPSESNVLNGGKPGPHQITGNGVGFKPDILDMDVMEKVLEVS  243

Query  1007  seeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVL  1186
             SE+AVNMAR LALKEGLMVGISSGANTVAALRLAS PENKGKLIVTVHPSFGERYLSSVL
Sbjct  244   SEDAVNMARTLALKEGLMVGISSGANTVAALRLASLPENKGKLIVTVHPSFGERYLSSVL  303

Query  1187  YQELRAEAEAMQPVPVD  1237
             +Q+LR EAE MQPV VD
Sbjct  304   FQDLRTEAENMQPVSVD  320



>ref|XP_010467018.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial-like [Camelina sativa]
Length=349

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/337 (81%), Positives = 306/337 (91%), Gaps = 0/337 (0%)
 Frame = +2

Query  227   SFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKD  406
             S AQRL+D PK F +TN+K + S LIGRTPLV+LNKVTEGCGAYIAAKQE  Q T SIKD
Sbjct  13    SSAQRLKDHPKAFASTNVKGDASMLIGRTPLVFLNKVTEGCGAYIAAKQEHFQSTCSIKD  72

Query  407   RPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRV  586
             RPA+AMI DAEKK LITPGKTTLIEPTSGNMGIS+AF+AAM+GYK+++TMPSYTS+ERRV
Sbjct  73    RPALAMIEDAEKKNLITPGKTTLIEPTSGNMGISLAFMAAMEGYKIIITMPSYTSLERRV  132

Query  587   TMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWE  766
             TMR FGA+LVLTDP KGMGG VKKA  LLE+TPN FMLQQF+NPANTQ+H++TTGPEIWE
Sbjct  133   TMRSFGAELVLTDPTKGMGGAVKKANQLLETTPNAFMLQQFNNPANTQVHYDTTGPEIWE  192

Query  767   DTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNG  946
             DT GNVDIFVMGIG GGTV+GVG+YLKS+NP+VKIYG+EPTESNILNG KPGPH ITGNG
Sbjct  193   DTHGNVDIFVMGIGIGGTVTGVGKYLKSRNPSVKIYGVEPTESNILNGDKPGPHEITGNG  252

Query  947   VGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENK  1126
             VGFKPDILDM +ME+VL VSSE+AVNMARELALKEGLMVGISSGANTVAA+RLA  PENK
Sbjct  253   VGFKPDILDMHIMEKVLEVSSEDAVNMARELALKEGLMVGISSGANTVAAIRLAKMPENK  312

Query  1127  GKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             GK+IVT+HPSFGERYLSSVL+ ELR EAE M+PV VD
Sbjct  313   GKVIVTIHPSFGERYLSSVLFDELRKEAEEMKPVSVD  349



>sp|Q43153.1|CYSC_SPIOL RecName: Full=Bifunctional L-3-cyanoalanine synthase/cysteine 
synthase, mitochondrial; AltName: Full=Beta-cyanoalanine synthase; 
Short=SoCAS; AltName: Full=Beta-substituted Ala synthase 
3-1; Short=SPIol-Bsas3-1; AltName: Full=Cysteine synthase 
C; Flags: Precursor [Spinacia oleracea]
 dbj|BAA07177.1| cysteine synthase [Spinacia oleracea]
 dbj|BAG72099.1| mitochondrial cysteine synthase [Spinacia oleracea]
Length=368

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/370 (76%), Positives = 317/370 (86%), Gaps = 5/370 (1%)
 Frame = +2

Query  134   AALTNLMKRRSFLQPSIFNT--RFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIG  307
             A +++ + RRS     IF T  R F+     A + +      P  F  TNIK   SQLIG
Sbjct  2     ATVSSCLLRRSRTASRIFKTSLRCFSTTSSSAQTVSG---SSPFPFTGTNIKTNVSQLIG  58

Query  308   RTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPT  487
             RTPLVYL+K++EG GAYIA KQEMMQPTAS+KDRPA+AMI DAEKKGLI+PGKT LIEPT
Sbjct  59    RTPLVYLSKISEGSGAYIAVKQEMMQPTASVKDRPALAMIEDAEKKGLISPGKTVLIEPT  118

Query  488   SGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYD  667
             SGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRV MR FGADL+LTDP KGMGGTVKKA  
Sbjct  119   SGNMGISMAFMAAMKGYKMVLTMPSYTSMERRVVMRAFGADLILTDPDKGMGGTVKKANQ  178

Query  668   LLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLK  847
             LL+STP+GFMLQQF+NPANTQ+HFETTGPEIWEDTQG VDIFVMGIGSGGTVSGVG+YLK
Sbjct  179   LLDSTPDGFMLQQFNNPANTQVHFETTGPEIWEDTQGKVDIFVMGIGSGGTVSGVGRYLK  238

Query  848   SQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNM  1027
             SQNPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP+ILDMDVM+ VL V S++AV M
Sbjct  239   SQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPEILDMDVMDAVLEVKSDDAVKM  298

Query  1028  ARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAE  1207
             AR+LAL+EGL+VGISSGANT+AAL LA +PENKGKLIVT+HPSFGERYLSS L++ELR E
Sbjct  299   ARQLALQEGLLVGISSGANTIAALDLAKRPENKGKLIVTIHPSFGERYLSSALFKELREE  358

Query  1208  AEAMQPVPVD  1237
             AE MQPVPV+
Sbjct  359   AENMQPVPVE  368



>ref|XP_010413401.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X1 [Camelina sativa]
Length=377

 Score =   520 bits (1338),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 314/371 (85%), Gaps = 9/371 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTR---FFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQ  298
             MA+    L+KR +   P I NT    F   G P   SFAQRLRDLPKDFP+TN K++ S 
Sbjct  1     MASVSKRLLKRETI--PCISNTMRKLFSTVGSP---SFAQRLRDLPKDFPSTNAKRDASL  55

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLV+LN+VTEGC AYIAAKQE  QPT SIKDRPA+AMIADAEKK LI PGKTTLI
Sbjct  56    LIGRTPLVFLNRVTEGCEAYIAAKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLI  115

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGIS+AF+AA+KGYK+V+TMPSYTS+ERRVTMR FGA+LVLTDP KGMGGTVKK
Sbjct  116   EPTSGNMGISLAFMAALKGYKIVMTMPSYTSLERRVTMRSFGAELVLTDPTKGMGGTVKK  175

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             AYDLL+STP+ FM QQF+NPANTQIH++TTGPEIWEDT GNVDIFVMGIGSGGTVSGVGQ
Sbjct  176   AYDLLDSTPDAFMCQQFANPANTQIHYDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGQ  235

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL VSSE+A
Sbjct  236   YLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEVSSEDA  295

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL-SSVLYQE  1195
             + MARELALKEGLMVGISSGANTVAALRLA  PENKGKLIVT+H SF E YL  SVL+ E
Sbjct  296   IKMARELALKEGLMVGISSGANTVAALRLAKMPENKGKLIVTIHASFREIYLFQSVLFDE  355

Query  1196  LRAEAEAMQPV  1228
                     Q +
Sbjct  356   KHKRCSQFQSI  366



>ref|XP_002883653.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59912.1| beta-substituted ala synthase 3_1 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   513 bits (1321),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 271/336 (81%), Positives = 302/336 (90%), Gaps = 6/336 (2%)
 Frame = +2

Query  248   DLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMI  427
             + PK FP+T  K + S LIGRTPLV+LNKVTEGC AYIAAKQE  QPT SIKDRPA+AMI
Sbjct  9     EYPKAFPSTKAKGDASMLIGRTPLVFLNKVTEGCEAYIAAKQEHFQPTCSIKDRPALAMI  68

Query  428   ADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGA  607
              DAEKK LITPGKTTLIEPTSGNMGIS+AF+AAMKGYK+++TMPSYTS+ERRVTMR FGA
Sbjct  69    VDAEKKNLITPGKTTLIEPTSGNMGISLAFMAAMKGYKIIITMPSYTSLERRVTMRSFGA  128

Query  608   DLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVD  787
             +LVLTDP KGMGG VKKAY+LLE+TP+ FMLQQF+NPANTQ+H++TTGPEIWEDT GNVD
Sbjct  129   ELVLTDPTKGMGGAVKKAYELLETTPDAFMLQQFNNPANTQVHYDTTGPEIWEDTHGNVD  188

Query  788   IFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKP------GPHHITGNGV  949
             IFVMGIG+GGTV+GVG+YLKS+NPNVKIYG+EP ESNILNGGKP      GPH ITGNGV
Sbjct  189   IFVMGIGTGGTVTGVGRYLKSKNPNVKIYGVEPAESNILNGGKPVVNFELGPHEITGNGV  248

Query  950   GFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKG  1129
             GFKPDILDMDVM++VL VSSE+AVNMARELALKEGLMVGISSGANTVAA+RLA  PENKG
Sbjct  249   GFKPDILDMDVMDKVLEVSSEDAVNMARELALKEGLMVGISSGANTVAAIRLAKMPENKG  308

Query  1130  KLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             KLIVT+HPSFGERYLSSVL+ ELR EA  M+PV VD
Sbjct  309   KLIVTIHPSFGERYLSSVLFDELRKEAAEMKPVSVD  344



>ref|XP_006827554.1| hypothetical protein AMTR_s00009p00219590 [Amborella trichopoda]
 gb|ERM94970.1| hypothetical protein AMTR_s00009p00219590 [Amborella trichopoda]
Length=367

 Score =   502 bits (1293),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 268/326 (82%), Positives = 289/326 (89%), Gaps = 0/326 (0%)
 Frame = +2

Query  260   DFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAE  439
             DF   N+KK  SQ+IGRTPLVYLNKV+EGCGA+IAAK EMMQP  SIKDR  +AMI DAE
Sbjct  42    DFARLNVKKNVSQVIGRTPLVYLNKVSEGCGAHIAAKLEMMQPCCSIKDRVGIAMIEDAE  101

Query  440   KKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVL  619
             KK LI+P KT LIEPTSGNMGI ++FIAA KGYK++LTMPSYTS+ERRVTMRVFG++LVL
Sbjct  102   KKKLISPDKTILIEPTSGNMGIGLSFIAASKGYKLILTMPSYTSLERRVTMRVFGSELVL  161

Query  620   TDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVM  799
             TDP KGMGG VKKA  L ESTPN FMLQQF NP+N ++HFETTGPEIWEDT G VDIFVM
Sbjct  162   TDPTKGMGGAVKKATQLHESTPNSFMLQQFENPSNVKVHFETTGPEIWEDTLGQVDIFVM  221

Query  800   gigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmd  979
              IGSGGTVSGVG+YLKSQNPNVKIYG+EP ESNILNGGKPGPH ITG GVGFKP ILDMD
Sbjct  222   AIGSGGTVSGVGRYLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGTGVGFKPGILDMD  281

Query  980   vmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSF  1159
             V+E VL VSSE+AV MARELALKEGLMVGISSGANTVAALRLAS PENKGKLIVTVHPSF
Sbjct  282   VLEAVLEVSSEDAVKMARELALKEGLMVGISSGANTVAALRLASMPENKGKLIVTVHPSF  341

Query  1160  GERYLSSVLYQELRAEAEAMQPVPVD  1237
             GERYLSSVL+QELR EAE MQPVPVD
Sbjct  342   GERYLSSVLFQELRDEAEKMQPVPVD  367



>ref|NP_001052135.1| Os04g0165700 [Oryza sativa Japonica Group]
 emb|CAE02117.2| OSJNBa0019G23.9 [Oryza sativa Japonica Group]
 dbj|BAF14049.1| Os04g0165700 [Oryza sativa Japonica Group]
 dbj|BAG95590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   493 bits (1268),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 265/377 (70%), Positives = 305/377 (81%), Gaps = 7/377 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPS---IFNTRFFNAGQPLAHSFAQRLR----DLPKDFPATNIKK  286
             M  AL +LM+RRS LQ              G P   +  Q         P   P   I+ 
Sbjct  1     MERALMSLMRRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQSPGILPGLKIRD  60

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
               SQLIGRTP+VYLNKVTEGCGA IAAK E +QP+ S+KDRPA++M+ DAEKKGLITPGK
Sbjct  61    SASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGLITPGK  120

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             TTLIEPTSGNMGI +AF+AA+KGY+++LTMPSYTS+ERRVTMR FGA LVLTDP KGMGG
Sbjct  121   TTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPTKGMGG  180

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
             TV+KA +L E+ P+ FMLQQF NPAN ++H+ETTGPEIWEDT G VDIFVMGIGSGGTV+
Sbjct  181   TVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGIGSGGTVT  240

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvs  1006
             GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKP+IL+MD+ME+V+ V 
Sbjct  241   GVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPEILNMDIMEKVIEVK  300

Query  1007  seeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVL  1186
              E+AV MARELALKEGL+VGISSGANTVAAL LA KPENKGKLIVTV PS GERYLSS L
Sbjct  301   GEDAVKMARELALKEGLLVGISSGANTVAALELAKKPENKGKLIVTVLPSLGERYLSSAL  360

Query  1187  YQELRAEAEAMQPVPVD  1237
             ++ELRAEAEAMQPVPVD
Sbjct  361   FEELRAEAEAMQPVPVD  377



>gb|AAV48542.1| beta-cyanoalanine synthase [Oryza sativa Indica Group]
 emb|CAC09478.2| H0806H05.11 [Oryza sativa Indica Group]
 gb|EAY93009.1| hypothetical protein OsI_14808 [Oryza sativa Indica Group]
Length=377

 Score =   493 bits (1268),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 266/377 (71%), Positives = 305/377 (81%), Gaps = 7/377 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPS---IFNTRFFNAGQPLAHSFAQRLR----DLPKDFPATNIKK  286
             M  AL +LM+RRS LQ              G P   +  Q         P   P   I+ 
Sbjct  1     MERALMSLMRRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQSPGILPGLKIRD  60

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
               SQLIGRTP+VYLNKVTEGCGA IAAK E +QP+ S+KDRPA++M+ DAEKKGLITPGK
Sbjct  61    SASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGLITPGK  120

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             TTLIEPTSGNMGI +AF+AA+KGY+++LTMPSYTS+ERRVTMR FGA LVLTDP KGMGG
Sbjct  121   TTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPTKGMGG  180

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
             TV+KA +L E+ P+ FMLQQF NPAN ++H+ETTGPEIWEDT G VDIFVMGIGSGGTV+
Sbjct  181   TVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGIGSGGTVT  240

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvs  1006
             GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKP+IL+MD+ME+VL V 
Sbjct  241   GVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPEILNMDIMEKVLEVK  300

Query  1007  seeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVL  1186
              E+AV MARELALKEGL+VGISSGANTVAAL LA KPENKGKLIVTV PS GERYLSS L
Sbjct  301   GEDAVKMARELALKEGLLVGISSGANTVAALELAKKPENKGKLIVTVLPSLGERYLSSAL  360

Query  1187  YQELRAEAEAMQPVPVD  1237
             ++ELRAEAEAMQPVPVD
Sbjct  361   FEELRAEAEAMQPVPVD  377



>ref|XP_009401845.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Musa acuminata subsp. malaccensis]
Length=367

 Score =   489 bits (1260),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 261/327 (80%), Positives = 289/327 (88%), Gaps = 0/327 (0%)
 Frame = +2

Query  257   KDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADA  436
             KD     I KE +QLIGRTP+VYLNKVTEGC A IAAK E +QP+ S+KDRPA+AMI DA
Sbjct  41    KDLSGLRINKEATQLIGRTPMVYLNKVTEGCHAQIAAKLEYLQPSFSVKDRPAVAMIEDA  100

Query  437   EKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLV  616
             EK GLITPGKTTLIEPTSGNMGI ++F+AA+KGYK+VLTMPSYTS+ERRVTMR FGA+LV
Sbjct  101   EKNGLITPGKTTLIEPTSGNMGIGLSFMAALKGYKLVLTMPSYTSLERRVTMRAFGANLV  160

Query  617   LTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFV  796
             LTDP KGMGGTVKKAY L+ES P+ FMLQQF NPAN ++HFETTGPEIW+DT G VDIFV
Sbjct  161   LTDPTKGMGGTVKKAYQLMESYPDAFMLQQFENPANVKVHFETTGPEIWDDTLGQVDIFV  220

Query  797   MgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldm  976
             MGIGSGGTV+GVGQYLKS+NPNVKIYG+EP ESNILNGG+PGPH ITGNGVGFKP ILDM
Sbjct  221   MGIGSGGTVTGVGQYLKSKNPNVKIYGVEPAESNILNGGQPGPHLITGNGVGFKPKILDM  280

Query  977   dvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPS  1156
             DVME+VL V SE+AV MARELA KEGL+VGISSGANTVAAL+LA  PENKGKLIVTV PS
Sbjct  281   DVMEKVLEVKSEDAVKMARELATKEGLLVGISSGANTVAALQLARMPENKGKLIVTVLPS  340

Query  1157  FGERYLSSVLYQELRAEAEAMQPVPVD  1237
              GERYLSS L++ELR EAE MQPVPVD
Sbjct  341   LGERYLSSALFEELRQEAEQMQPVPVD  367



>ref|XP_008801328.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Phoenix dactylifera]
Length=364

 Score =   489 bits (1259),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 260/328 (79%), Positives = 292/328 (89%), Gaps = 0/328 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             PK    + IKK+ SQLIGRTPLVYLNK+ EGC A +AAK E +QP+ S+KDRPA AM+ D
Sbjct  37    PKIGDLSGIKKDASQLIGRTPLVYLNKICEGCEARVAAKLEFLQPSFSVKDRPAYAMLED  96

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AEKKGLITPGKTTLIEPTSGNMGI +A +A +KGYK+VLTMPSYTS+ERRVTMR FGA+L
Sbjct  97    AEKKGLITPGKTTLIEPTSGNMGIGLACMATLKGYKLVLTMPSYTSLERRVTMRAFGANL  156

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGMGGTVKKAY+L++S P+ FMLQQF NPAN ++HFETTGPEIWEDT G VDIF
Sbjct  157   VLTDPAKGMGGTVKKAYELMDSYPDAFMLQQFENPANVKVHFETTGPEIWEDTLGKVDIF  216

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             VMGIGSGGTV+GVG+YLKS NPNVKIYG+EP ESN+LNGGKPGPH ITGNGVGFKP ILD
Sbjct  217   VMGIGSGGTVTGVGRYLKSMNPNVKIYGLEPAESNVLNGGKPGPHLITGNGVGFKPGILD  276

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             MDVMEEVL V+S++AV MARELA+KEGL+VGISSGANTVAALRLA KPENKGKLIVTVHP
Sbjct  277   MDVMEEVLEVTSDDAVKMARELAIKEGLLVGISSGANTVAALRLARKPENKGKLIVTVHP  336

Query  1154  SFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             S GERYLSS L++ELR EAE MQPV V+
Sbjct  337   SLGERYLSSALFEELRQEAEKMQPVAVN  364



>ref|XP_010918745.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
1, mitochondrial [Elaeis guineensis]
Length=366

 Score =   488 bits (1256),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 257/326 (79%), Positives = 288/326 (88%), Gaps = 0/326 (0%)
 Frame = +2

Query  260   DFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAE  439
             D     IKK+ SQLIGRTPLVYLNKV EGC A +AAK E +Q + S+KDRPA AM+ DAE
Sbjct  41    DLSGIKIKKDASQLIGRTPLVYLNKVCEGCEARVAAKLEFLQSSFSVKDRPAYAMLEDAE  100

Query  440   KKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVL  619
             KKGLITPGKTTLIEPTSGNMGI +A +A +KGYK+VLTMPSYTS+ERRVTMR FGA+LVL
Sbjct  101   KKGLITPGKTTLIEPTSGNMGIGLACMATLKGYKLVLTMPSYTSLERRVTMRAFGANLVL  160

Query  620   TDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVM  799
             TDP KGMGGTVKKAY+L++S P+ FMLQQF NPAN ++HFETTGPEIWEDT G VDIFVM
Sbjct  161   TDPTKGMGGTVKKAYELMDSYPDAFMLQQFENPANVKVHFETTGPEIWEDTLGQVDIFVM  220

Query  800   gigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmd  979
             GIGSGGTV+GVG+YLKS NPNVKIYG+EP ESN+LNGGKPGPH ITGNGVGFKP ILDMD
Sbjct  221   GIGSGGTVTGVGRYLKSMNPNVKIYGVEPAESNVLNGGKPGPHLITGNGVGFKPGILDMD  280

Query  980   vmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSF  1159
             VME+VL V+S++AV MARELA+KEGL+VGISSGANTVAAL+LA KPENKGKLIVTVHPS 
Sbjct  281   VMEKVLEVTSDDAVKMARELAIKEGLLVGISSGANTVAALQLARKPENKGKLIVTVHPSL  340

Query  1160  GERYLSSVLYQELRAEAEAMQPVPVD  1237
             GERYLSS L++ELR EAE MQPV VD
Sbjct  341   GERYLSSALFEELRQEAEKMQPVAVD  366



>ref|XP_004138496.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like isoform 
2 [Cucumis sativus]
 ref|XP_004171007.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Cucumis 
sativus]
Length=287

 Score =   479 bits (1232),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 255/287 (89%), Positives = 273/287 (95%), Gaps = 0/287 (0%)
 Frame = +2

Query  377   MMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTM  556
             MMQPT+SIKDRPA AMI DAEKKGLITPGKTTLIEPTSGNMGISMAF+A +KGYKMVLTM
Sbjct  1     MMQPTSSIKDRPAFAMINDAEKKGLITPGKTTLIEPTSGNMGISMAFMATLKGYKMVLTM  60

Query  557   PSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIH  736
             PSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAYDLLESTP+GFMLQQF+NPANTQ+H
Sbjct  61    PSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYDLLESTPDGFMLQQFANPANTQVH  120

Query  737   FETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGK  916
             FETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP ESN+LNGGK
Sbjct  121   FETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSRNPNVKIYGVEPAESNVLNGGK  180

Query  917   PGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAA  1096
             PGPHHITGNGVGFKPDILDMDVM++VL VSS++AVNMARELA+KEGLMVGISSGANTVAA
Sbjct  181   PGPHHITGNGVGFKPDILDMDVMDKVLEVSSDDAVNMARELAVKEGLMVGISSGANTVAA  240

Query  1097  LRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             LRLA  PENKGKLIVTVHPSFGERYLSSVL+QELR EAE MQPV VD
Sbjct  241   LRLAKLPENKGKLIVTVHPSFGERYLSSVLFQELRNEAENMQPVSVD  287



>ref|XP_004975070.1| PREDICTED: l-3-cyanoalanine synthase 2, mitochondrial-like [Setaria 
italica]
Length=376

 Score =   481 bits (1239),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 256/329 (78%), Positives = 290/329 (88%), Gaps = 1/329 (0%)
 Frame = +2

Query  254   PKDFPA-TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIA  430
             P   PA  NI+   SQLIGRTP+VYLNKVTEGCGA IAAK E +QP+ S+KDRPA++M+ 
Sbjct  48    PGVLPAGLNIRDSASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLE  107

Query  431   DAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGAD  610
             DAEKKGLITPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRVTMR FGA+
Sbjct  108   DAEKKGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGAN  167

Query  611   LVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDI  790
             LVLTDP KGMGGTV+KA +L E  P+ +MLQQF NPAN +IH+ETTGPEIWEDT G VDI
Sbjct  168   LVLTDPTKGMGGTVRKATELYEKHPSAYMLQQFQNPANVKIHYETTGPEIWEDTLGQVDI  227

Query  791   FVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIl  970
             FVMGIGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDIL
Sbjct  228   FVMGIGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDIL  287

Query  971   dmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVH  1150
             DMDVME+VL V SE+AV MARELA+KEGL+VGISSGANTVAA+ LA KPENKGKLIVTV 
Sbjct  288   DMDVMEKVLEVKSEDAVKMARELAVKEGLLVGISSGANTVAAIELAKKPENKGKLIVTVL  347

Query  1151  PSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             PS GERYLSS L+ ELR EAEAM+PVPVD
Sbjct  348   PSLGERYLSSALFDELRKEAEAMEPVPVD  376



>gb|ABR17848.1| unknown [Picea sitchensis]
Length=383

 Score =   481 bits (1238),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 248/321 (77%), Positives = 284/321 (88%), Gaps = 0/321 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             N+KK+ SQL+ RTP+VYLNKVTEGCGAY+AAK EMMQP  SIKDR   AMI DAE+KGLI
Sbjct  63    NLKKDVSQLMARTPIVYLNKVTEGCGAYVAAKLEMMQPCCSIKDRVGYAMILDAEEKGLI  122

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +P K+ L+EPTSGNMGIS+A+IAA +GYK+VLTMPSYTS+ERRVTMR FG++LVLTDP K
Sbjct  123   SPEKSVLVEPTSGNMGISLAYIAASRGYKLVLTMPSYTSLERRVTMRAFGSELVLTDPVK  182

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GMGG +KKA DLL++ PN FMLQQF NPAN + HFE+TGPEIWEDT G VDIFVMGIGSG
Sbjct  183   GMGGAIKKAADLLQTIPNAFMLQQFDNPANVKAHFESTGPEIWEDTAGQVDIFVMGIGSG  242

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTVSGVG+YLKS+NPNVKIYG+EP ESN+LNGGKPGPH ITG GVGF P ILD+D+++ V
Sbjct  243   GTVSGVGRYLKSKNPNVKIYGLEPAESNVLNGGKPGPHQITGTGVGFAPKILDLDILDGV  302

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS++A+ MARELA KEGLMVGISSGANTV AL+LA KPENK KLIVTVHPSFGERYL
Sbjct  303   IEVSSDDALKMARELAWKEGLMVGISSGANTVGALQLARKPENKNKLIVTVHPSFGERYL  362

Query  1175  SSVLYQELRAEAEAMQPVPVD  1237
             SSVL+QELR EA+AMQPV VD
Sbjct  363   SSVLFQELREEAQAMQPVSVD  383



>gb|KCW71586.1| hypothetical protein EUGRSUZ_E00118 [Eucalyptus grandis]
 gb|KCW71587.1| hypothetical protein EUGRSUZ_E00118 [Eucalyptus grandis]
Length=287

 Score =   477 bits (1228),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 256/287 (89%), Positives = 275/287 (96%), Gaps = 0/287 (0%)
 Frame = +2

Query  377   MMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTM  556
             MMQPT+SIKDRPA+AMI DAEKK LI+PGKTTLIEPTSGNMGISMAF+AAMKGYKM+LTM
Sbjct  1     MMQPTSSIKDRPALAMINDAEKKNLISPGKTTLIEPTSGNMGISMAFMAAMKGYKMILTM  60

Query  557   PSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIH  736
             PSYTS+ERRVTMR FGA+L+LTDP KGMGGTVKKAYDLLESTPN  MLQQFSNPAN+Q+H
Sbjct  61    PSYTSLERRVTMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAHMLQQFSNPANSQVH  120

Query  737   FETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGK  916
             FETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EPTESN+LNGGK
Sbjct  121   FETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGLEPTESNVLNGGK  180

Query  917   PGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAA  1096
             PGPHHITGNGVGFKPDILDMDVMEEVLMVSSE++VNMAR+LALKEGLMVGISSGANTVAA
Sbjct  181   PGPHHITGNGVGFKPDILDMDVMEEVLMVSSEDSVNMARQLALKEGLMVGISSGANTVAA  240

Query  1097  LRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             LRLA +PENKGKLIVTVHPSFGERYLSSVL+QELR EA+ MQPV VD
Sbjct  241   LRLAQRPENKGKLIVTVHPSFGERYLSSVLFQELRDEAQKMQPVSVD  287



>ref|XP_006653160.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase, 
mitochondrial-like [Oryza brachyantha]
Length=365

 Score =   480 bits (1235),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 288/328 (88%), Gaps = 0/328 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             P   P   I+   SQLIGRTP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ D
Sbjct  38    PGVLPGIRIRDTASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPALSMLED  97

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AE+K LITPGKTTLIEPTSGNMGI +AF+AA+KGY+++LTMPSYTS+ERRVTMR FGA L
Sbjct  98    AERKRLITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKL  157

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDP KGMGGTV+KA +L E+ P+ FMLQQF NPAN ++H+ETTGPEIWEDT G VDIF
Sbjct  158   VLTDPTKGMGGTVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGEVDIF  217

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             VMGIGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILD
Sbjct  218   VMGIGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILD  277

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             MDVME+VL V SE+AV MARELALKEGL+VGISSGANTVAAL LA KPENKGKLIVTV P
Sbjct  278   MDVMEKVLEVKSEDAVKMARELALKEGLLVGISSGANTVAALELAKKPENKGKLIVTVLP  337

Query  1154  SFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             S GERYLSS L++ELR EAEAMQPVPVD
Sbjct  338   SLGERYLSSALFEELRNEAEAMQPVPVD  365



>ref|XP_002447473.1| hypothetical protein SORBIDRAFT_06g001610 [Sorghum bicolor]
 gb|EES11801.1| hypothetical protein SORBIDRAFT_06g001610 [Sorghum bicolor]
Length=386

 Score =   479 bits (1234),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 251/325 (77%), Positives = 286/325 (88%), Gaps = 0/325 (0%)
 Frame = +2

Query  263   FPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEK  442
              P   I+   SQLIGRTP+VYLNKVTEGCGA IAAK E +QP+ S+KDRPA++M+ DAEK
Sbjct  62    LPGLKIRDSASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEK  121

Query  443   KGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  622
             +GLITPGKTTLIEPTSGNMGI +AF+AA+KGY+++LTMPSYTS+ERRVTMR FGA+LVLT
Sbjct  122   RGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGANLVLT  181

Query  623   DPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMg  802
             DP KGMGGTV+KA +L E  P+ +MLQQF NPAN ++H+ETTGPEIWEDT G VDIFVMG
Sbjct  182   DPTKGMGGTVRKAAELYEKHPSAYMLQQFQNPANVKVHYETTGPEIWEDTLGQVDIFVMG  241

Query  803   igsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdv  982
             IGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMDV
Sbjct  242   IGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDV  301

Query  983   meevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFG  1162
             ME+VL V  E+AV MARELALKEGL+VGISSGANTVAAL LA KPENKGKLIVTV PS G
Sbjct  302   MEKVLEVKGEDAVKMARELALKEGLLVGISSGANTVAALELAKKPENKGKLIVTVLPSLG  361

Query  1163  ERYLSSVLYQELRAEAEAMQPVPVD  1237
             ERYLSS L+ ELR EAEAM+PVPVD
Sbjct  362   ERYLSSALFDELRKEAEAMEPVPVD  386



>gb|EAZ29717.1| hypothetical protein OsJ_13780 [Oryza sativa Japonica Group]
Length=386

 Score =   479 bits (1233),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 303/386 (78%), Gaps = 16/386 (4%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPS---IFNTRFFNAGQPLAHSFAQRLR----DLPKDFPATNIKK  286
             M  AL +LM+RRS LQ              G P   +  Q         P   P   I+ 
Sbjct  1     MERALMSLMRRRSLLQSGGRAPPAMAAAAGGSPFFSTLQQAAAADPVQSPGILPGLKIRD  60

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
               SQLIGRTP+VYLNKVTEGCGA IAAK E +QP+ S+KDRPA++M+ DAEKKGLITPGK
Sbjct  61    SASQLIGRTPMVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMLEDAEKKGLITPGK  120

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             TTLIEPTSGNMGI +AF+AA+KGY+++LTMPSYTS+ERRVTMR FGA LVLTDP KGMGG
Sbjct  121   TTLIEPTSGNMGIGLAFMAALKGYELILTMPSYTSLERRVTMRAFGAKLVLTDPTKGMGG  180

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
             TV+KA +L E+ P+ FMLQQF NPAN ++H+ETTGPEIWEDT G VDIFVMGIGSGGTV+
Sbjct  181   TVRKAAELYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMGIGSGGTVT  240

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPG---------PHHITGNGVGFKPDIldmd  979
             GVG+YLK +NPN KIYG+EP E+N+LNGGKP           H ITGNGVGFKP+IL+MD
Sbjct  241   GVGKYLKEKNPNAKIYGVEPAEANVLNGGKPDNEDLSFCSRSHLITGNGVGFKPEILNMD  300

Query  980   vmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSF  1159
             +ME+V+ V  E+AV MARELALKEGL+VGISSGANTVAAL LA KPENKGKLIVTV PS 
Sbjct  301   IMEKVIEVKGEDAVKMARELALKEGLLVGISSGANTVAALELAKKPENKGKLIVTVLPSL  360

Query  1160  GERYLSSVLYQELRAEAEAMQPVPVD  1237
             GERYLSS L++ELRAEAEAMQPVPVD
Sbjct  361   GERYLSSALFEELRAEAEAMQPVPVD  386



>ref|XP_003579777.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
2, mitochondrial [Brachypodium distachyon]
Length=378

 Score =   478 bits (1230),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 249/325 (77%), Positives = 287/325 (88%), Gaps = 0/325 (0%)
 Frame = +2

Query  263   FPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEK  442
              PA  I+   + LIGRTPLVYLNKVTEGCGA IAAK E +QP+ S+KDRPA++M+ DAEK
Sbjct  54    LPALKIRDTAAHLIGRTPLVYLNKVTEGCGARIAAKLEFLQPSFSVKDRPAISMMEDAEK  113

Query  443   KGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  622
             KGLITPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRV MR FGA LVLT
Sbjct  114   KGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMRAFGAQLVLT  173

Query  623   DPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMg  802
             DPAKGMGGTV+KA  L E+ P+ FMLQQF NPAN ++H+ETTGPEIWEDT G VDIFVMG
Sbjct  174   DPAKGMGGTVRKATQLYENHPSAFMLQQFENPANVKVHYETTGPEIWEDTLGQVDIFVMG  233

Query  803   igsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdv  982
             IGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMD+
Sbjct  234   IGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDI  293

Query  983   meevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFG  1162
             ME+VL V  E+AV MA++LALKEGL+VGISSGANTVAA+ LA +PENKGKLIVTVHPS G
Sbjct  294   MEKVLEVKGEDAVKMAQQLALKEGLLVGISSGANTVAAIELAKRPENKGKLIVTVHPSAG  353

Query  1163  ERYLSSVLYQELRAEAEAMQPVPVD  1237
             ERYLS+ L+++LR EAEAMQPVPVD
Sbjct  354   ERYLSAALFEDLRKEAEAMQPVPVD  378



>ref|XP_003623997.1| Cysteine synthase [Medicago truncatula]
 gb|AES80215.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula]
Length=287

 Score =   474 bits (1221),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 255/287 (89%), Positives = 271/287 (94%), Gaps = 0/287 (0%)
 Frame = +2

Query  377   MMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTM  556
             MMQPTASIKDRPA+AM+ DAEKK LITPGKT LIEPTSGNMGIS+AF+AAMKGYKMVLTM
Sbjct  1     MMQPTASIKDRPALAMMEDAEKKNLITPGKTILIEPTSGNMGISLAFMAAMKGYKMVLTM  60

Query  557   PSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIH  736
             PSYTS+ERRV MR FGA+L+LTDP KGMGGTVKKAYDLLESTPN FMLQQFSNPANT++H
Sbjct  61    PSYTSLERRVCMRAFGAELILTDPTKGMGGTVKKAYDLLESTPNAFMLQQFSNPANTKVH  120

Query  737   FETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGK  916
             FETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYG+EP+ESN+LNGGK
Sbjct  121   FETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPSESNVLNGGK  180

Query  917   PGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAA  1096
             PGPH ITGNGVGFKPDILDMDVME+VL VSSE+AVNMAR LALKEGLMVGISSGANTVAA
Sbjct  181   PGPHQITGNGVGFKPDILDMDVMEKVLEVSSEDAVNMARTLALKEGLMVGISSGANTVAA  240

Query  1097  LRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             LRLAS PENKGKLIVTVHPSFGERYLSSVL+Q+LR EAE MQPV VD
Sbjct  241   LRLASLPENKGKLIVTVHPSFGERYLSSVLFQDLRTEAENMQPVSVD  287



>gb|ADG60234.1| beta-cyanoalanine synthase [Triticum aestivum]
Length=378

 Score =   478 bits (1230),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 252/333 (76%), Positives = 291/333 (87%), Gaps = 1/333 (0%)
 Frame = +2

Query  242   LRDLPKDFPAT-NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAM  418
             L+   +D P   NI+   + LIGRTPLVYLNKVTEGCGA +AAK E +QP+ S+KDRPA+
Sbjct  46    LQQQQEDHPGVLNIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAI  105

Query  419   AMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRV  598
             +MI DAEKKGLITPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRV M+ 
Sbjct  106   SMIEDAEKKGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKA  165

Query  599   FGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQG  778
             FGA LVLTDPAKGMGGTV+KA  L E+ P+ FMLQQF NPAN Q+H+ETTGPEIWEDT G
Sbjct  166   FGAQLVLTDPAKGMGGTVRKATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLG  225

Query  779   NVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFK  958
              VDIFVMGIGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFK
Sbjct  226   QVDIFVMGIGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFK  285

Query  959   PDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLI  1138
             PDILDMD+ME+VL V SE+AV MA++LAL+EGL+VGISSGANTVAA+ LA +PENKGKLI
Sbjct  286   PDILDMDIMEKVLEVKSEDAVTMAQQLALQEGLLVGISSGANTVAAIELAKRPENKGKLI  345

Query  1139  VTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             VTVHPS GERYLSS L++ LR EAEAMQPVPVD
Sbjct  346   VTVHPSAGERYLSSALFEGLRKEAEAMQPVPVD  378



>dbj|BAJ98194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   476 bits (1224),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 248/321 (77%), Positives = 285/321 (89%), Gaps = 0/321 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI+   + LIGRTPLVYLNKVTEGCGA +AAK E +QP+ S+KDRPA++MI DAEKKGLI
Sbjct  53    NIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIEDAEKKGLI  112

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRV M+ FGA LVLTDPAK
Sbjct  113   TPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQLVLTDPAK  172

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GMGGTV+KA  L E+ P+ FMLQQF NPAN Q+H+ETTGPEIWEDT G VDIFVMGIGSG
Sbjct  173   GMGGTVRKATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIFVMGIGSG  232

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMD+ME+V
Sbjct  233   GTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDIMEKV  292

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             L V  E+AV MA++LAL+EGL+VGISSGANTVAA+ LA +PENKGKLIVTVHPS GERYL
Sbjct  293   LEVKGEDAVKMAQQLALQEGLLVGISSGANTVAAIELAKRPENKGKLIVTVHPSAGERYL  352

Query  1175  SSVLYQELRAEAEAMQPVPVD  1237
             SS L++ LR EAEAMQPVPVD
Sbjct  353   SSALFEGLRKEAEAMQPVPVD  373



>gb|EMT13011.1| Cysteine synthase, chloroplastic/chromoplastic [Aegilops tauschii]
Length=378

 Score =   476 bits (1224),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 250/328 (76%), Positives = 288/328 (88%), Gaps = 1/328 (0%)
 Frame = +2

Query  257   KDFPAT-NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             +D P   NI+   + LIGRTPLVYLNKVTEGCGA +AAK E +QP+ S+KDRPA++MI D
Sbjct  51    EDHPGVLNIRDTAAHLIGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIED  110

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AEKKGLITPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRV M+ FGA L
Sbjct  111   AEKKGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQL  170

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGMGGTV+KA  L E+ P+ FMLQQF NPAN Q+H+ETTGPEIWEDT G VDIF
Sbjct  171   VLTDPAKGMGGTVRKATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIF  230

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             VMGIGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILD
Sbjct  231   VMGIGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILD  290

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             MD+ME+VL V  E+AV MA++LAL+EGL+VGISSGANTVAA+ LA +PENKGKLIVTVHP
Sbjct  291   MDIMEKVLEVKGEDAVKMAKQLALQEGLLVGISSGANTVAAIELAKRPENKGKLIVTVHP  350

Query  1154  SFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             S GERYLSS L++ LR EAEAMQPVPVD
Sbjct  351   SAGERYLSSALFEGLRKEAEAMQPVPVD  378



>gb|ACG34624.1| cysteine synthase [Zea mays]
Length=382

 Score =   473 bits (1217),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 247/325 (76%), Positives = 285/325 (88%), Gaps = 0/325 (0%)
 Frame = +2

Query  263   FPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEK  442
              P   I+   SQLIGRTP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEK
Sbjct  58    LPGLKIRDSASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMLEDAEK  117

Query  443   KGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  622
             +GLITPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRVTMR FGA+LVLT
Sbjct  118   RGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGANLVLT  177

Query  623   DPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMg  802
             DPAKGMGGTV+KA +L E  P+  MLQQF NPAN ++H++TTGPEIWEDT G VDIFVMG
Sbjct  178   DPAKGMGGTVRKATELYERHPSAHMLQQFQNPANVKVHYDTTGPEIWEDTLGQVDIFVMG  237

Query  803   igsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdv  982
             IGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMDV
Sbjct  238   IGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDV  297

Query  983   meevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFG  1162
             ME+VL V  E+AV MARELA+KEGL+VGISSGANTVAAL LA +PENKGKLIVTV PS G
Sbjct  298   MEKVLEVKGEDAVKMARELAVKEGLLVGISSGANTVAALELAKRPENKGKLIVTVLPSLG  357

Query  1163  ERYLSSVLYQELRAEAEAMQPVPVD  1237
             ERYLSS L+ ELR EA+AM+PV VD
Sbjct  358   ERYLSSALFDELRKEAQAMEPVAVD  382



>ref|XP_008667338.1| PREDICTED: cysteine synthase isoform X1 [Zea mays]
 gb|ACN32017.1| unknown [Zea mays]
 gb|ADG60236.1| beta-cyanoalanine synthase [Zea mays]
 tpg|DAA38628.1| TPA: cysteine synthase [Zea mays]
Length=382

 Score =   472 bits (1215),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 247/325 (76%), Positives = 285/325 (88%), Gaps = 0/325 (0%)
 Frame = +2

Query  263   FPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEK  442
              P   I+   SQLIGRTP+VYLNKVTEGCGA +AAK E +QP+ S+KDRPA++M+ DAEK
Sbjct  58    LPGLKIRDSASQLIGRTPMVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMLEDAEK  117

Query  443   KGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  622
             +GLITPGKTTLIEPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRVTMR FGA+LVLT
Sbjct  118   RGLITPGKTTLIEPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVTMRAFGANLVLT  177

Query  623   DPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMg  802
             DPAKGMGGTV+KA +L E  P+  MLQQF NPAN ++H++TTGPEIWEDT G VDIFVMG
Sbjct  178   DPAKGMGGTVRKATELYERHPSAHMLQQFQNPANVKVHYDTTGPEIWEDTLGQVDIFVMG  237

Query  803   igsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdv  982
             IGSGGTV+GVG+YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMDV
Sbjct  238   IGSGGTVTGVGKYLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDV  297

Query  983   meevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFG  1162
             ME+VL V  E+AV MARELA+KEGL+VGISSGANTVAAL LA +PENKGKLIVTV PS G
Sbjct  298   MEKVLEVKGEDAVKMARELAVKEGLLVGISSGANTVAALELAKRPENKGKLIVTVLPSLG  357

Query  1163  ERYLSSVLYQELRAEAEAMQPVPVD  1237
             ERYLSS L+ ELR EA+AM+PV VD
Sbjct  358   ERYLSSALFDELRKEAQAMEPVAVD  382



>gb|EMS53577.1| Cysteine synthase, chloroplastic/chromoplastic [Triticum urartu]
Length=339

 Score =   470 bits (1209),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  299   LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
             LIGRTPLVYLN+VTEGCGA +AAK E +QP+ S+KDRPA++MI DAEKKGLITPGKTTLI
Sbjct  27    LIGRTPLVYLNRVTEGCGARVAAKLEFLQPSFSVKDRPAISMIEDAEKKGLITPGKTTLI  86

Query  479   EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
             EPTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRV M+ FGA LVLTDPAKGMGGTV+K
Sbjct  87    EPTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQLVLTDPAKGMGGTVRK  146

Query  659   AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
             A  L E+ P+ FMLQQF NPAN Q+H+ETTGPEIWEDT G VDIFVMGIGSGGTV+GVG+
Sbjct  147   ATQLYENHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIFVMGIGSGGTVTGVGK  206

Query  839   YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeA  1018
             YLK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMD+ME+VL V  E+A
Sbjct  207   YLKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDIMEKVLEVKGEDA  266

Query  1019  VNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQEL  1198
             V MA++LAL+EGL+VGISSGANTVAA+ LA +PENKGKLIVTVHPS GERYLSS L++ L
Sbjct  267   VKMAKQLALQEGLLVGISSGANTVAAIELAKRPENKGKLIVTVHPSAGERYLSSALFEGL  326

Query  1199  RAEAEAMQPVPVD  1237
             R EAEAMQPVPVD
Sbjct  327   RKEAEAMQPVPVD  339



>gb|AEA86281.1| chloroplast cysteine synthase [Solanum nigrum]
Length=275

 Score =   463 bits (1192),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 252/275 (92%), Positives = 265/275 (96%), Gaps = 0/275 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NIK + SQLIG+TPLVYLNKV+EGCGAYIA KQEMMQPT+SIKDRPA AMI DAEKKGLI
Sbjct  1     NIKTQVSQLIGKTPLVYLNKVSEGCGAYIAVKQEMMQPTSSIKDRPAFAMINDAEKKGLI  60

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKTTLIEPTSGNMGISMAF+AAMKGYK++LTMPSYTS+ERRVTMR FGADLV+TDP K
Sbjct  61    TPGKTTLIEPTSGNMGISMAFMAAMKGYKIILTMPSYTSLERRVTMRAFGADLVITDPTK  120

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM GTVKKAYDLLESTPN FMLQQFSNPANTQ+HFETTGPEIWEDTQGNVDIFVMGIGSG
Sbjct  121   GMEGTVKKAYDLLESTPNAFMLQQFSNPANTQVHFETTGPEIWEDTQGNVDIFVMGIGSG  180

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTVSGVGQYLKS+NPNVKIYGIEPTESN+LNGGKPGPH ITGNGVGFKPDILDMDVMEEV
Sbjct  181   GTVSGVGQYLKSKNPNVKIYGIEPTESNVLNGGKPGPHQITGNGVGFKPDILDMDVMEEV  240

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAAL  1099
             LMVSSEE+VNMARELALKEGLMVGISSGANTVAAL
Sbjct  241   LMVSSEESVNMARELALKEGLMVGISSGANTVAAL  275



>gb|ADG60235.1| beta-cyanoalanine synthase [Hordeum vulgare]
Length=372

 Score =   464 bits (1194),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 251/372 (67%), Positives = 297/372 (80%), Gaps = 2/372 (1%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSIFNTRFFNAGQPLAHS--FAQRLRDLPKDFPATNIKKETSQL  301
             M   +  LM+ +S L  +        A   +  S  F+   +   +D    NI+   + L
Sbjct  1     MERMVMRLMRNKSLLAGASSRGGGGLASSSIVDSSPFSTLQQQQQEDPGVLNIRDTAAHL  60

Query  302   IGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIE  481
             IGRTPLVYLNKVTEGCGA +AAK E +QP+ S+KDRPA++MI DAEKKGLITPGKTTLIE
Sbjct  61    IGRTPLVYLNKVTEGCGARVAAKLEFLQPSFSVKDRPAISMIEDAEKKGLITPGKTTLIE  120

Query  482   PTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKA  661
             PTSGNMGI +AF+AA+KGY++VLTMPSYTS+ERRV M+ FGA LVLTDP  G  GT +KA
Sbjct  121   PTSGNMGIGLAFMAALKGYELVLTMPSYTSLERRVVMKAFGAQLVLTDPXXGXXGTXRKA  180

Query  662   YDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQY  841
               L ++ P+ FMLQQF NPAN Q+H+ETTGPEIWEDT G VDIFVMGIGSGGTV+GVG+Y
Sbjct  181   TQLYDNHPSAFMLQQFENPANVQVHYETTGPEIWEDTLGQVDIFVMGIGSGGTVTGVGKY  240

Query  842   LKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAV  1021
             LK +NPN KIYG+EP E+N+LNGGKPGPH ITGNGVGFKPDILDMD+ME+VL V  E+AV
Sbjct  241   LKEKNPNAKIYGVEPAEANVLNGGKPGPHLITGNGVGFKPDILDMDIMEKVLEVKGEDAV  300

Query  1022  NMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELR  1201
              MA++LAL+EGL+VGISSGANTVAA+ LA +PENKGKLIVTVHPS GERYLSS L++ LR
Sbjct  301   KMAQQLALQEGLLVGISSGANTVAAIELAKRPENKGKLIVTVHPSAGERYLSSALFEGLR  360

Query  1202  AEAEAMQPVPVD  1237
              EAEAMQPVPVD
Sbjct  361   KEAEAMQPVPVD  372



>ref|XP_008244658.1| PREDICTED: L-3-cyanoalanine synthase 1, mitochondrial isoform 
X2 [Prunus mume]
Length=287

 Score =   460 bits (1183),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 266/287 (93%), Gaps = 0/287 (0%)
 Frame = +2

Query  377   MMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTM  556
             M QPT+SIKDRPA++MI DAEK+GLITPGKT L+EPTSGNMGISMAF+AAM+GYKMVLTM
Sbjct  1     MFQPTSSIKDRPALSMINDAEKRGLITPGKTVLVEPTSGNMGISMAFMAAMRGYKMVLTM  60

Query  557   PSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIH  736
             PSYTS+ERRV MR FGA+L+LTDPA+GMGGTVKKAYDLLESTPN  MLQQFSNPANTQ+H
Sbjct  61    PSYTSLERRVCMRAFGAELILTDPARGMGGTVKKAYDLLESTPNAHMLQQFSNPANTQVH  120

Query  737   FETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGK  916
             FETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKS+NPNV+IYG+EP ESN+LNGGK
Sbjct  121   FETTGPEIWEDTDGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVQIYGVEPAESNVLNGGK  180

Query  917   PGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAA  1096
             PGPH ITGNGVGFKPDILD+DVM+ V+ V S++AV MAR LAL+EGLMVGISSGANTVAA
Sbjct  181   PGPHLITGNGVGFKPDILDLDVMDRVIEVKSDDAVKMARRLALEEGLMVGISSGANTVAA  240

Query  1097  LRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             + LA KPENKGKLIVTVHPSFGERYLSSVL++ELR EAE MQPV VD
Sbjct  241   IELAQKPENKGKLIVTVHPSFGERYLSSVLFEELRKEAENMQPVSVD  287



>gb|ABK23130.1| unknown [Picea sitchensis]
Length=307

 Score =   461 bits (1185),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/307 (79%), Positives = 273/307 (89%), Gaps = 0/307 (0%)
 Frame = +2

Query  317   LVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGN  496
             +VYLNKVTEGCGAY+AAK EMMQP  SIKDR   AMI DAE+KGLI+P K+ L+EPTSGN
Sbjct  1     MVYLNKVTEGCGAYVAAKLEMMQPCCSIKDRVGYAMILDAEEKGLISPEKSVLVEPTSGN  60

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
             MGI++++IAA +GYK+VLTMPSYTS+ERRVTMR FG++LVLTDP KGMGG VKKA DLL+
Sbjct  61    MGIALSYIAASRGYKLVLTMPSYTSLERRVTMRAFGSELVLTDPVKGMGGAVKKAADLLQ  120

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
             STPN FMLQQF NPAN + HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG+YLKS+N
Sbjct  121   STPNAFMLQQFDNPANVKAHFETTGPEIWEDTAGQVDIFVMGIGSGGTVSGVGRYLKSKN  180

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PNVKIYG+EP ESNILNGGKPGPH ITG GVGF P ILD+D+++ V+ VSS++A+ MARE
Sbjct  181   PNVKIYGLEPAESNILNGGKPGPHQITGTGVGFTPKILDLDILDGVIEVSSDDALKMARE  240

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LA KEGLMVGISSGANTVAAL+LA +PENK KLIVTVHPSFGERYLSS+L+QELR EAE 
Sbjct  241   LAWKEGLMVGISSGANTVAALQLARRPENKNKLIVTVHPSFGERYLSSMLFQELRQEAEM  300

Query  1217  MQPVPVD  1237
             MQPV VD
Sbjct  301   MQPVSVD  307



>gb|KDO86225.1| hypothetical protein CISIN_1g021775mg [Citrus sinensis]
Length=307

 Score =   449 bits (1154),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 228/283 (81%), Positives = 249/283 (88%), Gaps = 3/283 (1%)
 Frame = +2

Query  128  MAAALTNLMKRRSFLQPSIFNTRFFNAGQPL---AHSFAQRLRDLPKDFPATNIKKETSQ  298
            MAAAL + +K+R+         R   + QP    + SFAQRLRDLPKD PATNIK++ SQ
Sbjct  1    MAAALRSFLKKRALTCSEPMLMRRLVSSQPAPVDSSSFAQRLRDLPKDLPATNIKRDVSQ  60

Query  299  LIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLI  478
            LIGRTPLV+LNKV+EGCGAYIA KQEM QPTASIKDRPA+AM+ DAE K LI+PGKTT+I
Sbjct  61   LIGRTPLVFLNKVSEGCGAYIAVKQEMFQPTASIKDRPAVAMLEDAENKNLISPGKTTII  120

Query  479  EPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKK  658
            EPTSGNMGISMAF+AAMKGYKMVLTMPSYTS+ERRVTMR FGADL+LTDPAKGMGGTVKK
Sbjct  121  EPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPAKGMGGTVKK  180

Query  659  AYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQ  838
            A +LLESTPN FMLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQ
Sbjct  181  AQELLESTPNAFMLQQFSNPANTRVHFETTGPEIWEDTMGQVDIFVMGIGSGGTVSGVGQ  240

Query  839  YLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDI  967
            YLKSQNPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDI
Sbjct  241  YLKSQNPNVKIYGVEPAESNILNGGKPGPHLITGNGVGFKPDI  283



>ref|XP_006291669.1| hypothetical protein CARUB_v10017827mg [Capsella rubella]
 gb|EOA24567.1| hypothetical protein CARUB_v10017827mg [Capsella rubella]
Length=272

 Score =   433 bits (1114),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/272 (86%), Positives = 253/272 (93%), Gaps = 0/272 (0%)
 Frame = +2

Query  422   MIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVF  601
             MIADAEKK LI PGKTTLIEPTSGNMGIS+AF+AA+KGYK+V+TMPSYTS+ERRVTMR F
Sbjct  1     MIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAALKGYKIVMTMPSYTSLERRVTMRSF  60

Query  602   GADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGN  781
             GA+LVLTDP KGMGGTVKKAYDLLESTP+ FM QQF+NPANTQIH++TTGPEIWEDT GN
Sbjct  61    GAELVLTDPTKGMGGTVKKAYDLLESTPDAFMCQQFANPANTQIHYDTTGPEIWEDTLGN  120

Query  782   VDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKP  961
             VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP
Sbjct  121   VDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKP  180

Query  962   DIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIV  1141
             DILDMDVME VL VSSE+A+ MARELALKEGLMVGISSGANTVAALRLA  PENKGKLIV
Sbjct  181   DILDMDVMESVLEVSSEDAIKMARELALKEGLMVGISSGANTVAALRLAKMPENKGKLIV  240

Query  1142  TVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             T+H SFGERYLSSVL+ ELR EAE M+PV VD
Sbjct  241   TIHASFGERYLSSVLFDELRKEAEEMKPVSVD  272



>ref|XP_010413403.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X3 [Camelina sativa]
 ref|XP_010469078.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial isoform X1 [Camelina sativa]
Length=272

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/272 (86%), Positives = 253/272 (93%), Gaps = 0/272 (0%)
 Frame = +2

Query  422   MIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVF  601
             MIADAEKK LI PGKTTLIEPTSGNMGIS+AF+AA+KGYK+V+TMPSYTS+ERRVTMR F
Sbjct  1     MIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAALKGYKIVMTMPSYTSLERRVTMRSF  60

Query  602   GADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGN  781
             GA+LVLTDP KGMGGTVKKAYDLL+STP+ FM QQF+NPANTQIH++TTGPEIWEDT GN
Sbjct  61    GAELVLTDPTKGMGGTVKKAYDLLDSTPDAFMCQQFANPANTQIHYDTTGPEIWEDTLGN  120

Query  782   VDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKP  961
             VDIFVMGIGSGGTVSGVGQYLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP
Sbjct  121   VDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKP  180

Query  962   DIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIV  1141
             DILDMDVME VL VSSE+A+ MARELALKEGLMVGISSGANTVAALRLA  PENKGKLIV
Sbjct  181   DILDMDVMESVLEVSSEDAIKMARELALKEGLMVGISSGANTVAALRLAKMPENKGKLIV  240

Query  1142  TVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             T+H SFGERYLSSVL+ ELR EAE M+PV VD
Sbjct  241   TIHASFGERYLSSVLFDELRKEAEEMKPVSVD  272



>ref|XP_008343406.1| PREDICTED: LOW QUALITY PROTEIN: L-3-cyanoalanine synthase 2, 
mitochondrial-like, partial [Malus domestica]
Length=292

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 222/284 (78%), Positives = 247/284 (87%), Gaps = 6/284 (2%)
 Frame = +2

Query  134  AALTNLMKRRS--FLQPSIFNTRFFNA--GQPL--AHSFAQRLRDLPKDFPATNIKKETS  295
            AAL + +K+RS           R F+A   QP+  + SFAQR+ +LPKD PAT IK + S
Sbjct  2    AALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIPDSPSFAQRIGNLPKDLPATQIKTQVS  61

Query  296  QLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTL  475
            QLIGRTP+VYLNKVTEGCGA+IA KQEM QPTASIKDRPA++MI DAE+KGLITPG+TTL
Sbjct  62   QLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETTL  121

Query  476  IEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVK  655
            IEPTSGNMGISMAF+AAMKGYKMVLT+PSYTS+ERRV MR FGADL+LTDP KGMGGTVK
Sbjct  122  IEPTSGNMGISMAFMAAMKGYKMVLTLPSYTSLERRVCMRCFGADLILTDPTKGMGGTVK  181

Query  656  KAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvg  835
            KAYDLLESTPN FMLQQFSNPANT++HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVG
Sbjct  182  KAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVG  241

Query  836  QYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDI  967
            QYLKS+NPNV+IYG+EP ESN+LNGGKPGPH ITGNGV FKPDI
Sbjct  242  QYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVXFKPDI  285



>ref|NP_001078324.1| cysteine synthase C1 [Arabidopsis thaliana]
 gb|AEE80204.1| cysteine synthase C1 [Arabidopsis thaliana]
Length=272

 Score =   430 bits (1105),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 232/272 (85%), Positives = 254/272 (93%), Gaps = 0/272 (0%)
 Frame = +2

Query  422   MIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVF  601
             MIADAEKK LI PGKTTLIEPTSGNMGIS+AF+AAMKGY++++TMPSYTS+ERRVTMR F
Sbjct  1     MIADAEKKKLIIPGKTTLIEPTSGNMGISLAFMAAMKGYRIIMTMPSYTSLERRVTMRSF  60

Query  602   GADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGN  781
             GA+LVLTDPAKGMGGTVKKAYDLL+STP+ FM QQF+NPANTQIHF+TTGPEIWEDT GN
Sbjct  61    GAELVLTDPAKGMGGTVKKAYDLLDSTPDAFMCQQFANPANTQIHFDTTGPEIWEDTLGN  120

Query  782   VDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKP  961
             VDIFVMGIGSGGTVSGVG+YLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP
Sbjct  121   VDIFVMGIGSGGTVSGVGRYLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKP  180

Query  962   DIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIV  1141
             +ILDMDVME VL VSSE+A+ MARELALKEGLMVGISSGANTVAA+RLA  PENKGKLIV
Sbjct  181   EILDMDVMESVLEVSSEDAIKMARELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIV  240

Query  1142  TVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             T+H SFGERYLSSVL+ ELR EAE M+PV VD
Sbjct  241   TIHASFGERYLSSVLFDELRKEAEEMKPVSVD  272



>emb|CDY48919.1| BnaA09g39180D [Brassica napus]
Length=315

 Score =   411 bits (1056),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 220/258 (85%), Positives = 242/258 (94%), Gaps = 0/258 (0%)
 Frame = +2

Query  464   KTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMG  643
             +TTLIEPTSGNMGISMAF+AA+KGYK+++TMPSYTS+ERRVTMR FGA+LVLTDP KGMG
Sbjct  58    QTTLIEPTSGNMGISMAFMAALKGYKIIMTMPSYTSLERRVTMRSFGAELVLTDPTKGMG  117

Query  644   GTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtv  823
             GTVKKAYDLLESTP+  MLQQF+NPANTQIH++TTGPEIWEDT GNVDIFVMGIGSGGTV
Sbjct  118   GTVKKAYDLLESTPDAHMLQQFANPANTQIHYDTTGPEIWEDTLGNVDIFVMGIGSGGTV  177

Query  824   sgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmv  1003
             SGVGQYLKS+NPNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKPDILDMDVME VL V
Sbjct  178   SGVGQYLKSKNPNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPDILDMDVMESVLEV  237

Query  1004  sseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSV  1183
             SSE+A+ MARELALKEGLMVGISSGANTVAA++LA  PENKGKLIVT+H SFGERYLSS+
Sbjct  238   SSEDAIKMARELALKEGLMVGISSGANTVAAIKLAKMPENKGKLIVTIHASFGERYLSSI  297

Query  1184  LYQELRAEAEAMQPVPVD  1237
             L+ ELR EAEAM+PV VD
Sbjct  298   LFDELRKEAEAMKPVSVD  315



>ref|XP_002301363.2| hypothetical protein POPTR_0002s16220g [Populus trichocarpa]
 gb|EEE80636.2| hypothetical protein POPTR_0002s16220g [Populus trichocarpa]
Length=276

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/250 (82%), Positives = 224/250 (90%), Gaps = 2/250 (1%)
 Frame = +2

Query  194  RFFNA--GQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAA  367
            R F+A      + SFAQRLRDLPKD P T IK   SQLIG+TPLVYLNKVTEGCGAYIA 
Sbjct  26   RLFSAEAATVASASFAQRLRDLPKDLPGTKIKTRVSQLIGKTPLVYLNKVTEGCGAYIAV  85

Query  368  KQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMV  547
            KQEM QPT+SIKDRPA+AM+ +AEKK LI PGKTTLIEPTSGNMGISMAF+AAMKGYKM+
Sbjct  86   KQEMFQPTSSIKDRPALAMVEEAEKKNLIAPGKTTLIEPTSGNMGISMAFMAAMKGYKMI  145

Query  548  LTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANT  727
            LTMPSYTS+ERRVTMR FGA+L+LTDPAKGMGGTVKKAY+LLESTPN FMLQQFSNPANT
Sbjct  146  LTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELLESTPNAFMLQQFSNPANT  205

Query  728  QIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILN  907
            Q+HFETTGPEIWEDT G VDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYG+EP ESNILN
Sbjct  206  QVHFETTGPEIWEDTVGKVDIFVMGIGSGGTVSGVGQYLKSQNPNVKIYGVEPAESNILN  265

Query  908  GGKPGPHHIT  937
            GGKPG + ++
Sbjct  266  GGKPGMNLVS  275



>ref|XP_010488706.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase 
C1, mitochondrial-like [Camelina sativa]
Length=273

 Score =   405 bits (1041),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 219/273 (80%), Positives = 246/273 (90%), Gaps = 1/273 (0%)
 Frame = +2

Query  422   MIADAEKKGLITPGKTTLIEPTSGNMGIS-MAFIAAMKGYKMVLTMPSYTSIERRVTMRV  598
             MI DAEKK LITPGKT L+EPTSGNMGIS +AF+AAMKGYK+++TMPSYTS+ERRVTMR 
Sbjct  1     MIEDAEKKNLITPGKTILVEPTSGNMGISFLAFMAAMKGYKIIITMPSYTSLERRVTMRS  60

Query  599   FGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQG  778
             FGA+LVLTDP KGMGG VKK+  LLE+TPN FMLQQF+NPANTQ H++TTGPEIWEDT G
Sbjct  61    FGAELVLTDPTKGMGGAVKKSKQLLETTPNAFMLQQFNNPANTQAHYDTTGPEIWEDTHG  120

Query  779   NVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFK  958
             NVDIFVMGIG+GGTV+GVG++LKS+NPNVKIYG+EPTESNILNGGKP PH ITGNGVGFK
Sbjct  121   NVDIFVMGIGTGGTVTGVGKFLKSRNPNVKIYGVEPTESNILNGGKPCPHEITGNGVGFK  180

Query  959   PDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLI  1138
             PDILDM+VM++VL VSSE+AVNMA EL LKEGLMVG   GANTVAA+RLA  PENKGKLI
Sbjct  181   PDILDMNVMDKVLEVSSEDAVNMASELGLKEGLMVGYHGGANTVAAIRLAKMPENKGKLI  240

Query  1139  VTVHPSFGERYLSSVLYQELRAEAEAMQPVPVD  1237
             VT+HPSF ERYLSSVL+ ELR EAE M+PV VD
Sbjct  241   VTIHPSFVERYLSSVLFDELRKEAEEMKPVSVD  273



>ref|XP_001764851.1| predicted protein [Physcomitrella patens]
 gb|EDQ70293.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   402 bits (1032),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 261/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QLIG+TP+VYLN V +GC A IAAK E+M+P  S+KDR   +MI DAE KG I
Sbjct  78    NIADDVTQLIGKTPMVYLNTVVDGCVANIAAKLEIMEPCCSVKDRIGFSMITDAESKGAI  137

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERR+ +R FGA+L+LTDPAK
Sbjct  138   TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRILLRAFGAELILTDPAK  197

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++++ TPN +MLQQF NPAN ++HFETTGPEIWEDT G VDI V GIG+G
Sbjct  198   GMKGAVQKAEEIVKKTPNSYMLQQFENPANPKVHFETTGPEIWEDTAGKVDILVAGIGTG  257

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+G G++LKSQNP VK+ G+EPTES++L+GGKPGPH I G G GF P ILD+++++E+
Sbjct  258   GTVTGAGRFLKSQNPGVKVIGVEPTESSVLSGGKPGPHKIQGIGAGFIPGILDVEILDEI  317

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS +AV MA++LALKEGL+VGISSGA T AA+ +A +PENKGKLI  V PSFGERYL
Sbjct  318   IQISSNDAVEMAKQLALKEGLLVGISSGAATAAAIEVAKRPENKGKLIAVVLPSFGERYL  377

Query  1175  SSVLYQELRAEAEAMQP  1225
             SSVL+Q +R EAEAM+P
Sbjct  378   SSVLFQSIREEAEAMKP  394



>ref|XP_001755364.1| predicted protein [Physcomitrella patens]
 gb|EDQ79844.1| predicted protein [Physcomitrella patens]
Length=348

 Score =   396 bits (1017),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 261/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QLIG+TP+VYLN V EGC A IAAK E+M+P  S+KDR   +MI DAE KG I
Sbjct  30    NIADDVTQLIGKTPMVYLNTVVEGCTANIAAKLEIMEPCCSVKDRIGFSMITDAENKGAI  89

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERR+ ++ FGA+LVLTDPAK
Sbjct  90    TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRILLKAFGAELVLTDPAK  149

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++++ TPN +MLQQF NPAN ++HFETTGPEIWEDT G +DI V GIG+G
Sbjct  150   GMKGAVQKAEEIVKKTPNSYMLQQFENPANPKVHFETTGPEIWEDTAGKIDILVAGIGTG  209

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+G G+YLKS+NPNVKI G+EP+ES++L+GGKPGPH I G G GF P ILD+++++E+
Sbjct  210   GTVTGAGRYLKSKNPNVKIIGVEPSESSVLSGGKPGPHKIQGIGAGFIPGILDVEILDEI  269

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS +AV MA++LALKEGL+VGISSGA T AA+ +A +PEN GKLI  + PSFGERYL
Sbjct  270   IQVSSNDAVEMAKQLALKEGLLVGISSGAATAAAVEVAKRPENAGKLIAVILPSFGERYL  329

Query  1175  SSVLYQELRAEAEAMQP  1225
             SSVL+Q +R EAEAMQP
Sbjct  330   SSVLFQSIREEAEAMQP  346



>ref|XP_010242705.1| PREDICTED: cysteine synthase-like [Nelumbo nucifera]
Length=385

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 262/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MIADAE+KG+I
Sbjct  67    NIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEQKGVI  126

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDP K
Sbjct  127   TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRVLLKAFGAELVLTDPTK  186

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+S PN +MLQQF NPAN +IH+ETTGPEIWEDT G VDIFV GIG+G
Sbjct  187   GMKGAVQKAEEILKSIPNAYMLQQFDNPANPKIHYETTGPEIWEDTSGKVDIFVAGIGTG  246

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP++K+ G+EP ESNIL+GGKPGPH I G G GF P  LD +V++EV
Sbjct  247   GTISGVGRFLKEKNPDIKVIGVEPAESNILSGGKPGPHKIQGIGAGFVPKNLDNEVLDEV  306

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             L +SS+EAV MA++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  307   LEISSDEAVEMAKQLALQEGLLVGISSGAAATAAIKVAKRPENAGKLIAVVFPSFGERYL  366

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  367   SSVLFQSIREECEKMQPEP  385



>ref|XP_008800744.1| PREDICTED: cysteine synthase-like [Phoenix dactylifera]
Length=397

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 263/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             N+ ++ +QLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MIADAE+KGLI
Sbjct  79    NVAEDVTQLIGKTPMVYLNNILKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEEKGLI  138

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  SIERRV ++ FGA+LVLTD AK
Sbjct  139   TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLLKAFGAELVLTDSAK  198

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TPN +MLQQF NPAN ++H+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  199   GMKGAVQKAEEILKNTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFVAGIGTG  258

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG +LKS+NPN+K+ GIEP ESNIL+GGKPGPH I G G GF P  LD +V++E+
Sbjct  259   GTISGVGHFLKSKNPNIKVIGIEPAESNILSGGKPGPHKIQGIGAGFVPRNLDHEVVDEI  318

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  319   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVAKRPENAGKLIAVVFPSFGERYL  378

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  379   SSVLFQSIRDECEKMQPEP  397



>ref|XP_009416025.1| PREDICTED: cysteine synthase-like [Musa acuminata subsp. malaccensis]
Length=397

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/346 (61%), Positives = 272/346 (79%), Gaps = 1/346 (0%)
 Frame = +2

Query  197   FFNAGQPLAHSFAQRLRDLPK-DFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQ  373
             +  +G P      + +   P+ +    NI ++ +QLIG+TP+VYLN + +GC A IAAK 
Sbjct  52    YACSGSPRRDVSCKTVSSKPQTEIEGLNIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKL  111

Query  374   EMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLT  553
             E+M+P  S+KDR   +MIADAE+KG+ITPGK+ L+EPTSGN GI +AFIAA KGYK++LT
Sbjct  112   EIMEPCCSVKDRIGYSMIADAEQKGVITPGKSILVEPTSGNTGIGLAFIAAAKGYKLILT  171

Query  554   MPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQI  733
             MP+  SIERRV ++ FGA+LVLTD AKGM G V+KA ++L+ T N +MLQQF NPAN +I
Sbjct  172   MPASMSIERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILKKTTNAYMLQQFDNPANPKI  231

Query  734   HFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGG  913
             H+ETTGPEIWEDT G VDIFV GIG+GGT+SGVG +LK +NPN+K+ GIEP+ESNIL+GG
Sbjct  232   HYETTGPEIWEDTSGKVDIFVAGIGTGGTISGVGHFLKEKNPNIKVIGIEPSESNILSGG  291

Query  914   KPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVA  1093
             KPGPH I G G GF P  LD++V++E++ +SS+EAV +A++LAL+EGL+VGISSGA   A
Sbjct  292   KPGPHKIQGIGAGFVPRNLDLEVVDEIIEISSDEAVEIAKQLALQEGLLVGISSGAAAAA  351

Query  1094  ALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
             A+++A +PEN GKLIV V PSFGERYLSSVL+Q +R E E MQP P
Sbjct  352   AMKVARRPENAGKLIVVVFPSFGERYLSSVLFQSIRDECEKMQPEP  397



>emb|CAA47329.1| cysteine synthase [Spinacia oleracea]
Length=383

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 260/324 (80%), Gaps = 0/324 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             P      NI ++ SQLIG+TP+VYLN V++G  A IAAK E M+P  S+KDR   +MI D
Sbjct  59    PSTIEGLNIAEDVSQLIGKTPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDD  118

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AE+KG+ITPGKTTL+EPTSGN GI +AFIAA +GYK+ LTMP+  S+ERRV ++ FGA+L
Sbjct  119   AEQKGVITPGKTTLVEPTSGNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAEL  178

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGM G V+KA ++L+ TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF
Sbjct  179   VLTDPAKGMKGAVEKAEEILKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIF  238

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             V GIG+GGT+SGVG+YLK +NP V++ GIEPTESNIL+GGKPGPH I G G GF P  LD
Sbjct  239   VAGIGTGGTISGVGRYLKERNPGVQVIGIEPTESNILSGGKPGPHKIQGLGAGFVPSNLD  298

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             + VM+EV+ VSSEEAV MA++LA+KEGL+VGISSG    AA+R+  +PEN GKLI  V P
Sbjct  299   LGVMDEVIEVSSEEAVEMAKQLAMKEGLLVGISSGRRAAAAVRIGKRPENAGKLIAVVFP  358

Query  1154  SFGERYLSSVLYQELRAEAEAMQP  1225
             SFGERYLSS+L+Q +R E E M+P
Sbjct  359   SFGERYLSSILFQSIREECENMKP  382



>dbj|BAG72098.1| chloroplast cysteine synthase [Spinacia oleracea]
Length=384

 Score =   394 bits (1012),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 260/324 (80%), Gaps = 0/324 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             P      NI ++ SQLIG+TP+VYLN V++G  A IAAK E M+P  S+KDR   +MI D
Sbjct  59    PSTIEGLNIAEDVSQLIGKTPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDD  118

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AE+KG+ITPGKTTL+EPTSGN GI +AFIAA +GYK+ LTMP+  S+ERRV ++ FGA+L
Sbjct  119   AEQKGVITPGKTTLVEPTSGNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAEL  178

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGM G V+KA ++L+ TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF
Sbjct  179   VLTDPAKGMKGAVEKAEEILKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIF  238

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             V GIG+GGT+SGVG+YLK +NP V++ GIEPTESNIL+GGKPGPH I G G GF P  LD
Sbjct  239   VAGIGTGGTISGVGRYLKERNPGVQVIGIEPTESNILSGGKPGPHKIQGLGAGFVPSNLD  298

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             + VM+EV+ VSSEEAV MA++LA+KEGL+VGISSG    AA+R+  +PEN GKLI  V P
Sbjct  299   LGVMDEVIEVSSEEAVEMAKQLAMKEGLLVGISSGRRAAAAVRIGKRPENAGKLIAVVFP  358

Query  1154  SFGERYLSSVLYQELRAEAEAMQP  1225
             SFGERYLSS+L+Q +R E E M+P
Sbjct  359   SFGERYLSSILFQSIREECENMKP  382



>ref|XP_009768645.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Nicotiana 
sylvestris]
Length=387

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 260/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI+DAE+KGLI
Sbjct  69    NIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLI  128

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  129   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  188

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  189   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTG  248

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  249   GTISGAGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  308

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN+GKLI  V PSFGERYL
Sbjct  309   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENEGKLIAVVFPSFGERYL  368

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  369   STILFQSIREECEKMQP  385



>gb|AGT40331.1| O-acetylserine thiol-lyase [Nicotiana attenuata]
Length=387

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 260/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI+DAE+KGLI
Sbjct  69    NIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLI  128

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  129   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  188

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  189   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTG  248

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  249   GTISGAGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  308

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN+GKLI  V PSFGERYL
Sbjct  309   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENEGKLIAVVFPSFGERYL  368

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  369   STILFQSIREECEKMQP  385



>ref|XP_010930274.1| PREDICTED: cysteine synthase [Elaeis guineensis]
Length=397

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 261/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MIADAE+KGLI
Sbjct  79    NIAEDVSQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGNSMIADAEEKGLI  138

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  SIERRV  + FGA+LVLTD AK
Sbjct  139   TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLFKAFGAELVLTDSAK  198

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF+ GIG+G
Sbjct  199   GMKGAVQKAEEILKNTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIAGIGTG  258

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG +LK +NP +K+ GIEP ESNIL+GGKPGPH I G G GF P  LD++V++E+
Sbjct  259   GTISGVGSFLKGKNPKIKVIGIEPAESNILSGGKPGPHKIQGIGAGFVPRNLDLEVVDEI  318

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             L +SS+EAV  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  319   LEISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVAERPENAGKLIAVVFPSFGERYL  378

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  379   SSVLFQSIRDECEKMQPEP  397



>dbj|BAP47504.1| O-acetylserine (thiol)lyase [Gentiana triflora]
Length=393

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 214/355 (60%), Positives = 275/355 (77%), Gaps = 6/355 (2%)
 Frame = +2

Query  179   SIFNTR----FFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEG  346
             S F+++     F+  +  A SF Q+L     D    NI ++ +QLIG+TP+VYLN + +G
Sbjct  41    STFDSKRKGSLFSQRRCQAVSFEQKLPKTAID--GVNIAEDVTQLIGKTPMVYLNSIVKG  98

Query  347   CGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAA  526
               A+IAAK E+M+P  S+KDR   +MI DAE+KGLI+PGK+ L+EPTSGN GI +AFIAA
Sbjct  99    SLAHIAAKLEIMEPCCSVKDRIGYSMITDAEQKGLISPGKSVLVEPTSGNTGIGLAFIAA  158

Query  527   MKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQ  706
              KGYK++LTMP+  S+ERRV ++ FGADLVLTDPAKGM G V+KA ++L STPN +MLQQ
Sbjct  159   SKGYKLILTMPASMSLERRVLLKAFGADLVLTDPAKGMKGAVQKAEEILNSTPNAYMLQQ  218

Query  707   FSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEP  886
             F NPAN ++H+ETTGPEIWEDT G VDI V GIG+GGT+SGVG++LK +NP +K+ G+EP
Sbjct  219   FDNPANPKVHYETTGPEIWEDTSGTVDILVAGIGTGGTISGVGRFLKERNPGIKVIGVEP  278

Query  887   TESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVG  1066
             TESN+L+GGKPGPH I G G GF P  LD DVM+EV+ +SS+EAV MA+++AL+EGL+VG
Sbjct  279   TESNVLSGGKPGPHKIQGIGAGFIPRNLDQDVMDEVIQISSDEAVEMAKQVALQEGLLVG  338

Query  1067  ISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
             ISSGA   AAL++  +PEN GKLI  V PSFGERYLS+VL+Q +R E E M PVP
Sbjct  339   ISSGAAAAAALKVGKRPENAGKLIAVVFPSFGERYLSTVLFQSIREECEKMVPVP  393



>ref|XP_006492781.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Citrus sinensis]
Length=391

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 209/319 (66%), Positives = 261/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MIADAE+KGLI
Sbjct  73    NIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLI  132

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  133   TPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAK  192

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF+ GIG+G
Sbjct  193   GMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTG  252

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G+YLK +NPN+K+ GIEP+ESNIL+GGKPGPH I G G GF P  LD  V++EV
Sbjct  253   GTISGAGRYLKEKNPNIKVIGIEPSESNILSGGKPGPHKIQGIGAGFVPRNLDEGVLDEV  312

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS+EAV +A++LAL+EGL+VGISSGA   AA+ +  +PEN GKLI  V PSFGERYL
Sbjct  313   IEVSSDEAVEIAKQLALQEGLLVGISSGAAAAAAMEVGKRPENAGKLIAVVFPSFGERYL  372

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQPVP
Sbjct  373   SSVLFQSIREECENMQPVP  391



>ref|NP_001190152.1| cysteine synthase C1 [Arabidopsis thaliana]
 gb|AEE80205.1| cysteine synthase C1 [Arabidopsis thaliana]
Length=247

 Score =   386 bits (992),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 209/247 (85%), Positives = 231/247 (94%), Gaps = 0/247 (0%)
 Frame = +2

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
             MGIS+AF+AAMKGY++++TMPSYTS+ERRVTMR FGA+LVLTDPAKGMGGTVKKAYDLL+
Sbjct  1     MGISLAFMAAMKGYRIIMTMPSYTSLERRVTMRSFGAELVLTDPAKGMGGTVKKAYDLLD  60

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
             STP+ FM QQF+NPANTQIHF+TTGPEIWEDT GNVDIFVMGIGSGGTVSGVG+YLKS+N
Sbjct  61    STPDAFMCQQFANPANTQIHFDTTGPEIWEDTLGNVDIFVMGIGSGGTVSGVGRYLKSKN  120

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PNVKIYG+EP ESNILNGGKPGPH ITGNGVGFKP+ILDMDVME VL VSSE+A+ MARE
Sbjct  121   PNVKIYGVEPAESNILNGGKPGPHAITGNGVGFKPEILDMDVMESVLEVSSEDAIKMARE  180

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LALKEGLMVGISSGANTVAA+RLA  PENKGKLIVT+H SFGERYLSSVL+ ELR EAE 
Sbjct  181   LALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDELRKEAEE  240

Query  1217  MQPVPVD  1237
             M+PV VD
Sbjct  241   MKPVSVD  247



>ref|XP_006442164.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
 gb|ESR55404.1| hypothetical protein CICLE_v10020519mg [Citrus clementina]
Length=391

 Score =   391 bits (1005),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 261/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MIADAE+KGLI
Sbjct  73    NIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLI  132

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  133   TPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAK  192

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF+ GIG+G
Sbjct  193   GMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTG  252

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G+YLK +NPN+K+ G+EP+ESNIL+GGKPGPH I G G GF P  LD  V++EV
Sbjct  253   GTISGAGRYLKEKNPNIKVIGVEPSESNILSGGKPGPHKIQGIGAGFVPRNLDEGVLDEV  312

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS+EAV +A++LAL+EGL+VGISSGA   AA+ +  +PEN GKLI  V PSFGERYL
Sbjct  313   IEVSSDEAVEIAKQLALQEGLLVGISSGAAAAAAMEVGKRPENAGKLIAVVFPSFGERYL  372

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQPVP
Sbjct  373   SSVLFQSIREECENMQPVP  391



>emb|CAJ32461.1| putative chloroplast cysteine synthase 1 precursor [Nicotiana 
tabacum]
Length=364

 Score =   390 bits (1002),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 201/327 (61%), Positives = 262/327 (80%), Gaps = 0/327 (0%)
 Frame = +2

Query  245   RDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAM  424
             ++ P      NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M
Sbjct  36    QNQPLKVEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSM  95

Query  425   IADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFG  604
             I+DAE+KGLI+PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FG
Sbjct  96    ISDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFG  155

Query  605   ADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNV  784
             A+LVLTDPAKGM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPE+WEDT+G +
Sbjct  156   AELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEMWEDTKGKI  215

Query  785   DIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPD  964
             DI V GIG+GGT+SG G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P 
Sbjct  216   DILVAGIGTGGTISGAGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPG  275

Query  965   IldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVT  1144
              LD DVM+EV+ +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  
Sbjct  276   NLDQDVMDEVIEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIAV  335

Query  1145  VHPSFGERYLSSVLYQELRAEAEAMQP  1225
             V PSFGERYLS++L+Q +R E E MQP
Sbjct  336   VFPSFGERYLSTILFQSIREECEKMQP  362



>ref|XP_009401140.1| PREDICTED: cysteine synthase-like [Musa acuminata subsp. malaccensis]
Length=384

 Score =   391 bits (1004),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 263/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MIADAE++G+I
Sbjct  66    NIAEDVSQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMIADAEQRGVI  125

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPG++ L+EPTSGN GI +AFIAA KGYK++LTMP+  SIERRV ++ FGA+LVLTD AK
Sbjct  126   TPGESILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSIERRVLLKAFGAELVLTDSAK  185

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L +TPN +MLQQF NPAN +IH+E+TGPEIWEDT+G VDIFV G+G+G
Sbjct  186   GMKGAVQKAEEILNNTPNAYMLQQFDNPANPKIHYESTGPEIWEDTRGKVDIFVAGVGTG  245

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG +LK +NPN+K+ GIEP+ESNIL+GGKPGPH I G G GF P  LD++V++E+
Sbjct  246   GTISGVGCFLKEKNPNIKVIGIEPSESNILSGGKPGPHKIQGIGAGFVPRNLDLEVVDEI  305

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             L +SS+EAV  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  306   LEISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVARRPENAGKLIAVVFPSFGERYL  365

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  366   SSVLFQSIRDECEKMQPEP  384



>ref|XP_010672447.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Beta 
vulgaris subsp. vulgaris]
Length=385

 Score =   391 bits (1004),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 209/318 (66%), Positives = 259/318 (81%), Gaps = 0/318 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ SQLIG+TPLVYLN V  G  A IAAK E M+P  S+KDR   +M+ DAE+KG I
Sbjct  68    NIAEDVSQLIGKTPLVYLNNVVNGSVASIAAKLESMEPCCSVKDRIGYSMVDDAEQKGAI  127

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKTTL+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+L+LTDPAK
Sbjct  128   TPGKTTLVEPTSGNTGIGLAFIAAARGYKLILTMPASMSMERRVILKAFGAELILTDPAK  187

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+ A ++L  TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  188   GMKGAVEIAEEILRKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  247

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+YLK +NP+VK+ GIEPTESNIL+GGKPGPH I G G GF P  LD+ V++EV
Sbjct  248   GTISGVGRYLKERNPDVKVIGIEPTESNILSGGKPGPHKIQGLGAGFVPRNLDLGVVDEV  307

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS+E+V MA++LA+KEGL+VGISSGA   AA+++  +PEN GKLIV V PSFGERYL
Sbjct  308   IEVSSDESVEMAKQLAMKEGLLVGISSGAAAAAAVKIGKRPENAGKLIVVVFPSFGERYL  367

Query  1175  SSVLYQELRAEAEAMQPV  1228
             SSVL+Q +R E E M+PV
Sbjct  368   SSVLFQSIREECENMKPV  385



>ref|XP_009592252.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Nicotiana 
tomentosiformis]
Length=387

 Score =   391 bits (1004),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 259/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI+DAE+KGLI
Sbjct  69    NIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLI  128

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  129   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  188

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPE+WEDT+G +DI V GIG+G
Sbjct  189   GMKGAVSKAEEILHNTPDAYILQQFDNPANPKIHYETTGPEMWEDTKGKIDILVAGIGTG  248

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  249   GTISGAGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  308

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  V PSFGERYL
Sbjct  309   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIAVVFPSFGERYL  368

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  369   STILFQSIREECEKMQP  385



>gb|AHL84159.1| cysteine synthase [Nicotiana tabacum]
Length=387

 Score =   390 bits (1003),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 259/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI+DAE+KGLI
Sbjct  69    NIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLI  128

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  129   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  188

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPE+WEDT+G +DI V GIG+G
Sbjct  189   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEMWEDTKGKIDILVAGIGTG  248

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  249   GTISGAGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  308

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  V PSFGERYL
Sbjct  309   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIAVVFPSFGERYL  368

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  369   STILFQSIREECEKMQP  385



>gb|AAX07221.1| chloroplast cysteine synthase GCS2 [Allium sativum]
Length=383

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 214/383 (56%), Positives = 284/383 (74%), Gaps = 15/383 (4%)
 Frame = +2

Query  128   MAAALTNLMKRRSF---LQPSIFNTRFFNAGQ--------PLAHS---FAQRLRDLPK-D  262
             MAA    L+ R +    ++P   ++ FF+  Q        P A S     + +   P  +
Sbjct  1     MAALSQALLPRFTLSQSIKPKSRSSAFFSCNQYSTAIKITPCASSSRILCKAVSIKPDTE  60

Query  263   FPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEK  442
                 NI ++ +QLIG+TP+VYLN + +GC A +AAK E M+P +S+KDR   +MI+DAE+
Sbjct  61    IEGLNIAEDVTQLIGKTPMVYLNSIAKGCVANVAAKLESMEPCSSVKDRIGYSMISDAEQ  120

Query  443   KGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLT  622
             KGLITPGK+ L+EPTSGN GI++AF+AA KGYK++LTMP+  S+ERRV  + FGA+LVLT
Sbjct  121   KGLITPGKSVLVEPTSGNTGIALAFVAASKGYKLILTMPASMSMERRVLFKAFGAELVLT  180

Query  623   DPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMg  802
             D AKGM G ++KA D+++ TPNG+MLQQF NPAN +IHFETTGPEIWEDT G +DIF+ G
Sbjct  181   DAAKGMKGAIQKAEDIVKKTPNGYMLQQFDNPANPKIHFETTGPEIWEDTNGKIDIFIAG  240

Query  803   igsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdv  982
             IG+GGT++GVG++LKS+NP +K+ GI PTESN+L+GGKPGPH I G G GF P ILD  V
Sbjct  241   IGTGGTITGVGRFLKSKNPRIKVIGIGPTESNVLSGGKPGPHKIQGIGAGFIPSILDSKV  300

Query  983   meevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFG  1162
             ++E+L VSSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFG
Sbjct  301   IDEILEVSSEEAIETAKQLALQEGLLVGISSGAAAAAAMKVAKRPENAGKLITVVFPSFG  360

Query  1163  ERYLSSVLYQELRAEAEAMQPVP  1231
             ERYLS+ L+Q +R E E M+P P
Sbjct  361   ERYLSTALFQSIREECEKMEPEP  383



>sp|P32260.2|CYSKP_SPIOL RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=CSase B; Short=CS-B; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL B; Flags: Precursor [Spinacia oleracea]
Length=383

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 211/324 (65%), Positives = 261/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             P      NI ++ SQLIG+TP+VYLN V++G  A IAAK E M+P  S+KDR   +MI D
Sbjct  59    PSTIEGLNIAEDVSQLIGKTPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDD  118

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AE+KG+ITPGKTTL+EPTSGN GI +AFIAA +GYK+ LTMP+  S+ERRV ++ FGA+L
Sbjct  119   AEQKGVITPGKTTLVEPTSGNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAEL  178

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGM G V+KA ++L+ TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF
Sbjct  179   VLTDPAKGMKGAVEKAEEILKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIF  238

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             V GIG+GGT+SGVG+YLK +NP V++ GIEPTESNIL+GGKPGPH I G G GF P  LD
Sbjct  239   VAGIGTGGTISGVGRYLKERNPGVQVIGIEPTESNILSGGKPGPHKIQGLGAGFVPSNLD  298

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             + VM+EV+ VSSEEAV MA++LA+KEGL+VGISSGA   AA+R+  +PEN GKLI  V P
Sbjct  299   LGVMDEVIEVSSEEAVEMAKQLAMKEGLLVGISSGAAAAAAVRIGKRPENAGKLIAVVFP  358

Query  1154  SFGERYLSSVLYQELRAEAEAMQP  1225
             SFGERYLSS+L+Q +R E E M+P
Sbjct  359   SFGERYLSSILFQSIREECENMKP  382



>gb|AIL49301.1| cysteine synthase isoform 1 [Capsicum annuum]
Length=384

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/324 (63%), Positives = 262/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             P +    NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI+D
Sbjct  59    PTEIEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISD  118

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AE+KGLI+PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+L
Sbjct  119   AEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAEL  178

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI 
Sbjct  179   VLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDIL  238

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             V GIG+GGT+SG G+YLK +NPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD
Sbjct  239   VAGIGTGGTISGTGRYLKEKNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLD  298

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
              DVM+EV+ +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++A +PEN GKLI  V P
Sbjct  299   QDVMDEVIEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVAKRPENAGKLIAVVFP  358

Query  1154  SFGERYLSSVLYQELRAEAEAMQP  1225
             SFGERYLSS+L+Q +R E E M+P
Sbjct  359   SFGERYLSSILFQSIREECEKMKP  382



>dbj|BAA03542.1| cysteine synthase [Spinacia oleracea]
Length=383

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 211/324 (65%), Positives = 261/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  254   PKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIAD  433
             P      NI ++ SQLIG+TP+VYLN V++G  A IAAK E M+P  S+KDR   +MI D
Sbjct  59    PSTIEGLNIAEDVSQLIGKTPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDD  118

Query  434   AEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADL  613
             AE+KG+ITPGKTTL+EPTSGN GI +AFIAA +GYK+ LTMP+  S+ERRV ++ FGA+L
Sbjct  119   AEQKGVITPGKTTLVEPTSGNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAEL  178

Query  614   VLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIF  793
             VLTDPAKGM G V+KA ++L+ TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF
Sbjct  179   VLTDPAKGMKGAVEKAEEILKKTPDSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIF  238

Query  794   VMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIld  973
             V GIG+GGT+SGVG+YLK +NP V++ GIEPTESNIL+GGKPGPH I G G GF P  LD
Sbjct  239   VAGIGTGGTISGVGRYLKERNPGVQVIGIEPTESNILSGGKPGPHKIQGLGAGFVPSNLD  298

Query  974   mdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHP  1153
             + VM+EV+ VSSEEAV MA++LA+KEGL+VGISSGA   AA+R+  +PEN GKLI  V P
Sbjct  299   LGVMDEVIEVSSEEAVEMAKQLAMKEGLLVGISSGAAAAAAVRIGKRPENAGKLIAVVFP  358

Query  1154  SFGERYLSSVLYQELRAEAEAMQP  1225
             SFGERYLSS+L+Q +R E E M+P
Sbjct  359   SFGERYLSSILFQSIREECENMKP  382



>ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Vitis 
vinifera]
 emb|CBI24697.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 262/324 (81%), Gaps = 0/324 (0%)
 Frame = +2

Query  260   DFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAE  439
             D    NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MIADAE
Sbjct  59    DVEGLNIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAE  118

Query  440   KKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVL  619
             ++G ITPGK+TL+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVL
Sbjct  119   QRGAITPGKSTLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVL  178

Query  620   TDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVM  799
             TDPAKGM G V+KA ++L+STPN +MLQQF NPAN ++H++TTGPEIWEDT+G VDIF+ 
Sbjct  179   TDPAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYQTTGPEIWEDTRGKVDIFIA  238

Query  800   gigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmd  979
             GIG+GGT+SGVG++LK QNPN+K+ G+EP ESNIL+GGKPGPH I G G GF P  LD D
Sbjct  239   GIGTGGTISGVGKFLKKQNPNIKVIGVEPLESNILSGGKPGPHKIQGIGAGFVPSNLDQD  298

Query  980   vmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSF  1159
             V++EV+ +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSF
Sbjct  299   VVDEVIEISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVGKRPENAGKLIAVVFPSF  358

Query  1160  GERYLSSVLYQELRAEAEAMQPVP  1231
             GERYLS+ L+Q +R E E MQP P
Sbjct  359   GERYLSTALFQTIRDECEKMQPEP  382



>sp|O81155.1|CYSKP_SOLTU RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=CSase B; Short=CS-B; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL B; Flags: Precursor [Solanum tuberosum]
 gb|AAC25636.1| cysteine synthase [Solanum tuberosum]
Length=386

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  68    NIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLI  127

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  128   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAK  187

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  188   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTG  247

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  248   GTITGTGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  307

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  AR LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  V PS+GERYL
Sbjct  308   IEISSDEAVETARTLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIGVVFPSYGERYL  367

Query  1175  SSVLYQELRAEAEAMQP  1225
             SS+L+Q +R E E M+P
Sbjct  368   SSILFQSIREECEKMKP  384



>ref|XP_002974389.1| hypothetical protein SELMODRAFT_232271 [Selaginella moellendorffii]
 ref|XP_002985686.1| hypothetical protein SELMODRAFT_234827 [Selaginella moellendorffii]
 gb|EFJ13264.1| hypothetical protein SELMODRAFT_234827 [Selaginella moellendorffii]
 gb|EFJ24611.1| hypothetical protein SELMODRAFT_232271 [Selaginella moellendorffii]
Length=305

 Score =   385 bits (990),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 250/303 (83%), Gaps = 0/303 (0%)
 Frame = +2

Query  317   LVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGN  496
             +VYLN V +GC A IAAK E+M+P  S+KDR   +MI+DAE+KG ITPGK+ L+EPTSGN
Sbjct  1     MVYLNSVVDGCVANIAAKLEIMEPCCSVKDRIGYSMISDAEEKGAITPGKSVLVEPTSGN  60

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
              GI +AFIAA K YK++LTMP+  S+ERR+ ++ FGA+LVLTDPAKGM G V+KA ++L+
Sbjct  61    TGIGLAFIAAAKNYKLILTMPASMSLERRILLKAFGAELVLTDPAKGMKGAVQKAEEILK  120

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
              TPN +MLQQF NPAN ++HFETTGPEIWEDT+G VDI V GIG+GGTV+G G++LK +N
Sbjct  121   KTPNSYMLQQFENPANPKVHFETTGPEIWEDTRGKVDILVAGIGTGGTVTGAGRFLKKKN  180

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PN+KIYG+EPTESN+L+GGKPGPH I G G GF P ILD+++++EV+ VSS ++V MA++
Sbjct  181   PNIKIYGVEPTESNVLSGGKPGPHKIQGIGAGFIPSILDVEILDEVIQVSSNDSVEMAKQ  240

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LALKEGL+VGISSGA   AA+++A +PEN  KLI  V PSFGERYLSSVL+Q +R E+E 
Sbjct  241   LALKEGLLVGISSGAAVCAAIQVAKRPENANKLICVVLPSFGERYLSSVLFQSIREESEK  300

Query  1217  MQP  1225
             MQP
Sbjct  301   MQP  303



>dbj|BAB20862.1| plastidic cysteine synthase 1 [Solanum tuberosum]
Length=386

 Score =   389 bits (998),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  68    NIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLI  127

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  128   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAK  187

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  188   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTG  247

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  248   GTITGTGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  307

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  V PS+GERYL
Sbjct  308   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIGVVFPSYGERYL  367

Query  1175  SSVLYQELRAEAEAMQP  1225
             SS+L+Q +R E E M+P
Sbjct  368   SSILFQSIREECEKMKP  384



>ref|XP_004244764.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Solanum 
lycopersicum]
Length=386

 Score =   388 bits (997),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  68    NIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLI  127

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  128   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAK  187

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  188   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTG  247

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  248   GTITGTGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  307

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  V PS+GERYL
Sbjct  308   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIGVVFPSYGERYL  367

Query  1175  SSVLYQELRAEAEAMQP  1225
             SS+L+Q +R E E M+P
Sbjct  368   SSILFQSIREECENMKP  384



>ref|XP_010526597.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Tarenaya hassleriana]
Length=402

 Score =   389 bits (998),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 259/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ SQLIGRTP+VYLN + +GC A +A K E+M+P  S+KDR   +M+ DAE+KGLI
Sbjct  84    NIAEDVSQLIGRTPMVYLNNIVKGCVANVAVKLEIMEPCCSVKDRIGYSMVTDAEQKGLI  143

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI++AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  144   TPGKSVLVEPTSGNTGIALAFIAAAKGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  203

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM   ++KA  +L+STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  204   GMTAAIQKAEQILKSTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFVAGIGTG  263

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+Y+K + P VK+ GIEPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  264   GTISGVGRYIKERKPGVKVIGIEPTESDILSGGKPGPHKIQGIGAGFVPKNLDQGIMDEV  323

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A+++AL+EGL+VGISSGA   AA+++A +PEN GKLIV V PSFGERYL
Sbjct  324   ITISSEEAIETAKQVALQEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVVFPSFGERYL  383

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S+ L+Q +R E E MQP P
Sbjct  384   STPLFQSIREECEKMQPEP  402



>ref|XP_009138900.1| PREDICTED: cysteine synthase, mitochondrial [Brassica rapa]
Length=422

 Score =   389 bits (999),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 212/364 (58%), Positives = 274/364 (75%), Gaps = 14/364 (4%)
 Frame = +2

Query  176   PSIFNTRFFNAGQPLAHSFAQRLR---DLPKDFPATNIKKE-----------TSQLIGRT  313
             P I +  F  +G PLA    Q+ R   D+ K  P   +K+E            SQLIG+T
Sbjct  57    PEISSLSFSASGFPLAMKSQQQSRSYGDVSKRDPCEAVKRENGADGLNIAENVSQLIGKT  116

Query  314   PLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSG  493
             P+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I+PGK+ L+EPTSG
Sbjct  117   PMVYLNSMAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVEPTSG  176

Query  494   NMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLL  673
             N GI +AFIAA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDPAKGM G V+KA ++L
Sbjct  177   NTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDPAKGMTGAVQKAEEIL  236

Query  674   ESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQ  853
             +STP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+GGT++GVG+++K +
Sbjct  237   KSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTGGTITGVGRFIKEK  296

Query  854   NPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMAR  1033
             NP V++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV+ +SSEEA+  A+
Sbjct  297   NPKVQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDRAIMDEVIAISSEEAIETAK  356

Query  1034  ELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAE  1213
             +LALKEGLMVGISSGA   AA+ +A +PEN GKLI  V PSFGERYLS+ L+Q +R E E
Sbjct  357   QLALKEGLMVGISSGAAAAAAIMVAKRPENAGKLIAVVFPSFGERYLSTPLFQSIREEVE  416

Query  1214  AMQP  1225
              MQP
Sbjct  417   KMQP  420



>ref|XP_009394263.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis]
 ref|XP_009394264.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis]
Length=325

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 256/314 (82%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIGRTPLVYLNKV  GCGA IAAK EMM+P +S+KDR   +MIADAE+KGLIT
Sbjct  8     IAKDVTELIGRTPLVYLNKVVNGCGARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIT  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PGK+ LIEPTSGN GI +AF+AA KGYK+VLTMP+  SIERR+ ++ FGA+LVLTDP  G
Sbjct  68    PGKSVLIEPTSGNTGIGLAFMAAAKGYKLVLTMPASMSIERRIILKAFGAELVLTDPVLG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA +L   TPN ++LQQF NP+N +IH+ETTGPEIW+ T G VDI V GIG+GG
Sbjct  128   MKGAVEKAEELAAKTPNSYILQQFENPSNPKIHYETTGPEIWKGTAGRVDILVSGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G++LK QNPN+K+YG+EP ES +L+GG+PG H I G G GF P +LD+++++EV+
Sbjct  188   TITGTGRFLKEQNPNIKLYGVEPAESAVLSGGRPGAHKIQGIGAGFIPGVLDVNLVDEVI  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              +SS E++ MA+ LALKEGL+VGISSGA   AA+R+A +PEN+GKLIV V PSFGERYLS
Sbjct  248   QISSNESIEMAKLLALKEGLLVGISSGAAAAAAIRVAQRPENEGKLIVVVFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVLYQ ++ EAE M
Sbjct  308   SVLYQSIKKEAENM  321



>ref|XP_006351051.1| PREDICTED: cysteine synthase isoform X1 [Solanum tuberosum]
Length=386

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  68    NIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLI  127

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDP K
Sbjct  128   SPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPVK  187

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L +TP+ ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  188   GMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTG  247

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G++LK QNPN+KI G+EPTESN+L+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  248   GTITGTGRFLKEQNPNIKIIGVEPTESNVLSGGKPGPHKIQGIGAGFIPGNLDQDVMDEV  307

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA  +AA+++  +PEN GKLI  V PS+GERYL
Sbjct  308   IEISSDEAVETAKQLALQEGLLVGISSGAAALAAIQVGKRPENAGKLIGVVFPSYGERYL  367

Query  1175  SSVLYQELRAEAEAMQP  1225
             SS+L+Q +R E E M+P
Sbjct  368   SSILFQSIREECEKMKP  384



>gb|ABK23255.1| unknown [Picea sitchensis]
 gb|ACN40960.1| unknown [Picea sitchensis]
Length=325

 Score =   384 bits (986),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 261/315 (83%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI K+ + LIG+TP+VYLNKV +GC A IAAK E+M+P  S+KDR   +MI+DAE+KGLI
Sbjct  7     NIAKDVTDLIGKTPMVYLNKVADGCVAKIAAKLEIMEPCCSVKDRIGYSMISDAEEKGLI  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ L+EPTSGN GI +AFIAA KGYK++LTMPS  SIERRV +R FGA+L+LTDPA+
Sbjct  67    IPGRSILVEPTSGNTGIGLAFIAAAKGYKLILTMPSSMSIERRVLLRAFGAELILTDPAR  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA +++E TPN +MLQQF NP+N +IH+E+TGPEIW+DT G +D FV GIG+G
Sbjct  127   GMKGAVQKAEEIVEKTPNAYMLQQFENPSNPKIHYESTGPEIWQDTAGQIDAFVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+GVG+YLK + P V+IYG+EP ES +++GGKPGPH I G G GF P  LD+++++EV
Sbjct  187   GTVTGVGRYLKEKKPEVQIYGVEPVESAVISGGKPGPHKIQGIGAGFIPGNLDVNILDEV  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+E+V+MA++LALKEGL+VGISSGA T AA+R+A +PEN GKLIV + PSFGERYL
Sbjct  247   IQISSDESVDMAKQLALKEGLLVGISSGAATAAAIRVAKRPENAGKLIVVILPSFGERYL  306

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL+Q ++ EAE M
Sbjct  307   SSVLFQSIKLEAENM  321



>gb|ABK23421.1| unknown [Picea sitchensis]
Length=401

 Score =   387 bits (993),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN V +GC A IAAK E+M+P  S+KDR   +MI DAE KG I
Sbjct  83    NIAEDVTQLIGKTPMVYLNNVVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEAKGAI  142

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+ AK
Sbjct  143   TPGKSILVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSLERRVLLRAFGAELVLTEAAK  202

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L  TPN +MLQQF NPAN ++H+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  203   GMKGAVQKAEEILNKTPNAYMLQQFDNPANPKVHYETTGPEIWEDTEGKVDIFVAGIGTG  262

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+GVG+YLK +NPN+KI G+EPTESNIL+GGKPGPH I G G GF P  LD+D+++EV
Sbjct  263   GTVTGVGRYLKGKNPNIKIIGVEPTESNILSGGKPGPHKIQGIGAGFIPRNLDVDILDEV  322

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV MA++LAL+EGLMVGISSGA   AA+ +A +  N GKLI  V PSFGERYL
Sbjct  323   IQISSDEAVEMAKQLALQEGLMVGISSGAAAAAAIEVAKRSGNSGKLIAVVFPSFGERYL  382

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+VL+Q +R E E MQP
Sbjct  383   STVLFQSIREECEKMQP  399



>ref|XP_010532551.1| PREDICTED: cysteine synthase [Tarenaya hassleriana]
 ref|XP_010532552.1| PREDICTED: cysteine synthase [Tarenaya hassleriana]
Length=322

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG+TPLVYLN V EGC   +AAK E M+P +S+KDR   +MIADAE KG
Sbjct  2     ASGIAKDVTELIGKTPLVYLNNVAEGCVGRVAAKLESMEPCSSVKDRIGYSMIADAEAKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF+AA KGYK+++TMP+  SIERR+ +  FGA+LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFMAAAKGYKLIITMPASMSIERRIILLAFGAELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G V KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ ++G VD FV GIG
Sbjct  122   AKGMKGAVAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKCSEGKVDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPN+K+YG+EP ES IL+GGKPGPH I G G GF P ILD+D+++
Sbjct  182   TGGTITGAGKYLKEQNPNLKLYGVEPVESPILSGGKPGPHKIQGIGAGFIPGILDVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSSEE++ MAR LA+KEGL+VGISSGA  VAA+RLA +PEN GKLIV V PSFGER
Sbjct  242   EVVQVSSEESIEMARLLAVKEGLLVGISSGAAAVAAIRLAKRPENAGKLIVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+  +R EAEAM
Sbjct  302   YLSTVLFDAVRKEAEAM  318



>ref|XP_002949438.1| hypothetical protein VOLCADRAFT_89892 [Volvox carteri f. nagariensis]
 gb|EFJ49457.1| hypothetical protein VOLCADRAFT_89892 [Volvox carteri f. nagariensis]
Length=361

 Score =   385 bits (988),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 197/315 (63%), Positives = 250/315 (79%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QLIG+TP+VYLNKVT+GC A IAAK E+M+P  S+KDR   +MI+ AEK GLI
Sbjct  42    NIASDVTQLIGKTPMVYLNKVTDGCVAKIAAKLEIMEPCCSVKDRIGYSMISAAEKDGLI  101

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKTTL+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERR+ +R FGA+LVLTDPAK
Sbjct  102   TPGKTTLVEPTSGNTGIGLAFIAAAKGYKLILTMPASMSMERRILLRAFGAELVLTDPAK  161

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L STP+ FMLQQF NP N ++H+ETTGPEIW+ T+G VDI V G+G+G
Sbjct  162   GMKGAVAKAEEILASTPDAFMLQQFQNPNNPKVHYETTGPEIWDATEGAVDILVSGVGTG  221

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YL+ +   V++  +EP ES +L+GGKPGPH I G G GF P +LD  ++ EV
Sbjct  222   GTITGTGRYLREKKDKVELVAVEPAESPVLSGGKPGPHKIQGIGAGFVPAVLDTSLISEV  281

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS++A+ MAR LAL+EGLMVGISSGA   AA+++A +PEN GKL+V V PSFGERYL
Sbjct  282   VQVSSDDAIEMARRLALEEGLMVGISSGAAVQAAIKVAKRPENAGKLVVVVLPSFGERYL  341

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL+Q LR EA  M
Sbjct  342   SSVLFQSLRDEAARM  356



>ref|XP_010256041.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
 ref|XP_010256042.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
 ref|XP_010256043.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
Length=325

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 201/316 (64%), Positives = 256/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
               I K+ ++LIG+TPLVYLN +  GC A +AAK EMM+P +S+KDR   +MIADAE+KGL
Sbjct  6     CKIAKDITELIGKTPLVYLNNIVHGCVARVAAKLEMMEPCSSVKDRIGYSMIADAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPGK+ LIEPTSGN GI +AF+AA KGY++++TMP+  S+ERR+ +R FGA+LVLTDPA
Sbjct  66    ITPGKSVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRIILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             +GM G V+KA ++L  TPN ++LQQF NPAN +IH+ETTGPEIW+ T G VD FV GIG+
Sbjct  126   RGMKGAVQKAEEILAKTPNAYILQQFENPANPRIHYETTGPEIWKGTAGKVDAFVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G  ++LK QNP +KIYGIEP ES IL+GGKPGPH I G G GF P +L++D+++E
Sbjct  186   GGTITGTAKFLKEQNPEIKIYGIEPAESAILSGGKPGPHKIQGIGAGFIPGVLEVDLIDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             VL VSS+EA+  A+ LALKEGL+VGISSGA T AALR+A +PEN GKLIV + PSFGERY
Sbjct  246   VLQVSSDEAIETAKLLALKEGLLVGISSGAATAAALRIAKRPENAGKLIVVIFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ +R EAE M
Sbjct  306   LSSVLFESVRREAENM  321



>ref|XP_011073980.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 
X1 [Sesamum indicum]
Length=396

 Score =   386 bits (991),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  78    NIAEDVTQLIGKTPMVYLNNIVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEQKGLI  137

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  138   TPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDAAK  197

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA +++ ST N +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  198   GMKGAVQKAEEIVNSTQNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDILVAGIGTG  257

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+YLK  NPN+K+ G+EPTESNIL+GGKPGPH I G G GF P  LD DVM+EV
Sbjct  258   GTISGVGRYLKKYNPNIKVIGVEPTESNILSGGKPGPHKIQGIGAGFIPKNLDQDVMDEV  317

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  318   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVGKRPENAGKLIAVVFPSFGERYL  377

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+VL+Q +R E E MQP
Sbjct  378   STVLFQSIREECEKMQP  394



>gb|KHG11750.1| Cysteine synthase, chloroplastic/chromoplastic [Gossypium arboreum]
Length=402

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 262/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI+DAE++GLI
Sbjct  84    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMISDAEQRGLI  143

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGY+++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  144   TPGKSILVEPTSGNTGIGLAFIAASKGYRLILTMPASMSLERRVLLKAFGAELVLTDSAK  203

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++++STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  204   GMKGAVQKAEEIVKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFVGGIGTG  263

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NPN+K+ G+EPTESNIL+GGKPGPH I G G GF P  LD DV++EV
Sbjct  264   GTISGVGRFLKEKNPNIKVIGVEPTESNILSGGKPGPHKIQGIGAGFIPGNLDQDVVDEV  323

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN G+LI  V PSFGERYL
Sbjct  324   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVGKRPENAGQLIAVVFPSFGERYL  383

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  384   SSVLFQSIRDECEKMQPEP  402



>ref|XP_003082455.1| plastidic cysteine synthase 1 (ISS) [Ostreococcus tauri]
Length=345

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 256/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A NI    +QL+G TP+VYLNKV+EGCGA IAAK E+M+P  S+KDR   +MIA AE++G
Sbjct  26    AVNIADNVTQLVGCTPMVYLNKVSEGCGAEIAAKLEIMEPCCSVKDRIGWSMIAAAEQEG  85

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
              ITPGKTTL+EPTSGN GI +AFIAA KGYK+ LTMP+  S+ERR+ ++ FGA+LVLTDP
Sbjct  86    KITPGKTTLVEPTSGNTGIGLAFIAAAKGYKLTLTMPASMSLERRILLKAFGANLVLTDP  145

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G V KA ++   T + ++LQQF NPAN ++HFETTGPEIWEDT G +DIFV G+G
Sbjct  146   AKGMKGAVGKAEEIAAKTADSYILQQFENPANPKVHFETTGPEIWEDTAGQIDIFVAGVG  205

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLKS+NPN KI  +EPTES +L+GG PGPH I G G GF P ILD+D+++
Sbjct  206   TGGTITGTGRYLKSKNPNCKIVAVEPTESPVLSGGGPGPHKIQGIGAGFIPGILDVDIID  265

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             E++ V+S++A+ MA++LAL+EGLMVGISSGA  VAA++LA +PEN GKLI TV PSFGER
Sbjct  266   EIVQVASDDAIAMAKQLALQEGLMVGISSGAAAVAAIQLAKRPENAGKLIGTVFPSFGER  325

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLSS L+  +R EAEAM
Sbjct  326   YLSSALFSTIRDEAEAM  342



>emb|CEF99986.1| Cysteine synthase K/M [Ostreococcus tauri]
Length=357

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 256/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A NI    +QL+G TP+VYLNKV+EGCGA IAAK E+M+P  S+KDR   +MIA AE++G
Sbjct  38    AVNIADNVTQLVGCTPMVYLNKVSEGCGAEIAAKLEIMEPCCSVKDRIGWSMIAAAEQEG  97

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
              ITPGKTTL+EPTSGN GI +AFIAA KGYK+ LTMP+  S+ERR+ ++ FGA+LVLTDP
Sbjct  98    KITPGKTTLVEPTSGNTGIGLAFIAAAKGYKLTLTMPASMSLERRILLKAFGANLVLTDP  157

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G V KA ++   T + ++LQQF NPAN ++HFETTGPEIWEDT G +DIFV G+G
Sbjct  158   AKGMKGAVGKAEEIAAKTADSYILQQFENPANPKVHFETTGPEIWEDTAGQIDIFVAGVG  217

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLKS+NPN KI  +EPTES +L+GG PGPH I G G GF P ILD+D+++
Sbjct  218   TGGTITGTGRYLKSKNPNCKIVAVEPTESPVLSGGGPGPHKIQGIGAGFIPGILDVDIID  277

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             E++ V+S++A+ MA++LAL+EGLMVGISSGA  VAA++LA +PEN GKLI TV PSFGER
Sbjct  278   EIVQVASDDAIAMAKQLALQEGLMVGISSGAAAVAAIQLAKRPENAGKLIGTVFPSFGER  337

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLSS L+  +R EAEAM
Sbjct  338   YLSSALFSTIRDEAEAM  354



>ref|XP_002524867.1| cysteine synthase, putative [Ricinus communis]
 gb|EEF37491.1| cysteine synthase, putative [Ricinus communis]
Length=408

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 260/319 (82%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAEK+G I
Sbjct  90    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMIDDAEKRGAI  149

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  150   TPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVLTDSAK  209

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NPAN ++H+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  210   GMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFVGGIGTG  269

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+YLK +NPN+K+ G+EPTESNIL+GG+PGPH I G G GF P  LD DV++EV
Sbjct  270   GTISGVGRYLKEKNPNIKVIGVEPTESNILSGGQPGPHKIQGIGAGFVPRNLDQDVVDEV  329

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  330   VQISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVGKRPENAGKLIAVVFPSFGERYL  389

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  390   SSVLFQSIREECENMQPEP  408



>emb|CDY45790.1| BnaC04g22760D [Brassica napus]
Length=427

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 215/375 (57%), Positives = 275/375 (73%), Gaps = 13/375 (3%)
 Frame = +2

Query  140   LTNLMKRRSFLQPSIFNTRFFNAGQPLAHSFAQRLR--DLPKDFPATNIKKET-------  292
             LT+   R     P I +  F  +G PL     Q     D+ K  P   +K ET       
Sbjct  51    LTSSTLRHFRSSPEISSLSFSASGFPLGMKSQQSRSYGDVSKRDPCEAVKLETGADGLNI  110

Query  293   ----SQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITP  460
                 SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I+P
Sbjct  111   AQNVSQLIGKTPMVYLNSMAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISP  170

Query  461   GKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGM  640
             GK+ L+EPTSGN GI +AFIAA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDPAKGM
Sbjct  171   GKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDPAKGM  230

Query  641   GGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggt  820
              G V+KA ++L+STP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+GGT
Sbjct  231   TGAVQKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTGGT  290

Query  821   vsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlm  1000
             ++GVG+++K QNP V++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV+ 
Sbjct  291   ITGVGRFIKEQNPKVQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDRAIMDEVIA  350

Query  1001  vsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSS  1180
             +SSEEA+  A++LALKEGLMVGISSGA   AA+ +A +PEN GKLI  V PSFGERYLS+
Sbjct  351   ISSEEAIETAKQLALKEGLMVGISSGAAAAAAIMVAKRPENAGKLIAVVFPSFGERYLST  410

Query  1181  VLYQELRAEAEAMQP  1225
              L+Q +R E E MQP
Sbjct  411   PLFQSIREEVEKMQP  425



>ref|XP_010512249.1| PREDICTED: cysteine synthase, mitochondrial [Camelina sativa]
Length=431

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLNK+ +GC A IAAK E+M+P  S+KDR   +M+ DAE+KGLI
Sbjct  113   NIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGLI  172

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PGK+ L+EPTSGN GI +AFIAA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  173   APGKSVLVEPTSGNTGIGLAFIAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  232

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT G VDIFV GIG+G
Sbjct  233   GMTGAVQKAEEILKTTPDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFVAGIGTG  292

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG++LK +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD ++M+EV
Sbjct  293   GTITGVGRFLKEKNPKSQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQEIMDEV  352

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EA+  A++LALKEGLMVGISSGA   AA+R+A +PEN GKLI  V PSFGERYL
Sbjct  353   IAISSDEAIEFAKQLALKEGLMVGISSGAAAAAAIRVAKRPENAGKLIAVVFPSFGERYL  412

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  413   STPLFQSIREEVEKMQP  429



>emb|CDP08001.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/317 (62%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A+IAAK E+M+P  S+KDR   +MIADAE+KG+I
Sbjct  81    NIAEDVTQLIGKTPMVYLNNIVKGSVAHIAAKLEIMEPCCSVKDRIGYSMIADAEQKGVI  140

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA +GYK++LTMPS  S+ERRV +R FGA+L+LTDPAK
Sbjct  141   TPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPSSMSLERRVLLRAFGAELILTDPAK  200

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++   TPN ++LQQF NPAN +IH++TTGPEIWEDT+G VDI V GIG+G
Sbjct  201   GMKGAVEKAEEIRNKTPNSYILQQFDNPANPKIHYDTTGPEIWEDTRGKVDILVAGIGTG  260

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SG G+YLK +NP +K+ G+EP ESNIL+GGKPGPH I G G GF P  LD +VM+EV
Sbjct  261   GTISGAGRYLKERNPGIKVIGVEPLESNILSGGKPGPHKIQGIGAGFIPRNLDEEVMDEV  320

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + + S EA+  A+++AL+EGL+VGISSGA T AAL++  +PEN+GKLI  V PSFGERYL
Sbjct  321   IAIDSAEAIETAKQVALQEGLLVGISSGAATAAALQVGKRPENEGKLIAVVFPSFGERYL  380

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  381   STALFQSIREECEKMQP  397



>ref|XP_010039322.1| PREDICTED: cysteine synthase [Eucalyptus grandis]
 gb|KCW46034.1| hypothetical protein EUGRSUZ_L00009 [Eucalyptus grandis]
Length=410

 Score =   385 bits (988),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 259/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIGRTP+VYLN + +GC A +AAK E+M+P  S+KDR   +MIADAE+KGLI
Sbjct  92    NIAEDVTQLIGRTPMVYLNNLVKGCVANVAAKLEIMEPCCSVKDRIGHSMIADAERKGLI  151

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV  + FGA+LVLTD AK
Sbjct  152   TPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLFKAFGAELVLTDAAK  211

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L STPN +MLQQF NPAN ++H+ETTGPEIWEDT+G VDIF+ GIG+G
Sbjct  212   GMKGAVQKAEEILNSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTRGKVDIFIAGIGTG  271

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP +K+ G+EP ESNIL+GGKPGPH I G G GF P  LD ++++EV
Sbjct  272   GTISGVGRFLKQKNPKIKVIGVEPLESNILSGGKPGPHKIQGIGAGFVPKNLDQELVDEV  331

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A+++AL+EGL+VGISSGA   AA+ +A +PEN GKLI  V PSFGERYL
Sbjct  332   IEISSDEAVETAKQVALQEGLLVGISSGAAAAAAMMVAKRPENAGKLIAVVFPSFGERYL  391

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+Q +R E E MQP P
Sbjct  392   SSVLFQSIREECEKMQPEP  410



>emb|CDX89032.1| BnaA04g01540D [Brassica napus]
Length=429

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 201/317 (63%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I
Sbjct  111   NIAENVSQLIGKTPMVYLNSMAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFI  170

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDPAK
Sbjct  171   SPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDPAK  230

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  231   GMTGAVQKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  290

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NPNV++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  291   GTITGVGRFIKEKNPNVQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQAIMDEV  350

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LALKEGLMVGISSGA   AA+ +A +PEN GKLI  V PSFGERYL
Sbjct  351   IAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIMVAKRPENAGKLIAVVFPSFGERYL  410

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  411   STPLFQSIREEVEKMQP  427



>gb|KFK35189.1| hypothetical protein AALP_AA5G251700 [Arabis alpina]
Length=425

 Score =   385 bits (989),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 259/317 (82%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KGLI
Sbjct  107   NIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGLI  166

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  167   SPGKSVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSMERRVLLKAFGAELVLTDPAK  226

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  227   GMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  286

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NP V++ G+EPTES+IL+GGKPGPH I G G GF P  LD ++M+EV
Sbjct  287   GTITGVGRFIKEKNPKVQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQNIMDEV  346

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGLMVGISSGA   AA+R+A +PEN GKLI  V PSFGERYL
Sbjct  347   IAISSEEAIETAKQLALREGLMVGISSGAAAAAAIRVAKRPENAGKLIAVVFPSFGERYL  406

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  407   STPLFQSIREEVEKMQP  423



>ref|XP_010917723.1| PREDICTED: cysteine synthase [Elaeis guineensis]
Length=325

 Score =   381 bits (978),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 257/314 (82%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG+TPLVYLN V  GCGA IAAK EMM+P +S+KDR   +MIADAE+KGLIT
Sbjct  8     IAKDVTELIGKTPLVYLNNVVSGCGARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIT  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PGK+ LIEPTSGN GI +AF+AA KGYK+VLTMP+  S+ERR+ ++ FGA+LVLTDP  G
Sbjct  68    PGKSVLIEPTSGNTGIGLAFMAAAKGYKLVLTMPASMSLERRIILKAFGAELVLTDPILG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA +L   T N ++LQQF NP+N +IH+ETTGPEIW+ T G VDI V GIG+GG
Sbjct  128   MKGAVQKAEELAAKTLNSYILQQFENPSNPKIHYETTGPEIWKGTAGKVDILVSGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YLK +NP +K+ G+EPTES +L+GGKPGPH I G G GF P +LD+D+++EV+
Sbjct  188   TITGTGKYLKEKNPEIKLCGVEPTESAVLSGGKPGPHKIQGIGAGFIPGVLDIDLIDEVI  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              VSS+EA+ MA+ LALKEGL+VGISSGA  VAA+RLA +PEN+GKLIV V PSFGERYLS
Sbjct  248   QVSSDEAIEMAKLLALKEGLLVGISSGAAAVAAIRLAQRPENEGKLIVVVFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVLYQ ++ EAE+M
Sbjct  308   SVLYQSIKKEAESM  321



>gb|EYU36679.1| hypothetical protein MIMGU_mgv1a007743mg [Erythranthe guttata]
Length=396

 Score =   384 bits (985),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +MI DAE+KG I
Sbjct  78    NIAEDVTQLIGKTPMVYLNSIVKGCVANIAAKLEIMEPCCSVKDRIGYSMITDAEEKGQI  137

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLT+ AK
Sbjct  138   SPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTEAAK  197

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA +++ +TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  198   GMKGAVQKAEEIVNNTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  257

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+YLK  NPNVK+ G+EPTESNIL+GGKPGPH I G G GF P  LD D+++EV
Sbjct  258   GTISGVGRYLKEYNPNVKVIGVEPTESNILSGGKPGPHKIQGIGAGFIPKNLDQDLIDEV  317

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  318   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIQVGKRPENAGKLIAVVFPSFGERYL  377

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+VL+Q +R E E MQP
Sbjct  378   STVLFQSIREECETMQP  394



>dbj|BAJ91393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 269/349 (77%), Gaps = 6/349 (2%)
 Frame = +2

Query  194   RFFNAGQPL------AHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGA  355
             R F AG  L      A S + R   L  +    NI  + +QLIG+TP+VYLN++ +GC A
Sbjct  38    RRFPAGSSLLAVNAPAASPSWRRHALATEVEGLNIADDVTQLIGKTPMVYLNRIVKGCVA  97

Query  356   YIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKG  535
              +AAK E+M+P  S+KDR  ++MI+DAE+KGLITPGK+ L+E TSGN GI +AFIAA +G
Sbjct  98    NVAAKLEIMEPCCSVKDRIGISMISDAEEKGLITPGKSVLVEATSGNTGIGLAFIAASRG  157

Query  536   YKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSN  715
             YK++LTMP+  S+ERRV ++ FGA+LVLTD AKGM G + KA ++L  TPN +ML+QF N
Sbjct  158   YKLILTMPTSMSMERRVLLKAFGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDN  217

Query  716   PANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTES  895
             PAN ++H+ETTGPEIWED++G VDIF+ GIG+GGT+SG G++LK +NP+VK+ G+EPTES
Sbjct  218   PANPKVHYETTGPEIWEDSKGKVDIFIGGIGTGGTISGTGRFLKEKNPDVKVIGVEPTES  277

Query  896   NILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISS  1075
             NIL+GGKPGPH I G G GF P  LD DV+ EV+ +SS+EAV  A++LAL+EGL+VGISS
Sbjct  278   NILSGGKPGPHKIQGIGAGFVPRNLDSDVLNEVIEISSDEAVETAKQLALQEGLLVGISS  337

Query  1076  GANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQ  1222
             GA   AA+++A +PEN GKLIV V PSFGERYLSSVL+Q +R E E M+
Sbjct  338   GAAAAAAIKVAQRPENAGKLIVVVFPSFGERYLSSVLFQSIREECEKME  386



>ref|XP_006290351.1| hypothetical protein CARUB_v10017296mg [Capsella rubella]
 gb|EOA23249.1| hypothetical protein CARUB_v10017296mg [Capsella rubella]
Length=432

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KGLI
Sbjct  114   NIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGLI  173

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  174   SPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  233

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  234   GMTGAVQKAEEVLKTTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  293

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  294   GTITGVGRFIKEKNPKSQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEV  353

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LALKEGLMVGISSGA   AA+R+A +PEN GKLI  V PSFGERYL
Sbjct  354   IAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIRVAKRPENAGKLIAVVFPSFGERYL  413

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  414   STPLFQSIREEVEKMQP  430



>ref|XP_006284124.1| hypothetical protein CARUB_v10005256mg [Capsella rubella]
 gb|EOA17022.1| hypothetical protein CARUB_v10005256mg [Capsella rubella]
Length=322

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEK+G
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKQG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  SIERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPIESAILSGGKPGPHKIQGIGAGFIPSVLNVDIID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAEAM
Sbjct  302   YLSTVLFDATRKEAEAM  318



>ref|XP_006402661.1| hypothetical protein EUTSA_v10005989mg [Eutrema salsugineum]
 gb|ESQ44114.1| hypothetical protein EUTSA_v10005989mg [Eutrema salsugineum]
Length=434

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  SQLIG+TP+VYLN + + C A IAAK E+M+P  S+KDR   +M+ DAE+KGLI
Sbjct  116   NIAENVSQLIGKTPMVYLNSIAKDCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGLI  175

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PGK+ L+EPTSGN GI +AFIAA +GY+++LTMPS  S+ERRV ++ FGA+LVLTDPAK
Sbjct  176   APGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPSSMSMERRVLLKAFGAELVLTDPAK  235

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L+STP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  236   GMTGAVLKAEEILKSTPDAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  295

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NP V++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  296   GTITGVGRFIKEKNPKVQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEV  355

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGLMVGISSGA   AA+R+A++PEN GKLI  V PSFGERYL
Sbjct  356   IAISSEEAIETAKQLALREGLMVGISSGAAAAAAIRVANRPENAGKLIAVVFPSFGERYL  415

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  416   STPLFQSIREEVEKMQP  432



>ref|XP_002868245.1| O-acetylserine (thiol) lyase (oas-tl) isoform A1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44504.1| O-acetylserine (thiol) lyase (oas-tl) isoform A1 [Arabidopsis 
lyrata subsp. lyrata]
Length=322

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  SIERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>ref|XP_009107806.1| PREDICTED: cysteine synthase [Brassica rapa]
 gb|ACX70135.1| O-acetylserine(thiol)lyase isoform A4 [Brassica rapa subsp. chinensis]
 emb|CDY68436.1| BnaAnng27260D [Brassica napus]
Length=322

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAE+KG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEEKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNPNVKLYGVEPIESAILSGGKPGPHKIQGIGAGFIPSVLEVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR LALKEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  242   EVVQVSSDESIDMARLLALKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>sp|O23733.1|CYSK1_BRAJU RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=O-acetylserine 
(thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine 
sulfhydrylase; AltName: Full=OAS-TL4 [Brassica juncea]
 emb|CAA71798.1| O-acetylserine(thiol) lyase [Brassica juncea]
Length=322

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAE+KG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEQKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNPNVKLYGVEPIESAILSGGKPGPHKIQGIGAGFIPSVLEVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR LALKEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  242   EVVQVSSDESIDMARLLALKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>ref|XP_007033723.1| O-acetylserine lyase B isoform 1 [Theobroma cacao]
 gb|EOY04649.1| O-acetylserine lyase B isoform 1 [Theobroma cacao]
Length=402

 Score =   382 bits (981),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 260/324 (80%), Gaps = 0/324 (0%)
 Frame = +2

Query  260   DFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAE  439
             D    NI  + +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MIADAE
Sbjct  79    DIEGLNIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAE  138

Query  440   KKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVL  619
             ++G+ITPGK+ L+EPTSGN GI +AFIAA KGY+++LTMP+  S+ERRV ++ FGA+LVL
Sbjct  139   QRGVITPGKSILVEPTSGNTGIGLAFIAASKGYQLILTMPASMSLERRVLLKAFGAELVL  198

Query  620   TDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVM  799
             TD AKGM G V+KA ++L+STPN +MLQQF NPAN +IH+ETTGPEIWED++G VDIF+ 
Sbjct  199   TDSAKGMKGAVQKAEEILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDSRGKVDIFIA  258

Query  800   gigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmd  979
             GIG+GGT+SGVG++LK +NP +K+ G+EPTESNIL+GGKPGPH I G G GF P  LD D
Sbjct  259   GIGTGGTISGVGRFLKEKNPKIKVIGVEPTESNILSGGKPGPHKIQGIGAGFVPRNLDQD  318

Query  980   vmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSF  1159
             V++EV+ +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  + EN GKLI  V PSF
Sbjct  319   VVDEVIEISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVGKRSENAGKLIAVVFPSF  378

Query  1160  GERYLSSVLYQELRAEAEAMQPVP  1231
             GERYLSSVL+Q +R E E MQP P
Sbjct  379   GERYLSSVLFQSIRDECEKMQPEP  402



>ref|XP_002982693.1| hypothetical protein SELMODRAFT_234035 [Selaginella moellendorffii]
 gb|EFJ16446.1| hypothetical protein SELMODRAFT_234035 [Selaginella moellendorffii]
Length=305

 Score =   378 bits (971),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 250/305 (82%), Gaps = 0/305 (0%)
 Frame = +2

Query  317   LVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGN  496
             +VYLN V EGC A IAAK E+M+P  S+KDR  ++MI+DAE KG I+PGK+ L+EPTSGN
Sbjct  1     MVYLNSVVEGCVANIAAKLEIMEPCCSVKDRIGLSMISDAEAKGAISPGKSVLVEPTSGN  60

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
              GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDPAKGM G V KA +++ 
Sbjct  61    TGIGLAFIAAAKGYKLILTMPASMSMERRVLLKAFGAELVLTDPAKGMKGAVSKAEEIVS  120

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
             +TPN +MLQQF NPAN +IHFETTGPEIWEDTQG +D FV GIG+GGTV+G G+YLK +N
Sbjct  121   NTPNAYMLQQFENPANPKIHFETTGPEIWEDTQGKIDFFVSGIGTGGTVTGAGRYLKDKN  180

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PN+KI G+EPTESN+L+GGKPGPH I G G GF P IL++ +++EV+ +SS +AV MA++
Sbjct  181   PNIKIVGVEPTESNVLSGGKPGPHKIQGMGAGFIPGILEVGILDEVVEISSNDAVEMAKQ  240

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LALKEGL+VGISSGA   AA+R+A +PEN+ KLIV + PSFGERYLSSVL+Q +R E E 
Sbjct  241   LALKEGLLVGISSGAAVAAAIRIAKRPENENKLIVVILPSFGERYLSSVLFQSIREETEK  300

Query  1217  MQPVP  1231
             MQP P
Sbjct  301   MQPEP  305



>ref|NP_001045577.1| Os01g0978100 [Oryza sativa Japonica Group]
 dbj|BAD87047.1| putative plastidic cysteine synthase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF07491.1| Os01g0978100 [Oryza sativa Japonica Group]
 dbj|BAG89605.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89319.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94001.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56113.1| hypothetical protein OsJ_04976 [Oryza sativa Japonica Group]
Length=394

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 265/338 (78%), Gaps = 7/338 (2%)
 Frame = +2

Query  218   LAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTAS  397
             + H+ A  +  L       NI  + +QLIG+TP+VYLN + +GC A +AAK E+M+P  S
Sbjct  64    MCHAVAAEVEGL-------NIADDVTQLIGKTPMVYLNNIVKGCVANVAAKLEIMEPCCS  116

Query  398   IKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIE  577
             +KDR   +MI+DAE+KGLITPGK+ L+EPTSGN GI +AFIAA +GYK++LTMP+  S+E
Sbjct  117   VKDRIGYSMISDAEEKGLITPGKSVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSME  176

Query  578   RRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPE  757
             RRV ++ FGA+LVLTD AKGM G V KA ++L  TP+ +MLQQF NPAN ++H+ETTGPE
Sbjct  177   RRVLLKAFGAELVLTDAAKGMKGAVDKATEILNKTPDAYMLQQFDNPANPKVHYETTGPE  236

Query  758   IWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHIT  937
             IWED++G VD+F+ GIG+GGT+SG G++LK +NP +K+ GIEP+ESNIL+GGKPGPH I 
Sbjct  237   IWEDSKGKVDVFIGGIGTGGTISGAGRFLKEKNPGIKVIGIEPSESNILSGGKPGPHKIQ  296

Query  938   GNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKP  1117
             G G GF P  LD +V++EV+ +SS+EAV  A++LAL+EGL+VGISSGA   AA+++A +P
Sbjct  297   GIGAGFVPRNLDSEVLDEVIEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVAKRP  356

Query  1118  ENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
             EN GKL+V V PSFGERYLSS+L+Q +R E E +QP P
Sbjct  357   ENAGKLVVVVFPSFGERYLSSILFQSIREECEKLQPEP  394



>ref|XP_010524184.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Tarenaya hassleriana]
Length=398

 Score =   382 bits (980),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 259/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + SQLIGRTP+VYLN +  GC A +A K E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  80    NIADDVSQLIGRTPMVYLNNIVNGCVANVAVKLEIMEPCCSVKDRIGYSMITDAEQKGLI  139

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI++AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  140   TPGKSVLVEPTSGNTGIALAFIAAAKGYKLILTMPASMSLERRVLLKAFGAELVLTDPAK  199

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA  +L+STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  200   GMTGAIQKAEQILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFVAGIGTG  259

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+Y+K + P VK+ G+EPTES+IL+GGKPGPH I G G GF P  LD+++M+EV
Sbjct  260   GTISGVGRYIKERKPGVKVIGVEPTESDILSGGKPGPHKIQGIGAGFVPKNLDLNIMDEV  319

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A+++AL+EGL+VGISSGA   AA+++A +PEN GKL+  V PSFGERYL
Sbjct  320   ITISSEEAIETAKQVALQEGLLVGISSGAAAAAAVKVAKRPENAGKLVAVVFPSFGERYL  379

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S+ L+Q +R E E MQP P
Sbjct  380   STPLFQSIREECEKMQPEP  398



>ref|NP_193224.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 ref|NP_849386.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 ref|NP_001190732.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 ref|NP_001190733.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 sp|P47998.2|CYSK1_ARATH RecName: Full=Cysteine synthase 1; AltName: Full=At.OAS.5-8; 
AltName: Full=Beta-substituted Ala synthase 1;1; Short=ARAth-Bsas1;1; 
AltName: Full=CSase A; Short=AtCS-A; AltName: Full=Cys-3A; 
AltName: Full=O-acetylserine (thiol)-lyase 1; Short=OAS-TL 
A; AltName: Full=O-acetylserine sulfhydrylase; AltName: 
Full=Protein ONSET OF LEAF DEATH 3 [Arabidopsis thaliana]
 pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From 
Arabidopsis Thaliana
 emb|CAB10267.1| cytosolic O-acetylserine(thiol)lyase (EC 4.2.99.8) [Arabidopsis 
thaliana]
 emb|CAB72932.1| O-acetylserine (thiol) lyase A1 [Arabidopsis thaliana]
 emb|CAA56593.2| O-acetylserine (thiol) lyase [Arabidopsis thaliana]
 emb|CAB78530.1| cytosolic O-acetylserine(thiol)lyase (EC 4.2.99.8) [Arabidopsis 
thaliana]
 gb|ABF85780.1| At4g14880 [Arabidopsis thaliana]
 gb|AEE83512.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 gb|AEE83513.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 gb|AEE83514.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
 gb|AEE83515.1| O-acetylserine (thiol) lyase (OAS-TL) isoform A1 [Arabidopsis 
thaliana]
Length=322

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 253/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAEAM
Sbjct  302   YLSTVLFDATRKEAEAM  318



>emb|CAA58893.1| cysteine synthase [Arabidopsis thaliana]
 prf||2111276A Ser(Ac) thiol lyase
Length=322

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 253/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAEAAAAIKLAQRPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAEAM
Sbjct  302   YLSTVLFDATRKEAEAM  318



>ref|XP_006604835.1| PREDICTED: cysteine synthase-like isoform X2 [Glycine max]
 ref|XP_006604836.1| PREDICTED: cysteine synthase-like isoform X3 [Glycine max]
Length=325

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 258/316 (82%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             +NI K+ ++LIG+TPLVYLN + +GC A +AAK EMM+P +S+KDR   +MI DAE+KGL
Sbjct  6     SNIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPG++ LIEPTSGN GI +AF+AA KGYK+++TMPS  S+ERR  +R FGA+LVLTDPA
Sbjct  66    ITPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++ + TPN +MLQQF NPAN ++H+ETTGPEIW+ + G VD  V GIG+
Sbjct  126   KGMKGAVQKAEEIRDKTPNSYMLQQFENPANPKVHYETTGPEIWKGSSGKVDALVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGTV+G G+YLK QNP++K+YGIEP ES IL+GGKPGPH I G G GF P +LD+D+++E
Sbjct  186   GGTVTGAGKYLKEQNPDIKLYGIEPVESPILSGGKPGPHKIQGIGAGFIPGVLDVDLLDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SSEEA+  A+ LALKEGL+VGISSGA   AA+++A +PEN GKLIV V PSFGERY
Sbjct  246   VVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAVKIAKRPENAGKLIVAVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ ++ EAE++
Sbjct  306   LSSVLFESVKREAESL  321



>ref|XP_004309642.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Fragaria vesca subsp. vesca]
Length=397

 Score =   381 bits (979),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 258/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLNK+ +G  A IAAK E+M+P  S+KDR   +MI DAE++GLI
Sbjct  79    NIAEDVTQLIGKTPMVYLNKIIKGSVANIAAKLEIMEPCCSVKDRIGYSMITDAEQRGLI  138

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLT+ AK
Sbjct  139   KPGQSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTNSAK  198

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NPAN ++H+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  199   GMKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYETTGPEIWEDTKGKVDIFVGGIGTG  258

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP +KI G+EPTESNIL+GGKPGPH I G G GF P  L  DV++E+
Sbjct  259   GTISGVGRFLKEKNPRIKIIGVEPTESNILSGGKPGPHKIQGIGAGFIPGNLHQDVVDEI  318

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  319   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLITVVFPSFGERYL  378

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+VL+Q +R E E MQP
Sbjct  379   STVLFQSIREECEKMQP  395



>ref|XP_008373398.1| PREDICTED: cysteine synthase-like [Malus domestica]
Length=397

 Score =   381 bits (978),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 200/319 (63%), Positives = 256/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++GLI
Sbjct  79    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMITDAEQRGLI  138

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  139   KPGQSVLVEPTSGNTGIGLAFIAATKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAK  198

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++  STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  199   GMKGAVQKAEEICNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVGGIGTG  258

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP VKI G+EPTESNIL+GGKPGPH I G G GF P  L  DV++E+
Sbjct  259   GTISGVGRFLKEKNPKVKIIGVEPTESNILSGGKPGPHKIQGIGAGFIPRNLHQDVVDEI  318

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  319   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVGKRPENAGKLIAVVFPSFGERYL  378

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  379   STILFQSIREECEKMQPEP  397



>ref|XP_006414628.1| hypothetical protein EUTSA_v10025734mg [Eutrema salsugineum]
 ref|XP_006414629.1| hypothetical protein EUTSA_v10025734mg [Eutrema salsugineum]
 ref|XP_006414630.1| hypothetical protein EUTSA_v10025734mg [Eutrema salsugineum]
 gb|ESQ56081.1| hypothetical protein EUTSA_v10025734mg [Eutrema salsugineum]
 gb|ESQ56082.1| hypothetical protein EUTSA_v10025734mg [Eutrema salsugineum]
 gb|ESQ56083.1| hypothetical protein EUTSA_v10025734mg [Eutrema salsugineum]
Length=322

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 252/317 (79%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG  LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVQLVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +LD+D+++
Sbjct  182   TGGTITGAGKYLKEQNPNVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPGVLDVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++ AR LALKEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  242   EVVQVSSDESIDTARLLALKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>gb|ACX70136.1| O-acetylserine(thiol)lyase isoform A6 [Brassica rapa subsp. chinensis]
Length=322

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 251/317 (79%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I  + ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVELAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +L+ ++++
Sbjct  182   TGGTITGAGKYLKEQNPNVKLYGVEPIESAILSGGKPGPHKIQGIGAGFVPSVLEANLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR LA KEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  242   EVVQVSSDESIDMARLLARKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>gb|EPS66048.1| cysteine synthase [Genlisea aurea]
Length=325

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 257/314 (82%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG+TPLVYLN + +GC A IAAK E+M+P +S+KDR   +MI DAE++GLIT
Sbjct  8     IAKDVTELIGKTPLVYLNNIVDGCVARIAAKLELMEPCSSVKDRIGYSMIKDAEEQGLIT  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PG++ LIEPTSGN GI +AF+AA KGYK+++TMPS  S+ERR+ +R FGA+LVLTDPAKG
Sbjct  68    PGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRIILRAFGAELVLTDPAKG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA ++ + TPN ++LQQF NPAN +IH+ETTGPEIW+ T G +D F+ GIG+GG
Sbjct  128   MKGAVQKAEEIRDRTPNSYILQQFENPANPKIHYETTGPEIWKGTNGKIDAFISGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YLK QNP+VK+Y IEPTES +L+GGKPGPH I G G GF P +L++ +++EV+
Sbjct  188   TITGAGKYLKEQNPDVKLYAIEPTESPVLSGGKPGPHKIQGIGAGFIPGVLEVGLIDEVI  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              +SSEEAV  A+ LA+KEGL+VGISSGA   AA+R+A +PEN GKLIV + PSFGERYLS
Sbjct  248   QISSEEAVETAKLLAVKEGLLVGISSGAAAAAAIRVAKRPENAGKLIVVIFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVL++ +R EAEAM
Sbjct  308   SVLFESVRKEAEAM  321



>ref|XP_001691935.1| cysteine synthase [Chlamydomonas reinhardtii]
 gb|EDP04425.1| cysteine synthase [Chlamydomonas reinhardtii]
Length=359

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 250/315 (79%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + ++LIG+TP+VYLNKV  G  A IAAK E+M+P  S+KDR   +MI+ AEK+GLI
Sbjct  39    NIATDVTELIGKTPMVYLNKVATGTHAKIAAKLEIMEPCCSVKDRIGYSMISSAEKEGLI  98

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERR+ +R FGA+LVLTDPAK
Sbjct  99    TPGKTVLVEPTSGNTGIGLAFIAAARGYKLILTMPASMSLERRILLRAFGAELVLTDPAK  158

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L STP+ FMLQQF NP N ++H+ETTGPEIW  T G VDI V G+G+G
Sbjct  159   GMKGAVAKAEEILASTPDAFMLQQFQNPNNPKVHYETTGPEIWSATDGKVDILVSGVGTG  218

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YL+ +  +V++  +EP ES +L+GGKPGPH I G G GF P +LD  ++ EV
Sbjct  219   GTITGTGRYLREKKSDVQLVAVEPAESPVLSGGKPGPHKIQGIGAGFVPAVLDTALISEV  278

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS++A++MAR LAL+EGLMVGISSGA   AA+++AS+PEN+GKL+V V PSFGERYL
Sbjct  279   VQVSSDDAIDMARRLALEEGLMVGISSGAAVQAAIKVASRPENEGKLVVVVLPSFGERYL  338

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL+Q+LR EA  M
Sbjct  339   SSVLFQQLRDEASKM  353



>ref|XP_009372595.1| PREDICTED: cysteine synthase-like [Pyrus x bretschneideri]
Length=397

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 256/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++GLI
Sbjct  79    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMITDAEQRGLI  138

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ L+EPTSGN GI +AFIAA KGY+++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  139   KPGQSVLVEPTSGNTGIGLAFIAATKGYRLILTMPASMSLERRVLLKAFGAELVLTDSAK  198

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++  STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  199   GMKGAVQKAEEICNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVGGIGTG  258

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP VKI G+EPTESNIL+GGKPGPH I G G GF P  L  DV++E+
Sbjct  259   GTISGVGRFLKEKNPKVKIIGVEPTESNILSGGKPGPHKIQGIGAGFIPRNLHQDVVDEI  318

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  319   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVGKRPENAGKLIAVVFPSFGERYL  378

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  379   STILFQSIREECEKMQPEP  397



>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From 
Arabidopsis Thaliana In Complex With C-Terminal Peptide From 
Arabidopsis Serine Acetyltransferase
Length=320

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/316 (62%), Positives = 252/316 (80%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKGL
Sbjct  1     SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGL  60

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S ERR+ +  FG +LVLTDPA
Sbjct  61    IKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPA  120

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG+
Sbjct  121   KGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGT  180

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++E
Sbjct  181   GGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDE  240

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGERY
Sbjct  241   VVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERY  300

Query  1172  LSSVLYQELRAEAEAM  1219
             LS+VL+   R EAEAM
Sbjct  301   LSTVLFDATRKEAEAM  316



>ref|XP_008797336.1| PREDICTED: cysteine synthase [Phoenix dactylifera]
Length=325

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 258/314 (82%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG+TPLVYLN V  GCGA IAAK EMM+P +S+KDR   +MIADAE+KGLIT
Sbjct  8     IAKDVTELIGKTPLVYLNNVVNGCGARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIT  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PGK+ LIEPTSGN GI +AF+AA KGYK+VLTMP+  S+ERR+ ++ FGA+LVLTDP  G
Sbjct  68    PGKSVLIEPTSGNTGIGLAFMAAAKGYKLVLTMPASMSLERRIILKAFGAELVLTDPVLG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA +L   TPN ++LQQF NP+N +IH+ETTGPEIW+ T G VDI + GIG+GG
Sbjct  128   MKGAVQKAEELAAKTPNSYVLQQFENPSNPKIHYETTGPEIWKGTSGKVDILISGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YLK +NP +K+ G+EPTES +L+GGKPGPH I G G GF P +LD+D+++EV+
Sbjct  188   TITGTGKYLKEKNPEIKLCGVEPTESAVLSGGKPGPHKIQGIGAGFIPGVLDVDLVDEVI  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              VSS+EA+ MA+ LALKEGL+VGISSGA  VAA+R+A +PEN+GKLIV V PSFGERYLS
Sbjct  248   QVSSDEAIEMAKLLALKEGLLVGISSGAAAVAAIRVAQRPENEGKLIVVVFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVLYQ ++ EAE+M
Sbjct  308   SVLYQSIKKEAESM  321



>ref|XP_001691936.1| cysteine synthase [Chlamydomonas reinhardtii]
 gb|EDP04426.1| cysteine synthase [Chlamydomonas reinhardtii]
Length=352

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 250/315 (79%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + ++LIG+TP+VYLNKV  G  A IAAK E+M+P  S+KDR   +MI+ AEK+GLI
Sbjct  32    NIATDVTELIGKTPMVYLNKVATGTHAKIAAKLEIMEPCCSVKDRIGYSMISSAEKEGLI  91

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERR+ +R FGA+LVLTDPAK
Sbjct  92    TPGKTVLVEPTSGNTGIGLAFIAAARGYKLILTMPASMSLERRILLRAFGAELVLTDPAK  151

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L STP+ FMLQQF NP N ++H+ETTGPEIW  T G VDI V G+G+G
Sbjct  152   GMKGAVAKAEEILASTPDAFMLQQFQNPNNPKVHYETTGPEIWSATDGKVDILVSGVGTG  211

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YL+ +  +V++  +EP ES +L+GGKPGPH I G G GF P +LD  ++ EV
Sbjct  212   GTITGTGRYLREKKSDVQLVAVEPAESPVLSGGKPGPHKIQGIGAGFVPAVLDTALISEV  271

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS++A++MAR LAL+EGLMVGISSGA   AA+++AS+PEN+GKL+V V PSFGERYL
Sbjct  272   VQVSSDDAIDMARRLALEEGLMVGISSGAAVQAAIKVASRPENEGKLVVVVLPSFGERYL  331

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL+Q+LR EA  M
Sbjct  332   SSVLFQQLRDEASKM  346



>ref|XP_010413649.1| PREDICTED: cysteine synthase, mitochondrial-like [Camelina sativa]
Length=431

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 256/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLNK+ +GC A IAAK E+++P  S+KDR   +M+ DAE+KGLI
Sbjct  113   NIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIIEPCCSVKDRIGYSMVTDAEQKGLI  172

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
               GK+ L+EPTSGN GI +AF+AA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  173   ARGKSVLVEPTSGNTGIGLAFVAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  232

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT G VDIFV GIG+G
Sbjct  233   GMTGAVQKAEEILKTTPDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFVAGIGTG  292

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG++LK +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD ++M+EV
Sbjct  293   GTITGVGRFLKEKNPKSQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQEIMDEV  352

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EA+  A++LALKEGLMVGISSGA   AA+R+A +PEN GKLI  V PSFGERYL
Sbjct  353   IAISSDEAIEFAKQLALKEGLMVGISSGAAAAAAIRVAKRPENAGKLIAVVFPSFGERYL  412

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  413   STPLFQSIREEVEKMQP  429



>ref|XP_007227711.1| hypothetical protein PRUPE_ppa006674mg [Prunus persica]
 gb|EMJ28910.1| hypothetical protein PRUPE_ppa006674mg [Prunus persica]
Length=400

 Score =   379 bits (974),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 257/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++GLI
Sbjct  82    NIAEDVTQLIGKTPMVYLNNMVKGSVANIAAKLEIMEPCCSVKDRIGYSMIIDAEQRGLI  141

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  142   KPGQSVLVEPTSGNTGIGLAFIAATKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAK  201

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++ +STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  202   GMKGAVQKAEEIFKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFVGGIGTG  261

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP +KI G+EP+ESNIL+GGKPGPH I G G GF P  L  DV++E+
Sbjct  262   GTISGVGRFLKEKNPKIKIIGVEPSESNILSGGKPGPHKIQGIGAGFIPRNLHQDVVDEI  321

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  322   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLITVVFPSFGERYL  381

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  382   STILFQSIREECEKMQPEP  400



>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine 
Sulfhydrylase K46a Mutant
Length=322

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/317 (62%), Positives = 252/317 (79%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+ DR   +MI+DAEKKG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVADRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAEAM
Sbjct  302   YLSTVLFDATRKEAEAM  318



>ref|XP_002981222.1| hypothetical protein SELMODRAFT_233668 [Selaginella moellendorffii]
 gb|EFJ17923.1| hypothetical protein SELMODRAFT_233668 [Selaginella moellendorffii]
Length=305

 Score =   375 bits (964),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 249/305 (82%), Gaps = 0/305 (0%)
 Frame = +2

Query  317   LVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGN  496
             +VYLN V EGC A IAAK E+M+P  S+KDR  ++MI+DAE KG I+PGK+ L+EPTSGN
Sbjct  1     MVYLNSVVEGCVANIAAKLEIMEPCCSVKDRIGLSMISDAEAKGAISPGKSVLVEPTSGN  60

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
              GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTDPAKGM G V KA +++ 
Sbjct  61    TGIGLAFIAAAKGYKLILTMPASMSMERRVLLKAFGAELVLTDPAKGMKGAVSKAEEIVS  120

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
              TPN +MLQQF NPAN +IHFETTGPE+WEDT+G +D FV GIG+GGTV+G G+YLK +N
Sbjct  121   KTPNAYMLQQFENPANPKIHFETTGPEVWEDTRGKIDFFVSGIGTGGTVTGAGRYLKDKN  180

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PN+KI G+EPTESN+L+GGKPGPH I G G GF P IL++ +++EV+ +SS +AV MA++
Sbjct  181   PNIKIVGVEPTESNVLSGGKPGPHKIQGMGAGFIPGILEVGILDEVVEISSNDAVEMAKQ  240

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LALKEGL+VGISSGA   AA+++A +PEN+ KLIV + PSFGERYLSSVL+Q +R E E 
Sbjct  241   LALKEGLLVGISSGAAVAAAIQIAKRPENENKLIVVILPSFGERYLSSVLFQSIREETEK  300

Query  1217  MQPVP  1231
             MQP P
Sbjct  301   MQPEP  305



>emb|CDY42795.1| BnaC01g22710D [Brassica napus]
Length=322

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 252/317 (79%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I  + ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASCIANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +L++++++
Sbjct  182   TGGTITGAGKYLKEQNPNVKLYGVEPIESAILSGGKPGPHKIQGIGAGFIPSVLEVNLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR LA KEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  242   EVVQVSSDESIDMARLLARKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>gb|KDP40178.1| hypothetical protein JCGZ_02176 [Jatropha curcas]
Length=325

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/315 (63%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
              I K+ ++LIG+TPLVYLN V +GC A IAAK EMM+P +S+KDR   +MI+DAE KGL+
Sbjct  7     EIAKDVTELIGKTPLVYLNHVVDGCVARIAAKLEMMEPCSSVKDRIGYSMISDAEAKGLL  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPG++ LIE TSGN GI +AF+AA KGY++++TMP+  S+ERR+ +R FGA+LVLTDPAK
Sbjct  67    TPGQSVLIEATSGNTGIGLAFMAAAKGYRLIITMPASMSLERRIILRAFGAELVLTDPAK  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L  TPN +MLQQF N AN +IH+ETTGPEIW+ + G VD FV GIG+G
Sbjct  127   GMKGAVQKAEEILAKTPNAYMLQQFENGANPKIHYETTGPEIWKGSGGKVDAFVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YLK QNPN+K+YG+EP ES +L+GGKPGPH I G G GF P +L++D+++EV
Sbjct  187   GTITGAGKYLKEQNPNIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLEVDIIDEV  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS+EA+  A+ LALKEGL+VGISSGA T AA++LA +PEN GKLIV + PSFGERYL
Sbjct  247   VQVSSDEAIETAKLLALKEGLLVGISSGAATAAAVKLAKRPENAGKLIVVIFPSFGERYL  306

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL++ +R EAE+M
Sbjct  307   SSVLFESVRREAESM  321



>ref|XP_009383903.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis]
Length=324

 Score =   376 bits (966),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 257/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A  I K+ ++LIG+TPLVYLNKVT+GC A +AAK E M+P +S+KDR   +MI+DAE++G
Sbjct  4     AGGIAKDVTELIGKTPLVYLNKVTDGCVARVAAKLESMEPCSSVKDRIGYSMISDAEERG  63

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             +I PGK+ LIEPTSGN GI +AF+AA KGYK+VLTMP+  S+ERR+ ++ FGA+LVLTDP
Sbjct  64    VIQPGKSILIEPTSGNTGIGLAFMAAAKGYKLVLTMPASMSLERRIILKAFGAELVLTDP  123

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             + GM G VKKA +L   TPN ++LQQF NPAN +IH+ETTGPEIW+ T G +D  V GIG
Sbjct  124   SSGMKGAVKKAEELAAKTPNSYILQQFENPANPKIHYETTGPEIWKGTGGKIDALVSGIG  183

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK +NP++K+YG+EP ES +L GGKPGPH I G G GF PD+LD+ +++
Sbjct  184   TGGTITGAGRYLKEKNPDIKLYGVEPVESAVLCGGKPGPHKIQGLGAGFIPDVLDVHLID  243

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+EA+  A+ LALKEGL+VGISSGA  VAA++LA +PEN+GKLIV V PSFGER
Sbjct  244   EVIQVSSDEAIETAKLLALKEGLLVGISSGAAAVAAVKLAQRPENEGKLIVVVFPSFGER  303

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLSSVL+Q ++ EAE M
Sbjct  304   YLSSVLFQSIKKEAECM  320



>ref|NP_001276178.1| cysteine synthase-like [Glycine max]
 gb|ACU22789.1| unknown [Glycine max]
Length=325

 Score =   376 bits (965),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 257/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             +NI K+ ++LIG+TPLVYLN + +GC A +AAK EMM+P +S+KDR   +MI DAE+KGL
Sbjct  6     SNIAKDVTELIGKTPLVYLNHIVDGCVAKVAAKLEMMEPCSSVKDRIGHSMIVDAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPG++ LIEPTSGN GI +AF+AA KGYK+++TMPS  S+ERR  +R FGA+LVLTDPA
Sbjct  66    ITPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++ + TPN +MLQQF NP N ++H+ETTGPEIW+ + G VD  V GIG+
Sbjct  126   KGMKGAVQKAEEIRDKTPNSYMLQQFENPTNPKVHYETTGPEIWKGSSGKVDALVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGTV+G G+YLK QNP++K+YGIEP ES IL+GGKPGPH I G G GF P +LD+D+++E
Sbjct  186   GGTVTGAGKYLKEQNPDIKLYGIEPVESPILSGGKPGPHKIQGIGAGFIPGVLDVDLLDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SSEEA+  A+ LALKEGL+VGISSGA   AA+++A +PEN GKL+V V PSFGERY
Sbjct  246   VVQISSEEAIETAKLLALKEGLLVGISSGAAAAAAVKIAKRPENAGKLVVAVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ ++ EAE++
Sbjct  306   LSSVLFESVKREAESL  321



>ref|XP_010469278.1| PREDICTED: cysteine synthase, mitochondrial-like isoform X1 [Camelina 
sativa]
Length=430

 Score =   380 bits (975),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLNK+ +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I
Sbjct  112   NIADNVSQLIGKTPMVYLNKIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGRI  171

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PGK+ L+EPTSGN GI +AFIAA KGY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  172   APGKSVLVEPTSGNTGIGLAFIAASKGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  231

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++T + +MLQQF NPAN +IH+ETTGPEIWEDT G VDIFV GIG+G
Sbjct  232   GMTGAVQKAEEILKTTHDAYMLQQFDNPANPKIHYETTGPEIWEDTNGKVDIFVAGIGTG  291

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG++LK +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD ++M+EV
Sbjct  292   GTITGVGRFLKEKNPKSQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQEIMDEV  351

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EA+  A++LALKEGLMVGISSGA   AA+R+A +PEN GKLI  V PSFGERYL
Sbjct  352   IAISSDEAIEFAKQLALKEGLMVGISSGAAAAAAIRVAKRPENAGKLIAVVFPSFGERYL  411

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  412   STPLFQSIREEVEKMQP  428



>ref|XP_006376449.1| hypothetical protein POPTR_0013s13150g [Populus trichocarpa]
 gb|ABK96537.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP54246.1| hypothetical protein POPTR_0013s13150g [Populus trichocarpa]
Length=402

 Score =   379 bits (972),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 257/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MIADAE++GLI
Sbjct  84    NIAGNVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGHSMIADAEQRGLI  143

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV  + FGA+LVLTD AK
Sbjct  144   TPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLFKAFGAELVLTDAAK  203

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++++ TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  204   GMKGAVQKAEEIVKRTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFVAGIGTG  263

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP +K+ GIEP+ESNIL+GGKPGPH I G G GF P  LD DV++EV
Sbjct  264   GTISGVGRFLKEKNPKIKVIGIEPSESNILSGGKPGPHKIQGIGAGFVPRNLDRDVVDEV  323

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A+++AL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  324   IEISSDEAVETAKQVALQEGLLVGISSGAAAAAAIKVGKRPENAGKLIAVVFPSFGERYL  383

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S+VL+Q +R E E MQP P
Sbjct  384   STVLFQSIREECEKMQPEP  402



>ref|NP_191535.2| cysteine synthase C [Arabidopsis thaliana]
 sp|Q43725.3|CYSKM_ARATH RecName: Full=Cysteine synthase, mitochondrial; AltName: Full=Beta-substituted 
Ala synthase 2;2; Short=ARAth-Bsas2;2; AltName: 
Full=CSase C; Short=AtCS-C; Short=CS-C; AltName: Full=O-acetylserine 
(thiol)-lyase; AltName: Full=O-acetylserine sulfhydrylase; 
AltName: Full=OAS-TL C; Flags: Precursor [Arabidopsis 
thaliana]
 pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- 
Serine-(Thiol)-Lyase C
 pdb|4AEC|B Chain B, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- 
Serine-(Thiol)-Lyase C
 gb|AAM20572.1| cysteine synthase [Arabidopsis thaliana]
 gb|AAM91285.1| cysteine synthase [Arabidopsis thaliana]
 dbj|BAE98443.1| cysteine synthase [Arabidopsis thaliana]
 gb|AEE79963.1| cysteine synthase C [Arabidopsis thaliana]
Length=430

 Score =   380 bits (975),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 256/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I
Sbjct  112   NIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFI  171

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  172   SPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  231

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIW+DT+G VDIFV GIG+G
Sbjct  232   GMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTG  291

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  292   GTITGVGRFIKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEV  351

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LALKEGLMVGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  352   IAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAVVFPSFGERYL  411

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  412   STPLFQSIREEVEKMQP  428



>ref|NP_851022.1| cysteine synthase C [Arabidopsis thaliana]
 dbj|BAH19583.1| AT3G59760 [Arabidopsis thaliana]
 gb|AEE79962.1| cysteine synthase C [Arabidopsis thaliana]
Length=433

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 256/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I
Sbjct  112   NIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFI  171

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  172   SPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  231

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIW+DT+G VDIFV GIG+G
Sbjct  232   GMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTG  291

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  292   GTITGVGRFIKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEV  351

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LALKEGLMVGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  352   IAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAVVFPSFGERYL  411

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  412   STPLFQSIREEVEKMQP  428



>ref|XP_006664222.1| PREDICTED: cysteine synthase-like [Oryza brachyantha]
Length=325

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 253/314 (81%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG TPLVYLN+VTEGC   +AAK E M+P +S+KDR   +MI DAE+KGLI 
Sbjct  8     IAKDVTELIGNTPLVYLNRVTEGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGLII  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PGK+ LIEPTSGN GI +AF+AA KGY++VLTMP+  S+ERR+ ++ FGA+L+LTDP  G
Sbjct  68    PGKSVLIEPTSGNTGIGLAFMAAAKGYRLVLTMPASMSMERRIILKAFGAELILTDPLLG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA +L   TPN F+LQQF NPAN +IH+ETTGPEIW++T G +D FV GIG+GG
Sbjct  128   MKGAVQKAEELAAKTPNSFILQQFENPANPKIHYETTGPEIWKNTGGKIDGFVSGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YL+ QNPN+KIYG+EP ES +L+GGKPGPH I G G GF P +LD+D+++E +
Sbjct  188   TITGAGRYLREQNPNIKIYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVDLIDETV  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              VSS+EA+ +A+ LALKEGL+VGISSGA   AA+RLAS+PEN GKL V V PSFGERYLS
Sbjct  248   QVSSDEAIEIAKALALKEGLLVGISSGAAAAAAVRLASRPENAGKLFVVVFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVL+Q ++ EAE M
Sbjct  308   SVLFQTIKKEAENM  321



>ref|XP_011037378.1| PREDICTED: cysteine synthase [Populus euphratica]
Length=402

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 257/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MIADAE++GLI
Sbjct  84    NIAGNVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGDSMIADAEQRGLI  143

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV  + FGA+LVLTD AK
Sbjct  144   TPGKSVLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLFKAFGAELVLTDAAK  203

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++++ TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  204   GMKGAVQKAEEIVKRTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFVAGIGTG  263

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NP +K+ GIEP+ESNIL+GGKPGPH I G G GF P  LD DV++EV
Sbjct  264   GTISGVGRFLKEKNPKIKVIGIEPSESNILSGGKPGPHKIQGIGAGFVPRNLDQDVVDEV  323

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A+++AL+EGL+VGISSGA   AA+++  +PEN GKLI  V PSFGERYL
Sbjct  324   IEISSDEAVETAKQVALQEGLLVGISSGAAAAAAIKVGKRPENAGKLIAVVFPSFGERYL  383

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S+VL+Q +R E E MQP P
Sbjct  384   STVLFQSIREECEKMQPEP  402



>emb|CAB71290.1| O-acetylserine (thiol) lyase [Arabidopsis thaliana]
Length=387

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 256/317 (81%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    SQLIG+TP+VYLN + +GC A IAAK E+M+P  S+KDR   +M+ DAE+KG I
Sbjct  69    NIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFI  128

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  129   SPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAK  188

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIW+DT+G VDIFV GIG+G
Sbjct  189   GMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTG  248

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K +NP  ++ G+EPTES+IL+GGKPGPH I G G GF P  LD  +M+EV
Sbjct  249   GTITGVGRFIKEKNPKTQVIGVEPTESDILSGGKPGPHKIQGIGAGFIPKNLDQKIMDEV  308

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LALKEGLMVGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  309   IAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAVVFPSFGERYL  368

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  369   STPLFQSIREEVEKMQP  385



>ref|XP_006397550.1| hypothetical protein EUTSA_v10001481mg [Eutrema salsugineum]
 gb|ESQ39003.1| hypothetical protein EUTSA_v10001481mg [Eutrema salsugineum]
Length=394

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  76    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEQKGLI  135

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  136   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  195

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  196   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  255

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD  +++E 
Sbjct  256   GTITGVGRFIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDQAIVDEY  315

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  316   IAISSEEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLITVVFPSFGERYL  375

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  376   STLLFQSIREECEKMQP  392



>ref|XP_003568980.1| PREDICTED: cysteine synthase-like [Brachypodium distachyon]
Length=391

 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 260/331 (79%), Gaps = 0/331 (0%)
 Frame = +2

Query  233   AQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRP  412
             + R   +  +    NI  + +QLIG+TP+VYLNK+ +GC A +AAK E+M+P  S+KDR 
Sbjct  59    SWRCHAVATEVEGLNIADDVTQLIGKTPMVYLNKIVQGCVANVAAKLEIMEPCCSVKDRI  118

Query  413   AMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTM  592
               +MI DAE+KGLI PGK+ L+E TSGN GI +AFIAA +GYK++LTMP+  S+ERRV +
Sbjct  119   GYSMITDAEEKGLIRPGKSVLVEATSGNTGIGLAFIAASRGYKLILTMPTSMSMERRVLL  178

Query  593   RVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDT  772
             + FGA+LVLTD AKGM G + KA ++L  TPN +ML+QF NPAN ++H+ETTGPEIWED+
Sbjct  179   KAFGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEIWEDS  238

Query  773   QGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVG  952
             +G VDIF+ GIG+GGT+SG G++LK +NP +K+ G+EPTESNIL+GGKPGPH I G G G
Sbjct  239   KGKVDIFIGGIGTGGTISGSGRFLKEKNPEIKVIGVEPTESNILSGGKPGPHKIQGIGAG  298

Query  953   FKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGK  1132
             F P  LD +V++EV+ +SS+EAV  A++LAL+EGL+VGISSGA   AA+++A +PEN GK
Sbjct  299   FVPRNLDSEVLDEVIEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVAKRPENAGK  358

Query  1133  LIVTVHPSFGERYLSSVLYQELRAEAEAMQP  1225
             LIV + PSFGERYLSSVL+Q +R E E MQP
Sbjct  359   LIVVMFPSFGERYLSSVLFQSIREECEQMQP  389



>gb|KDP35151.1| hypothetical protein JCGZ_10685 [Jatropha curcas]
Length=395

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 258/316 (82%), Gaps = 0/316 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAEK+G+I
Sbjct  77    NIAEDVTQLIGKTPMVYLNNIAKGSVANIAAKLEIMEPCCSVKDRIGYSMIIDAEKRGVI  136

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TP K+ L+EPTSGN GI +AFIAA +GY+++LTMP+  S+ERRV ++ FGA+LVLTDPAK
Sbjct  137   TPEKSILVEPTSGNTGIGLAFIAASRGYRLILTMPASMSLERRVLLKAFGAELVLTDPAK  196

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF+ GIG+G
Sbjct  197   GMKGAVQKAEEILKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIAGIGTG  256

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +N N+K+ GIEP+ESNIL+GGKPGPH I G G GF P  LD D+++EV
Sbjct  257   GTISGVGRFLKEKNQNIKVIGIEPSESNILSGGKPGPHKIQGIGAGFVPRNLDQDLVDEV  316

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A+++AL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  317   IEISSDEAVETAKQVALQEGLLVGISSGAAAAAALKVGKRPENAGKLIAVVFPSFGERYL  376

Query  1175  SSVLYQELRAEAEAMQ  1222
             S+VL+Q +R E E MQ
Sbjct  377   STVLFQSIREECEKMQ  392



>ref|NP_001140754.1| uncharacterized protein LOC100272829 [Zea mays]
 gb|ACF84551.1| unknown [Zea mays]
Length=396

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 262/340 (77%), Gaps = 2/340 (1%)
 Frame = +2

Query  218   LAH--SFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPT  391
             LAH  S + R R +  +    NI    SQLIG+TP+VYLN V +G  A +AAK E+M+P 
Sbjct  57    LAHTGSSSSRCRAVAAEVEGLNIANHVSQLIGKTPMVYLNNVVKGSVANVAAKLEIMEPC  116

Query  392   ASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTS  571
              S+KDR   +MI DAE+KGLITPGK+ L+E TSGN GI +AFIAA KGYK++LTMPS  S
Sbjct  117   CSVKDRIGYSMINDAEQKGLITPGKSVLVEATSGNTGIGLAFIAASKGYKLILTMPSSMS  176

Query  572   IERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTG  751
             +ERRV +R FGA+LVLTD AKGM G V KA ++L  TPN +MLQQF NPAN ++H+ETTG
Sbjct  177   MERRVLLRAFGAELVLTDAAKGMKGAVDKATEILNKTPNSYMLQQFDNPANPKVHYETTG  236

Query  752   PEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHH  931
             PEIWED++G VDI + GIG+GGT+SG G++LK +N  +K+ GIEP+ESNIL+GGKPGPH 
Sbjct  237   PEIWEDSKGKVDILIGGIGTGGTISGAGRFLKEKNSGIKVIGIEPSESNILSGGKPGPHK  296

Query  932   ITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLAS  1111
             I G G GF P  LD D+++EV+ +SS+EAV  A++LA++EGL+VGISSGA   AA+++A 
Sbjct  297   IQGIGAGFVPRNLDSDILDEVIEISSDEAVETAKQLAVQEGLLVGISSGAAAAAAIKVAK  356

Query  1112  KPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
             +PEN GKLIV V PSFGERYLSSVLYQ +R E E MQP P
Sbjct  357   RPENAGKLIVVVFPSFGERYLSSVLYQSIREECENMQPEP  396



>ref|XP_011032482.1| PREDICTED: cysteine synthase-like [Populus euphratica]
 ref|XP_011032484.1| PREDICTED: cysteine synthase-like [Populus euphratica]
Length=322

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 255/319 (80%), Gaps = 3/319 (1%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             +I K+ ++LIG+TPLVYLN V +GC A IAAK EMM+P +S+KDR   +MI DAE+KGLI
Sbjct  7     SISKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLI  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ LIEPTSGN GI +AF+AA KGY++++TMP+  S+ERR+ +  FGA+L+LTDPA+
Sbjct  67    KPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELILTDPAR  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L  TPN ++LQQF NPAN QIH+ETTGPEIW+ + G VD FV GIG+G
Sbjct  127   GMKGAVQKAEEILAKTPNAYLLQQFENPANPQIHYETTGPEIWKGSGGKVDAFVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YLK QNP++KIYG+EP ES +L+GGKPGPH I G G GF P +LD+ +++E 
Sbjct  187   GTITGAGKYLKEQNPDIKIYGVEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVGLLDET  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A+ LALKEGL+VGISSGA   AA+ +A +PEN GKLIV + PSFGERYL
Sbjct  247   VQISSEEAIETAKLLALKEGLLVGISSGA---AAIEIAKRPENAGKLIVVIFPSFGERYL  303

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL++ ++ EAE M  VP
Sbjct  304   SSVLFESVKEEAENMVFVP  322



>ref|XP_010041625.1| PREDICTED: cysteine synthase-like isoform X2 [Eucalyptus grandis]
 ref|XP_010041631.1| PREDICTED: cysteine synthase-like isoform X2 [Eucalyptus grandis]
 ref|XP_010041637.1| PREDICTED: cysteine synthase-like isoform X2 [Eucalyptus grandis]
 ref|XP_010041645.1| PREDICTED: cysteine synthase-like isoform X2 [Eucalyptus grandis]
 ref|XP_010041653.1| PREDICTED: cysteine synthase-like isoform X2 [Eucalyptus grandis]
 ref|XP_010041660.1| PREDICTED: cysteine synthase-like isoform X2 [Eucalyptus grandis]
 gb|KCW84895.1| hypothetical protein EUGRSUZ_B01724 [Eucalyptus grandis]
Length=325

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 256/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG+TP+VYLN VT+ C A IA K EMM+P +S+KDR   +MIADAE+KGL
Sbjct  6     STIAKDVTELIGKTPMVYLNHVTDRCVARIAVKLEMMEPCSSVKDRIGYSMIADAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG++ LIEPTSGN GI +AF+AA KGYK+++TMP+  S+ERR  +R FGA+LVLTDPA
Sbjct  66    IQPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRTILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++   TPN ++LQQF NPAN +IH+ETTGPEIW+ + G +D FV GIG+
Sbjct  126   KGMKGAVQKAEEIASKTPNAYILQQFENPANPKIHYETTGPEIWKSSGGKIDAFVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QNPN+K+YGIEP ES IL+GGKPGPH I G G GF P +LD+D+++E
Sbjct  186   GGTITGAGKYLKEQNPNIKLYGIEPVESAILSGGKPGPHKIQGIGAGFIPGVLDVDLIDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SS+EA+  A++LALKEGL+VGISSGA   AA+++A +PEN GKLIV + PSFGERY
Sbjct  246   VIQISSDEAIETAKQLALKEGLLVGISSGAAAAAAMKIAKRPENAGKLIVVIFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ ++ EAE M
Sbjct  306   LSSVLFESVKREAENM  321



>ref|NP_001235628.1| cysteine synthase [Glycine max]
 gb|AAL66291.1|AF452451_1 cysteine synthase [Glycine max]
 gb|KHN35177.1| Cysteine synthase [Glycine soja]
Length=325

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/316 (61%), Positives = 257/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG+TPLVYLNK+ +GC A +AAK E+M+P +S+KDR   +MIADAE+KGL
Sbjct  6     SGIAKDVTELIGKTPLVYLNKLADGCVARVAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPGK+ LIEPTSGN GI +AF+AA +GYK+++TMP+  S+ERR+ +  FGA+LVLTDPA
Sbjct  66    ITPGKSVLIEPTSGNTGIGLAFMAAARGYKLIITMPASMSLERRIILLAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++L  TPN ++LQQF NPAN ++H+ETTGPEIW+ + G +D FV GIG+
Sbjct  126   KGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGSDGKIDAFVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QNPN+K+ G+EP ES +L+GGKPGPH I G G GF P +L++++++E
Sbjct  186   GGTITGAGKYLKEQNPNIKLIGVEPVESPVLSGGKPGPHKIQGIGAGFIPGVLEVNLLDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SS+EA+  A+ LALKEGL VGISSGA   AA ++A +PEN GKLIV V PSFGERY
Sbjct  246   VIQISSDEAIETAKLLALKEGLFVGISSGAAAAAAFQIAKRPENAGKLIVAVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ +R EAE+M
Sbjct  306   LSSVLFESVRREAESM  321



>ref|XP_009148046.1| PREDICTED: cysteine synthase [Brassica rapa]
 ref|XP_009148056.1| PREDICTED: cysteine synthase [Brassica rapa]
Length=322

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 252/317 (79%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I  + ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D F+ GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFISGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +L++++++
Sbjct  182   TGGTITGAGKYLKEQNPNVKLYGVEPIESAILSGGKPGPHKIQGIGAGFIPSVLEVNLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR LA KEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  242   EVVQVSSDESIDMARLLARKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>sp|Q00834.1|CYSK_SPIOL RecName: Full=Cysteine synthase; AltName: Full=CSase A; AltName: 
Full=O-acetylserine (thiol)-lyase; Short=OAS-TL A; AltName: 
Full=O-acetylserine sulfhydrylase [Spinacia oleracea]
 dbj|BAA01279.1| O-acetylserine(thiol)-lyase [Spinacia oleracea]
 dbj|BAG72097.1| cytoplasmic cysteine synthase [Spinacia oleracea]
Length=325

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 255/314 (81%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG+TPLVYLN V +GC A +AAK E M+P +S+KDR   +MI DAEK GLIT
Sbjct  8     IAKDVTELIGKTPLVYLNTVADGCVARVAAKLEGMEPCSSVKDRIGFSMITDAEKSGLIT  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PG++ LIEPTSGN GI +AFIAA KGYK+++TMP+  S+ERR  +R FGA+L+LTDPAKG
Sbjct  68    PGESVLIEPTSGNTGIGLAFIAAAKGYKLIITMPASMSLERRTILRAFGAELILTDPAKG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA ++ + TPN ++LQQF NPAN ++H+ETTGPEIW+ T G +DIFV GIG+GG
Sbjct  128   MKGAVQKAEEIRDKTPNSYILQQFENPANPKVHYETTGPEIWKGTGGKIDIFVSGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YLK QNP+VK+ G+EP ES +L+GGKPGPH I G G GF P +LD+++++EV+
Sbjct  188   TITGAGKYLKEQNPDVKLIGLEPVESAVLSGGKPGPHKIQGLGAGFIPGVLDVNIIDEVV  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              +SSEE++ MA+ LALKEGL+VGISSGA   AA+++A +PEN GKLIV V PSFGERYLS
Sbjct  248   QISSEESIEMAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVAVFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVL+  +R EAE+M
Sbjct  308   SVLFDSVRKEAESM  321



>gb|KHN31018.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=389

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 200/319 (63%), Positives = 256/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++G I
Sbjct  71    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRGAI  130

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  131   TPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDAAK  190

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NP+N +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  191   GMNGAVQKAEEILKSTPNAYMLQQFDNPSNPKIHYETTGPEIWEDTRGKIDILVAGIGTG  250

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTVSGVGQ+LK QNP +++ G+EP ESNIL GGKPGPH I G G GF P  LD DV++EV
Sbjct  251   GTVSGVGQFLKQQNPKIQVIGVEPLESNILTGGKPGPHKIQGIGAGFVPRNLDQDVLDEV  310

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  311   IAISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLIGVVFPSFGERYL  370

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  371   STILFQSIREECEKMQPEP  389



>emb|CDY09039.1| BnaC08g09930D [Brassica napus]
Length=312

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/317 (60%), Positives = 241/317 (76%), Gaps = 15/317 (5%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A+ I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKG
Sbjct  2     ASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S+ERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D F     
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGF-----  176

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
                       YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  177   ----------YLKEQNPNVKLYGVEPIESAILSGGKPGPHKIQGIGAGFIPSVLEVDLID  226

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR LALKEGL+VGISSGA   AA++LA +PEN GKL V V PSFGER
Sbjct  227   EVVQVSSDESIDMARLLALKEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGER  286

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  287   YLSTVLFDATRKEAESM  303



>ref|XP_001420867.1| O-acetylserinethiol lyase/cysteine synthase [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO99160.1| O-acetylserinethiol lyase/cysteine synthase [Ostreococcus lucimarinus 
CCE9901]
Length=305

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 247/301 (82%), Gaps = 0/301 (0%)
 Frame = +2

Query  317   LVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGN  496
             +VYLNK +EGCGA IAAK E+M+P  S+KDR   +MIA AE++G ITPGKTTL+EPTSGN
Sbjct  1     MVYLNKTSEGCGAEIAAKLEIMEPCCSVKDRIGWSMIAAAEEEGKITPGKTTLVEPTSGN  60

Query  497   MGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLE  676
              GI +AFIAA KGYK+ LTMP+  S+ERR+ ++ FGA+LVLTDPAKGM G V+KA ++  
Sbjct  61    TGIGLAFIAAAKGYKLTLTMPASMSLERRILLKAFGANLVLTDPAKGMKGAVQKAEEIAA  120

Query  677   STPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQN  856
              TPN ++LQQF NPAN ++HFETTGPEIWEDT G +DIFV G+G+GGT++G G+YLKS+N
Sbjct  121   KTPNSYVLQQFENPANPKVHFETTGPEIWEDTAGQIDIFVAGVGTGGTITGTGRYLKSKN  180

Query  857   PNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARE  1036
             PN+KI  +EPTES +L+GG PGPH I G G GF P ILDMDV++EV+ ++S++A++MA+E
Sbjct  181   PNIKIVAVEPTESPVLSGGGPGPHKIQGIGAGFIPGILDMDVIDEVVQIASDDAISMAKE  240

Query  1037  LALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEA  1216
             LAL+EGLMVGISSGA   AA++LA +PEN GKLI TV PSFGERYLSS LY  +R EAE 
Sbjct  241   LALQEGLMVGISSGAAAAAAIQLAKRPENAGKLITTVFPSFGERYLSSALYSTIREEAET  300

Query  1217  M  1219
             M
Sbjct  301   M  301



>gb|AAC27794.1| putative O-acetylserine(thiol)lyase precursor [Chlamydomonas 
reinhardtii]
Length=352

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 249/315 (79%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + ++LIG+TP+VYLNKV  G  A IAAK E+M+P  S+KDR   +MI+ AEK+GLI
Sbjct  32    NIATDVTELIGKTPMVYLNKVATGTHAKIAAKLEIMEPCCSVKDRIGYSMISSAEKEGLI  91

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGKT L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERR+ +R FGA+LVLTDPAK
Sbjct  92    TPGKTVLVEPTSGNTGIGLAFIAAARGYKLILTMPASMSLERRILLRAFGAELVLTDPAK  151

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L STP+ FMLQQF NP N ++H+ETTGPEIW  T G VDI V G+G+G
Sbjct  152   GMKGAVAKAEEILASTPDAFMLQQFQNPNNPKVHYETTGPEIWSATDGKVDILVSGVGTG  211

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YL+ +  +V++  +EP ES +L+GGKPGPH I G G GF P +LD  ++ EV
Sbjct  212   GTITGTGRYLREKKSDVQLVAVEPAESPVLSGGKPGPHKIQGIGAGFVPAVLDTALISEV  271

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSS++A++MAR LAL+EGLMVGISSGA   AA+++AS+PEN+GKL+V V P FGERYL
Sbjct  272   VQVSSDDAIDMARRLALEEGLMVGISSGAAVQAAIKVASRPENEGKLVVVVLPPFGERYL  331

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL+Q+LR EA  M
Sbjct  332   SSVLFQQLRDEASKM  346



>ref|XP_010041618.1| PREDICTED: cysteine synthase-like isoform X1 [Eucalyptus grandis]
Length=333

 Score =   375 bits (962),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 256/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG+TP+VYLN VT+ C A IA K EMM+P +S+KDR   +MIADAE+KGL
Sbjct  14    STIAKDVTELIGKTPMVYLNHVTDRCVARIAVKLEMMEPCSSVKDRIGYSMIADAEEKGL  73

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG++ LIEPTSGN GI +AF+AA KGYK+++TMP+  S+ERR  +R FGA+LVLTDPA
Sbjct  74    IQPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRTILRAFGAELVLTDPA  133

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++   TPN ++LQQF NPAN +IH+ETTGPEIW+ + G +D FV GIG+
Sbjct  134   KGMKGAVQKAEEIASKTPNAYILQQFENPANPKIHYETTGPEIWKSSGGKIDAFVSGIGT  193

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QNPN+K+YGIEP ES IL+GGKPGPH I G G GF P +LD+D+++E
Sbjct  194   GGTITGAGKYLKEQNPNIKLYGIEPVESAILSGGKPGPHKIQGIGAGFIPGVLDVDLIDE  253

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SS+EA+  A++LALKEGL+VGISSGA   AA+++A +PEN GKLIV + PSFGERY
Sbjct  254   VIQISSDEAIETAKQLALKEGLLVGISSGAAAAAAMKIAKRPENAGKLIVVIFPSFGERY  313

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ ++ EAE M
Sbjct  314   LSSVLFESVKREAENM  329



>emb|CDY23400.1| BnaC04g49280D [Brassica napus]
Length=389

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  71    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  130

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  131   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  190

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  191   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  250

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K + P +K+ G+EPTES IL GGKPGPH I G G GF P  LD  V++E 
Sbjct  251   GTITGVGRFIKERKPELKVIGVEPTESAILAGGKPGPHKIQGIGAGFIPKNLDQSVVDEY  310

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  311   ISISSDEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  370

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  371   STMLFQSIREECEKMQP  387



>emb|CDY30438.1| BnaA04g25390D [Brassica napus]
Length=389

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  71    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGFSMITDAEEKGLI  130

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  131   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  190

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  191   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  250

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K + P +K+ G+EPTES IL GGKPGPH I G G GF P  LD  V++E 
Sbjct  251   GTITGVGRFIKERKPELKVIGVEPTESAILAGGKPGPHKIQGIGAGFIPKNLDQSVVDEY  310

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  311   ISISSDEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  370

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  371   STMLFQSIREECEKMQP  387



>ref|XP_010534505.1| PREDICTED: cysteine synthase, mitochondrial-like [Tarenaya hassleriana]
Length=396

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 201/319 (63%), Positives = 259/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ SQLIGRTP++YLN + +GC A +A K E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  78    NIAEDISQLIGRTPMMYLNNIVKGCVANVAVKLEIMEPCCSVKDRIGYSMINDAEQKGLI  137

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI++AFIAA +GYK++LTMPS  S+ERRV ++ FGA+LVLTDPAK
Sbjct  138   TPGKSVLVEPTSGNTGIALAFIAAARGYKLILTMPSSMSLERRVLLKAFGAELVLTDPAK  197

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA  +L+ TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIFV GIG+G
Sbjct  198   GMTGAIQKAEQILKDTPNSYMLQQFDNPANPKIHYETTGPEIWEDTKGKVDIFVAGIGTG  257

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+Y+K + P VK+ GIEPTES++L+GGKPGPH I G G GF P  LD D+M+EV
Sbjct  258   GTISGVGRYIKERKPGVKVIGIEPTESDVLSGGKPGPHKIQGIGAGFAPKNLDQDIMDEV  317

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A+++ALKEG++VGISSGA   AA+++A + EN GKL+V V PSFGERYL
Sbjct  318   ITISSEEAIETAKQVALKEGILVGISSGAAAAAAIKVAKRAENAGKLVVVVFPSFGERYL  377

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S+ L+Q +R E E MQP P
Sbjct  378   STPLFQSIREECEKMQPEP  396



>ref|XP_009142968.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Brassica 
rapa]
Length=396

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  78    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  137

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  138   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  197

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  198   GMTGAIQKAEEILKNTPDSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  257

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+Y+K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD  V++E 
Sbjct  258   GTITGVGRYIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFIPKNLDQTVVDEY  317

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  318   IAISSEEAIEFAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  377

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  378   STLLFQSIRDECENMQP  394



>ref|XP_006295957.1| hypothetical protein CARUB_v10025099mg [Capsella rubella]
 gb|EOA28855.1| hypothetical protein CARUB_v10025099mg [Capsella rubella]
Length=392

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  74    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  133

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ LIE TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  134   TPGKSVLIESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  193

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN ++LQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  194   GMTGAIQKAEEILKNTPNSYILQQFDNPANPKIHYETTGPEIWEDTRGKIDILVAGIGTG  253

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG+++K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD+ +++E 
Sbjct  254   GTISGVGRFIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDLAIVDEY  313

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LALKEGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  314   IAISSEEAIETAKQLALKEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  373

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  374   STQLFQSIREECEQMQP  390



>ref|XP_006655669.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Oryza brachyantha]
Length=397

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 206/375 (55%), Positives = 275/375 (73%), Gaps = 8/375 (2%)
 Frame = +2

Query  128   MAAALTNLMKRRSFLQPSI-------FNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKK  286
              +   + L  RRS L P +         +R  +  Q   H    R   +  +    NI  
Sbjct  24    FSCCFSVLSPRRSLLLPPLARNPTLPLQSRPHHL-QTTNHPSTWRCHAVAAEVEGLNIAD  82

Query  287   ETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGK  466
             + +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI+DAE+KGLITPGK
Sbjct  83    DVTQLIGKTPMVYLNNIVKGCVANVAAKLEIMEPCCSVKDRIGYSMISDAEEKGLITPGK  142

Query  467   TTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGG  646
             + L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD +KGM G
Sbjct  143   SVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSMERRVLLKAFGAELVLTDASKGMKG  202

Query  647   TVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvs  826
              V KA ++L  TPN +MLQQF NPAN ++H+ETTGPEIWED++G VDIF+ GIG+GGT+S
Sbjct  203   AVDKATEILNKTPNAYMLQQFDNPANPKVHYETTGPEIWEDSKGKVDIFIGGIGTGGTIS  262

Query  827   gvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvs  1006
             G G++LK +N  +K+ GIEP+ESNIL+GGKPGPH I G G GF P  LD +V++EV+ +S
Sbjct  263   GAGRFLKEKNHEIKVIGIEPSESNILSGGKPGPHKIQGIGAGFVPRNLDSEVLDEVIEIS  322

Query  1007  seeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVL  1186
             S+EAV  A++LAL+EGL+VGISSGA   AA+++A +PEN GKL+V V PSFGERYLSS+L
Sbjct  323   SDEAVETAKQLALQEGLLVGISSGAAAAAAIKVAKRPENAGKLVVVVFPSFGERYLSSIL  382

Query  1187  YQELRAEAEAMQPVP  1231
             +Q +R + E MQP P
Sbjct  383   FQSIREDCEKMQPEP  397



>gb|EMT06609.1| Cysteine synthase, chloroplastic/chromoplastic [Aegilops tauschii]
Length=392

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 207/357 (58%), Positives = 270/357 (76%), Gaps = 5/357 (1%)
 Frame = +2

Query  167   FLQPSIFNTRFFNAGQPLA-----HSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLN  331
              L P  F  + F     LA      S + R   L  +    NI  + +QLIG+TP+VYLN
Sbjct  33    ILGPYFFVLKMFPGSSLLAVNAPAPSPSWRRHALATEVEGLNIADDVTQLIGKTPMVYLN  92

Query  332   KVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISM  511
             K+ +GC A +AAK E+M+P  S+KDR  ++MI+DAE+KGLITPGK+ L+E TSGN GI +
Sbjct  93    KIVKGCVANVAAKLEIMEPCCSVKDRIGISMISDAEEKGLITPGKSVLVEATSGNTGIGL  152

Query  512   AFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNG  691
             AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD AKGM G + KA ++L  TPN 
Sbjct  153   AFIAASRGYKLILTMPTSMSMERRVLLKAFGAELVLTDAAKGMKGALDKATEILNKTPNS  212

Query  692   FMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKI  871
             +ML+QF NPAN ++H+ETTGPEIWED++G VDIF+ GIG+GGT+SG G++LK +NP+VK+
Sbjct  213   YMLEQFDNPANPKVHYETTGPEIWEDSKGKVDIFIGGIGTGGTISGAGRFLKEKNPDVKV  272

Query  872   YGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKE  1051
              G+EPTESNIL+GGKPGPH I G G GF P  LD DV+ EV+ +SS+EAV  A++LAL+E
Sbjct  273   IGVEPTESNILSGGKPGPHKIQGIGAGFVPRNLDSDVLNEVIEISSDEAVETAKQLALQE  332

Query  1052  GLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQ  1222
             GL+VGISSGA   AA+++A +PEN GKLIV V PSFGERYLSSVL+Q +R E E M+
Sbjct  333   GLLVGISSGAAAAAAIKVAQRPENAGKLIVVVFPSFGERYLSSVLFQSIREECEKME  389



>ref|XP_004167180.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
Length=390

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 252/319 (79%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QL+G+TP+VYLN + +GC A +AAK EMM+P  S+KDR   +MI+DAEKKGLI
Sbjct  72    NIASDVTQLVGKTPMVYLNNIVKGCVANVAAKLEMMEPCCSVKDRIGYSMISDAEKKGLI  131

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA KGYK++L MP+  S+ERRV ++ FGA +VLT+PAK
Sbjct  132   SPGKSILVEPTSGNTGIGLAFIAASKGYKLILAMPASMSLERRVLLKAFGATVVLTNPAK  191

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+ TPN + L QF NPAN ++H+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  192   GMKGAVEKAEEILQKTPNAYKLNQFDNPANPKVHYETTGPEIWEDTKGKLDILVAGIGTG  251

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NPN+K+ GIEPT SN++NGGKPGPH I G G GF P+ LD  V++EV
Sbjct  252   GTISGVGRFLKEKNPNIKVIGIEPTASNVINGGKPGPHKIQGIGAGFIPNNLDEGVVDEV  311

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +S EEA+  A++LA++EGL+VGISSGA   AAL++A +PEN GKLI  V  SFGERYL
Sbjct  312   IEISDEEAIETAKQLAMQEGLLVGISSGATGAAALKVAKRPENAGKLIAVVFASFGERYL  371

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SS L+  +R E E MQ  P
Sbjct  372   SSALFHSIREECENMQHEP  390



>ref|XP_004135335.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
 gb|KGN51658.1| Cysteine synthase [Cucumis sativus]
Length=390

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 252/319 (79%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QL+G+TP+VYLN + +GC A +AAK EMM+P  S+KDR   +MI+DAEKKGLI
Sbjct  72    NIASDVTQLVGKTPMVYLNNIVKGCVANVAAKLEMMEPCCSVKDRIGYSMISDAEKKGLI  131

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA KGYK++L MP+  S+ERRV ++ FGA +VLT+PAK
Sbjct  132   SPGKSILVEPTSGNTGIGLAFIAASKGYKLILAMPASMSLERRVLLKAFGATVVLTNPAK  191

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+ TPN + L QF NPAN ++H+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  192   GMKGAVEKAEEILQKTPNAYKLNQFDNPANPKVHYETTGPEIWEDTKGKLDILVAGIGTG  251

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NPN+K+ GIEPT SN++NGGKPGPH I G G GF P+ LD  V++EV
Sbjct  252   GTISGVGRFLKEKNPNIKVIGIEPTASNVINGGKPGPHKIQGIGAGFIPNNLDEGVVDEV  311

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +S EEA+  A++LA++EGL+VGISSGA   AAL++A +PEN GKLI  V  SFGERYL
Sbjct  312   IEISDEEAIETAKQLAMQEGLLVGISSGATGAAALKVAKRPENAGKLIAVVFASFGERYL  371

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SS L+  +R E E MQ  P
Sbjct  372   SSALFHSIREECENMQHEP  390



>emb|CDX79804.1| BnaA05g03520D [Brassica napus]
Length=396

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  78    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  137

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  138   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  197

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  198   GMTGAIQKAEEILKNTPDSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  257

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+Y+K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD  V++E 
Sbjct  258   GTITGVGRYIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFIPKNLDQTVVDEY  317

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  318   IAISSEEAIEFAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  377

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  378   STLLFQSIRDECENMQP  394



>gb|KHG07476.1| Cysteine synthase [Gossypium arboreum]
Length=324

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 255/314 (81%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ +QLIG+TPLVYLNKV EGC A IAAK E M+P +S+KDR   +MIADAE+KG+I 
Sbjct  7     IAKDVTQLIGKTPLVYLNKVVEGCVAPIAAKLEAMEPCSSVKDRIGYSMIADAEEKGIIK  66

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PG++ LIEPTSGN GI +AF+AA KGYK+V+TMPS  S+ERR+ +R FGA+LVLTDPA+ 
Sbjct  67    PGESVLIEPTSGNTGIGLAFMAAAKGYKLVITMPSSMSLERRMVLRAFGAELVLTDPARC  126

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA ++   TPN F+LQQF NPAN +IH++TTGPEIW+ T G VDI V GIG+GG
Sbjct  127   MKGAVQKAEEIHAKTPNSFILQQFENPANPKIHYKTTGPEIWKGTGGRVDILVSGIGTGG  186

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             TV+G G+YLK QNPN+K+ G+EP ES +L+GGKPGPH I G G GF P +LD+++++EV+
Sbjct  187   TVTGAGKYLKEQNPNIKLIGVEPVESAVLSGGKPGPHKIQGLGAGFIPGVLDVNLLDEVI  246

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              +SSEEAV  A++LALKEGL+VGISSGA   AA+++A +PEN GKLIV V PSFGERYLS
Sbjct  247   QISSEEAVETAKQLALKEGLLVGISSGAAAAAAVKIAKRPENTGKLIVVVFPSFGERYLS  306

Query  1178  SVLYQELRAEAEAM  1219
             SVL++ ++ EAE M
Sbjct  307   SVLFESVKREAENM  320



>emb|CDY17914.1| BnaC04g03050D [Brassica napus]
Length=392

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 255/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  74    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  133

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  134   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  193

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TP+ +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  194   GMTGAIQKAEEILKNTPDSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  253

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+Y+K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD  V++E 
Sbjct  254   GTITGVGRYIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFIPKNLDQTVVDEY  313

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  314   IAISSEEAIEFAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  373

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  374   STLLFQSIRDECENMQP  390



>ref|XP_010551723.1| PREDICTED: cysteine synthase-like [Tarenaya hassleriana]
 ref|XP_010551724.1| PREDICTED: cysteine synthase-like [Tarenaya hassleriana]
Length=325

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 255/314 (81%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG TPLVYLN V EGC   +AAK E M+P +S+KDR   +MIADAE K LI 
Sbjct  8     IAKDVTELIGNTPLVYLNNVVEGCVGRVAAKLESMEPCSSVKDRIGYSMIADAEAKRLIK  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PG++ LIEPTSGN G+ +AF+AA KGYK+++TMP+  SIERR+ +  FGA+LVLTDPAKG
Sbjct  68    PGESVLIEPTSGNTGVGLAFMAAAKGYKLIITMPASMSIERRIILLAFGAELVLTDPAKG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V KA ++LE TP+G++LQQF NPAN +IH++TTGPEIW+ + G VD FV GIG+GG
Sbjct  128   MKGAVAKAEEILEKTPHGYILQQFENPANPKIHYKTTGPEIWKGSNGKVDGFVSGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YLK QNPN+K+YG+EP ES IL+GGKPGPH I G G GF P ILD+D+++EV+
Sbjct  188   TITGAGKYLKEQNPNIKLYGVEPVESPILSGGKPGPHKIQGIGAGFIPGILDVDLIDEVV  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              VSSEEA+ MAR LA+KEGL+VGISSGA  VAA+RLA +PEN+GKLIV + PSFGERYLS
Sbjct  248   QVSSEEAIEMARLLAVKEGLLVGISSGAAAVAAIRLAKRPENEGKLIVALFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             +VL+  +R EAEAM
Sbjct  308   TVLFDAVRKEAEAM  321



>ref|XP_009142225.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Brassica rapa]
Length=389

 Score =   376 bits (965),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  71    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  130

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  131   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  190

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  191   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  250

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K + P +K+ G+EPTES IL GGKPGPH I G G GF P  LD  V++E 
Sbjct  251   GTITGVGRFIKERKPELKVIGVEPTESAILAGGKPGPHKIQGIGAGFIPKNLDQSVVDEY  310

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  311   ISISSDEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  370

Query  1175  SSVLYQELRAEAEAMQP  1225
             S++L+Q +R E E MQP
Sbjct  371   STMLFQSIREECEKMQP  387



>ref|XP_004967885.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Setaria italica]
Length=401

 Score =   376 bits (966),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 269/349 (77%), Gaps = 4/349 (1%)
 Frame = +2

Query  185   FNTRFFNAGQPLAHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIA  364
             F TR  +A    + S + R R +  +    NI  + +QLIG+TP+VYLN + +G  A +A
Sbjct  57    FLTRIGSA----SVSSSARCRAVAAEVEGLNIANDVTQLIGKTPMVYLNNIVKGSVANVA  112

Query  365   AKQEMMQPTASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKM  544
             AK E+M+P  S+KDR   +MI DAE+KGLITPGK+ L+E TSGN GI +AFIAA KGYK+
Sbjct  113   AKLEIMEPCCSVKDRIGYSMINDAEEKGLITPGKSVLVEATSGNTGIGLAFIAASKGYKL  172

Query  545   VLTMPSYTSIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPAN  724
             +LTMPS  S+ERRV +R FGA+LVLTD AKGM G + KA ++L+ TPN +MLQQF NPAN
Sbjct  173   ILTMPSSMSMERRVLLRAFGAELVLTDAAKGMKGALDKATEILDKTPNSYMLQQFDNPAN  232

Query  725   TQIHFETTGPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNIL  904
              ++H+ETTGPEIWED++G VDIF+ GIG+GGT+SG G++LK +NP +K+ GIEP+ESNIL
Sbjct  233   PKVHYETTGPEIWEDSKGKVDIFIGGIGTGGTISGAGRFLKEKNPEIKVIGIEPSESNIL  292

Query  905   NGGKPGPHHITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGAN  1084
             +GGKPGPH I G G GF P  LD DV++EV+ +SS+EAV  A++LA++EGL+VGISSGA 
Sbjct  293   SGGKPGPHKIQGIGAGFVPRNLDSDVLDEVIEISSDEAVETAKQLAVQEGLLVGISSGAA  352

Query  1085  TVAALRLASKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
               AA+++A +PEN GKLIV + PSFGERYLSSVLYQ +R E E +QP P
Sbjct  353   AAAAIKVAKRPENAGKLIVVIFPSFGERYLSSVLYQSIREECENLQPEP  401



>gb|ABQ02253.1| O-acetylserine (thiol)lyase [Glycine soja]
Length=325

 Score =   374 bits (959),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 254/316 (80%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG+TPLVYLNK+ +GC A +AAK E+M+P +S+KDR   +MIADAE+KGL
Sbjct  6     SGIAKDVTELIGKTPLVYLNKLADGCVARVAAKLELMEPCSSVKDRIGYSMIADAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPGK+ LIEPTSGN GI +AF+AA +GYK+++TMP+  S+ERR+ +  FGA+LVLTDPA
Sbjct  66    ITPGKSVLIEPTSGNTGIGLAFMAAARGYKLIITMPASMSLERRIILLAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++L  TPN ++LQQF NPAN ++H+ETTGPEIW+ + G  D FV GIG+
Sbjct  126   KGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGSDGKTDAFVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QNPN+K+ G+EP ES +L+GGKPGPH I G G GF P +L +++++E
Sbjct  186   GGTITGAGKYLKEQNPNIKLIGVEPVESPVLSGGKPGPHKIQGIGAGFIPGVLGVNLLDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SS+EA+  A+ LALKEGL VGISSGA   A  ++A +PEN GKLIV V PSFGERY
Sbjct  246   VIQISSDEAIETAKLLALKEGLFVGISSGAAAAATFQIAKRPENAGKLIVAVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ +R EAE+M
Sbjct  306   LSSVLFESVRREAESM  321



>sp|O23735.1|CYSK2_BRAJU RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=O-acetylserine 
(thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine 
sulfhydrylase; AltName: Full=OAS-TL6 [Brassica juncea]
 emb|CAA71800.1| O-acetylserine(thiol) lyase [Brassica juncea]
Length=324

 Score =   373 bits (958),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 251/314 (80%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I  + ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKGLI 
Sbjct  7     IANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK  66

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  SIERR+ +  FG +LVLTDPAKG
Sbjct  67    PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDPAKG  126

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T+G +D F+ GIG+GG
Sbjct  127   MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTEGKIDGFISGIGTGG  186

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             T++G G+YLK QNPNVK+YG+EP ES IL+GGKPGPH I G G GF P++L+ ++++EV+
Sbjct  187   TITGAGKYLKEQNPNVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPNVLETNLIDEVV  246

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              VSS+E+++MAR LA +EGL+VGISSGA   AA++LA +PEN GKL V V PSFGERYLS
Sbjct  247   QVSSDESIDMARLLAREEGLLVGISSGAAAAAAIKLAKRPENAGKLFVAVFPSFGERYLS  306

Query  1178  SVLYQELRAEAEAM  1219
             +VL+   R EAE+M
Sbjct  307   TVLFDATRKEAESM  320



>ref|NP_001146719.1| cysteine synthase1 [Zea mays]
 gb|ACL54616.1| unknown [Zea mays]
 gb|AFW79719.1| cysteine synthase [Zea mays]
Length=398

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 264/341 (77%), Gaps = 3/341 (1%)
 Frame = +2

Query  218   LAHSFAQ---RLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQP  388
             LAH+ +    R R +  +    NI  + +QLIG TP+VYLN V +G  A +AAK E+M+P
Sbjct  58    LAHTASPPSLRCRAVAAEVGGLNIANDVTQLIGNTPMVYLNNVVKGSVANVAAKLEIMEP  117

Query  389   TASIKDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYT  568
               S+KDR   +MI DAE+KGLITPGK+ L+E TSGN GI +AFIAA KGYK++LTMPS  
Sbjct  118   CCSVKDRIGYSMINDAEQKGLITPGKSVLVEATSGNTGIGLAFIAASKGYKLILTMPSSM  177

Query  569   SIERRVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETT  748
             S+ERRV +R FGA+LVLTD AKGM G + KA ++L  TPN +MLQQF NPAN Q+H+ETT
Sbjct  178   SMERRVLLRAFGAELVLTDAAKGMKGALDKATEILNKTPNSYMLQQFDNPANPQVHYETT  237

Query  749   GPEIWEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPH  928
             GPEIWED++G VDIF+ GIG+GGT+SG G++LK +NP +K+ GIEP+ESNIL+GGKPGPH
Sbjct  238   GPEIWEDSKGKVDIFIGGIGTGGTISGAGRFLKEKNPGIKVIGIEPSESNILSGGKPGPH  297

Query  929   HITGNGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLA  1108
              I G G GF P  LD D+++EV+ +SS+EAV  A++LA++EGL+VGISSGA   AA+++A
Sbjct  298   KIQGIGAGFVPRNLDSDILDEVIEISSDEAVETAKQLAVQEGLLVGISSGAAAAAAIKVA  357

Query  1109  SKPENKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
              +PEN GKLIV V PSFGERYLSSVLYQ +R E E MQP P
Sbjct  358   KRPENAGKLIVVVFPSFGERYLSSVLYQSIREECENMQPEP  398



>emb|CDM81371.1| unnamed protein product [Triticum aestivum]
Length=392

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 202/334 (60%), Positives = 264/334 (79%), Gaps = 0/334 (0%)
 Frame = +2

Query  221   AHSFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASI  400
             A S + R   L  +    NI  + +QLIG+TP+VYLNK+ +GC A +AAK E+M+P  S+
Sbjct  56    APSPSWRRHALATEVEGLNIADDVTQLIGKTPMVYLNKIVKGCVANVAAKLEIMEPCCSV  115

Query  401   KDRPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIER  580
             KDR  ++MI+DAE+KGLITPGK+ L+E TSGN GI +AFIAA +GYK++LTMP+  S+ER
Sbjct  116   KDRIGISMISDAEEKGLITPGKSVLVEATSGNTGIGLAFIAASRGYKLILTMPTSMSMER  175

Query  581   RVTMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEI  760
             RV ++ FGA+LVLTD AKGM G + KA ++L  TPN +ML+QF NPAN ++H+ETTGPEI
Sbjct  176   RVLLKAFGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEI  235

Query  761   WEDTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITG  940
             WED++G VDIF+ GIG+GGT+SG G++LK +NP+VK+ G+EPTESNIL+GGKPGPH I G
Sbjct  236   WEDSKGKVDIFIGGIGTGGTISGAGRFLKEKNPDVKVIGVEPTESNILSGGKPGPHKIQG  295

Query  941   NGVGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPE  1120
              G GF P  LD DV+ EV+ +SS+EAV  A++LAL+EGL+VGISSGA   AA+++A +PE
Sbjct  296   IGAGFVPRNLDSDVLNEVIEISSDEAVETAKQLALQEGLLVGISSGAAAAAAIKVAQRPE  355

Query  1121  NKGKLIVTVHPSFGERYLSSVLYQELRAEAEAMQ  1222
             N GKLIV V PSFGERYLSSVL+Q +R E E M+
Sbjct  356   NAGKLIVVVFPSFGERYLSSVLFQSIREECEKME  389



>ref|XP_010508379.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=395

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  77    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  136

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  137   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  196

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  197   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  256

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+GVG+++K + P  K+ G+EPTES IL+GGKPGPH I G G GF P  LD+ +++E 
Sbjct  257   GTVTGVGRFIKERKPEFKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDLTIVDEY  316

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  317   IAISSEEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  376

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  377   STQLFQSIREECEKMQP  393



>gb|KHN32353.1| Cysteine synthase, chloroplastic/chromoplastic [Glycine soja]
Length=351

 Score =   374 bits (960),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 254/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++G I
Sbjct  33    NIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRGAI  92

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  93    TPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDAAK  152

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NP+N ++H+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  153   GMNGAVQKAEEILKSTPNSYMLQQFDNPSNPKVHYETTGPEIWEDTRGKIDILVAGIGTG  212

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTVSG GQ+LK QNP +++ G+EP ESNIL GGKPGPH I G G GF P  LD DV++EV
Sbjct  213   GTVSGAGQFLKQQNPKIQVIGVEPLESNILTGGKPGPHKIQGIGAGFVPRNLDQDVLDEV  272

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  273   IAISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLIGVVFPSFGERYL  332

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  333   STILFQSIREECEKMQPEP  351



>ref|XP_010517954.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic [Camelina 
sativa]
Length=395

 Score =   375 bits (964),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  77    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  136

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  137   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  196

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  197   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  256

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+GVG+++K + P  K+ G+EPTES IL+GGKPGPH I G G GF P  LD+ +++E 
Sbjct  257   GTVTGVGRFIKERKPEFKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDLTIVDEY  316

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  317   IAISSEEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  376

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  377   STQLFQSIREECEKMQP  393



>ref|XP_010506279.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=395

 Score =   375 bits (964),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI +  +QLIG+TP+VYLN + +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  77    NIAENAAQLIGKTPMVYLNNIVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  136

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  137   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  196

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L++TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDI V GIG+G
Sbjct  197   GMTGAIQKAEEILKNTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDILVAGIGTG  256

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTV+GVG+++K + P  K+ G+EPTES IL+GGKPGPH I G G GF P  LD+ +++E 
Sbjct  257   GTVTGVGRFIKERKPEFKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDLTIVDEY  316

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  317   IAISSEEAIETAKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  376

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  377   STQLFQSIREECEKMQP  393



>ref|XP_010466525.1| PREDICTED: putative inactive cysteine synthase 2 [Camelina sativa]
 ref|XP_010466526.1| PREDICTED: putative inactive cysteine synthase 2 [Camelina sativa]
 ref|XP_010466527.1| PREDICTED: putative inactive cysteine synthase 2 [Camelina sativa]
Length=325

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 254/315 (81%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
              I K+ ++LIG TPLVYLNKVT+ C  ++AAK EMM+P +S+KDR   +MIADAE KGLI
Sbjct  7     KIAKDVTELIGNTPLVYLNKVTKDCVGHVAAKLEMMEPCSSVKDRIGYSMIADAEAKGLI  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ LIEPTSGN G+ +AF+AA KGYK+V+TMP+  SIERR+ +  FGA+LVLTDPAK
Sbjct  67    KPGESVLIEPTSGNTGVGLAFVAAAKGYKLVITMPASMSIERRIILLAFGAELVLTDPAK  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V KA ++L  TPNG+MLQQF NPANT+IH+ETTGPEIW+   G VDIFV GIG+G
Sbjct  127   GMKGAVAKAEEILAKTPNGYMLQQFENPANTKIHYETTGPEIWKGCGGKVDIFVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YLK QNP +K+YG+EP ES IL+GGKPGPH I G G GF P ILD+D+M+EV
Sbjct  187   GTLTGAGKYLKEQNPKIKLYGVEPVESPILSGGKPGPHKIQGIGAGFIPGILDVDLMDEV  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + VSSEE+++MAR LA +EGL+VGISSGA   AA++LA KPEN GKLIV V PSFGERYL
Sbjct  247   IQVSSEESIDMARLLAREEGLLVGISSGAAAAAAIKLAKKPENAGKLIVVVFPSFGERYL  306

Query  1175  SSVLYQELRAEAEAM  1219
             S+VL+   R EAE M
Sbjct  307   STVLFDATRKEAEKM  321



>ref|XP_003518876.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 
1 [Glycine max]
Length=394

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 254/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++G I
Sbjct  76    NIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRGAI  135

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  136   TPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDAAK  195

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NP+N ++H+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  196   GMNGAVQKAEEILKSTPNSYMLQQFDNPSNPKVHYETTGPEIWEDTRGKIDILVAGIGTG  255

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTVSG GQ+LK QNP +++ G+EP ESNIL GGKPGPH I G G GF P  LD DV++EV
Sbjct  256   GTVSGAGQFLKQQNPKIQVIGVEPLESNILTGGKPGPHKIQGIGAGFVPRNLDQDVLDEV  315

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  316   IAISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLIGVVFPSFGERYL  375

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  376   STILFQSIREECEKMQPEP  394



>gb|ACU19896.1| unknown [Glycine max]
Length=389

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 255/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++G I
Sbjct  71    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGFSMINDAEQRGAI  130

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+EPTSGN GI +AFIAA +GYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  131   TPGKSILVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVLLKAFGAELVLTDAAK  190

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L+STPN +MLQQF NP+N +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  191   GMNGAVQKAEEILKSTPNAYMLQQFDNPSNPKIHYETTGPEIWEDTRGKIDILVAGIGTG  250

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GTVSGVGQ+LK QNP +++ G+EP ESNIL GGKPGPH I G G GF P  LD DV++EV
Sbjct  251   GTVSGVGQFLKQQNPKIQVIGVEPLESNILTGGKPGPHKIQGIGAGFVPRNLDQDVLDEV  310

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  311   IAISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLIGVVFPSFGERYL  370

Query  1175  SSVLYQELRAEAEAMQPVP  1231
              ++L+Q +R E E MQP P
Sbjct  371   FTILFQSIREECEKMQPEP  389



>ref|XP_008446019.1| PREDICTED: cysteine synthase [Cucumis melo]
Length=389

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 254/319 (80%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI  + +QL+G+TP+VYLN + +GC A +AAK EMM+P  S+KDR   +MI DAE+KGLI
Sbjct  71    NIASDVTQLVGKTPMVYLNNIVKGCVANVAAKLEMMEPCCSVKDRIGYSMITDAEQKGLI  130

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             +PGK+ L+EPTSGN GI +AFIAA KGYK++L MP+  S+ERRV ++ FGA +VLT+PAK
Sbjct  131   SPGKSVLVEPTSGNTGIGLAFIAASKGYKLILAMPASMSLERRVLLKAFGAKVVLTNPAK  190

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++L++TPN +ML QF NPAN ++H+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  191   GMKGAVEKAEEILKNTPNAYMLHQFDNPANPKVHYETTGPEIWEDTKGKLDILVAGIGTG  250

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVG++LK +NPN+K+ GIEPT SN++NGGKPGPH I G G GF P+ LD  V++EV
Sbjct  251   GTISGVGRFLKEKNPNIKVIGIEPTASNVINGGKPGPHKIQGIGAGFIPNNLDESVVDEV  310

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + ++ EEAV  A++LA++EGL+VGISSGA   AAL++A +PEN GKL+  V  SFGERYL
Sbjct  311   IEITDEEAVETAKQLAMQEGLLVGISSGATAAAALKVAKRPENAGKLVAVVFASFGERYL  370

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             SSVL+  +R E E MQ  P
Sbjct  371   SSVLFHSIREECENMQHEP  389



>ref|XP_010435053.1| PREDICTED: cysteine synthase 1-like [Camelina sativa]
Length=322

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A  I K+ ++LIG TPLVYLN VTEGC   +AAK EMM+P +S+KDR   +MI+DAEK+G
Sbjct  2     ACRIAKDVTELIGNTPLVYLNNVTEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKQG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  SIERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA KPEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAKKPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>ref|XP_002881929.1| hypothetical protein ARALYDRAFT_903778 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58188.1| hypothetical protein ARALYDRAFT_903778 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 253/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    +QLIG+TP+VYLN V +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  74    NIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  133

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  134   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  193

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L+ TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  194   GMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKIDILVAGIGTG  253

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD+ +++E 
Sbjct  254   GTITGVGRFIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDLAIVDEY  313

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  +++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  314   IAISSEEAIETSKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  373

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  374   STQLFQSIREECEQMQP  390



>ref|XP_004299115.1| PREDICTED: cysteine synthase-like [Fragaria vesca subsp. vesca]
Length=325

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 256/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG+TPLVYLN + +GC A IAAK EMM+P +S+KDR   +MIADAE KGL
Sbjct  6     SGIAKDVTELIGKTPLVYLNHIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEAKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPG++ LIEPTSGN GI +AF+AA K Y++++TMP+  SIERR+ +R FGA+LVLTDPA
Sbjct  66    ITPGQSVLIEPTSGNTGIGLAFMAAAKQYRLIITMPASMSIERRIILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V+KA ++L  TPN +MLQQF NPAN ++H+ETTGPEIWE T G +D FV GIG+
Sbjct  126   KGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWEGTGGKIDAFVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK +NP+VK+YG+EP ES +L GGKPGPH I G G GF P +L++++++E
Sbjct  186   GGTITGAGKYLKEKNPSVKLYGVEPVESPVLTGGKPGPHKIQGIGAGFIPGVLEVNIIDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SS+EA+  A+ LA KEGL+VGISSGA   AA+++A +PEN GKLIV V PSFGERY
Sbjct  246   VIQISSDEAIETAKLLATKEGLLVGISSGAAAAAAIKIAKRPENAGKLIVVVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ +R EAE+M
Sbjct  306   LSSVLFESVRKEAESM  321



>ref|XP_010277228.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
 ref|XP_010277235.1| PREDICTED: cysteine synthase [Nelumbo nucifera]
Length=325

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 256/316 (81%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
               I K+ ++LIG+TPLVYLN +T+GC A IAAK EMM+P +S+KDR   +MI DAE+KGL
Sbjct  6     CTIAKDVTELIGKTPLVYLNNITDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG+T LIEPTSGN GI +AF+AA KGYK+++TMP+  S+ERR+ +R FGA++ LTDPA
Sbjct  66    IRPGETVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILRAFGAEVFLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KG+ G V+KA ++L  TPN ++LQQF NPAN +IH+ETTGPEIW+ T G VD F+ GIG+
Sbjct  126   KGVKGAVQKAEEILAKTPNAYILQQFENPANPKIHYETTGPEIWKGTAGKVDAFISGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G++LK +NP++K+YG+EP ES +L+GGKPGPH I G G GF P +L++D+++E
Sbjct  186   GGTITGAGKFLKEKNPDIKLYGVEPVESAVLSGGKPGPHKIQGIGAGFIPAVLEVDLIDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ +SS+EA+  A+ LALKEGL+ GISSGA   AAL++A +PEN GKLIV + PSFGERY
Sbjct  246   VIQISSDEAIETAKLLALKEGLLTGISSGAAAAAALKIAKRPENAGKLIVVIFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++ +R EAE+M
Sbjct  306   LSSVLFESVRKEAESM  321



>gb|KDP23623.1| hypothetical protein JCGZ_23456 [Jatropha curcas]
Length=325

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 256/314 (82%), Gaps = 0/314 (0%)
 Frame = +2

Query  278   IKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLIT  457
             I K+ ++LIG+TPLVYLN V +GC A IAAK EMM+P +S+KDR   +MIADAE+KGLI 
Sbjct  8     IAKDVTELIGKTPLVYLNHVVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIK  67

Query  458   PGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAKG  637
             PG++ LIEPTSGN GI +AF+AA KGYK+++TMP+  S+ERR+ +R FGA+LVLTDPA+G
Sbjct  68    PGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRMVLRAFGAELVLTDPARG  127

Query  638   MGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsgg  817
             M G V+KA ++L  TPN ++LQQF NPAN +IH+ETTGPEIW+ + G VD  V GIG+GG
Sbjct  128   MKGAVQKAEEILAKTPNAYILQQFENPANPKIHYETTGPEIWKGSGGKVDALVSGIGTGG  187

Query  818   tvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeevl  997
             TV+G G+YLK QNP++KIYGIEP ES +L+GGKPGPH I G G GF P +LD+ +++EV+
Sbjct  188   TVTGAGRYLKEQNPDIKIYGIEPVESAVLSGGKPGPHKIQGIGAGFIPGVLDVSLLDEVV  247

Query  998   mvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYLS  1177
              VSSEEA+  A+ LALKEGL+VGISSGA   AA+R+A +PEN GKLIV V PSFGERYLS
Sbjct  248   QVSSEEAIETAKLLALKEGLLVGISSGAAAAAAIRIAKRPENAGKLIVVVFPSFGERYLS  307

Query  1178  SVLYQELRAEAEAM  1219
             SVL++ ++ EAE+M
Sbjct  308   SVLFESVKREAESM  321



>gb|AFK33382.1| unknown [Lotus japonicus]
Length=325

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 253/316 (80%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             T +  + ++LIG TPLVYLN++ +GC   IAAK EMM+P +S+KDR   +MIADAE+KGL
Sbjct  6     TTVANDVTELIGNTPLVYLNRIVDGCVGRIAAKLEMMEPCSSVKDRIGYSMIADAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG++ LIE TSGN GI +AF+AA KGYK+++TMPS  S+ERR  +R FGA+LVLTDPA
Sbjct  66    IKPGESVLIEATSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             +GM G V+KA ++ E TPN ++LQQF NPAN ++H+ETTGPEIW+ + G VD  V GIG+
Sbjct  126   RGMKGAVQKAEEIREKTPNSYILQQFENPANPKVHYETTGPEIWKSSNGKVDALVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QNP VK+YG+EP+ES IL+GGKPGPH I G G GF P ILD+D+++E
Sbjct  186   GGTITGAGKYLKEQNPGVKLYGVEPSESAILSGGKPGPHKIQGIGAGFIPGILDVDILDE  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ VSSEEAV  A+ LALKEGL+VGISSGA   AA++LA +PEN GKLIV V PSFGERY
Sbjct  246   VVQVSSEEAVETAKLLALKEGLLVGISSGAAAAAAIKLARRPENDGKLIVVVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAM  1219
             LSSVL++  + EAE+M
Sbjct  306   LSSVLFEATKREAESM  321



>ref|XP_002499947.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61205.1| predicted protein [Micromonas sp. RCC299]
Length=360

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 247/316 (78%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
              NI    +QL+G TP+VYLNKVT+GC A IAAK E+M+P  S+KDR   +MIA AE+KG 
Sbjct  41    VNIADNVTQLVGCTPMVYLNKVTDGCVAEIAAKLEIMEPCCSVKDRIGFSMIASAEEKGE  100

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             ITPGKT L+EPTSGN GI +AFI+A KGY + LTMP+  S+ERR+ ++ FGADLVLTDPA
Sbjct  101   ITPGKTQLVEPTSGNTGIGLAFISAAKGYNLTLTMPASMSLERRILLKAFGADLVLTDPA  160

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G V KA +L    P+ ++LQQF NPAN ++HFETTGPEIWEDT G +DI V G+G+
Sbjct  161   KGMKGAVMKAEELAAGNPDAYILQQFENPANPKVHFETTGPEIWEDTAGQIDILVCGVGT  220

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGTV+G G+YLKS+NPNVK+  +EP ES +L+G  PGPH I G G GF P ILD D+++E
Sbjct  221   GGTVTGTGRYLKSKNPNVKVVAVEPKESAVLSGSGPGPHKIQGIGAGFIPGILDTDLLDE  280

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             ++ V S++A+ MA++LALKEGLMVGISSGA  +AA+ LA +PEN GKLI TV PSFGERY
Sbjct  281   IIQVGSDDAIEMAKQLALKEGLMVGISSGAAALAAIELAKRPENAGKLIATVFPSFGERY  340

Query  1172  LSSVLYQELRAEAEAM  1219
             LSS LY  +R EAEAM
Sbjct  341   LSSALYSTIREEAEAM  356



>ref|XP_004247562.1| PREDICTED: cysteine synthase [Solanum lycopersicum]
Length=325

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 254/320 (79%), Gaps = 0/320 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             T I K+ ++LIG TPLVYLN V +GC A +AAK E M+P +S+KDR   +MI DAE+KGL
Sbjct  6     TGIAKDVTELIGNTPLVYLNNVVDGCVARVAAKLESMEPCSSVKDRIGYSMITDAEEKGL  65

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG++ LIEPTSGN G+ +AF+AA KGYK+++TMPS  S+ERR+ +R FGA+LVLTDPA
Sbjct  66    IKPGESVLIEPTSGNTGVGLAFMAAAKGYKLIITMPSSMSLERRIILRAFGAELVLTDPA  125

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G + KA ++   TPN ++LQQF NPAN +IH+ETTGPEIW+ + G VD  V GIG+
Sbjct  126   KGMKGAISKAEEIRGKTPNSYILQQFENPANPKIHYETTGPEIWKGSNGKVDALVSGIGT  185

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YL+ QNPN+K+YG+EP ES IL+GGKPGPH I G G GF P +L+++++++
Sbjct  186   GGTITGSGKYLREQNPNIKLYGVEPVESAILSGGKPGPHKIQGIGAGFVPGVLEVNLIDD  245

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ VSS+E++ MA+ LALKEGL+VGISSGA   AA+++A +PEN GKLIV V PSFGERY
Sbjct  246   VVQVSSDESIEMAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVVFPSFGERY  305

Query  1172  LSSVLYQELRAEAEAMQPVP  1231
             LSSVL++ +R EAE M   P
Sbjct  306   LSSVLFETVRREAENMTVEP  325



>gb|KHN31439.1| Cysteine synthase [Glycine soja]
Length=325

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 258/315 (82%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             +I K+ ++LIG+TPLVYLN++ +GC A +AAK EMM+P +S+KDR   +MI DAE+KGLI
Sbjct  7     SIAKDVTELIGKTPLVYLNRIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEEKGLI  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPG++ LIEPTSGN GI +AF+AA KGYK+++TMPS  S+ERR  +R FGA+LVLTDPAK
Sbjct  67    TPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPAK  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++ + TPN ++LQQF NPAN +IH+ETTGPEIW+ + G VD  V GIG+G
Sbjct  127   GMKGAVQKAEEIRDKTPNSYILQQFENPANPKIHYETTGPEIWKGSSGKVDALVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YLK QNP++K+YGIEP ES IL+GGKPGPH I G G GF P +LD+D+++EV
Sbjct  187   GTITGAGKYLKDQNPDIKLYGIEPVESPILSGGKPGPHKIQGIGAGFIPGVLDVDLLDEV  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A+ LALKEGL+VGISSGA   AA+++A +PEN GKLI+ V PSFGERYL
Sbjct  247   VQISSEEAIETAKLLALKEGLLVGISSGAAAAAAIKIAKRPENAGKLIIAVFPSFGERYL  306

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL++ ++ EAE+M
Sbjct  307   SSVLFESVKREAESM  321



>ref|XP_008223611.1| PREDICTED: cysteine synthase-like [Prunus mume]
Length=400

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 257/319 (81%), Gaps = 0/319 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI ++ +QLIG+TP+VYLN + +G  A IAAK E+M+P  S+KDR   +MI DAE++GLI
Sbjct  82    NIAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIIDAEQRGLI  141

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
              PG++ L+EPTSGN GI +AFIAA KGYK++LTMP+  S+ERRV ++ FGA+LVLTD AK
Sbjct  142   KPGQSVLVEPTSGNTGIGLAFIAATKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAK  201

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++ +STPN +MLQQF NPAN +IH+ETTGPEIWEDT+G VDIF+ GIG+G
Sbjct  202   GMKGAVQKAEEIFKSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTG  261

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT+SGVGQ+LK +NP +KI G+EP+ESNIL+GGKPGPH I G G GF P  L  DV++E+
Sbjct  262   GTISGVGQFLKEKNPRIKIIGVEPSESNILSGGKPGPHKIQGIGAGFIPRNLHQDVVDEI  321

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SS+EAV  A++LAL+EGL+VGISSGA   AAL++  +PEN GKLI  V PSFGERYL
Sbjct  322   IEISSDEAVETAKQLALQEGLLVGISSGAAAAAALKVGKRPENAGKLITVVFPSFGERYL  381

Query  1175  SSVLYQELRAEAEAMQPVP  1231
             S++L+Q +R E E MQP P
Sbjct  382   STILFQSIREECEKMQPEP  400



>ref|XP_002457554.1| hypothetical protein SORBIDRAFT_03g009260 [Sorghum bicolor]
 gb|EES02674.1| hypothetical protein SORBIDRAFT_03g009260 [Sorghum bicolor]
Length=402

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 261/335 (78%), Gaps = 0/335 (0%)
 Frame = +2

Query  227   SFAQRLRDLPKDFPATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKD  406
             S + R R +  +    NI    +QLIG+TP+VYLN V +G  A +AAK E+M+P  S+KD
Sbjct  68    SPSSRCRAVAAEVEGLNIADNVTQLIGKTPMVYLNNVVKGSVANVAAKLEIMEPCCSVKD  127

Query  407   RPAMAMIADAEKKGLITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRV  586
             R   +MI DAE++GLITPGK+ L+E TSGN GI +AFIAA KGYK++LTMPS  S+ERRV
Sbjct  128   RIGYSMINDAEERGLITPGKSVLVEATSGNTGIGLAFIAASKGYKLILTMPSSMSMERRV  187

Query  587   TMRVFGADLVLTDPAKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWE  766
              +R FGA+LVLTD AKGM G V KA ++L  TPN +MLQQF NPAN ++H+ETTGPEIWE
Sbjct  188   LLRAFGAELVLTDAAKGMKGAVDKATEILNKTPNSYMLQQFDNPANPKVHYETTGPEIWE  247

Query  767   DTQGNVDIFVMgigsggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNG  946
             D++G VDIF+ GIG+GGT+SG G++LK +NP +K+ GIEP+ESNIL+GGKPGPH I G G
Sbjct  248   DSKGKVDIFIGGIGTGGTISGAGRFLKEKNPGIKVIGIEPSESNILSGGKPGPHKIQGIG  307

Query  947   VGFKPDIldmdvmeevlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENK  1126
              GF P  LD D+++EV+ +SS+EAV  A++LA++EGL+VGISSGA   AA+++A +PEN 
Sbjct  308   AGFVPRNLDSDILDEVIEISSDEAVETAKQLAVQEGLLVGISSGAAAAAAIKVAKRPENA  367

Query  1127  GKLIVTVHPSFGERYLSSVLYQELRAEAEAMQPVP  1231
             GKLIV V PSFGERYLS+VLYQ +R E E MQP P
Sbjct  368   GKLIVVVFPSFGERYLSTVLYQSIREECENMQPEP  402



>gb|ACL54626.1| unknown [Zea mays]
 gb|ACN34696.1| unknown [Zea mays]
 tpg|DAA47607.1| TPA: cysteine synthase isoform 1 [Zea mays]
 tpg|DAA47608.1| TPA: cysteine synthase isoform 2 [Zea mays]
 tpg|DAA47609.1| TPA: cysteine synthase isoform 3 [Zea mays]
Length=325

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 250/315 (79%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             +I K+ ++LIG TPLVYLNKVT+GC   +AAK E M+P +S+KDR   +MI DAE+KGLI
Sbjct  7     SIAKDVTELIGNTPLVYLNKVTDGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGLI  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPG + LIEPTSGN GI +AF+AA KGYK+ LTMP+  S+ERR+ ++ FGA+LVLTDP  
Sbjct  67    TPGVSVLIEPTSGNTGIGLAFMAAAKGYKLTLTMPASMSMERRIILKAFGAELVLTDPLL  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G VKKA ++   TPN ++LQQF NPAN +IH+ETTGPEIW+ T G +D  V GIG+G
Sbjct  127   GMKGAVKKAEEIQAKTPNSYILQQFENPANPKIHYETTGPEIWKATAGKIDGLVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YL+ QNPNVK+YG+EP ES +LNGGKPGPH I G G GF P +LD+D+++E 
Sbjct  187   GTITGTGRYLREQNPNVKLYGVEPVESAVLNGGKPGPHKIQGIGAGFIPGVLDVDLLDET  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             L VSS+EA+  A+ LALKEGL+VGISSGA   AA+RLA +PEN GKL V V PSFGERYL
Sbjct  247   LQVSSDEAIETAKALALKEGLLVGISSGAAAAAAVRLAKRPENAGKLFVVVFPSFGERYL  306

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL+Q ++ EAE+M
Sbjct  307   SSVLFQSIKKEAESM  321



>ref|XP_010449974.1| PREDICTED: cysteine synthase 1-like [Camelina sativa]
Length=322

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 254/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  269   ATNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKG  448
             A  I K+ ++LIG TPLVYLNKV EGC   +AAK EMM+P +S+KDR   +MI+DAEK+G
Sbjct  2     ACRIAKDVTELIGNTPLVYLNKVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKQG  61

Query  449   LITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDP  628
             LI PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  SIERR+ +  FG +LVLTDP
Sbjct  62    LIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDP  121

Query  629   AKGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgig  808
             AKGM G + KA ++L  TPNG++LQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG
Sbjct  122   AKGMKGAIAKAEEILAKTPNGYILQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIG  181

Query  809   sggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvme  988
             +GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++
Sbjct  182   TGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDIID  241

Query  989   evlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGER  1168
             EV+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA KPEN GKL V + PSFGER
Sbjct  242   EVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAKKPENAGKLFVAIFPSFGER  301

Query  1169  YLSSVLYQELRAEAEAM  1219
             YLS+VL+   R EAE+M
Sbjct  302   YLSTVLFDATRKEAESM  318



>dbj|BAF02052.1| cytosolic O-acetylserine(thiol)lyase [Arabidopsis thaliana]
Length=487

 Score =   377 bits (968),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 197/316 (62%), Positives = 252/316 (80%), Gaps = 0/316 (0%)
 Frame = +2

Query  272   TNIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGL  451
             + I K+ ++LIG TPLVYLN V EGC   +AAK EMM+P +S+KDR   +MI+DAEKKGL
Sbjct  168   SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGL  227

Query  452   ITPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPA  631
             I PG++ LIEPTSGN G+ +AF AA KGYK+++TMP+  S ERR+ +  FG +LVLTDPA
Sbjct  228   IKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPA  287

Query  632   KGMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigs  811
             KGM G + KA ++L  TPNG+MLQQF NPAN +IH+ETTGPEIW+ T G +D FV GIG+
Sbjct  288   KGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGT  347

Query  812   ggtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmee  991
             GGT++G G+YLK QN NVK+YG+EP ES IL+GGKPGPH I G G GF P +L++D+++E
Sbjct  348   GGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDE  407

Query  992   vlmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERY  1171
             V+ VSS+E+++MAR+LALKEGL+VGISSGA   AA++LA +PEN GKL V + PSFGERY
Sbjct  408   VVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERY  467

Query  1172  LSSVLYQELRAEAEAM  1219
             LS+VL+   R EAEAM
Sbjct  468   LSTVLFDATRKEAEAM  483



>ref|NP_181903.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
 ref|NP_001189745.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
 sp|P47999.2|CYSKP_ARATH RecName: Full=Cysteine synthase, chloroplastic/chromoplastic; 
AltName: Full=At.OAS.7-4; AltName: Full=Beta-substituted Ala 
synthase 2;1; Short=ARAth-Bsas2;1; AltName: Full=CSase B; 
Short=AtCS-B; Short=CS-B; AltName: Full=O-acetylserine (thiol)-lyase; 
AltName: Full=O-acetylserine sulfhydrylase; AltName: 
Full=OAS-TL B; AltName: Full=cpACS1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB64031.1| cysteine synthase (cpACS1) [Arabidopsis thaliana]
 emb|CAB71292.1| O-acetylserine (thiol) lyase B [Arabidopsis thaliana]
 emb|CAA56594.2| O-acetylserine (thiol) lyase [Arabidopsis thaliana]
 gb|AAL38816.1| cysteine synthase cpACS1 [Arabidopsis thaliana]
 gb|AAM20315.1| putative cysteine synthase cpACS1 [Arabidopsis thaliana]
 gb|AAM63361.1| cysteine synthase cpACS1 [Arabidopsis thaliana]
 dbj|BAE98603.1| cysteine synthase [Arabidopsis thaliana]
 gb|AEC10317.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
 gb|AEC10318.1| O-acetylserine (thiol) lyase (OAS-TL) isoform oasB [Arabidopsis 
thaliana]
Length=392

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 253/317 (80%), Gaps = 0/317 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             NI    +QLIG+TP+VYLN V +GC A +AAK E+M+P  S+KDR   +MI DAE+KGLI
Sbjct  74    NIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLI  133

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPGK+ L+E TSGN GI +AFIAA KGYK++LTMP+  S+ERRV +R FGA+LVLT+PAK
Sbjct  134   TPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAK  193

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G ++KA ++L+ TPN +MLQQF NPAN +IH+ETTGPEIWEDT+G +DI V GIG+G
Sbjct  194   GMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGKIDILVAGIGTG  253

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++GVG+++K + P +K+ G+EPTES IL+GGKPGPH I G G GF P  LD+ +++E 
Sbjct  254   GTITGVGRFIKERKPELKVIGVEPTESAILSGGKPGPHKIQGIGAGFVPKNLDLAIVDEY  313

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  +++LAL+EGL+VGISSGA   AA+++A +PEN GKLI  V PSFGERYL
Sbjct  314   IAISSEEAIETSKQLALQEGLLVGISSGAAAAAAIQVAKRPENAGKLIAVVFPSFGERYL  373

Query  1175  SSVLYQELRAEAEAMQP  1225
             S+ L+Q +R E E MQP
Sbjct  374   STQLFQSIREECEQMQP  390



>ref|NP_001238392.1| cysteine synthase [Glycine max]
 gb|ABO15564.1| cysteine synthase [Glycine max]
Length=325

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = +2

Query  275   NIKKETSQLIGRTPLVYLNKVTEGCGAYIAAKQEMMQPTASIKDRPAMAMIADAEKKGLI  454
             +I K+ ++LIG+TPLVYLN++ +GC A +AAK EMM+P +S+KDR   +MI DAE+KG I
Sbjct  7     SIAKDVTELIGKTPLVYLNRIVDGCVAKVAAKLEMMEPCSSVKDRIGYSMIVDAEEKGFI  66

Query  455   TPGKTTLIEPTSGNMGISMAFIAAMKGYKMVLTMPSYTSIERRVTMRVFGADLVLTDPAK  634
             TPG++ LIEPTSGN GI +AF+AA KGYK+++TMPS  S+ERR  +R FGA+LVLTDPAK
Sbjct  67    TPGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPSSMSLERRTILRAFGAELVLTDPAK  126

Query  635   GMGGTVKKAYDLLESTPNGFMLQQFSNPANTQIHFETTGPEIWEDTQGNVDIFVMgigsg  814
             GM G V+KA ++ + TPN ++LQQF NPAN +IH+ETTGPEIW+ + G VD  V GIG+G
Sbjct  127   GMKGAVQKAEEIRDKTPNSYILQQFENPANPKIHYETTGPEIWKGSSGKVDALVSGIGTG  186

Query  815   gtvsgvgQYLKSQNPNVKIYGIEPTESNILNGGKPGPHHITGNGVGFKPDIldmdvmeev  994
             GT++G G+YLK QNP++K+YGIEP ES IL+GGKPGPH I G G GF P +LD+D+++EV
Sbjct  187   GTITGAGKYLKDQNPDIKLYGIEPVESPILSGGKPGPHKIQGIGAGFIPGVLDVDLLDEV  246

Query  995   lmvsseeAVNMARELALKEGLMVGISSGANTVAALRLASKPENKGKLIVTVHPSFGERYL  1174
             + +SSEEA+  A+ LALKEGL+VGISSGA   AA+++A +PEN GKLI+ V PSFGERYL
Sbjct  247   VQISSEEAIETAKLLALKEGLLVGISSGAAAAAAIKIAKRPENAGKLIIAVFPSFGERYL  306

Query  1175  SSVLYQELRAEAEAM  1219
             SSVL++ +R EAE+M
Sbjct  307   SSVLFESVRREAESM  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3808606879987