BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20966_g5_i1 len=3693 path=[24353:0-2791 17108:2792-2815
17132:2816-3692]

Length=3693
                                                                      Score     E

ref|XP_009792268.1|  PREDICTED: uncharacterized protein LOC104239349   1034   0.0      
ref|XP_009604232.1|  PREDICTED: uncharacterized protein LOC104099...   1006   0.0      
ref|XP_009604233.1|  PREDICTED: uncharacterized protein LOC104099...    990   0.0      
emb|CDP16676.1|  unnamed protein product                                978   0.0      
ref|XP_004234229.1|  PREDICTED: uncharacterized protein LOC101267...    978   0.0      
ref|XP_009603069.1|  PREDICTED: uncharacterized protein LOC104098110    973   0.0      
ref|XP_009804675.1|  PREDICTED: uncharacterized protein LOC104249864    963   0.0      
ref|XP_011098854.1|  PREDICTED: uncharacterized protein LOC105177410    937   0.0      
ref|XP_010660786.1|  PREDICTED: uncharacterized protein LOC100266440    862   0.0      
ref|XP_006599039.1|  PREDICTED: uncharacterized protein LOC100775...    811   0.0      
gb|KHN10822.1|  hypothetical protein glysoja_027435                     808   0.0      
ref|XP_006604139.1|  PREDICTED: uncharacterized protein LOC100783...    796   0.0      
ref|XP_010248932.1|  PREDICTED: uncharacterized protein LOC104591...    761   0.0      
ref|XP_007161753.1|  hypothetical protein PHAVU_001G095700g             748   0.0      
ref|XP_010317389.1|  PREDICTED: uncharacterized protein LOC101267...    735   0.0      
ref|XP_010248934.1|  PREDICTED: uncharacterized protein LOC104591...    714   0.0      
ref|XP_006338685.1|  PREDICTED: uncharacterized protein LOC102601194    694   0.0      
ref|XP_004231790.1|  PREDICTED: uncharacterized protein LOC101246002    684   0.0      
ref|XP_010111604.1|  hypothetical protein L484_017629                   650   0.0      
gb|EYU34792.1|  hypothetical protein MIMGU_mgv1a000774mg                643   0.0      
ref|XP_010250787.1|  PREDICTED: uncharacterized protein LOC104592935    642   0.0      
gb|KDP46310.1|  hypothetical protein JCGZ_10150                         640   0.0      
ref|XP_002509546.1|  conserved hypothetical protein                     631   0.0      Ricinus communis
ref|XP_006447110.1|  hypothetical protein CICLE_v10014104mg             631   0.0      
gb|KDO55628.1|  hypothetical protein CISIN_1g001323mg                   630   0.0      
ref|XP_007031806.1|  F28J7.14 protein, putative isoform 1               625   0.0      
emb|CBI40057.3|  unnamed protein product                                613   0.0      
gb|KHG12394.1|  Myosin-H heavy chain                                    610   0.0      
ref|XP_002298610.2|  hypothetical protein POPTR_0001s34080g             598   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011006910.1|  PREDICTED: uncharacterized protein LOC105112767    598   0.0      
ref|XP_008341316.1|  PREDICTED: uncharacterized protein LOC103404206    595   0.0      
ref|XP_007217648.1|  hypothetical protein PRUPE_ppa001023mg             592   0.0      
ref|XP_008450078.1|  PREDICTED: uncharacterized protein LOC103491...    593   0.0      
ref|XP_008231148.1|  PREDICTED: uncharacterized protein LOC103330360    593   0.0      
ref|XP_004303991.1|  PREDICTED: uncharacterized protein LOC101295544    590   0.0      
ref|XP_004145715.1|  PREDICTED: uncharacterized protein LOC101208084    588   0.0      
ref|XP_004166049.1|  PREDICTED: uncharacterized protein LOC101224875    588   0.0      
ref|XP_008379131.1|  PREDICTED: uncharacterized protein LOC103442...    587   0.0      
ref|XP_008379130.1|  PREDICTED: uncharacterized protein LOC103442...    587   0.0      
gb|KDO55629.1|  hypothetical protein CISIN_1g001323mg                   584   0.0      
ref|XP_009371670.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    584   0.0      
ref|XP_007031807.1|  F28J7.14 protein, putative isoform 2               577   0.0      
gb|KHG27738.1|  hypothetical protein F383_11185                         590   0.0      
ref|XP_008379132.1|  PREDICTED: uncharacterized protein LOC103442...    570   0.0      
gb|KHG27739.1|  hypothetical protein F383_11185                         589   2e-180   
ref|XP_004513997.1|  PREDICTED: uncharacterized protein LOC101491530    569   4e-180   
ref|XP_010248936.1|  PREDICTED: uncharacterized protein LOC104591...    564   7e-180   
ref|XP_003555120.1|  PREDICTED: uncharacterized protein LOC100818...    568   7e-179   
gb|KHN24270.1|  hypothetical protein glysoja_043203                     566   3e-178   
ref|XP_010248935.1|  PREDICTED: uncharacterized protein LOC104591...    564   1e-177   
ref|XP_010496437.1|  PREDICTED: uncharacterized protein LOC104773506    558   1e-176   
ref|XP_010669952.1|  PREDICTED: uncharacterized protein LOC104887065    559   2e-176   
ref|XP_007151538.1|  hypothetical protein PHAVU_004G055300g             560   4e-176   
ref|XP_002884258.1|  hypothetical protein ARALYDRAFT_317012             556   6e-176   
ref|XP_008783793.1|  PREDICTED: uncharacterized protein LOC103702930    561   1e-175   
ref|XP_010930139.1|  PREDICTED: uncharacterized protein LOC105051...    559   1e-174   
gb|KDO81961.1|  hypothetical protein CISIN_1g0039202mg                  545   6e-174   
ref|XP_010655431.1|  PREDICTED: uncharacterized protein LOC100254476    555   9e-174   
ref|XP_006484067.1|  PREDICTED: uncharacterized protein LOC102623...    548   7e-173   
gb|EPS67291.1|  hypothetical protein M569_07484                         545   2e-172   
ref|XP_002514952.1|  conserved hypothetical protein                     551   2e-172   Ricinus communis
ref|XP_006299859.1|  hypothetical protein CARUB_v10016062mg             546   2e-172   
ref|XP_006438080.1|  hypothetical protein CICLE_v10030641mg             546   3e-172   
ref|XP_007225287.1|  hypothetical protein PRUPE_ppa001362mg             543   4e-172   
ref|XP_006438081.1|  hypothetical protein CICLE_v10030641mg             546   9e-172   
ref|XP_008222064.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    548   1e-171   
emb|CBI27581.3|  unnamed protein product                                537   5e-171   
ref|NP_186830.1|  uncharacterized protein                               542   1e-170   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98842.1|  hypothetical protein                                   541   2e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408550.1|  hypothetical protein EUTSA_v10020012mg             535   4e-168   
ref|XP_008360127.1|  PREDICTED: uncharacterized protein LOC103423821    538   5e-168   
ref|XP_010436731.1|  PREDICTED: uncharacterized protein LOC104720537    525   4e-167   
ref|XP_002312634.2|  hypothetical protein POPTR_0008s17750g             531   1e-165   Populus trichocarpa [western balsam poplar]
ref|XP_009372322.1|  PREDICTED: uncharacterized protein LOC103961496    531   4e-165   
gb|KDO55630.1|  hypothetical protein CISIN_1g001323mg                   527   5e-164   
gb|KCW53022.1|  hypothetical protein EUGRSUZ_J02316                     515   2e-163   
ref|XP_010029012.1|  PREDICTED: uncharacterized protein LOC104419151    526   7e-163   
ref|XP_009406405.1|  PREDICTED: uncharacterized protein LOC103989324    528   8e-163   
ref|XP_008804456.1|  PREDICTED: uncharacterized protein LOC103717...    513   2e-162   
ref|XP_002315621.2|  hypothetical protein POPTR_0010s06780g             519   4e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010033393.1|  PREDICTED: uncharacterized protein LOC104422695    518   1e-161   
ref|XP_006845237.1|  hypothetical protein AMTR_s00005p00258190          514   6e-161   
ref|XP_006361551.1|  PREDICTED: uncharacterized protein LOC102578599    520   6e-161   
ref|XP_010913133.1|  PREDICTED: uncharacterized protein LOC105038912    509   6e-161   
ref|XP_011041529.1|  PREDICTED: uncharacterized protein LOC105137...    519   7e-161   
ref|XP_011041533.1|  PREDICTED: uncharacterized protein LOC105137...    519   7e-161   
ref|XP_010103204.1|  hypothetical protein L484_006756                   518   1e-160   
ref|XP_010524262.1|  PREDICTED: uncharacterized protein LOC104802377    514   2e-160   
ref|XP_010278999.1|  PREDICTED: uncharacterized protein LOC104613...    510   6e-160   
ref|XP_010279000.1|  PREDICTED: uncharacterized protein LOC104613...    508   9e-160   
ref|NP_001078088.1|  uncharacterized protein                            511   1e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011029662.1|  PREDICTED: uncharacterized protein LOC105129...    517   1e-159   
gb|KHN07401.1|  hypothetical protein glysoja_012699                     509   1e-159   
ref|XP_011029659.1|  PREDICTED: uncharacterized protein LOC105129...    517   1e-159   
ref|XP_006576839.1|  PREDICTED: uncharacterized protein LOC100777...    509   2e-159   
ref|XP_010928480.1|  PREDICTED: uncharacterized protein LOC105050...    505   3e-159   
ref|XP_006576843.1|  PREDICTED: uncharacterized protein LOC100777...    505   4e-159   
ref|XP_003553424.1|  PREDICTED: uncharacterized protein LOC100804...    507   9e-159   
gb|KHN05077.1|  hypothetical protein glysoja_013984                     512   1e-158   
ref|XP_006604379.1|  PREDICTED: uncharacterized protein LOC100804...    503   2e-158   
gb|KDP26777.1|  hypothetical protein JCGZ_17935                         514   2e-158   
ref|XP_010025335.1|  PREDICTED: uncharacterized protein LOC104415699    511   4e-158   
ref|XP_004239198.1|  PREDICTED: uncharacterized protein LOC101265024    511   2e-157   
ref|XP_003625192.1|  hypothetical protein MTR_7g092460                  500   2e-157   
ref|XP_007045031.1|  Uncharacterized protein isoform 1                  511   2e-157   
ref|XP_011033284.1|  PREDICTED: uncharacterized protein LOC105131...    503   2e-157   
ref|XP_006850138.1|  hypothetical protein AMTR_s00022p00233300          503   2e-157   
ref|XP_011033285.1|  PREDICTED: uncharacterized protein LOC105131...    499   4e-157   
ref|XP_004493542.1|  PREDICTED: uncharacterized protein LOC101494...    499   5e-157   
emb|CDX91925.1|  BnaC03g32270D                                          504   5e-157   
ref|XP_009615808.1|  PREDICTED: uncharacterized protein LOC104108475    509   1e-156   
gb|KHG22020.1|  Phospholipid--sterol O-acyltransferase -like protein    511   2e-156   
ref|XP_008795713.1|  PREDICTED: uncharacterized protein LOC103711377    497   2e-156   
ref|XP_010257255.1|  PREDICTED: uncharacterized protein LOC104597431    501   3e-156   
ref|XP_007144029.1|  hypothetical protein PHAVU_007G123200g             520   6e-156   
ref|XP_004310056.1|  PREDICTED: uncharacterized protein LOC101302325    506   1e-155   
ref|XP_002282962.2|  PREDICTED: uncharacterized protein LOC100253823    495   2e-155   Vitis vinifera
ref|XP_002526750.1|  conserved hypothetical protein                     498   2e-155   Ricinus communis
gb|KHG27481.1|  Pre-mRNA-processing factor 19                           504   4e-155   
ref|XP_009761880.1|  PREDICTED: uncharacterized protein LOC104213993    504   6e-155   
ref|XP_010682835.1|  PREDICTED: uncharacterized protein LOC104897609    498   9e-155   
gb|KDP37358.1|  hypothetical protein JCGZ_06812                         496   1e-154   
gb|KHN30580.1|  hypothetical protein glysoja_030017                     504   1e-154   
ref|XP_009391818.1|  PREDICTED: uncharacterized protein LOC103977891    492   3e-154   
ref|XP_004957173.1|  PREDICTED: uncharacterized protein LOC101757500    493   2e-153   
ref|XP_006490049.1|  PREDICTED: uncharacterized protein LOC102611...    491   7e-153   
gb|KDO57226.1|  hypothetical protein CISIN_1g003892mg                   491   8e-153   
ref|XP_009134581.1|  PREDICTED: uncharacterized protein LOC103858888    492   3e-152   
ref|XP_007162261.1|  hypothetical protein PHAVU_001G137700g             490   3e-152   
emb|CDX74320.1|  BnaA03g27270D                                          492   4e-152   
ref|XP_002322696.2|  hypothetical protein POPTR_0016s05200g             486   5e-152   Populus trichocarpa [western balsam poplar]
emb|CDP10087.1|  unnamed protein product                                489   5e-152   
ref|XP_002462561.1|  hypothetical protein SORBIDRAFT_02g028255          488   6e-152   Sorghum bicolor [broomcorn]
ref|XP_004495366.1|  PREDICTED: uncharacterized protein LOC101504...    494   9e-152   
ref|XP_006421474.1|  hypothetical protein CICLE_v10004356mg             488   9e-152   
ref|XP_007204273.1|  hypothetical protein PRUPE_ppa001635mg             487   1e-151   
ref|XP_009418204.1|  PREDICTED: uncharacterized protein LOC103998...    484   3e-151   
ref|XP_009418203.1|  PREDICTED: uncharacterized protein LOC103998...    484   3e-151   
emb|CBI29891.3|  unnamed protein product                                482   3e-151   
ref|XP_007028895.1|  Nucleolar protein gar2-related isoform 2           483   4e-151   
ref|XP_007028894.1|  Nucleolar protein gar2-related isoform 1           486   5e-151   
gb|ABA96901.1|  expressed protein                                       487   4e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960725.1|  PREDICTED: uncharacterized protein LOC101785...    487   5e-150   
ref|XP_003590840.1|  hypothetical protein MTR_1g075790                  489   6e-150   
gb|KCW53021.1|  hypothetical protein EUGRSUZ_J02316                     484   9e-150   
ref|XP_008356497.1|  PREDICTED: uncharacterized protein LOC103420...    479   2e-149   
ref|XP_008356498.1|  PREDICTED: uncharacterized protein LOC103420...    479   4e-149   
ref|XP_003574740.1|  PREDICTED: uncharacterized protein LOC100845006    478   5e-149   
ref|XP_011020299.1|  PREDICTED: uncharacterized protein LOC105122726    481   5e-149   
ref|XP_006663923.1|  PREDICTED: uncharacterized protein LOC102711391    484   5e-149   
ref|XP_008240833.1|  PREDICTED: uncharacterized protein LOC103339339    481   7e-149   
ref|XP_011029663.1|  PREDICTED: uncharacterized protein LOC105129...    487   2e-148   
ref|XP_009345114.1|  PREDICTED: uncharacterized protein LOC103936...    478   3e-148   
ref|XP_009345116.1|  PREDICTED: uncharacterized protein LOC103936...    475   4e-148   
ref|NP_001062183.1|  Os08g0505200                                       474   6e-148   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60373.1|  hypothetical protein TRIUR3_21199                       475   1e-147   
dbj|BAK07252.1|  predicted protein                                      480   2e-147   
ref|XP_006659567.1|  PREDICTED: uncharacterized protein LOC102707702    473   3e-147   
ref|XP_008651773.1|  PREDICTED: uncharacterized protein LOC100384...    475   6e-147   
ref|XP_011071208.1|  PREDICTED: uncharacterized protein LOC105156...    479   6e-147   
ref|XP_011071210.1|  PREDICTED: uncharacterized protein LOC105156...    478   8e-147   
ref|XP_006381030.1|  hypothetical protein POPTR_0006s05550g             471   1e-146   
ref|XP_009791126.1|  PREDICTED: uncharacterized protein LOC104238...    478   1e-146   
gb|EMT23332.1|  hypothetical protein F775_06572                         472   2e-146   
ref|XP_009791125.1|  PREDICTED: uncharacterized protein LOC104238...    478   2e-146   
ref|XP_010238583.1|  PREDICTED: uncharacterized protein LOC100821761    478   2e-146   
ref|XP_007028896.1|  Nucleolar protein gar2-related isoform 3           473   3e-146   
ref|XP_010057656.1|  PREDICTED: uncharacterized protein LOC104445437    473   3e-146   
gb|KHG14195.1|  myoH                                                    474   4e-146   
ref|XP_008662663.1|  PREDICTED: uncharacterized protein LOC103641028    476   4e-146   
gb|KHG14194.1|  myoH                                                    474   6e-146   
ref|XP_006363839.1|  PREDICTED: uncharacterized protein LOC102597...    473   9e-146   
ref|XP_006363841.1|  PREDICTED: uncharacterized protein LOC102597...    469   1e-145   
ref|XP_009630632.1|  PREDICTED: uncharacterized protein LOC104120...    474   2e-145   
ref|XP_011086757.1|  PREDICTED: uncharacterized protein LOC105168391    477   2e-145   
ref|XP_009630631.1|  PREDICTED: uncharacterized protein LOC104120...    474   3e-145   
ref|XP_004234749.1|  PREDICTED: uncharacterized protein LOC101260514    471   3e-145   
ref|XP_009769977.1|  PREDICTED: uncharacterized protein LOC104220...    468   3e-145   
dbj|BAC53933.1|  hypothetical protein                                   468   5e-145   Nicotiana tabacum [American tobacco]
ref|XP_010506045.1|  PREDICTED: uncharacterized protein LOC104782733    464   1e-144   
ref|XP_010508591.1|  PREDICTED: uncharacterized protein LOC104785140    464   1e-144   
gb|EEE52991.1|  hypothetical protein OsJ_35667                          473   2e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009769974.1|  PREDICTED: uncharacterized protein LOC104220...    469   2e-144   
gb|EYU39889.1|  hypothetical protein MIMGU_mgv1a002696mg                463   3e-144   
ref|XP_004166567.1|  PREDICTED: uncharacterized LOC101213868            468   5e-144   
ref|XP_004151009.1|  PREDICTED: uncharacterized protein LOC101213868    467   6e-144   
ref|XP_008442265.1|  PREDICTED: uncharacterized protein LOC103486172    467   6e-144   
ref|XP_010111442.1|  hypothetical protein L484_028102                   467   9e-144   
ref|XP_004304320.1|  PREDICTED: uncharacterized protein LOC101299504    466   2e-143   
ref|XP_008339316.1|  PREDICTED: uncharacterized protein LOC103402348    460   3e-143   
gb|EAZ09559.1|  hypothetical protein OsI_31838                          464   1e-142   Oryza sativa Indica Group [Indian rice]
ref|NP_001063524.1|  Os09g0487200                                       463   1e-142   Oryza sativa Japonica Group [Japonica rice]
gb|EYU42105.1|  hypothetical protein MIMGU_mgv1a001198mg                465   3e-142   
ref|XP_009600559.1|  PREDICTED: uncharacterized protein LOC104095...    460   3e-142   
emb|CAN81894.1|  hypothetical protein VITISV_042522                     471   3e-142   Vitis vinifera
ref|XP_008643808.1|  PREDICTED: uncharacterized protein LOC100382...    459   4e-142   
ref|NP_181761.1|  nucleolar protein gar2-like protein                   458   4e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293794.1|  hypothetical protein CARUB_v10022776mg             458   5e-142   
ref|XP_009600555.1|  PREDICTED: uncharacterized protein LOC104095...    461   2e-141   
ref|XP_009418206.1|  PREDICTED: uncharacterized protein LOC103998...    455   2e-141   
emb|CDP13321.1|  unnamed protein product                                466   6e-141   
ref|XP_006411492.1|  hypothetical protein EUTSA_v10016357mg             455   7e-141   
ref|XP_004973859.1|  PREDICTED: uncharacterized protein LOC101774...    456   7e-141   
ref|XP_006660764.1|  PREDICTED: uncharacterized protein LOC102709200    459   2e-140   
ref|XP_002879979.1|  hypothetical protein ARALYDRAFT_483324             453   2e-140   
gb|AFV66585.1|  LSG                                                     454   3e-140   
gb|AFV66581.1|  LSG                                                     453   6e-140   
gb|AFV66586.1|  LSG                                                     453   8e-140   
gb|AFV66580.1|  LSG                                                     453   8e-140   
ref|XP_008392120.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    456   1e-139   
ref|XP_010524226.1|  PREDICTED: uncharacterized protein LOC104802359    452   2e-139   
ref|XP_010238293.1|  PREDICTED: uncharacterized protein LOC100822798    455   2e-139   
gb|AFV66584.1|  LSG                                                     451   3e-139   
ref|XP_006402842.1|  hypothetical protein EUTSA_v10005822mg             451   3e-139   
gb|EMT23515.1|  hypothetical protein F775_02218                         456   3e-139   
gb|AFV66582.1|  LSG                                                     451   4e-139   
ref|XP_006339938.1|  PREDICTED: uncharacterized protein LOC102578258    458   6e-139   
gb|ABG21937.1|  expressed protein                                       454   8e-139   
gb|AFV66579.1|  LSG                                                     448   4e-138   
ref|XP_002444781.1|  hypothetical protein SORBIDRAFT_07g027880          447   1e-137   Sorghum bicolor [broomcorn]
ref|XP_011075189.1|  PREDICTED: uncharacterized protein LOC105159...    451   1e-137   
emb|CDY47964.1|  BnaA04g24420D                                          444   1e-137   
ref|XP_011075190.1|  PREDICTED: uncharacterized protein LOC105159...    450   2e-137   
ref|XP_010672738.1|  PREDICTED: uncharacterized protein LOC104889256    448   4e-137   
ref|XP_006290682.1|  hypothetical protein CARUB_v10016776mg             445   4e-137   
ref|XP_004233605.1|  PREDICTED: uncharacterized protein LOC101268546    452   6e-137   
ref|XP_008450082.1|  PREDICTED: uncharacterized protein LOC103491...    446   3e-136   
ref|XP_009142054.1|  PREDICTED: uncharacterized protein LOC103865941    439   1e-135   
emb|CAB41177.1|  putative protein                                       440   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191337.2|  uncharacterized protein                               440   3e-135   Arabidopsis thaliana [mouse-ear cress]
gb|KDO55631.1|  hypothetical protein CISIN_1g001323mg                   445   3e-134   
ref|XP_010516407.1|  PREDICTED: uncharacterized protein LOC104792...    437   5e-134   
ref|XP_010928483.1|  PREDICTED: uncharacterized protein LOC105050...    437   5e-134   
ref|XP_004973857.1|  PREDICTED: uncharacterized protein LOC101774...    438   7e-134   
ref|XP_002878171.1|  hypothetical protein ARALYDRAFT_486231             435   4e-133   
emb|CDY53495.1|  BnaC04g02610D                                          430   3e-132   
dbj|BAB10586.1|  unnamed protein product                                428   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540405.1|  PREDICTED: uncharacterized protein LOC104814...    435   4e-131   
ref|XP_007031809.1|  F28J7.14 protein, putative isoform 4               436   7e-131   
ref|XP_010442054.1|  PREDICTED: uncharacterized protein LOC104725146    428   1e-129   
ref|NP_199137.2|  uncharacterized protein                               429   4e-129   Arabidopsis thaliana [mouse-ear cress]
gb|EMS58521.1|  hypothetical protein TRIUR3_09895                       426   7e-129   
ref|XP_010494294.1|  PREDICTED: uncharacterized protein LOC104771465    426   8e-128   
emb|CDX88965.1|  BnaA04g02210D                                          417   8e-128   
ref|XP_010481889.1|  PREDICTED: uncharacterized protein LOC104760629    425   9e-128   
ref|XP_010928485.1|  PREDICTED: uncharacterized protein LOC105050...    417   9e-128   
emb|CDX79881.1|  BnaA05g02750D                                          416   2e-127   
gb|EPS74447.1|  hypothetical protein M569_00306                         411   3e-127   
ref|XP_002865440.1|  predicted protein                                  417   4e-127   
emb|CDY14825.1|  BnaC04g48220D                                          415   1e-126   
gb|EYU25921.1|  hypothetical protein MIMGU_mgv1a021104mg                426   1e-126   
emb|CDY47667.1|  BnaC04g24040D                                          414   1e-126   
gb|KDO57230.1|  hypothetical protein CISIN_1g003892mg                   416   3e-126   
gb|KDO57229.1|  hypothetical protein CISIN_1g003892mg                   415   5e-126   
ref|XP_007045032.1|  Uncharacterized protein isoform 2                  422   2e-125   
ref|XP_009139010.1|  PREDICTED: uncharacterized protein LOC103863026    409   6e-125   
ref|XP_007028897.1|  Nucleolar protein gar2-related isoform 4           407   1e-124   
ref|XP_007028898.1|  Nucleolar protein gar2-related isoform 5           407   2e-124   
ref|XP_010540404.1|  PREDICTED: uncharacterized protein LOC104814...    417   3e-124   
ref|XP_010540402.1|  PREDICTED: uncharacterized protein LOC104814...    417   3e-124   
ref|XP_009142821.1|  PREDICTED: uncharacterized protein LOC103866623    406   5e-124   
emb|CDY43600.1|  BnaC09g17390D                                          414   9e-124   
emb|CDY46489.1|  BnaA02g36730D                                          409   4e-123   
ref|XP_009114011.1|  PREDICTED: uncharacterized protein LOC103839258    410   3e-122   
gb|EPS72150.1|  hypothetical protein M569_02605                         412   7e-122   
gb|KCW90261.1|  hypothetical protein EUGRSUZ_A02411                     394   3e-118   
ref|XP_009123872.1|  PREDICTED: uncharacterized protein LOC103848806    400   3e-118   
ref|XP_006606930.1|  PREDICTED: uncharacterized protein LOC100782261    399   6e-117   
ref|NP_001168390.1|  uncharacterized protein LOC100382159               379   6e-114   Zea mays [maize]
dbj|BAJ85160.1|  predicted protein                                      372   3e-112   
emb|CDY32963.1|  BnaA09g16300D                                          380   2e-111   
ref|XP_006399169.1|  hypothetical protein EUTSA_v10012820mg             377   3e-111   
ref|XP_006403275.1|  hypothetical protein EUTSA_v10003145mg             381   3e-111   
ref|NP_196310.2|  uncharacterized protein                               376   9e-111   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11151.1|  unnamed protein product                                373   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122310.1|  PREDICTED: uncharacterized protein LOC103847033    374   4e-110   
ref|XP_010423278.1|  PREDICTED: uncharacterized protein LOC104708410    370   7e-109   
ref|XP_010452641.1|  PREDICTED: uncharacterized protein LOC104734707    367   2e-107   
ref|XP_010491284.1|  PREDICTED: uncharacterized protein LOC104768896    363   4e-106   
ref|XP_006287137.1|  hypothetical protein CARUB_v10000308mg             362   8e-106   
gb|EEC69055.1|  hypothetical protein OsI_37901                          350   3e-105   
ref|XP_002970153.1|  hypothetical protein SELMODRAFT_410939             357   7e-104   
ref|XP_006589278.1|  PREDICTED: putative leucine-rich repeat-cont...    360   2e-103   
ref|XP_006589277.1|  PREDICTED: putative leucine-rich repeat-cont...    360   2e-103   
ref|XP_001766285.1|  predicted protein                                  353   3e-103   
ref|XP_001764536.1|  predicted protein                                  345   5e-102   
emb|CDX98969.1|  BnaC09g48660D                                          350   1e-101   
ref|XP_010520070.1|  PREDICTED: uncharacterized protein LOC104799318    349   2e-101   
ref|XP_002871241.1|  hypothetical protein ARALYDRAFT_487508             348   6e-101   
ref|NP_001170428.1|  uncharacterized protein LOC100384417               337   9e-101   
ref|XP_008804457.1|  PREDICTED: uncharacterized protein LOC103717...    343   1e-99    
gb|AFW56726.1|  hypothetical protein ZEAMMB73_979442                    342   7e-99    
ref|XP_006280082.1|  hypothetical protein CARUB_v10025966mg             338   4e-97    
ref|XP_010517748.1|  PREDICTED: uncharacterized protein LOC104793152    327   6e-96    
tpg|DAA39226.1|  TPA: hypothetical protein ZEAMMB73_716077              314   3e-91    
ref|XP_008364521.1|  PREDICTED: uncharacterized protein LOC103428203    305   3e-85    
ref|XP_010489624.1|  PREDICTED: uncharacterized protein LOC104767275    286   5e-84    
dbj|BAD93748.1|  hypothetical protein                                   271   2e-78    
ref|XP_010928484.1|  PREDICTED: uncharacterized protein LOC105050...    281   4e-78    
ref|XP_008360650.1|  PREDICTED: uncharacterized protein LOC103424338    263   5e-75    
ref|XP_008367385.1|  PREDICTED: uncharacterized protein LOC103431016    261   2e-74    
ref|XP_008368278.1|  PREDICTED: uncharacterized protein LOC103431882    258   5e-74    
gb|EMT26321.1|  hypothetical protein F775_15560                         260   4e-73    
ref|XP_008361841.1|  PREDICTED: uncharacterized protein LOC103425...    263   5e-71    
ref|XP_008361840.1|  PREDICTED: uncharacterized protein LOC103425...    263   2e-70    
ref|XP_008340192.1|  PREDICTED: uncharacterized protein LOC103403144    240   6e-68    
gb|EMT26320.1|  hypothetical protein F775_15559                         233   5e-65    
ref|XP_002984118.1|  hypothetical protein SELMODRAFT_120004             233   4e-64    
ref|XP_008664021.1|  PREDICTED: uncharacterized protein LOC103642546    218   2e-60    
dbj|BAJ86259.1|  predicted protein                                      217   5e-60    
ref|XP_006845238.1|  hypothetical protein AMTR_s00005p00258270          211   1e-57    
gb|AGW24464.1|  hypothetical protein                                    169   9e-45    
ref|XP_010518048.1|  PREDICTED: uncharacterized protein LOC104793...    173   4e-44    
gb|EAY82687.1|  hypothetical protein OsI_37902                          160   1e-37    
ref|NP_001146753.1|  uncharacterized protein LOC100280355               149   1e-37    
ref|XP_010266035.1|  PREDICTED: uncharacterized protein LOC104603654    132   1e-31    
gb|AFV66583.1|  LSG                                                     126   1e-27    
gb|AAM61597.1|  unknown                                                 114   1e-24    
dbj|BAJ92328.1|  predicted protein                                      107   4e-21    
ref|XP_002894017.1|  hypothetical protein ARALYDRAFT_891455             101   5e-21    
gb|KHN26999.1|  hypothetical protein glysoja_042088                   98.6    1e-19    
ref|XP_010243037.1|  PREDICTED: uncharacterized protein LOC104587...  99.8    3e-19    
ref|NP_001176859.1|  Os12g0236050                                     99.4    7e-19    
ref|XP_009351399.1|  PREDICTED: uncharacterized protein LOC103942925  97.1    2e-18    
ref|XP_002865441.1|  predicted protein                                96.7    3e-18    
dbj|BAB10585.1|  unnamed protein product                              95.5    6e-18    
emb|CDY46488.1|  BnaA02g36720D                                        93.6    7e-18    
ref|XP_010484869.1|  PREDICTED: uncharacterized protein LOC104763161  94.0    1e-17    
gb|KHN18299.1|  hypothetical protein glysoja_042396                   80.1    2e-13    
gb|AEX12511.1|  hypothetical protein 2_4510_01                        68.6    2e-09    
gb|AEX12509.1|  hypothetical protein 2_4510_01                        68.6    2e-09    
gb|AEX12508.1|  hypothetical protein 2_4510_01                        66.2    8e-09    
gb|AEX12510.1|  hypothetical protein 2_4510_01                        63.9    5e-08    
ref|XP_005851174.1|  hypothetical protein CHLNCDRAFT_137813           66.6    5e-08    
gb|KHN32939.1|  hypothetical protein glysoja_041789                   63.5    1e-07    
gb|KDD73704.1|  hypothetical protein H632_c1911p0                     62.0    3e-07    
ref|XP_001698284.1|  hypothetical protein CHLREDRAFT_93782            55.8    9e-05    



>ref|XP_009792268.1| PREDICTED: uncharacterized protein LOC104239349 [Nicotiana sylvestris]
 ref|XP_009792269.1| PREDICTED: uncharacterized protein LOC104239349 [Nicotiana sylvestris]
 ref|XP_009792270.1| PREDICTED: uncharacterized protein LOC104239349 [Nicotiana sylvestris]
Length=1066

 Score =  1034 bits (2673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/1100 (56%), Positives = 781/1100 (71%), Gaps = 54/1100 (5%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MVLG  G+TR  PSVQ EYLI+I EIKPWPPS SL+TL+AV+I+WEH DK+SGST QV P
Sbjct  1     MVLGLKGRTRNSPSVQVEYLIHIKEIKPWPPSHSLRTLRAVLIEWEHEDKHSGSTNQVVP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                T SG+G+GRIEFNESFR+P+TLLRE S K  +G+ FQKNC+EF+LYEPRRD TVKGQ
Sbjct  61    SSGTGSGIGDGRIEFNESFRLPVTLLRETSLKGGDGNAFQKNCVEFHLYEPRRDKTVKGQ  120

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGTA+ID A+YGVV+E L++  PINCKR+YRNT QPLL LKIQ   + R++S +R+ ++
Sbjct  121   LLGTAIIDLADYGVVRESLSICPPINCKRTYRNTAQPLLFLKIQIGERSRVRSSLRDKLK  180

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvn---sssavesncssPHQ  875
             RE+SMD +   S+S L++EEY +EAE ASYTDDD    SS ++   SSS  ESN  SP Q
Sbjct  181   REASMDRNG--SLSRLLSEEYADEAEFASYTDDDDDDVSSHLSVPVSSSTNESNYGSPPQ  238

Query  876   KENGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDW  1055
             +E+ SEG K+     E+ +VL  ++++ N+D+   ++ + SLN S S S +   S    W
Sbjct  239   EEDRSEGVKSSPRRDEDENVLDYKKRLANMDETPETKSLPSLNGSLSHSSTDLSSDLA-W  297

Query  1056  ISKKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQR  1235
             ISKKIG  ++I+ STS   D   E T N  +     +Q + ++ + +N E+ ++  S+Q 
Sbjct  298   ISKKIGGCSSIQYSTSNVSDITEE-TQNACMIIKQDKQVQCMEQIPVNGESVNEQSSRQN  356

Query  1236  TE--ESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTLS-NGIQEDARTGVSDNGLAE  1406
             ++  E  C    +  DDN N  ++V +   ++I+E+ ST   N + +DAR  V+ NG  +
Sbjct  357   SDPAEKACPIPHIT-DDNNNFVSTVSNFSDSEIEENTSTPPVNSLCDDARAAVTKNGSVD  415

Query  1407  GENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNS  1586
             GEN+EG+Q N Q              GKE + ++GQC   E ++   +++T K  L+   
Sbjct  416   GENSEGYQQNEQ--------------GKEPMEDEGQCKNDESISCYSEEDTVKHDLKETH  461

Query  1587  AIIAGRESVGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSN  1760
             AI A R+S GAK++   +E L HV SV +  ESNR +GSV SNQ +++D   S  G +SN
Sbjct  462   AISAYRDSSGAKSSTPDNEILKHVMSVRSSPESNRGDGSVGSNQLLVQDTLKSARGFSSN  521

Query  1761  DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVH  1940
             + KD K   ++T+N++LE K  +LEQ+++MLEGELREAAA+E+GL+SVVAEHG S NKVH
Sbjct  522   ERKDQKASPRDTTNILLESKIHKLEQRVKMLEGELREAAAIEVGLYSVVAEHGCSMNKVH  581

Query  1941  APARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAA  2120
             APARRLSR Y HACKE SVL+R SAA+S +SG+ L+AKACG+DV RLTFWLSN V+LRA 
Sbjct  582   APARRLSRFYLHACKETSVLKRGSAAKSAISGIYLIAKACGHDVARLTFWLSNSVVLRAT  641

Query  2121  ICKFSEKQQLPLSSEYS-KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGF  2297
             I KF  +QQLPLS+E    N+VV +++K SPLKW+S      V +D+  +  +W++P+ F
Sbjct  642   ITKFHGQQQLPLSTETMLGNSVVTDKKKFSPLKWESH-SSNGVEDDICDSLGNWKDPVTF  700

Query  2298  TKALEKVEAWIFSRIIESIWWQTFTPHMQSGAAT----SLDSEINKIYQRTSSSCSEEPE  2465
              +ALEK EAWIFSRIIESIWWQT  PHMQSGAAT    S+ SEIN +  +TSSS +EE  
Sbjct  701   IRALEKAEAWIFSRIIESIWWQTLIPHMQSGAATAICNSMGSEINNVCSKTSSSGAEEHV  760

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESAD  2645
             NFSL+LWKKA +DA +RICPVRAGGHECGCL LLSKLIM+QCVARLDVAMFNAILRESAD
Sbjct  761   NFSLDLWKKALKDACDRICPVRAGGHECGCLRLLSKLIMEQCVARLDVAMFNAILRESAD  820

Query  2646  DIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlve  2825
             ++P+DP+SDPIS+ EVLPIPAGKASF AGAQLKNAIGNWSRWL DL G            
Sbjct  821   EMPSDPISDPISDAEVLPIPAGKASFGAGAQLKNAIGNWSRWLTDLVG---------NSL  871

Query  2826  ddeNKADN-SNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
              DEN+ADN  +G E    D  SK FYLL+A+SDLMMLPKDMLLSRT+RKEVCPTFG  +I
Sbjct  872   HDENRADNDDDGSEE--YDTSSKSFYLLDALSDLMMLPKDMLLSRTIRKEVCPTFGPIII  929

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldg  3182
              RVLNVF+ DEFCPDPIP  VLEALN+ED  + EE+SV+++PC+AAPI Y PPS A+   
Sbjct  930   RRVLNVFVADEFCPDPIPECVLEALNTEDPFDAEEDSVMSYPCTAAPIAYKPPSTAS-VD  988

Query  3183  ilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngng-  3359
              L    SS S+L R  SSVLKKSYTSDDELD++D  +N I  E  E T P   S      
Sbjct  989   SLLGDISSHSKLRRIGSSVLKKSYTSDDELDQMD--MNFIISEGIE-TSPLAKSSRILKG  1045

Query  3360  ----ngVRYQLLREVWMSSE  3407
                 N VRYQLLREVW+ SE
Sbjct  1046  NVDGNAVRYQLLREVWIKSE  1065



>ref|XP_009604232.1| PREDICTED: uncharacterized protein LOC104099060 isoform X1 [Nicotiana 
tomentosiformis]
Length=1079

 Score =  1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/1100 (55%), Positives = 781/1100 (71%), Gaps = 41/1100 (4%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MVLG   +TR  PSVQ EYLI+I EIKPWPPS SL+T +AV+I+WEHGDK+SGST QV P
Sbjct  1     MVLGLKARTRNSPSVQVEYLIHIKEIKPWPPSHSLRTPRAVLIEWEHGDKHSGSTNQVVP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                T SG+G+GRIEFNESFR+P+TLL+E S K  +G+TFQKNCIEF+LYEPRRD TVKGQ
Sbjct  61    SSGTGSGIGDGRIEFNESFRLPVTLLKETSLKGGDGNTFQKNCIEFHLYEPRRDKTVKGQ  120

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGTA++D A+YGVV+E L++  PINCKR+YRNT QPLL LKIQ   + R++S +R+ ++
Sbjct  121   LLGTAIVDLADYGVVRESLSICPPINCKRTYRNTAQPLLFLKIQIGERSRVRSSLRDKLK  180

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncs---sPHQ  875
             RE+SMD +   S+S L++EEY +EAE ASYTDDD    SS +++  +  +N S   SP Q
Sbjct  181   REASMDRNG--SLSRLLSEEYADEAEFASYTDDDDDDVSSHLSAPVSSSANESNYGSPPQ  238

Query  876   KENGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDW  1055
             +E+ SEG K+   + E+ +VL  ++++ ++D+   ++ + SL  S S S +   S    W
Sbjct  239   EEDISEGVKSSAGQDEDENVLDYKERLADVDENPETKSLSSLQGSLSHSSTDMSSDLA-W  297

Query  1056  ISKKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQR  1235
             ISKKIG  ++++ ST F      E T N  +     +Q + ++ +  N ++  +  S+Q 
Sbjct  298   ISKKIGGCSSVQYST-FNVSDINEETQNACMIIKQDKQVQCMEQIAANGKSVGEKSSRQN  356

Query  1236  TE--ESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTLS-NGIQEDARTGVSDNGLAE  1406
             ++  E  C    +  D++ N  ++V     + ++E  STLS NG+ +DAR   ++NG  E
Sbjct  357   SDPAERACPIPCIT-DESSNFESTVSIFSNSVMEEKKSTLSVNGLWDDARDAGTENGSVE  415

Query  1407  GENTEGHQGNTQELVTERDK-HQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGN  1583
             GEN+E HQ N QE V    K HQE  +GKE   ++GQC + E ++   + +T K  L   
Sbjct  416   GENSEDHQENGQECVLRNGKQHQENEQGKESSEDEGQCKKDELISCYSEVDTIKLDLMEI  475

Query  1584  SAIIAGRESVGAK--TTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITS  1757
             +AI + R+S  AK  T+  E + HV SV +  ESNR +GSV SNQ +++D      G +S
Sbjct  476   NAISSYRDSSEAKSSTSHSEIVKHVMSVRSSPESNRGDGSVGSNQILVQDTPKGARGFSS  535

Query  1758  NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKV  1937
             N+ K+ KV  ++T+N++LE +  +LEQ+++MLEGELREAAA+E+GL+SVVAEHG S NKV
Sbjct  536   NERKE-KVSPRDTTNILLESQIHKLEQRVKMLEGELREAAAIEVGLYSVVAEHGCSANKV  594

Query  1938  HAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRA  2117
             H+PARRLSR Y HACKENSVL+R SAA+S +SG+ LVAKACGNDV RLTFWLSN V+LRA
Sbjct  595   HSPARRLSRFYLHACKENSVLKRGSAAKSAISGIYLVAKACGNDVARLTFWLSNSVVLRA  654

Query  2118  AICKFSEKQQLPLSSEYS-KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLG  2294
              I KF  +QQLPLS+E     +VV +++K SPLKW+S      V +D+  +  +WE+P+ 
Sbjct  655   TITKFHGRQQLPLSTETMLGKSVVADKKKFSPLKWESH-SSNGVRDDICESLGNWEDPVT  713

Query  2295  FTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAAT----SLDSEINKIYQRTSSSCSEEP  2462
             F +AL+K EAWIFSRIIESIWWQT  PHMQSGA+T    S+ SEIN +  RTSS  +E+ 
Sbjct  714   FIRALKKTEAWIFSRIIESIWWQTLIPHMQSGASTAICNSMGSEINNVCSRTSSFGAEDG  773

Query  2463  ENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESA  2642
             + FSL+LWKKA +DA ERICPVRA GHECGCLH+LSK IM+QCV RLDVAMFNAILRESA
Sbjct  774   K-FSLDLWKKALKDACERICPVRAAGHECGCLHMLSKSIMEQCVVRLDVAMFNAILRESA  832

Query  2643  DDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlv  2822
             D++P+DP+SDPIS+ EVLPIPAGKASF AGAQLKNAIGNWSRWL DL G           
Sbjct  833   DEMPSDPISDPISDAEVLPIPAGKASFGAGAQLKNAIGNWSRWLTDLVG---------NS  883

Query  2823  eddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
               DEN+ DN + +E +  D  SK FYLL+A+SDLMMLPKDMLLSRT+RKEVCPTFG  +I
Sbjct  884   LVDENREDNDD-NESEEYDTSSKSFYLLDALSDLMMLPKDMLLSRTIRKEVCPTFGPIII  942

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldg  3182
              RVLNVF+ DEFCPDPIP  VLEALN+ED  + EE+SV+++PC+AAPI Y PPS  +   
Sbjct  943   RRVLNVFVADEFCPDPIPECVLEALNTEDPFDAEEDSVMSYPCTAAPIAYKPPSTVS-VD  1001

Query  3183  ilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsg-----  3347
              L    SS S+L RS SSVLKKSYTSDDELD++D  +N I  E  E T P   S      
Sbjct  1002  GLLGDISSHSKLRRSGSSVLKKSYTSDDELDQMD--MNFIISEGIE-TSPLAKSSRILKG  1058

Query  3348  ngngngVRYQLLREVWMSSE  3407
             + +GN VRYQLLREVW++SE
Sbjct  1059  SVDGNSVRYQLLREVWINSE  1078



>ref|XP_009604233.1| PREDICTED: uncharacterized protein LOC104099060 isoform X2 [Nicotiana 
tomentosiformis]
Length=1054

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/1098 (54%), Positives = 769/1098 (70%), Gaps = 62/1098 (6%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MVLG   +TR  PSVQ EYLI+I EIKPWPPS SL+T +AV+I+WEHGDK+SGST QV P
Sbjct  1     MVLGLKARTRNSPSVQVEYLIHIKEIKPWPPSHSLRTPRAVLIEWEHGDKHSGSTNQVVP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                T SG+G+GRIEFNESFR+P+TLL+E S K  +G+TFQKNCIEF+LYEPRRD TVKGQ
Sbjct  61    SSGTGSGIGDGRIEFNESFRLPVTLLKETSLKGGDGNTFQKNCIEFHLYEPRRDKTVKGQ  120

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGTA++D A+YGVV+E L++  PINCKR+YRNT QPLL LKIQ   + R++S +R+ ++
Sbjct  121   LLGTAIVDLADYGVVRESLSICPPINCKRTYRNTAQPLLFLKIQIGERSRVRSSLRDKLK  180

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncs---sPHQ  875
             RE+SMD +   S+S L++EEY +EAE ASYTDDD    SS +++  +  +N S   SP Q
Sbjct  181   REASMDRNG--SLSRLLSEEYADEAEFASYTDDDDDDVSSHLSAPVSSSANESNYGSPPQ  238

Query  876   KENGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDW  1055
             +E+ SEG K+   + E+ +VL  ++++ ++D+   ++ + SL  S S S +   S    W
Sbjct  239   EEDISEGVKSSAGQDEDENVLDYKERLADVDENPETKSLSSLQGSLSHSSTDMSSDLA-W  297

Query  1056  ISKKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQR  1235
             ISKKIG  ++++ ST F      E T N  +     +Q + ++ +  N ++  +  S+Q 
Sbjct  298   ISKKIGGCSSVQYST-FNVSDINEETQNACMIIKQDKQVQCMEQIAANGKSVGEKSSRQN  356

Query  1236  TE--ESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTLS-NGIQEDARTGVSDNGLAE  1406
             ++  E  C    +  D++ N  ++V     + ++E  STLS NG+ +DAR   ++NG  E
Sbjct  357   SDPAERACPIPCIT-DESSNFESTVSIFSNSVMEEKKSTLSVNGLWDDARDAGTENGSVE  415

Query  1407  GENTEGHQGNTQELVTERDK-HQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGN  1583
             GEN+E HQ N QE V    K HQE  +GKE   ++GQC + E       D++  +    +
Sbjct  416   GENSEDHQENGQECVLRNGKQHQENEQGKESSEDEGQCKKDE-------DSSEAKSSTSH  468

Query  1584  SAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSND  1763
             S I+                 HV SV +  ESNR +GSV SNQ +++D      G +SN+
Sbjct  469   SEIV----------------KHVMSVRSSPESNRGDGSVGSNQILVQDTPKGARGFSSNE  512

Query  1764  WKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHA  1943
              K+ KV  ++T+N++LE +  +LEQ+++MLEGELREAAA+E+GL+SVVAEHG S NKVH+
Sbjct  513   RKE-KVSPRDTTNILLESQIHKLEQRVKMLEGELREAAAIEVGLYSVVAEHGCSANKVHS  571

Query  1944  PARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAI  2123
             PARRLSR Y HACKENSVL+R SAA+S +SG+ LVAKACGNDV RLTFWLSN V+LRA I
Sbjct  572   PARRLSRFYLHACKENSVLKRGSAAKSAISGIYLVAKACGNDVARLTFWLSNSVVLRATI  631

Query  2124  CKFSEKQQLPLSSEYS-KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFT  2300
              KF  +QQLPLS+E     +VV +++K SPLKW+S      V +D+  +  +WE+P+ F 
Sbjct  632   TKFHGRQQLPLSTETMLGKSVVADKKKFSPLKWESH-SSNGVRDDICESLGNWEDPVTFI  690

Query  2301  KALEKVEAWIFSRIIESIWWQTFTPHMQSGAAT----SLDSEINKIYQRTSSSCSEEPEN  2468
             +AL+K EAWIFSRIIESIWWQT  PHMQSGA+T    S+ SEIN +  RTSS  +E+ + 
Sbjct  691   RALKKTEAWIFSRIIESIWWQTLIPHMQSGASTAICNSMGSEINNVCSRTSSFGAEDGK-  749

Query  2469  FSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADD  2648
             FSL+LWKKA +DA ERICPVRA GHECGCLH+LSK IM+QCV RLDVAMFNAILRESAD+
Sbjct  750   FSLDLWKKALKDACERICPVRAAGHECGCLHMLSKSIMEQCVVRLDVAMFNAILRESADE  809

Query  2649  IPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlved  2828
             +P+DP+SDPIS+ EVLPIPAGKASF AGAQLKNAIGNWSRWL DL G             
Sbjct  810   MPSDPISDPISDAEVLPIPAGKASFGAGAQLKNAIGNWSRWLTDLVG---------NSLV  860

Query  2829  deNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITR  3008
             DEN+ DN + +E +  D  SK FYLL+A+SDLMMLPKDMLLSRT+RKEVCPTFG  +I R
Sbjct  861   DENREDNDD-NESEEYDTSSKSFYLLDALSDLMMLPKDMLLSRTIRKEVCPTFGPIIIRR  919

Query  3009  VLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgil  3188
             VLNVF+ DEFCPDPIP  VLEALN+ED  + EE+SV+++PC+AAPI Y PPS  +    L
Sbjct  920   VLNVFVADEFCPDPIPECVLEALNTEDPFDAEEDSVMSYPCTAAPIAYKPPSTVS-VDGL  978

Query  3189  gdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsg-----ng  3353
                 SS S+L RS SSVLKKSYTSDDELD++D  +N I  E  E T P   S      + 
Sbjct  979   LGDISSHSKLRRSGSSVLKKSYTSDDELDQMD--MNFIISEGIE-TSPLAKSSRILKGSV  1035

Query  3354  ngngVRYQLLREVWMSSE  3407
             +GN VRYQLLREVW++SE
Sbjct  1036  DGNSVRYQLLREVWINSE  1053



>emb|CDP16676.1| unnamed protein product [Coffea canephora]
Length=1105

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/1127 (56%), Positives = 771/1127 (68%), Gaps = 58/1127 (5%)
 Frame = +3

Query  99    YTFLFLLRFVH*SEDYCGVLAAMVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTL  278
             YTF  L+   H        L  MVLG   K R  PSVQ +YLI+I EIKPWPPSQSL+TL
Sbjct  12    YTFQ-LISLCHSGWQKNYFLVTMVLGMKAKNRKSPSVQVDYLIHIQEIKPWPPSQSLRTL  70

Query  279   KAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDT  458
             +AVVIQWEHGD++SGST QV P L T S VG+GRIEFNESFR+P+TLLRE+S+K  +GDT
Sbjct  71    RAVVIQWEHGDRSSGSTNQVVPSLGTGSAVGDGRIEFNESFRLPVTLLRELSAKGGDGDT  130

Query  459   FQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPL  638
             FQKNCIEFNLYEPRRD TVKGQLLGTAVID A+YGVVKE L++S  I+CKR+YRNT QPL
Sbjct  131   FQKNCIEFNLYEPRRDKTVKGQLLGTAVIDLADYGVVKETLSISASIHCKRTYRNTSQPL  190

Query  639   LCLKIQTVGKGRMKSLVRNNVRRESSMDSSAGESVSALMNeeyteeaetasytdddvssh  818
             L LKIQ+V K R+ S   +++ RE+S+D +  +SVSAL+NEEY EEAETASY+DDD SSH
Sbjct  191   LFLKIQSVDKSRVSSSSWDHLTREASVDKNGVDSVSALINEEYAEEAETASYSDDDGSSH  250

Query  819   sslvnsssavesncssPHQKENGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVls  998
             SSL  SSSAVESN  SP  KENG EG K    +A +  +   EQ++   D K ++    S
Sbjct  251   SSLAVSSSAVESNGGSPQNKENGLEGIKASVGKAGDVRIPALEQQLAEADDKQLTTSNAS  310

Query  999   lnassssspstalssdlDWISKKIGARNNIKSSTS------FEKDSRMECTPNT--NVKT  1154
             L   SS S S  L+SDL WI+KKIGAR +++S++S       EK+     +P     V  
Sbjct  311   LKGGSSRSSSVDLTSDLAWITKKIGAR-SVQSTSSPITNEVTEKEMSNMRSPTVFGEVPC  369

Query  1155  NTGEQAEGVDSVVINCENGSQNHSQQRT-----EESICDGSLVNIDDNRNSNNSVGHIIK  1319
             + GE    +DS  I+  +  +  S+  T     +E+  D S VN ++  +S NS+   I 
Sbjct  370   DIGENV--LDSGSIDTRSAIEQSSKANTCNPISKEAFSD-SKVNGNEILSSLNSLDSSID  426

Query  1320  ADIDESFSTLSNGIQEDARTGVSDNGLAEGENTEGHQGNTQELVTERDKHQETGEGKELI  1499
               +D++ + LS GI    +  ++ NG A G+N E +Q        E  K  +  EG    
Sbjct  427   EVVDDNAAVLSKGI---CKIDLAQNGFAGGDNCEIYQ--------ENGKQWKFTEG----  471

Query  1500  IEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKT---TCDERLNHVSSVHTL  1670
                GQC E +P++S  +D+   Q    N  +   RE +  K+     D    HV SV + 
Sbjct  472   --MGQCMEDKPMDSFSRDDLRDQDFFENDVLSPSREHIEIKSHNQNADRNSKHVKSVRSP  529

Query  1671  GESNRA-NGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQ  1847
              + NR+ NGS + NQFV   +++  +G  S++ +D KV  KET N++ + K ++LEQ+I+
Sbjct  530   MDQNRSNNGSAQGNQFVSGGRQSVGQGFVSSERRDNKVHPKETRNILSDSKIKQLEQRIK  589

Query  1848  MLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSV  2027
              LE ELRE AA+E+GL+SVVAEHGSSTNKVHAPARRLSR Y HA K NS  +R  AA+S 
Sbjct  590   RLEAELRETAAIEVGLYSVVAEHGSSTNKVHAPARRLSRFYLHASKVNSQSQRGGAAKSA  649

Query  2028  VSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS-KNAVVKNERKA  2204
             +SGLILVAKACGNDVPRLTFWLSN ++LRA I +   +QQLPLS   + KN +      +
Sbjct  650   ISGLILVAKACGNDVPRLTFWLSNSIVLRAIISESLAEQQLPLSGPMNGKNGIRNGNMTS  709

Query  2205  SPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQ  2384
             SPLKWQS     S+ + L  + +DWE+P  FT ALEKVE+WIFSRIIESIWWQ  TPHMQ
Sbjct  710   SPLKWQSL-SSNSIQSTLDQSSDDWEDPCTFTSALEKVESWIFSRIIESIWWQILTPHMQ  768

Query  2385  SGA---ATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGC  2555
             SGA      LDS  NK+YQRTSSS  E    FSLELWK+AF+DA ERICPVRA GHECGC
Sbjct  769   SGAIQRGIILDS--NKMYQRTSSSGDE--GTFSLELWKRAFKDACERICPVRAEGHECGC  824

Query  2556  LHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGA  2735
             L +LS+LIM+QCVARLDVAMFNAILR+S DDIPTDPVSDPIS+  VLPI  GKASF AGA
Sbjct  825   LPILSRLIMEQCVARLDVAMFNAILRDSIDDIPTDPVSDPISDANVLPILVGKASFGAGA  884

Query  2736  QLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAM  2915
             QLKNAIGNWSRWL DLFGI    +DDD   +D N A  S+ HE   QD   KPF LLN++
Sbjct  885   QLKNAIGNWSRWLTDLFGI----DDDDGTLEDVNIAWESSDHENIPQDTSLKPFNLLNSL  940

Query  2916  SDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHM  3095
             SDLMMLPKDMLLSRT+RKEVCPTFG +LI RVLN F+PDEFCP+PIP VVLEALNSED  
Sbjct  941   SDLMMLPKDMLLSRTIRKEVCPTFGPTLIRRVLNAFVPDEFCPEPIPKVVLEALNSEDSF  1000

Query  3096  EVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeld  3275
             + E+   VNFPCSAAPIVY PPS A+    +   + +  +LTR  S VLKKSYTSDDELD
Sbjct  1001  DAEDS--VNFPCSAAPIVYRPPSPAS-VAGMIGDAGNHYRLTRKGSLVLKKSYTSDDELD  1057

Query  3276  eldsPLNLI--KMENSEVTKPg-ggsgngngngVRYQLLREVWMSSE  3407
             EL SPL+ I   ++ S  T+      GNG  N VRYQLLR VW +S+
Sbjct  1058  ELASPLSSIIDSLQGSSSTETIWASRGNGCQNAVRYQLLRAVWKNSK  1104



>ref|XP_004234229.1| PREDICTED: uncharacterized protein LOC101267486 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010317388.1| PREDICTED: uncharacterized protein LOC101267486 isoform X1 [Solanum 
lycopersicum]
Length=1082

 Score =   978 bits (2527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/1108 (54%), Positives = 770/1108 (69%), Gaps = 53/1108 (5%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MVLG   +TR  PSVQ EYLI+I EIKPWP SQSL T +AV+I+W++GDK SGST QV P
Sbjct  1     MVLGLKTRTRNSPSVQVEYLIHIKEIKPWPASQSLNTPRAVLIEWQYGDKLSGSTNQVVP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L T SG+G+GRIEF+ESFR+P+TLLRE S KS +GDT+QKNCIEF+LYEPRRD TVKGQ
Sbjct  61    SLGTGSGIGDGRIEFDESFRLPVTLLRETSFKSGDGDTYQKNCIEFHLYEPRRDKTVKGQ  120

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
              LGTA ID A+YGV++E L++  PINCKR+YRN+ QPLL LKIQ V + RM+  +R++++
Sbjct  121   HLGTATIDLADYGVIRESLSICPPINCKRTYRNSAQPLLFLKIQLVERCRMRPSLRDSLK  180

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKEN  884
             RE+SMD +   S+S L++EEY EEAE ASYTDDDVSSH SL  SSS   SN  SP Q E 
Sbjct  181   REASMDRNG--SLSRLLSEEYAEEAEFASYTDDDVSSHLSLPVSSSTNGSNYGSPPQGEE  238

Query  885   GSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWISK  1064
                G K+   + E  +VL  ++++KN++KK  ++    L  S S + +        WISK
Sbjct  239   RFTGVKSSPGQDEYENVLDDKRRLKNMEKKQGTKSPSRLQGSLSHTSTDLSFDLA-WISK  297

Query  1065  KIGARNNIKSST----SFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQ  1232
             KIGA ++ + +T    S   D++ +C     +     +QA+ V+ +V + E+G +   ++
Sbjct  298   KIGASSSTQYATSNVSSITGDTQNDC-----MLIKQDKQAQCVEQIVASDESGGEISCRR  352

Query  1233  RTEESICDGS--------LVNIDDNRNSNNSVGHIIKADIDESFSTLS-NGIQEDARTGV  1385
              +EE   D          L   D++ N  N+V +    +I+E+ ST S NG+ +DAR  V
Sbjct  353   SSEEGFFDAHPAEKACPVLHITDESSNFVNTVSNFSDNEIEENTSTPSLNGLCDDARDAV  412

Query  1386  SDNGLAEGENTEGHQGNTQELVTER-DKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTT  1562
             + NG     N+E H+ N+Q+       +HQE    KE++  KG+C + E V+   ++ T 
Sbjct  413   TQNG-----NSEDHRENSQQCSPHNGGQHQENEHEKEILENKGRCKKDESVSCYPEEATL  467

Query  1563  KQHLEGNSAIIAGRESVGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRN  1736
                L+   A+ A R+S GAK+T   +E L HV SV +  ESNR +GSV S+Q +++D   
Sbjct  468   VPVLKETGAVSAYRDSSGAKSTTPQNEILKHVMSVRSSSESNR-DGSVGSDQLLVQDTPK  526

Query  1737  SIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEH  1916
              ++G +SN+ KD KV  ++T+N++LE K  +LEQ+++MLE ELRE+AA+E+GL+SVVAEH
Sbjct  527   GVKGFSSNERKDQKVSPRDTTNILLESKIHKLEQRVKMLEEELRESAAIEVGLYSVVAEH  586

Query  1917  GSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLS  2096
             G S NKVHAPARRLSR Y HA KENSVL+R +AA+S +SG+ LVAKACGNDV RLTFWLS
Sbjct  587   GYSANKVHAPARRLSRFYLHAYKENSVLKRGNAAKSAISGIYLVAKACGNDVARLTFWLS  646

Query  2097  NCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKA--SPLKWQSFPHKKSVGNDLPGTF  2270
             N V+LRA I KF  +QQ+PLS++      V  ++K   SPLKW+S      V ND+  + 
Sbjct  647   NSVVLRATITKFHGQQQIPLSADSMPEKTVVKDKKKKFSPLKWESC-SSNDVRNDICESL  705

Query  2271  EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS----LDSEINKIYQRT  2438
              +WE+P+ F +ALEK+EAWIFSRIIESIWWQT  P+MQSGAAT+    +  EINK     
Sbjct  706   GNWEDPVTFIRALEKIEAWIFSRIIESIWWQTLIPYMQSGAATAICNDMGPEINKFSSTA  765

Query  2439  SSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMF  2618
             SSS +EE  NFSLELWKKA R A ERICP+RAGGHECGCLH LSKLIM+QCVARLDVA+F
Sbjct  766   SSSGAEEHGNFSLELWKKALRHACERICPIRAGGHECGCLHFLSKLIMEQCVARLDVAIF  825

Query  2619  NAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdd  2798
             NAILR S+D++P+DP+SDPIS+ EVLPIPAGKASF AGAQLK AIGNWSRW+ +L G   
Sbjct  826   NAILRVSSDEMPSDPISDPISDAEVLPIPAGKASFGAGAQLKIAIGNWSRWITELVG---  882

Query  2799  ddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVC  2978
                      DDE++ADN +  +    D+ S+ F LLNA+SDLM+LPKDMLLSRT+RKEVC
Sbjct  883   --SGGANSVDDESRADNED--DGSEYDSSSESFNLLNALSDLMLLPKDMLLSRTIRKEVC  938

Query  2979  PTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAP  3158
             PTFG  +I RVLNVF+PDEFCPDPI  VVLEALNSED  + EE+SV+++PC+AAP+ Y P
Sbjct  939   PTFGPIIIRRVLNVFVPDEFCPDPIHEVVLEALNSEDPFDAEEDSVMSYPCTAAPVAYKP  998

Query  3159  PSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgg  3338
             PS A+    L    S  SQL RS+SSVLKKSYTSDDELD+LD  LN I  E    T P  
Sbjct  999   PSTAS-VDGLLGDVSHHSQLRRSKSSVLKKSYTSDDELDQLD--LNFIISEGI-ATSPLV  1054

Query  3339  gsgngng-----ngVRYQLLREVWMSSE  3407
              S          N VRYQLLREVWM SE
Sbjct  1055  KSSRIAEGSGNGNAVRYQLLREVWMKSE  1082



>ref|XP_009603069.1| PREDICTED: uncharacterized protein LOC104098110 [Nicotiana tomentosiformis]
 ref|XP_009603073.1| PREDICTED: uncharacterized protein LOC104098110 [Nicotiana tomentosiformis]
 ref|XP_009603081.1| PREDICTED: uncharacterized protein LOC104098110 [Nicotiana tomentosiformis]
Length=1071

 Score =   973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1101 (54%), Positives = 761/1101 (69%), Gaps = 50/1101 (5%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MV G   KTR  PSVQ +YLI+I EIKPWPPSQSL+T++A++IQWEHGD+ SGST+QV P
Sbjct  1     MVSG-RAKTRKGPSVQVDYLIHIQEIKPWPPSQSLRTVRAILIQWEHGDR-SGSTSQVVP  58

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SGVG+G I FNESF++P+TLLREIS K  +GDTFQKNCIEFNLYEPRRD  VKGQ
Sbjct  59    SLG--SGVGDGSIGFNESFKLPVTLLREISVKGGDGDTFQKNCIEFNLYEPRRDKMVKGQ  116

Query  525   LLGTAVIDFANYGVV-KEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
              LGTA+I+FA YGVV KEGLNVS PINC R+YRNTVQPL+ LKIQ   + R  S  R+ +
Sbjct  117   PLGTAIINFAEYGVVNKEGLNVSAPINCTRAYRNTVQPLIFLKIQQFDRSRASSSSRDGL  176

Query  702   RRESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKE  881
              R +S+D +  ESVS L +EEY EEAE AS+TDDDVSSHSS+  + S   S      Q E
Sbjct  177   TRGASIDRTGVESVSTLTSEEYAEEAEIASFTDDDVSSHSSVAANGSNCGSLP----QGE  232

Query  882   NGSEGGKNRRAEAENNHVL-GSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWI  1058
             + +EG K+   + E+ HVL  S+ K  +LD+K V + + +   S   SP+   S    W+
Sbjct  233   DEAEGVKSNPGQNEDEHVLLYSKNKSADLDEKQVVKSLSNSKPSLPHSPTDLSSDLA-WL  291

Query  1059  SKKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRT  1238
             S+KIG   + K + S   D   E T N  V T   E  +  + ++ N E+G +  +QQ +
Sbjct  292   SRKIGGNGSNKLAMS-NADEITENTQNPYVITEHVEPVQQRERILANSESGGEISTQQCS  350

Query  1239  EESICDGSL-------VNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG  1397
             +E      L        +ID++++  NS  H   ++  E+ ST      EDAR  V++NG
Sbjct  351   DEERVSSHLDQAGLPISHIDESKSFMNSASHFSSSENAENASTPVGNGHEDARAVVAENG  410

Query  1398  LAEGENTEGHQGNTQEL-VTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHL  1574
               EGEN+E +Q   QE     R+ +QE  + KE+            V     ++  K   
Sbjct  411   SNEGENSEKYQERRQESSANNRENYQENEQVKEI------------VEEEESEDAMKNDS  458

Query  1575  EGNSAIIAGRESVGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEG  1748
             E +  I A  +S GAK++   +ERL HV SV +  E NR NGSV+ NQ + +DK+    G
Sbjct  459   EESDVISAYTDSYGAKSSIQNNERLKHVKSVRSSAEPNRVNGSVKGNQLLAQDKQIRARG  518

Query  1749  ITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSST  1928
             + +N+ KD K +S +TS ++LE K  +LEQ+++M EGELREAAA+E GL+SV+AEHGSS 
Sbjct  519   L-ANERKDRKAQSTDTSTILLESKLHKLEQRVKMAEGELREAAAIEAGLYSVIAEHGSSK  577

Query  1929  NKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVL  2108
             NKVHAPARRLSR YFHACK++S L+R +AA+S VSGLILVA+ACGNDV RLTFWLSN ++
Sbjct  578   NKVHAPARRLSRFYFHACKDDSPLKRGTAAKSAVSGLILVARACGNDVSRLTFWLSNSLV  637

Query  2109  LRAAICKFSEKQQLPLSSEYS-KNAVVKNERK-ASPLKWQSFPHKKSVGNDLPGTFEDWE  2282
             LRA I KF  +Q LP S+E    NA  +++++ +SPLKW+SF     + +D+  +F +WE
Sbjct  638   LRATIGKFQRQQYLPHSTETMLGNAFSRDKKQISSPLKWESF-SSNGIRDDICESFGNWE  696

Query  2283  NPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS----LDSEINKIYQRTSSSC  2450
             +P  FT+AL++ EAWIFSRI+ESIWWQT TPHMQSGAA      + S IN +++RT+SS 
Sbjct  697   DPRTFTRALQRTEAWIFSRIVESIWWQTLTPHMQSGAAKEIREIMSSLINNVHRRTASSD  756

Query  2451  SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
             +EE  +FS ELWKKAF+DA ERICPVRAGGHECGCLH LSKLIM+QCVARLDVAMFNAIL
Sbjct  757   NEERGSFSSELWKKAFKDACERICPVRAGGHECGCLHFLSKLIMEQCVARLDVAMFNAIL  816

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             RESAD+IP+DP+SDPIS+ +VLPIPAGKASF AGAQLKN IG+WSRWL DLFGIDD +  
Sbjct  817   RESADEIPSDPISDPISDADVLPIPAGKASFGAGAQLKNTIGSWSRWLTDLFGIDDGESL  876

Query  2811  ddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFG  2990
              D+   D N+ D S     K  D  +K FYLLNA+SDLMMLPKDMLL RT+RKEVCP FG
Sbjct  877   KDIKGADNNEKDGS-----KELDTSAKAFYLLNALSDLMMLPKDMLLDRTIRKEVCPAFG  931

Query  2991  LSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAA  3170
               LI RVLN+F+PDEFC DPIP  VL AL+SED +E E++SV N+PC+AAP+ Y PP   
Sbjct  932   QLLIRRVLNIFVPDEFCRDPIPEAVLGALHSEDPLEAEDDSVTNYPCAAAPVAYIPP-PI  990

Query  3171  AldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsg-  3347
             +L   +    SS SQLTRS SS+LKKSYTSD+EL++LDSPLN I  + SE ++       
Sbjct  991   SLVTDMLGDISSYSQLTRSGSSLLKKSYTSDEELEQLDSPLNFIINDGSEASQSLAKPSW  1050

Query  3348  -ngngngVRYQLLREVWMSSE  3407
                     RYQLLREVW++SE
Sbjct  1051  MTKGSGRQRYQLLREVWINSE  1071



>ref|XP_009804675.1| PREDICTED: uncharacterized protein LOC104249864 [Nicotiana sylvestris]
 ref|XP_009804676.1| PREDICTED: uncharacterized protein LOC104249864 [Nicotiana sylvestris]
Length=1074

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/1101 (55%), Positives = 763/1101 (69%), Gaps = 47/1101 (4%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             M+ G   K+R  PSVQ +YLI+I +IKPWPPSQSLKT++A++IQWEHGD+ SGST QV P
Sbjct  1     MISGLRAKSRKGPSVQVDYLIHIQDIKPWPPSQSLKTVRAILIQWEHGDR-SGSTGQVVP  59

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SGVG+G IEFNESF++P+TLLREIS K  +GDTFQKNCIEFNLYEPRRD TVKGQ
Sbjct  60    SLG--SGVGDGSIEFNESFKLPVTLLREISIKGGDGDTFQKNCIEFNLYEPRRDKTVKGQ  117

Query  525   LLGTAVIDFANYGVV-KEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
              LGTA+I+ A YGVV KEGLNVS PINC R+YRNTVQPL+ LKIQ   + R  S  R+ +
Sbjct  118   PLGTAIINLAEYGVVNKEGLNVSAPINCTRAYRNTVQPLVFLKIQQFDRSRASSSSRDVL  177

Query  702   RRESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKE  881
              R +S+D +  ESVS L +EEY EEAE AS+TDDDVSSHSS+  SSSA  SNC S  Q E
Sbjct  178   TRGASIDRTGVESVSTLTSEEYAEEAEIASFTDDDVSSHSSVAASSSANGSNCGSLPQGE  237

Query  882   NGSEGGKNRRAEAENNHVL-GSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWI  1058
             + +EG K+   E E  HVL  S+ K  +LD+K V + + + N S   SP+   S    W+
Sbjct  238   DETEGVKSNPNEDE--HVLLYSKNKSADLDEKQVVKSLSNSNPSLPHSPTDLSSDLA-WL  294

Query  1059  SKKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRT  1238
             S+KIG   + K +TS   +   E T N  V T   E  +  + ++ N ++G +  +QQ  
Sbjct  295   SRKIGGNGSNKLATS-NANEITENTLNPYVITEHVEPVQQRERILANSDSGGEISTQQCC  353

Query  1239  EESICDGSL-------VNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG  1397
             +E      L        +ID++++  NS  H   ++  E+ ST      EDAR  V++NG
Sbjct  354   DEERVSSHLDQVGFPISHIDESKSFMNSASHFSSSENAENASTPVGNRHEDARAVVTENG  413

Query  1398  LAEGENTEGHQGNTQEL-VTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHL  1574
               EGEN+E +Q   QE     R+ +QE  + KE+            V     ++  K   
Sbjct  414   SNEGENSEKYQERRQESSANNRENYQENEQVKEI------------VEEEESEDAMKNDS  461

Query  1575  EGNSAIIAGRESVGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEG  1748
             E +  I A  +S G K++   +ERL HV SV +  E NR NGSV+ NQ + +DK+    G
Sbjct  462   EESDVISAYTDSYGEKSSIQNNERLKHVKSVRSSAEPNRVNGSVKGNQLLAQDKQICARG  521

Query  1749  ITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSST  1928
             + +N+ KD K +S +TS ++LE K  +LEQ+++M EGELREAAA+E GL+SVVAEHGSS 
Sbjct  522   L-ANERKDRKAQSTDTSTILLESKLHKLEQRVKMAEGELREAAAIEAGLYSVVAEHGSSK  580

Query  1929  NKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVL  2108
             NKVHAPARRLSR YFHACK++S L+R +AA+S VSGLILVA+ACGNDV RLTFWLSN ++
Sbjct  581   NKVHAPARRLSRFYFHACKDDSPLKRGTAAKSAVSGLILVARACGNDVSRLTFWLSNSLV  640

Query  2109  LRAAICKFSEKQQLPLSSEYS-KNAVVKNERK-ASPLKWQSFPHKKSVGNDLPGTFEDWE  2282
             LRA I KF  +Q LP S+E    NA  +++++ +SPLKW+SF     + +DL  +F +WE
Sbjct  641   LRATIGKFQRQQYLPHSTETMIGNAFSRDKKQISSPLKWESF-SSNGIRDDLCESFGNWE  699

Query  2283  NPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAAT----SLDSEINKIYQRTSSSC  2450
             +P  FT+AL++ EAWIFSRI+ESIWWQT TPHMQSGAA     S+ S I  +Y+RT+SS 
Sbjct  700   DPRTFTRALQRTEAWIFSRIVESIWWQTLTPHMQSGAAKEIRESMSSLICNVYRRTASSD  759

Query  2451  SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
             +EE  +FS ELWKKAF+DA ERICPVRAGGHECGCLH LSKLIM+QCVARLDVAMFNAIL
Sbjct  760   NEERGSFSSELWKKAFKDACERICPVRAGGHECGCLHFLSKLIMEQCVARLDVAMFNAIL  819

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             RESAD+IP+DP+SDPIS+ +VLPIPAGKASF AGAQLKN IG+WSRWL DLFGIDD +  
Sbjct  820   RESADEIPSDPISDPISDADVLPIPAGKASFGAGAQLKNMIGSWSRWLTDLFGIDDGESL  879

Query  2811  ddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFG  2990
              D+   D N+ D S     K  D  +K FYLLNA+SDLMMLPKDMLL RT+RKEVCP FG
Sbjct  880   KDIKGADNNEKDGS-----KEFDTSAKAFYLLNALSDLMMLPKDMLLDRTIRKEVCPAFG  934

Query  2991  LSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAA  3170
               LI RVLN+F+PDEFC DPIP  V  AL+SED +E E++SV N+PC AAP+ Y PP   
Sbjct  935   PLLIRRVLNIFVPDEFCRDPIPEAVFGALHSEDPLEAEDDSVTNYPCIAAPVAYIPP-PI  993

Query  3171  AldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsg-  3347
             +L   +    SS SQLTRS SS+LKKSYTSD+EL++LDSPLN I  + SE ++       
Sbjct  994   SLVTDMLGDISSYSQLTRSGSSLLKKSYTSDEELEQLDSPLNFIINDGSEASQALAKPSW  1053

Query  3348  -ngngngVRYQLLREVWMSSE  3407
                     RYQLLREVW++SE
Sbjct  1054  MTKGSGRQRYQLLREVWINSE  1074



>ref|XP_011098854.1| PREDICTED: uncharacterized protein LOC105177410 [Sesamum indicum]
Length=1057

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/1096 (52%), Positives = 751/1096 (69%), Gaps = 54/1096 (5%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MVLG   KTR  PSVQ +Y+I+I EIKPWPPSQSL+TL+AV+IQWE+G+K SG T QV P
Sbjct  1     MVLGLRTKTRRSPSVQLDYIIHIQEIKPWPPSQSLRTLRAVLIQWEYGEKISGFTNQVVP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L T SGVG+GRIEFNESFR+P+TL+RE+S +  +GDTFQKNCIEFNLYEPRRD TVKGQ
Sbjct  61    SLGTGSGVGDGRIEFNESFRLPVTLMREMSIRGGDGDTFQKNCIEFNLYEPRRDKTVKGQ  120

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGTAV+DFA+YG+ KE L++S PI+CKR+YRNT QPLL LKIQ+V + R  S  ++++ 
Sbjct  121   LLGTAVLDFADYGIFKESLSLSAPISCKRTYRNTAQPLLFLKIQSVERMRTSSSSKDSLI  180

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKEN  884
             RE SMDS+ GESVSALM+EEY EEAE  +  D    S  ++ + ++    + S PH++  
Sbjct  181   REVSMDSNHGESVSALMSEEYAEEAEFTTDDDGSSQSSLAVASFTADSNGSSS-PHKE--  237

Query  885   GSEGGKNRRA-EAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWIS  1061
              S+   N  A +A+ + V   +Q +   D++  ++  ++    SS S S  LSSD+ WIS
Sbjct  238   -SKPAVNHSAPDAKVDTV--QDQFVAKPDEEQATKSYMNPAGISSRSSSMDLSSDIAWIS  294

Query  1062  KKIGARNNIKSSTSFEKDSRMECTPNTNVKTNT-GEQAEGVDSVVINCENGSQNHSQQRT  1238
             KKI +++ ++ S   E D + +    +N+K+N  G+QAEG   + +   +     S   +
Sbjct  295   KKITSQS-LQPSQLEETDKQQK----SNIKSNEFGKQAEGGRDLKVQLSSEEGKLSHPIS  349

Query  1239  EESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNGLAEGENT  1418
             E+++ +               + H     I   FS L +   ++A +  +++ L  G   
Sbjct  350   EKTMAE---------------LHHQTDRHIGSGFSYLVD--DKNASSIGAEDLLVAGRTN  392

Query  1419  EGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIA  1598
                  +T E +TE  KH++  E + ++ ++ Q  E EP     Q    +Q +  N  + +
Sbjct  393   ARLNSSTDEEITE--KHEKYSEERRIMEDENQKVEEEPSGGLSQVEVQQQVMLENGLLSS  450

Query  1599  GRES--VGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKD  1772
              +ES  V +  +  ++  ++ SV +  +S+R+NGS+RSN F + D   +  G  S++ KD
Sbjct  451   TKESFTVHSSYSNTDKSKNLRSVRSSLDSSRSNGSIRSNHFSVTD---TARGSISSERKD  507

Query  1773  TKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPAR  1952
             +K   KET N++ + + Q+LEQKI+ LEGEL EAAA+E+ L+SVVAEHGSS  KVHAPAR
Sbjct  508   SKAFIKETRNLLSDSRIQQLEQKIKRLEGELMEAAALEVSLYSVVAEHGSSMTKVHAPAR  567

Query  1953  RLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF  2132
             RLSRLYFHA K+NS   R +A +S+VSGL+LVAKACGNDVPRLTFWLSN ++LRA + K 
Sbjct  568   RLSRLYFHASKQNSKSERGTAVKSIVSGLVLVAKACGNDVPRLTFWLSNSIVLRAIVNKS  627

Query  2133  SEKQQLPLS--SEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKA  2306
                 QLP+S   +  K +    ++K++PLKW+SFP K + G  +  +  +WENP  F  A
Sbjct  628   FGHSQLPISVGPDARKMSDKNGKKKSTPLKWESFPSKSTRGT-IEDSVGEWENPPMFAAA  686

Query  2307  LEKVEAWIFSRIIESIWWQTFTPHMQSGAAT----SLDSEINKIYQRTSSSCSEEPENFS  2474
             LEKVE WIFSRIIES+WWQTFTPHMQSGAA     S+DS+  K Y+RTSSS  ++  NFS
Sbjct  687   LEKVETWIFSRIIESLWWQTFTPHMQSGAAKAIRRSMDSDSGKSYRRTSSSIDQQ-GNFS  745

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             LELWK AFRDA ERICPVRA GH+CGCLH+LSKLIM+Q +ARLDVAMFNAILRESAD+IP
Sbjct  746   LELWKMAFRDACERICPVRAAGHDCGCLHVLSKLIMEQLIARLDVAMFNAILRESADEIP  805

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDP++DPIS+ EVLPIPAGKASF AGAQLKNAIGNWSRWL     +   D+ DD + ++E
Sbjct  806   TDPIADPISDAEVLPIPAGKASFGAGAQLKNAIGNWSRWLT---DLFGIDDGDDDLLENE  862

Query  2835  NKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVL  3014
             N ++ S+  ER ++D  SK F+LLNA+SDLMMLPKDMLLSRT+RKEVCPTFG +L+ R+L
Sbjct  863   NSSEASDDDERSSRDTSSKSFHLLNALSDLMMLPKDMLLSRTIRKEVCPTFGPTLLRRIL  922

Query  3015  NVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgd  3194
             N F+PDEFCP+PIP VVLEALNSED  +  E+  VNFPC AA IVY  P A      +  
Sbjct  923   NSFVPDEFCPEPIPGVVLEALNSEDSFDSNEDPTVNFPCVAAAIVYQTP-AVDWVANIFG  981

Query  3195  isssssqltrsrssVLKKSYTsddeldeldsPLNLIKMEN-----SEVTKPgggsgngng  3359
               SS  +LTRS SSVLKKS TSDDELD+LDSPL  I ++      S V        NG+ 
Sbjct  982   EISSHPKLTRSGSSVLKKSQTSDDELDDLDSPLKPIVLDGFQSSPSPVRPAWASKENGSR  1041

Query  3360  ngVRYQLLREVWMSSE  3407
             N VRYQLLREVWM+SE
Sbjct  1042  NTVRYQLLREVWMNSE  1057



>ref|XP_010660786.1| PREDICTED: uncharacterized protein LOC100266440 [Vitis vinifera]
Length=1099

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/1131 (50%), Positives = 725/1131 (64%), Gaps = 82/1131 (7%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MVLG     R   SV  +YLI+I EIKPWPPSQSL++ +AV+IQWEHGD+ SGST+ V P
Sbjct  1     MVLGVRTNNRKSGSVHVDYLIHIQEIKPWPPSQSLRSQRAVLIQWEHGDRTSGSTSSVIP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SG+G+G+IEFNESFR+ +TL+RE + KS + DTF KNC++FNLYEPRRD TV+GQ
Sbjct  61    ALG--SGIGDGKIEFNESFRLSVTLVREFALKSGDADTFHKNCLDFNLYEPRRDKTVRGQ  118

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGTA++D A+YG+++E  ++S+P+NCKRS+RNT QP+L LKIQ V KGR  S  R+N+ 
Sbjct  119   LLGTAILDLADYGIIREISSISIPMNCKRSFRNTAQPVLFLKIQPVDKGRTSSSSRDNLL  178

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKE-  881
             +E+S+  + GESVSAL+NEEY EEAE  S TDDDVSSHSSL  S++   +    PHQ E 
Sbjct  179   KEASLHKTGGESVSALINEEYAEEAEITSSTDDDVSSHSSLAVSTAVQSNGGL-PHQNEK  237

Query  882   NGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWIS  1061
             NGSE   N            S+ ++ N D   + EP  SL  +SS   S         +S
Sbjct  238   NGSERVNNNTGGGNEEQASDSKLRLTNSDTTPIIEPHPSLEGNSSCMSSID-------LS  290

Query  1062  KKIGARNN--------IKSSTSFEKD---------------SRMECTPNTNVKTNTGEQ-  1169
               +G+  N         +SSTS  K                 RME   NT++++N  E  
Sbjct  291   SDLGSPVNGHPSLPDSPESSTSTPKRILTLSSHSSSSSIVYERMEEESNTSIRSNDHEDL  350

Query  1170  AEGVDSVVINCENGSQNHSQQRTEESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTL  1349
                    V + +  +  +++Q T E I +G L  +     ++++V  +  A+   + S  
Sbjct  351   PREAHEKVPSGKTETGGNAKQSTGEKISNGFLAKVASPGINSHAVEKLSFAN--SANSQA  408

Query  1350  SNGIQEDARTGVSDNGLAEGENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGE  1529
             +    E+       NGL EG  T+      ++   +++  QE    +E + EK    E E
Sbjct  409   NREEYEEEVRRPIKNGLEEGVTTDNGPMEDRDEKEQKEYRQE----RENLEEKEHSIEEE  464

Query  1530  PVNSCLQDNTTKQHLEGNSAIIA--GRESVGAKTTCDERLNHVSSVHTLGESNRANGSVR  1703
             P N    D T KQ   G+  +    G   + +     +RL HV SV +  +S R+N  V 
Sbjct  465   PSNRVSLDATRKQASSGSDTLSFSWGNHELKSNILSSDRLKHVKSVRSSSDSARSNNLVG  524

Query  1704  SNQF--------VLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEG  1859
              NQF        VL D++N   G   +  KDT + + ET N   ERK Q+LE KI+MLEG
Sbjct  525   GNQFIEEAKEVGVLGDRQNGARGFIGSGRKDTIIYT-ETRNTFSERKIQQLEDKIKMLEG  583

Query  1860  ELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGL  2039
             ELREAAA+E  L+SVVAEHGSS NKVHAPARRLSR+Y HAC+E+S  RR SAARS VSGL
Sbjct  584   ELREAAAIEAALYSVVAEHGSSMNKVHAPARRLSRMYLHACRESSQSRRASAARSAVSGL  643

Query  2040  ILVAKACGNDVPRLTFWLSNCVLLRAAICKFS--EKQQLPLSSEYSKNAVVK-NERKASP  2210
              LVAKACGNDVPRLTFWLSN V+LRA I +     +Q+L   S   +N + K N ++ SP
Sbjct  644   ALVAKACGNDVPRLTFWLSNAVVLRAIISQAIGIPRQKLSAGSSNERNGIGKGNNQRLSP  703

Query  2211  LKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSG  2390
             LKW+ FP   S  N    +  DW++P     ALEK+EAWIFSRIIES+WWQT TPHMQS 
Sbjct  704   LKWKEFP-PSSKENKNASSLGDWKDPYTLISALEKLEAWIFSRIIESVWWQTLTPHMQSA  762

Query  2391  AATSL----DSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCL  2558
             A   +    DS+  K Y RTS S  +E  NF+L+LWKKAF+DA ER+CPVRAGGHECGCL
Sbjct  763   AMKEIYGDTDSDSRKSYGRTSGSSDQEQVNFALDLWKKAFKDACERLCPVRAGGHECGCL  822

Query  2559  HLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQ  2738
              +L+ L+M+QCV RLDVAMFNAILRES D+IPTDPVSDPIS+ +VLPIPAGK+SF AGAQ
Sbjct  823   PVLASLVMEQCVVRLDVAMFNAILRESVDEIPTDPVSDPISDSKVLPIPAGKSSFGAGAQ  882

Query  2739  LKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMS  2918
             LKN IGNWSRWL DLFG+D+DD  +          + ++  E + QD   K F+LLNA+S
Sbjct  883   LKNVIGNWSRWLTDLFGMDEDDLLE----------EGNDDIEDERQDVLFKSFHLLNALS  932

Query  2919  DLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME  3098
             DLMMLPKDMLLSR++RKEVCPTFG  LI RVL+ F+PDEFCPDPIP VV EAL+SED  E
Sbjct  933   DLMMLPKDMLLSRSIRKEVCPTFGAPLIRRVLDNFVPDEFCPDPIPGVVFEALDSEDPFE  992

Query  3099  VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddelde  3278
               E+S+ NFPC AAPIVYAPP AA+    +     + S L RS SSVL+KS+TSDDEL+E
Sbjct  993   AGEDSITNFPCIAAPIVYAPPPAAS-LASILGEVGNQSHLRRSNSSVLRKSHTSDDELEE  1051

Query  3279  ldsPLNLIKMENSEVTKPg--------ggsgngngngVRYQLLREVWMSSE  3407
             L+SPL+ I    S+  +P             NG+ + VRYQLLREVWM+SE
Sbjct  1052  LNSPLSSII---SDGFRPSPVPTKSNWKSRANGSQSDVRYQLLREVWMNSE  1099



>ref|XP_006599039.1| PREDICTED: uncharacterized protein LOC100775183 isoform X1 [Glycine 
max]
 ref|XP_006599040.1| PREDICTED: uncharacterized protein LOC100775183 isoform X2 [Glycine 
max]
Length=1043

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/1093 (47%), Positives = 679/1093 (62%), Gaps = 77/1093 (7%)
 Frame = +3

Query  192   RGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVG  371
             R   ++  EYLI+I EIKPWPPSQSL++L++V+IQWE+G+++SGST  V+P L   S  G
Sbjct  7     RSGGAIHMEYLIHIQEIKPWPPSQSLRSLRSVLIQWENGERSSGSTGVVSPSLGPNSAAG  66

Query  372   NGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDF  551
              G++EFNESFR+P+TL R++S ++     FQKNC+EF+L+E RRD T KGQLLGTA+ID 
Sbjct  67    EGKLEFNESFRLPVTLSRDMSIRNSTAAVFQKNCLEFHLHETRRDKTTKGQLLGTAIIDL  126

Query  552   ANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDSSA  731
             A+ GV++E L++  P+NC+R+YRNT QPLL ++I+ V K   KS +++++ +E +  ++ 
Sbjct  127   ADCGVLRETLSIRTPLNCQRNYRNTDQPLLFIQIEPVEKSCPKSSLKDSLSKEVTKGNNG  186

Query  732   GESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKENGSEGGKNR-  908
              ES+S LMN EY EEAE AS TDDDVSSHSS    +++ ES+   P + E  +  G  + 
Sbjct  187   SESISELMNGEYAEEAEIASSTDDDVSSHSSAAAVTTSSESSACMPPEHEENAPNGPAQN  246

Query  909   --RAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWISKKIGARN  1082
               R + E+ H L SE +++ L++                     L     ++S KIG+  
Sbjct  247   SGRNDKEHEHPLASETRVEKLNE-------------MEQDAYERLERSSSYVSSKIGSPV  293

Query  1083  NIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRTEESICDGS  1262
             N  +S +   + R   TP      N        DS     E  S++ S    +E++    
Sbjct  294   NGHTSITSTPNHRSATTPKQAASLN-------ADSSSPILEENSKSRSISSDDENLDQEG  346

Query  1263  LVNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDN---GLAEGENTEGHQG  1433
                + + RN   S G  I  D  +     SN    D+   V  N   GL       G + 
Sbjct  347   CEKVSNGRNM--STGVQINNDESDFDIYSSNTTSLDSNYLVDKNPSFGL-------GTKD  397

Query  1434  NTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRES-  1610
             N  E+    DK                  E E V   ++D     +L  NS  + G ++ 
Sbjct  398   NLSEMF-HSDKQYHV--------------EDESVAQGVKDQV---NLSSNSYSLGGLDNG  439

Query  1611  VGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQF-------VLRDKRNSIEGITSNDWK  1769
             +      +ERL HV SV +  +S R+ GS+ +N         V  D +N+   I S+D K
Sbjct  440   MKGNVLKNERLKHVRSVRSSADSVRSIGSLGNNHLAEVKENGVNGDTQNNGGNIRSSDRK  499

Query  1770  DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPA  1949
             D KV  +E  N +L+RK + LE KI+MLEGELREAA +E  L+SVVAEHGSST+KVHAPA
Sbjct  500   DAKVYPREARNAILDRKIEHLENKIKMLEGELREAAGIEAALYSVVAEHGSSTSKVHAPA  559

Query  1950  RRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK  2129
             RRLSRLY HACKEN   RR  AA+S VSGL LVAKACGNDVPRLTFWLSN ++LR  I K
Sbjct  560   RRLSRLYLHACKENLQARRAGAAKSAVSGLALVAKACGNDVPRLTFWLSNSIVLRTIISK  619

Query  2130  FSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLP-GTFEDWENPLGFT  2300
              ++      P  S  S+     N++   PL W+ F H+K+       G   +W++P  FT
Sbjct  620   TTKGMTPSNPSGSSTSRRNGEGNDKVTQPLLWRGFSHRKTENTAFEYGGIGNWDDPNVFT  679

Query  2301  KALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLE  2480
              ALEKVEAWIFSRI+ESIWWQ+ TPHMQ   A     +  K Y   SSSC +E  N SL+
Sbjct  680   SALEKVEAWIFSRIVESIWWQSLTPHMQLADAKITHKDSAKNYTNMSSSCDQEWGNLSLD  739

Query  2481  LWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTD  2660
             +WK AFR+A ER+CP+RAGGHECGCL +L KLIM+QCVARLDVAMFNAILRES DDIPTD
Sbjct  740   IWKNAFREACERLCPIRAGGHECGCLSVLPKLIMEQCVARLDVAMFNAILRESDDDIPTD  799

Query  2661  PVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNK  2840
             PVSDPIS+P+VLPIP G++SF AGAQLK AIGNWSRWL  LFG+DDDD  +D+ ++D + 
Sbjct  800   PVSDPISDPKVLPIPPGQSSFGAGAQLKTAIGNWSRWLTGLFGMDDDDPLEDIDDNDLDS  859

Query  2841  ADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNV  3020
              D S            K F+LLNA+SDL+MLPKDMLL+ ++RKEVCP F  SLI ++L+ 
Sbjct  860   NDESQN--------TFKSFHLLNALSDLLMLPKDMLLNASIRKEVCPMFSASLIKKILDN  911

Query  3021  FIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             F+PDEFCPDPIP  V EAL+S+D +E E ES+ NFPC+AAP  Y+PP  AA    +    
Sbjct  912   FVPDEFCPDPIPTDVFEALDSQDDLEDENESISNFPCNAAPTAYSPP-PAATITNITGEF  970

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsP----LNLIKMENSEVTKPgggsgngngngV  3368
              S SQL RS+SSV++KSYTSDDELDEL+ P    LN+    ++       G  + + + +
Sbjct  971   GSESQLRRSKSSVVRKSYTSDDELDELNYPLSSILNIGSSSSASTNSNRKGKDSRDESAI  1030

Query  3369  RYQLLREVWMSSE  3407
             RY+LLR+VWM+SE
Sbjct  1031  RYELLRDVWMNSE  1043



>gb|KHN10822.1| hypothetical protein glysoja_027435 [Glycine soja]
Length=1043

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/1093 (47%), Positives = 678/1093 (62%), Gaps = 77/1093 (7%)
 Frame = +3

Query  192   RGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVG  371
             R   ++  EYLI+I EIKPWPPSQSL++L++V+IQWE+G+++SGST  V+P L   S  G
Sbjct  7     RSGGAIHMEYLIHIQEIKPWPPSQSLRSLRSVLIQWENGERSSGSTGVVSPSLGPNSAAG  66

Query  372   NGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDF  551
              G++EFNESFR+P+TL R++S ++     FQKNC+EF+L+E RRD T KGQLLGTA+ID 
Sbjct  67    EGKLEFNESFRLPVTLSRDMSIRNSTAAVFQKNCLEFHLHETRRDKTTKGQLLGTAIIDL  126

Query  552   ANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDSSA  731
             A+ GV++E L++  P+NC+R+YRNT QPLL ++I+ V K   KS +++++ +E +  ++ 
Sbjct  127   ADCGVLRETLSIRTPLNCQRNYRNTDQPLLFIQIEPVEKSCPKSSLKDSLSKEVTKGNNG  186

Query  732   GESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKENGSEGGKNR-  908
              ES+S LMN EY EEAE AS TDDDVSSHSS    +++ ES+   P + E  +  G  + 
Sbjct  187   SESISELMNGEYAEEAEIASSTDDDVSSHSSAAAVTTSSESSACMPPEHEENAPNGPAQN  246

Query  909   --RAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWISKKIGARN  1082
               R + E+ H L SE +++ L++                     L     ++S KIG+  
Sbjct  247   SGRNDKEHEHPLASETRVEKLNE-------------MEQDAYERLERSSSYVSSKIGSPV  293

Query  1083  NIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRTEESICDGS  1262
             N  +S +   + R   TP      N        DS     E  S++ S    +E++    
Sbjct  294   NGHTSITSTPNHRSATTPKQAASLN-------ADSSSPILEENSKSRSISSDDENLDQEG  346

Query  1263  LVNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDN---GLAEGENTEGHQG  1433
                + + RN   S G  I  D  +     SN    D+   V  N   GL       G + 
Sbjct  347   CEKVSNGRNM--STGVQINNDESDFDIYSSNTTSLDSNYLVDKNPSFGL-------GTKD  397

Query  1434  NTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRES-  1610
             N  E+    DK                  E E V   ++D     +L  NS  + G ++ 
Sbjct  398   NLSEMF-HSDKQYHV--------------EDESVAQGVKDQV---NLSSNSYSLGGLDNG  439

Query  1611  VGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQF-------VLRDKRNSIEGITSNDWK  1769
             +      +ERL HV SV +  +S R+ GS+ +N         V  D +N+   I S+D K
Sbjct  440   MKGNVLKNERLKHVRSVRSSADSVRSIGSLGNNHLAEVKENGVNGDTQNNGGNIRSSDRK  499

Query  1770  DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPA  1949
             D KV  +E  N +L+   + LE KI+MLEGELREAAA+E  L+SVVAEHGSST+KVHAPA
Sbjct  500   DAKVYPREARNAILDNNIEHLENKIKMLEGELREAAAIEAALYSVVAEHGSSTSKVHAPA  559

Query  1950  RRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK  2129
             RRLSRLY HACKEN   RR  AA+S VSGL LVAKACGNDVPRLTFWLSN ++LR  I K
Sbjct  560   RRLSRLYLHACKENLQARRAGAAKSAVSGLALVAKACGNDVPRLTFWLSNSIVLRTIISK  619

Query  2130  FSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLP-GTFEDWENPLGFT  2300
              ++      P  S  S+     N++   PL W+ F H+K+       G   +W++P  FT
Sbjct  620   TTKGMTPSNPSGSSTSRRNGEGNDKVTQPLLWRGFSHRKTENTAFEYGGIGNWDDPNVFT  679

Query  2301  KALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLE  2480
              ALEKVEAWIFSRI+ESIWWQ+ TPHMQ   A     +  K Y   SSSC +E  N SL+
Sbjct  680   SALEKVEAWIFSRIVESIWWQSLTPHMQLADAKITHKDSAKNYTNMSSSCDQEWGNLSLD  739

Query  2481  LWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTD  2660
             +WK AFR+A ER+CP+RAGGHECGCL +L KLIM+QCVARLDVAMFNAILRES DDIPTD
Sbjct  740   IWKNAFREACERLCPIRAGGHECGCLSVLPKLIMEQCVARLDVAMFNAILRESDDDIPTD  799

Query  2661  PVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNK  2840
             PVSDPIS+P+VLPIP G++SF AGAQLK AIGNWSRWL  LFG+DDDD  +D+ ++D + 
Sbjct  800   PVSDPISDPKVLPIPPGQSSFGAGAQLKTAIGNWSRWLTGLFGMDDDDPLEDIDDNDLDS  859

Query  2841  ADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNV  3020
              D S            K F+LLNA+SDL+MLPKDMLL+ ++RKEVCP F  SLI ++L+ 
Sbjct  860   NDESQN--------TFKSFHLLNALSDLLMLPKDMLLNASIRKEVCPMFSASLIKKILDN  911

Query  3021  FIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             F+PDEFCPDPIP  V EAL+S+D +E E ES+ NFPC+AAP  Y+PP  AA    +    
Sbjct  912   FVPDEFCPDPIPTDVFEALDSQDDLEDENESISNFPCNAAPTAYSPP-PAATITNITGEF  970

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsP----LNLIKMENSEVTKPgggsgngngngV  3368
              S SQL RS+SSV++KSYTSDDELDEL+ P    LN+    ++       G  + + + +
Sbjct  971   GSESQLRRSKSSVVRKSYTSDDELDELNYPLSSILNIGSSSSASTNSNRKGKDSRDESAI  1030

Query  3369  RYQLLREVWMSSE  3407
             RY+LLR+VWM+SE
Sbjct  1031  RYELLRDVWMNSE  1043



>ref|XP_006604139.1| PREDICTED: uncharacterized protein LOC100783487 isoform X2 [Glycine 
max]
 ref|XP_006604140.1| PREDICTED: uncharacterized protein LOC100783487 isoform X3 [Glycine 
max]
 ref|XP_003553916.2| PREDICTED: uncharacterized protein LOC100783487 isoform X1 [Glycine 
max]
 gb|KHN24905.1| hypothetical protein glysoja_039823 [Glycine soja]
Length=1070

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/1107 (46%), Positives = 696/1107 (63%), Gaps = 68/1107 (6%)
 Frame = +3

Query  174   GPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLE  353
             G + ++ GV  V  EYLI+I EIKPWPPSQSL++L++V+IQWE+GD++SGST  V+P L 
Sbjct  3     GKNRRSGGV--VHMEYLIHIQEIKPWPPSQSLRSLRSVLIQWENGDRSSGSTGVVSPSLG  60

Query  354   TESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLG  533
               S  G  ++EFNESFR+P+TL R++S ++     FQKNC+EF+L+E RRD T KGQLLG
Sbjct  61    PNSAPGEAKLEFNESFRLPVTLSRDMSIRNSTAAVFQKNCLEFHLHETRRDKTTKGQLLG  120

Query  534   TAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRES  713
             TA+ID A+ GV++E L++  P+NC+R+YRNT QPLL ++I+ V K R KS +++++ +  
Sbjct  121   TAIIDLADCGVLRETLSIRTPLNCQRNYRNTDQPLLFIQIEPVEKSRPKSSLKDSLTK--  178

Query  714   SMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKENGSE  893
                ++  ESVSALMN EY EEAE  S+TDDDVSSHSS+   +++ ES+   P + E    
Sbjct  179   --GNNGSESVSALMNGEYAEEAEITSFTDDDVSSHSSVAAVTTSSESSACMPPEHEENGP  236

Query  894   GGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWISKKIG  1073
                +   + E+ H L SE +++ L+       V+  +A      S++  S +D +S ++G
Sbjct  237   AQNSGSNDKEHEHPLTSETRVEKLN-------VMEQDAYERLERSSSYVSSMD-VSSEVG  288

Query  1074  ARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRTEESIC  1253
             +  N  +S +   + R   TP      N        DS     E  S++ S+   +E++ 
Sbjct  289   SPVNGHTSITSTPNHRSATTPKQVASLN-------ADSSSPTLEENSKSRSRISDDENLD  341

Query  1254  DGSLVNIDD--------NRNSNNSVGHIIKAD---IDESFSTLSN---GIQEDARTGVSD  1391
               S   + +         RN+N S   I  ++   +D ++   +N   G++   +   S 
Sbjct  342   QESCEKVANCRNMSTVVQRNNNESDFDIYSSNTTSLDSNYLVDTNPSFGLETKDKLSESC  401

Query  1392  NGLAEGENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQH  1571
               + +    EG   N    + ++  ++     K+  +E    +EG         +  +  
Sbjct  402   EEVDKSRVLEGGSDNYYSSIQDQHGNEMFHSDKQYHVEDESVAEG---------SKDQVL  452

Query  1572  LEGNSAIIAGRES-VGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQF-------VLRD  1727
             L  NS    G ++ +      +ERL +V SV +  +S R  GS+ +N         V  D
Sbjct  453   LSSNSYSFGGSDNGMKGNVLKNERLKNVRSVRSSADSVRNIGSLGNNHLIEVKENGVNGD  512

Query  1728  KRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVV  1907
              +N+   I S+D KD KV  +E  N +L+ K + LE KI+MLEGELREAAA+E  L+SVV
Sbjct  513   AQNNGANIRSSDRKDAKVYPREARNAILDNKIEHLENKIKMLEGELREAAAIEAALYSVV  572

Query  1908  AEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTF  2087
             AEHGSS +KVHAPARRLSRLY HACKEN   RR  AA+S VSGL+LVAKACGNDVPRLTF
Sbjct  573   AEHGSSMSKVHAPARRLSRLYLHACKENFQARRAGAAKSAVSGLVLVAKACGNDVPRLTF  632

Query  2088  WLSNCVLLRAAICKFSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLP  2261
             WLSN ++LR  I K ++      P  S   +     N +   PL W+ F  +K+      
Sbjct  633   WLSNSIVLRTIISKTTKGMTPSNPSGSSTRRRNGEGNGKVTQPLLWRGFSPRKNENTAFE  692

Query  2262  -GTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRT  2438
              G    W++P  FT ALEKVEAWIFSRI+ESIWWQ+ TPHMQ   A +   +  K Y+  
Sbjct  693   YGGIGSWDDPNMFTSALEKVEAWIFSRIVESIWWQSLTPHMQLADAKATCKDSAKNYKNM  752

Query  2439  SSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMF  2618
             SSSC +E  N SL +WK AFR+A ER+CP+RAGGHECGCL +L +LIM+QCVARLDVAMF
Sbjct  753   SSSCDQEQGNLSLGIWKNAFREACERLCPIRAGGHECGCLSVLPRLIMEQCVARLDVAMF  812

Query  2619  NAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdd  2798
             NAILRES DDIPTDPVSDPIS+P+VLPIP G++SF AGAQLK AIGNWSRWL DLFG+  
Sbjct  813   NAILRESDDDIPTDPVSDPISDPKVLPIPPGQSSFGAGAQLKTAIGNWSRWLTDLFGM--  870

Query  2799  ddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVC  2978
              D+DD L + DEN  D+++G +        K F+LLNA+SDL+MLPKDMLL+ ++RKEVC
Sbjct  871   -DDDDPLEDRDENDLDSNDGSQNTL-----KSFHLLNALSDLLMLPKDMLLNASIRKEVC  924

Query  2979  PTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAP  3158
             P F  SLI ++L+ F+PDEFCPDPIP  V EAL+S+D +E E ES+ NFPC+AAPI Y+P
Sbjct  925   PMFSASLIKKILDNFVPDEFCPDPIPTDVFEALDSQDDLEDENESINNFPCNAAPIAYSP  984

Query  3159  PSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL---NLIKMENSEVTK  3329
             PS+      +     S SQL RS+SSV++KSYTSDDELDE++ PL         +   +K
Sbjct  985   PSSTT-ITSITGEIGSESQLRRSKSSVVRKSYTSDDELDEINYPLSSILNSGSSSPASSK  1043

Query  3330  Pg-ggsgngngngVRYQLLREVWMSSE  3407
             P      + + + VRY+LLR+VWM+SE
Sbjct  1044  PNWKWKDSRDESAVRYELLRDVWMNSE  1070



>ref|XP_010248932.1| PREDICTED: uncharacterized protein LOC104591675 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248933.1| PREDICTED: uncharacterized protein LOC104591675 isoform X1 [Nelumbo 
nucifera]
Length=1068

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/1111 (47%), Positives = 675/1111 (61%), Gaps = 81/1111 (7%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             M+LG   K R   SVQ +Y I+I EI+PWPPSQSL++L++V++QWE+GD+NSGST  V P
Sbjct  1     MLLGLRTKNRKGTSVQVDYFIHIQEIEPWPPSQSLRSLRSVLLQWENGDRNSGSTKPVIP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SGVG+G+IEFNESFR+P+TL RE+  KS + ++FQKNC+EF LYEPRRD TVKG 
Sbjct  61    SLG--SGVGDGKIEFNESFRLPVTLSREVPIKSGDVESFQKNCLEFTLYEPRRDKTVKGL  118

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGT +ID A YG+V+E + +S P+NCKR++RNT QP L +KIQ   K    SL R  + 
Sbjct  119   LLGTVMIDLAEYGIVQETICISAPMNCKRNFRNTAQPALFVKIQPFEKNCSSSLQRERLS  178

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQ-KE  881
             +    D    +SVS LM EEY EEAETAS+TDDDVSSHSSL  SSS  E++ SSP Q KE
Sbjct  179   KVVPRDKDGKDSVSVLMTEEYAEEAETASFTDDDVSSHSSLTISSSVFEASGSSPAQNKE  238

Query  882   NGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWIS  1061
             N SE  +N     +    +  E+  +  + + V+ P   LN SSS S           +S
Sbjct  239   NASEAVRNGAGSQDGVSAISLEKVPERSEVRAVTTPYKHLNRSSSHSSPVD-------LS  291

Query  1062  KKIGARNNIKSS-TSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRT  1238
              ++G+  +  SS T+F + S  + T     K    +  E   S  +     S++++QQ  
Sbjct  292   SEVGSPEDDHSSLTNFWQRSSEQIT-----KVPVTDSVEA--SSAVKGSRKSEDNAQQSI  344

Query  1239  EESICDG-SLVNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNGLAEGEN  1415
             ++   DG S      N N        ++ D      + ++    D   G S   +  GE 
Sbjct  345   KKDNTDGVSTRGAPSNPN--------LQMDGIAGLVSTTDSQINDRDYGESREQIGNGE-  395

Query  1416  TEGHQGNTQELVTERDKHQETGEGK----ELIIEKGQCSEGEPVNSCLQDNTTKQHLEGN  1583
              EG   N     +  ++  E   GK    +   EK    E +      QD   KQ   G 
Sbjct  396   -EGASTNNGRPASHMEEKDEEQLGKNRQEKKAGEKIHSKEDKSSKISSQDAMRKQVAFGT  454

Query  1584  SAIIAGRESVGAK--TTCDERLNHVSSVHTLGESNRANGSVRSNQF-----------VLR  1724
             S I      +G +  +    RL HV SV +  +++R N  +  NQ            ++ 
Sbjct  455   SPIAFDSRDLGVRDNSLTVSRLKHVKSVRSPVDTSRNNELLYGNQLTEVKEVDVSEDIVS  514

Query  1725  DKRNSIEGITSNDWKDT-KVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFS  1901
               R+SI    SND +D   V+     NV    K Q+LE +++ LE ELREAAAVE+GL+S
Sbjct  515   SSRSSITA-ESNDAQDACTVKLNCHYNV----KVQQLEHRVESLERELREAAAVEVGLYS  569

Query  1902  VVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRL  2081
             VVAEHGSS NKVHAPARRLSRLY HAC++ S   R +AARS VSGL+LVAKACGND+PRL
Sbjct  570   VVAEHGSSANKVHAPARRLSRLYHHACRKQSPGHRATAARSAVSGLVLVAKACGNDIPRL  629

Query  2082  TFWLSNCVLLRAAICKFSEKQQLPLSSE---YSKNAVVKNERKASPLKWQSFPHKKSVGN  2252
             TFWLSN V+LR  I +   + QL + +     +    + NE+K SPLKW      K    
Sbjct  630   TFWLSNSVVLREIISQVVGESQLSICAGPQIEANGGKMGNEKKYSPLKWNESSLNKKEKF  689

Query  2253  DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQ  2432
                  F++WE+P  F  ALEKVEAWIFSRIIES+WWQT TP+MQS      D    K+  
Sbjct  690   VFSNDFDEWEDPQTFVTALEKVEAWIFSRIIESVWWQTLTPYMQSATRIGND----KVMV  745

Query  2433  RTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDV  2609
               S S  ++ + NFSL LWK+AFRDA E++CPVRAGGHECGCL +L++L+M+QC+ RLDV
Sbjct  746   SNSGSLGDQEQGNFSLHLWKEAFRDACEKLCPVRAGGHECGCLPVLARLVMEQCMNRLDV  805

Query  2610  AMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFG  2789
             A+FNAILRESAD+IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLKNAIGNWSR L DLFG
Sbjct  806   ALFNAILRESADEIPTDPVSDPISDSKVLPIPAGKSSFGNGAQLKNAIGNWSRCLIDLFG  865

Query  2790  IddddedddlveddeNKADNSNG---HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRT  2960
             +           D++    + NG    +R+  +   K F+LLNA+SDLMMLPKDM+L+R 
Sbjct  866   M-----------DEDGSFKDENGLYDEDRQEPETSFKTFHLLNALSDLMMLPKDMILNRA  914

Query  2961  VRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAA  3140
             +RKEVCPT  + LI RVL+ F+PDEFC DP+P  VLE L+SED +E EEES+  FPC+AA
Sbjct  915   IRKEVCPTLSVPLIRRVLSNFVPDEFCSDPVPEFVLETLSSEDPVEAEEESLRTFPCNAA  974

Query  3141  PIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL------NLI  3302
             PIVY PP+ A     +     S  QL RS SS+L+KSYTSDDELDELDS L       L 
Sbjct  975   PIVYKPPTTAT-IVGVVGDVESQLQLRRSGSSMLRKSYTSDDELDELDSSLVSIITDGLW  1033

Query  3303  KMENSEVTKPgggsgngngngVRYQLLREVW  3395
                +S          NG     RY+LLREVW
Sbjct  1034  ARASSTRVPSWNLKENGGQKAQRYELLREVW  1064



>ref|XP_007161753.1| hypothetical protein PHAVU_001G095700g [Phaseolus vulgaris]
 ref|XP_007161754.1| hypothetical protein PHAVU_001G095700g [Phaseolus vulgaris]
 gb|ESW33747.1| hypothetical protein PHAVU_001G095700g [Phaseolus vulgaris]
 gb|ESW33748.1| hypothetical protein PHAVU_001G095700g [Phaseolus vulgaris]
Length=1070

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/1096 (45%), Positives = 670/1096 (61%), Gaps = 64/1096 (6%)
 Frame = +3

Query  204   SVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRI  383
             +V  EYLI+I EIKPWPPSQSL+ L++V+IQWE+G++ SGST  V+P     S  G G++
Sbjct  11    AVHMEYLIHIQEIKPWPPSQSLRLLRSVLIQWENGERASGSTGIVSPSPSPSSVAGEGKL  70

Query  384   EFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFANYG  563
             EFNESF++P+TL R++S ++   + FQKNC+EF+LYE RRD TVKGQLLGTA+ID A+ G
Sbjct  71    EFNESFKLPVTLSRDMSIRNSTAEVFQKNCLEFHLYETRRDKTVKGQLLGTAIIDLADCG  130

Query  564   VVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDSSAGESV  743
             V++E L++  P+NC+R+YRNT QPLL ++I+ V K   +S +++++ +    D++  ESV
Sbjct  131   VLRETLSIRTPLNCQRNYRNTDQPLLFIQIEPVEKSYPRSSLKDSLSKGVPKDNNGNESV  190

Query  744   SALMNeeyteeaetasytdddvsshsslvnsssavesnc-ssPHQKENGSEG-GKNRRAE  917
             SALMN EY EEAE AS++DDDVSSHSS+   +++ ES+    P Q+ENG  G  +N    
Sbjct  191   SALMNGEYAEEAEIASFSDDDVSSHSSVAAVTTSSESSACMPPEQEENGPNGSAQNSGRN  250

Query  918   AENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWISKKIGARNNIKSS  1097
              +  H L SE +++ L+       V+  +A      S++  S +D  S+     N   S 
Sbjct  251   DKGYHPLASETRVEKLN-------VMEQDAYERLERSSSYVSSMDVFSEVESPVNGHASI  303

Query  1098  TSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRTEESICDGSLVNID  1277
             TS  +  R   TP      N        DS     E  S++  +    E++       + 
Sbjct  304   TSIPQ-YRSVTTPKQVASLN-------ADSSPPALEENSKSRFRSSEHENLDQEGCEKVA  355

Query  1278  DNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNGLAEGENTEGHQGNTQELVTE  1457
             ++R     +G +++ + +ES   + +       +   D   + G  T   + N  E+  E
Sbjct  356   NSR----EMGTVVQLNSNESDFDIYSRTTTSLGSDYLDKNPSIGLET---KDNLSEICEE  408

Query  1458  RDKH--QETG-----EGKELI-IEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESV  1613
              DK   QE G      G E++  +K    E E V    +D    Q L  ++   +G    
Sbjct  409   VDKSLVQEGGSIEDKHGNEMLHFDKLYLVEDESVMQYAKD----QALLSSNLYSSGGSDN  464

Query  1614  GAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEG--------ITSND  1763
             G K     +ERL HV SV +    +  +     N  +   K N + G        I S+D
Sbjct  465   GLKCNFLKNERLKHVKSVRSSSSDSVRSIGSLGNNHLTEVKENGVNGDVQNNGGNIQSSD  524

Query  1764  WKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHA  1943
              K+ KV  +E   V+L+ K + +E KI+MLEGELREAAA+E  LFSVVAEHGSS +KVHA
Sbjct  525   RKEAKVYPREAKKVILDSKIEHMENKIKMLEGELREAAAIEAALFSVVAEHGSSMSKVHA  584

Query  1944  PARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAI  2123
             PARRLSRLY HACKEN   RR  AA+S VSGL+LVAKACGNDVPRLTFWLSN ++LR  I
Sbjct  585   PARRLSRLYLHACKENIEARRAGAAKSAVSGLVLVAKACGNDVPRLTFWLSNSIVLRTII  644

Query  2124  CKFSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSF-PHKKSVGNDLPGTFEDWENPLG  2294
              K ++      P  S   KN   K       L W+ F P K        G    W++   
Sbjct  645   SKTTKNMTPSNPSGSRTRKNGEAKVGNVTQHLIWRGFSPRKNDYTAFENGGIGKWDDLNV  704

Query  2295  FTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFS  2474
             FT ALEKVEAWIFSRI+ESIWWQ+ TP M    A     + +K Y+  S SC +E  N S
Sbjct  705   FTSALEKVEAWIFSRIVESIWWQSLTPCMHLSDAKVNRKDSSKNYKSMSGSCDQEQGNLS  764

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L++WK AFR+A ER+CP+RAGGHECGCL +L +LIM+QCVARLDVAMFNAILRES DDIP
Sbjct  765   LDIWKNAFREACERLCPIRAGGHECGCLSVLPRLIMEQCVARLDVAMFNAILRESNDDIP  824

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDPVSDPIS+P VLPIP GK+SF +GAQLK AIGNWSRWL         D      +D  
Sbjct  825   TDPVSDPISDPRVLPIPPGKSSFGSGAQLKTAIGNWSRWLT--------DLFGLDDDDSL  876

Query  2835  NKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVL  3014
             ++  +  G    +Q+   K F+LLNA+SDL+MLPKDMLLS ++RKEVCP F   LI R+L
Sbjct  877   DRDGDDLGSNDGSQNTSFKSFHLLNALSDLLMLPKDMLLSSSIRKEVCPMFTAPLIRRIL  936

Query  3015  NVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgd  3194
             + F+PDEFCPDPIP+ V EAL+S+D ++   ES+ +FPC+AAPI Y+PP  A     +  
Sbjct  937   DNFVPDEFCPDPIPDHVFEALDSQDDLDDGNESINDFPCNAAPIAYSPP-PATTITSITG  995

Query  3195  isssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggs-----gngng  3359
                S SQL RS+SSV++KSYTSDDELDEL+ PL+LI + N     P   S      + + 
Sbjct  996   EIGSESQLRRSKSSVVRKSYTSDDELDELNYPLSLI-LNNGSSAPPSTKSNCKWKESRDE  1054

Query  3360  ngVRYQLLREVWMSSE  3407
             + +R++LL++VWM+SE
Sbjct  1055  SSIRFELLKDVWMNSE  1070



>ref|XP_010317389.1| PREDICTED: uncharacterized protein LOC101267486 isoform X2 [Solanum 
lycopersicum]
Length=912

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/938 (51%), Positives = 631/938 (67%), Gaps = 53/938 (6%)
 Frame = +3

Query  675   MKSLVRNNVRRESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssaves  854
             M+  +R++++RE+SMD +   S+S L++EEY EEAE ASYTDDDVSSH SL  SSS   S
Sbjct  1     MRPSLRDSLKREASMDRNG--SLSRLLSEEYAEEAEFASYTDDDVSSHLSLPVSSSTNGS  58

Query  855   ncssPHQKENGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspsta  1034
             N  SP Q E    G K+   + E  +VL  ++++KN++KK  ++    L  S S + +  
Sbjct  59    NYGSPPQGEERFTGVKSSPGQDEYENVLDDKRRLKNMEKKQGTKSPSRLQGSLSHTSTDL  118

Query  1035  lssdlDWISKKIGARNNIKSSTS----FEKDSRMECTPNTNVKTNTGEQAEGVDSVVINC  1202
                   WISKKIGA ++ + +TS       D++ +C     +     +QA+ V+ +V + 
Sbjct  119   SFDLA-WISKKIGASSSTQYATSNVSSITGDTQNDC-----MLIKQDKQAQCVEQIVASD  172

Query  1203  ENGSQNHSQQRTEESICDGS--------LVNIDDNRNSNNSVGHIIKADIDESFSTLS-N  1355
             E+G +   ++ +EE   D          L   D++ N  N+V +    +I+E+ ST S N
Sbjct  173   ESGGEISCRRSSEEGFFDAHPAEKACPVLHITDESSNFVNTVSNFSDNEIEENTSTPSLN  232

Query  1356  GIQEDARTGVSDNGLAEGENTEGHQGNTQELVTERD-KHQETGEGKELIIEKGQCSEGEP  1532
             G+ +DAR  V+ NG     N+E H+ N+Q+       +HQE    KE++  KG+C + E 
Sbjct  233   GLCDDARDAVTQNG-----NSEDHRENSQQCSPHNGGQHQENEHEKEILENKGRCKKDES  287

Query  1533  VNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTC--DERLNHVSSVHTLGESNRANGSVRS  1706
             V+   ++ T    L+   A+ A R+S GAK+T   +E L HV SV +  ESNR +GSV S
Sbjct  288   VSCYPEEATLVPVLKETGAVSAYRDSSGAKSTTPQNEILKHVMSVRSSSESNR-DGSVGS  346

Query  1707  NQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVE  1886
             +Q +++D    ++G +SN+ KD KV  ++T+N++LE K  +LEQ+++MLE ELRE+AA+E
Sbjct  347   DQLLVQDTPKGVKGFSSNERKDQKVSPRDTTNILLESKIHKLEQRVKMLEEELRESAAIE  406

Query  1887  IGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGN  2066
             +GL+SVVAEHG S NKVHAPARRLSR Y HA KENSVL+R +AA+S +SG+ LVAKACGN
Sbjct  407   VGLYSVVAEHGYSANKVHAPARRLSRFYLHAYKENSVLKRGNAAKSAISGIYLVAKACGN  466

Query  2067  DVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKA--SPLKWQSFPHKK  2240
             DV RLTFWLSN V+LRA I KF  +QQ+PLS++      V  ++K   SPLKW+S     
Sbjct  467   DVARLTFWLSNSVVLRATITKFHGQQQIPLSADSMPEKTVVKDKKKKFSPLKWESC-SSN  525

Query  2241  SVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS----LD  2408
              V ND+  +  +WE+P+ F +ALEK+EAWIFSRIIESIWWQT  P+MQSGAAT+    + 
Sbjct  526   DVRNDICESLGNWEDPVTFIRALEKIEAWIFSRIIESIWWQTLIPYMQSGAATAICNDMG  585

Query  2409  SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQ  2588
              EINK     SSS +EE  NFSLELWKKA R A ERICP+RAGGHECGCLH LSKLIM+Q
Sbjct  586   PEINKFSSTASSSGAEEHGNFSLELWKKALRHACERICPIRAGGHECGCLHFLSKLIMEQ  645

Query  2589  CVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSR  2768
             CVARLDVA+FNAILR S+D++P+DP+SDPIS+ EVLPIPAGKASF AGAQLK AIGNWSR
Sbjct  646   CVARLDVAIFNAILRVSSDEMPSDPISDPISDAEVLPIPAGKASFGAGAQLKIAIGNWSR  705

Query  2769  WLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDML  2948
             W+ +L G            DDE++ADN +  +    D+ S+ F LLNA+SDLM+LPKDML
Sbjct  706   WITELVG-----SGGANSVDDESRADNED--DGSEYDSSSESFNLLNALSDLMLLPKDML  758

Query  2949  LSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFP  3128
             LSRT+RKEVCPTFG  +I RVLNVF+PDEFCPDPI  VVLEALNSED  + EE+SV+++P
Sbjct  759   LSRTIRKEVCPTFGPIIIRRVLNVFVPDEFCPDPIHEVVLEALNSEDPFDAEEDSVMSYP  818

Query  3129  CSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKM  3308
             C+AAP+ Y PPS A+    L    S  SQL RS+SSVLKKSYTSDDELD+LD  LN I  
Sbjct  819   CTAAPVAYKPPSTAS-VDGLLGDVSHHSQLRRSKSSVLKKSYTSDDELDQLD--LNFIIS  875

Query  3309  ENSEVTKPgggsgngng-----ngVRYQLLREVWMSSE  3407
             E    T P   S          N VRYQLLREVWM SE
Sbjct  876   EGI-ATSPLVKSSRIAEGSGNGNAVRYQLLREVWMKSE  912



>ref|XP_010248934.1| PREDICTED: uncharacterized protein LOC104591675 isoform X2 [Nelumbo 
nucifera]
Length=1052

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/1111 (46%), Positives = 659/1111 (59%), Gaps = 97/1111 (9%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             M+LG   K R   SVQ +Y I+I EI+PWPPSQSL++L++V++QWE+GD+NSGST  V P
Sbjct  1     MLLGLRTKNRKGTSVQVDYFIHIQEIEPWPPSQSLRSLRSVLLQWENGDRNSGSTKPVIP  60

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SGVG+G+IEFNESFR+P+TL RE+  KS + ++FQKNC+EF LYEPRRD TVKG 
Sbjct  61    SLG--SGVGDGKIEFNESFRLPVTLSREVPIKSGDVESFQKNCLEFTLYEPRRDKTVKGL  118

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LLGT +ID A YG+V+E + +S P+NCKR++RNT QP L +KIQ   K    SL R  + 
Sbjct  119   LLGTVMIDLAEYGIVQETICISAPMNCKRNFRNTAQPALFVKIQPFEKNCSSSLQRERLS  178

Query  705   RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQ-KE  881
             +    D    +SVS LM EEY EEAETAS+TDDDVSSHSSL  SSS  E++ SSP Q KE
Sbjct  179   KVVPRDKDGKDSVSVLMTEEYAEEAETASFTDDDVSSHSSLTISSSVFEASGSSPAQNKE  238

Query  882   NGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWIS  1061
             N SE  +N     +    +  E+  +  + + V+ P   LN SSS S           +S
Sbjct  239   NASEAVRNGAGSQDGVSAISLEKVPERSEVRAVTTPYKHLNRSSSHSSPVD-------LS  291

Query  1062  KKIGARNNIKSS-TSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRT  1238
              ++G+  +  SS T+F + S  + T     K    +  E   S  +     S++++QQ  
Sbjct  292   SEVGSPEDDHSSLTNFWQRSSEQIT-----KVPVTDSVEA--SSAVKGSRKSEDNAQQSI  344

Query  1239  EESICDG-SLVNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNGLAEGEN  1415
             ++   DG S      N N        ++ D      + ++    D   G S   +  GE 
Sbjct  345   KKDNTDGVSTRGAPSNPN--------LQMDGIAGLVSTTDSQINDRDYGESREQIGNGE-  395

Query  1416  TEGHQGNTQELVTERDKHQETGEGK----ELIIEKGQCSEGEPVNSCLQDNTTKQHLEGN  1583
              EG   N     +  ++  E   GK    +   EK    E +      QD   KQ   G 
Sbjct  396   -EGASTNNGRPASHMEEKDEEQLGKNRQEKKAGEKIHSKEDKSSKISSQDAMRKQVAFGT  454

Query  1584  SAIIAGRESVGAK--TTCDERLNHVSSVHTLGESNRANGSVRSNQF-----------VLR  1724
             S I      +G +  +    RL HV SV +  +++R N  +  NQ            ++ 
Sbjct  455   SPIAFDSRDLGVRDNSLTVSRLKHVKSVRSPVDTSRNNELLYGNQLTEVKEVDVSEDIVS  514

Query  1725  DKRNSIEGITSNDWKDT-KVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFS  1901
               R+SI    SND +D   V+     NV    K Q+LE +++ LE ELREAAAVE+GL+S
Sbjct  515   SSRSSITA-ESNDAQDACTVKLNCHYNV----KVQQLEHRVESLERELREAAAVEVGLYS  569

Query  1902  VVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRL  2081
             VVAEHGSS NKVHAPARRLSRLY HAC++ S   R +AARS VSGL+LVAKACGND+PRL
Sbjct  570   VVAEHGSSANKVHAPARRLSRLYHHACRKQSPGHRATAARSAVSGLVLVAKACGNDIPRL  629

Query  2082  TFWLSNCVLLRAAICKFSEKQQLPLSSE---YSKNAVVKNERKASPLKWQSFPHKKSVGN  2252
             TFWLSN V+LR  I +   + QL + +     +    + NE+K SPLKW      K    
Sbjct  630   TFWLSNSVVLREIISQVVGESQLSICAGPQIEANGGKMGNEKKYSPLKWNESSLNKKEKF  689

Query  2253  DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQ  2432
                  F++WE+P  F  ALEK                T TP+MQS      D    K+  
Sbjct  690   VFSNDFDEWEDPQTFVTALEK----------------TLTPYMQSATRIGND----KVMV  729

Query  2433  RTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDV  2609
               S S  ++ + NFSL LWK+AFRDA E++CPVRAGGHECGCL +L++L+M+QC+ RLDV
Sbjct  730   SNSGSLGDQEQGNFSLHLWKEAFRDACEKLCPVRAGGHECGCLPVLARLVMEQCMNRLDV  789

Query  2610  AMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFG  2789
             A+FNAILRESAD+IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLKNAIGNWSR L DLFG
Sbjct  790   ALFNAILRESADEIPTDPVSDPISDSKVLPIPAGKSSFGNGAQLKNAIGNWSRCLIDLFG  849

Query  2790  IddddedddlveddeNKADNSNG---HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRT  2960
             +D+D               + NG    +R+  +   K F+LLNA+SDLMMLPKDM+L+R 
Sbjct  850   MDEDGSFK-----------DENGLYDEDRQEPETSFKTFHLLNALSDLMMLPKDMILNRA  898

Query  2961  VRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAA  3140
             +RKEVCPT  + LI RVL+ F+PDEFC DP+P  VLE L+SED +E EEES+  FPC+AA
Sbjct  899   IRKEVCPTLSVPLIRRVLSNFVPDEFCSDPVPEFVLETLSSEDPVEAEEESLRTFPCNAA  958

Query  3141  PIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL------NLI  3302
             PIVY PP+ A     +     S  QL RS SS+L+KSYTSDDELDELDS L       L 
Sbjct  959   PIVYKPPTTAT-IVGVVGDVESQLQLRRSGSSMLRKSYTSDDELDELDSSLVSIITDGLW  1017

Query  3303  KMENSEVTKPgggsgngngngVRYQLLREVW  3395
                +S          NG     RY+LLREVW
Sbjct  1018  ARASSTRVPSWNLKENGGQKAQRYELLREVW  1048



>ref|XP_006338685.1| PREDICTED: uncharacterized protein LOC102601194 [Solanum tuberosum]
Length=1130

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/703 (55%), Positives = 489/703 (70%), Gaps = 40/703 (6%)
 Frame = +3

Query  1332  ESFSTLSNGIQEDARTGVSDNGLAEGENTEGHQGNTQELVTE-RDKHQETGEGKELIIEK  1508
             E+ ST      ED R  V+ NG  EGEN+E +Q   QE     R+ +QE  + +E++ E+
Sbjct  457   ENASTPLGNRHEDVRAVVTKNGSYEGENSENYQERRQESAAHNRENYQENEQVQEIVEEE  516

Query  1509  GQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTC--DERLNHVSSVHTLGESN  1682
                   + V+     N+T              +S G+K++   +ERL HV SV +  E N
Sbjct  517   ESEDSMKNVSEESDVNSTDT------------DSYGSKSSILNNERLKHVKSVRSSAEPN  564

Query  1683  RANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGE  1862
             R  GSVR NQ + ++K+ S +G+ +N+WKD K  S     ++LE K  +LEQ+++M EGE
Sbjct  565   RVRGSVRGNQLLAQNKQISTQGL-ANEWKDRKAHS----TILLESKLHKLEQRVKMAEGE  619

Query  1863  LREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLI  2042
             LREAAA+E+GL+SVVAEHGSSTNKVHAPARRLSR YFHACK++S+L+R SAA+S VSGLI
Sbjct  620   LREAAAIEVGLYSVVAEHGSSTNKVHAPARRLSRFYFHACKDDSLLKRGSAAKSAVSGLI  679

Query  2043  LVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERK--ASPLK  2216
             LVA+ACGNDVPRLTFWLSN V+LRA I KF  +  LP ++E      V  ++K  +SPLK
Sbjct  680   LVARACGNDVPRLTFWLSNSVVLRATISKFQRQLCLPRATETMLGEAVSKDKKNISSPLK  739

Query  2217  WQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAA  2396
             W++F     + +D   +F +WE+P  FT+AL++ EAWIFS I+ESIWWQT TPHMQSGAA
Sbjct  740   WETF-SSNVIRDDFCESFGNWEDPRTFTRALQRTEAWIFSLIVESIWWQTLTPHMQSGAA  798

Query  2397  T----SLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHL  2564
                  S++S I+K+Y+RT+SS +EE  ++S ELWKKAF+DA ERICPVRAGGHECGCL  
Sbjct  799   KEIRLSMNSLISKVYRRTASSDNEEHGSYSSELWKKAFKDACERICPVRAGGHECGCLRF  858

Query  2565  LSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLK  2744
             LSKLIM+QCVARLDVAMFNAILRESAD+IP+DP+SDPIS+ +VLPIPAG+ASF AGAQLK
Sbjct  859   LSKLIMEQCVARLDVAMFNAILRESADEIPSDPISDPISDADVLPIPAGQASFGAGAQLK  918

Query  2745  NAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDL  2924
             N +GNWSRWL DLF I           +    ++  NG   K  D  +K FYLLNA+SDL
Sbjct  919   NTVGNWSRWLTDLFDI--------DDGESLKNSNEENGS--KELDTSAKSFYLLNALSDL  968

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             MMLPKDMLLSRT+RKEVCP  G SLI RVLN+F+PDEFC D IP  V E L SE+  E E
Sbjct  969   MMLPKDMLLSRTMRKEVCPALGPSLIRRVLNIFVPDEFCRDSIPEAVFEVLLSEEPSEAE  1028

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             ++SV N+PC+AAP+ Y PP  A+    +     S S LTRS SSVLKKSYTSD+EL+ LD
Sbjct  1029  DDSVTNYPCTAAPVAYMPPPIAS-VAGMLGDGYSYSMLTRSASSVLKKSYTSDEELELLD  1087

Query  3285  sPLNLIKMENSEVTKPgggsgn--gngngVRYQLLREVWMSSE  3407
             SPLN I  + +E +       +   +    RYQLLREVW +SE
Sbjct  1088  SPLNFIISDGTEASHSLAKQSSMPKSSGRQRYQLLREVWDNSE  1130


 Score =   291 bits (744),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 213/433 (49%), Positives = 284/433 (66%), Gaps = 16/433 (4%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MV G   KTR  PSVQ +YLI+I EIKPWPPSQSLK+++A+VIQWE+GD+N GST+QV P
Sbjct  1     MVSGLRAKTRKGPSVQVDYLIHIQEIKPWPPSQSLKSVRAIVIQWENGDRN-GSTSQVVP  59

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SGVG+GRIEFNESF++P+TLL+EIS+K  +G++FQKNCIEFNLYEPRRD TVKGQ
Sbjct  60    FLG--SGVGDGRIEFNESFKLPVTLLKEISNKGGDGNSFQKNCIEFNLYEPRRDKTVKGQ  117

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV-  701
              LGTA+I+ A YGVVKEGLNVS PINC R+YRNT Q LL LKIQ   KGR+ S   +++ 
Sbjct  118   PLGTAIINLAEYGVVKEGLNVSAPINCTRAYRNTTQALLLLKIQPFEKGRVSSSSSSDIL  177

Query  702   RRESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKE  881
              RE S+D +  ESVS L +EE  EEAE AS+TDDD SSHSS+  SSSA  SNC S  Q E
Sbjct  178   TREVSIDRNGVESVSTLTSEECAEEAEIASFTDDDGSSHSSVAVSSSANGSNCGSLPQGE  237

Query  882   NGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWIS  1061
             + +EG K+   + E+ H+L S++K  +LD+K V + +  L  S S S +   S    W+S
Sbjct  238   DEAEGVKSNPGQHEDEHLLHSKKKSVDLDEKQVVKSLSDLKESPSPSSTDLSSDLA-WLS  296

Query  1062  KKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRTE  1241
             +KIG   + K STS E +   E + N  V T   E  + ++ ++ N E+G + ++ Q +E
Sbjct  297   RKIGGSGSNKFSTSSENEI-TENSQNPRVMTKHVEPVQRMERILANSESGGEIYTPQNSE  355

Query  1242  ESICDGSLVN--------IDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG  1397
             E   +  L           D++++  NS  H   ++  ++ ST      ED R  V++NG
Sbjct  356   EGRLNSHLDQEGFPISHITDESKSFMNSASHFSSSENADNASTPVVDRHEDVRDIVTENG  415

Query  1398  LAEGENTEGHQGN  1436
                 E+ E +Q N
Sbjct  416   --SYEDIENYQEN  426



>ref|XP_004231790.1| PREDICTED: uncharacterized protein LOC101246002 [Solanum lycopersicum]
 ref|XP_010315921.1| PREDICTED: uncharacterized protein LOC101246002 [Solanum lycopersicum]
Length=1133

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/753 (53%), Positives = 507/753 (67%), Gaps = 57/753 (8%)
 Frame = +3

Query  1182  DSVVINCENGSQNHS-QQRTEESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTLSNG  1358
             +S V N EN  +N   Q+  EE   + S+ N  +  + N++       D + +F+ L N 
Sbjct  427   ESGVYNIENYQENGKVQEIVEEEDSEDSMKNDSEKSDVNST-------DSENAFTPLGNR  479

Query  1359  IQEDARTGVSDNGLAEGENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVN  1538
               EDAR  V+ NG  EG+N+E +Q        ER+ +QE  + +E++ E+      + V+
Sbjct  480   -HEDARAVVTKNGSCEGQNSENYQ--------ERENYQENEQVQEIVEEEESEDAMKNVS  530

Query  1539  SCLQDNTTKQHLEGNSAIIAGRESVGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQ  1712
                  N+T              +S GAK++   +ERL HV SV +  E NR  GSVR NQ
Sbjct  531   EESDVNSTDT------------DSYGAKSSILNNERLKHVKSVRSSAEPNRVRGSVRGNQ  578

Query  1713  FVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
              + +DK  S + +  N+WK+    S     ++LE K  +LEQ+++M EGELREAAA+E+G
Sbjct  579   LLAQDKLISTQDL-GNEWKNRNAHS----TILLENKLHKLEQRVKMAEGELREAAAIEVG  633

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVVAEHGSSTNKVHAPARRLSR YFHACK++S+L+R SAA+S VSGLILVA+ACGNDV
Sbjct  634   LYSVVAEHGSSTNKVHAPARRLSRFYFHACKDDSLLKRGSAAKSAVSGLILVARACGNDV  693

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERK--ASPLKWQSFPHKKSV  2246
             PRLTFWLSN V+LRA I KF  +  LP ++E      V  ++K  +SPLKW++F      
Sbjct  694   PRLTFWLSNSVVLRATISKFQRQLCLPRTTETILGEAVSKDKKKISSPLKWETF-SSNVT  752

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAAT----SLDSE  2414
              +D   +F +WE+P  FT+AL++ EAWIFS I+ESIWWQT TPHMQSGAA     S++S 
Sbjct  753   KDDFCESFGNWEDPRTFTRALQRTEAWIFSLIVESIWWQTLTPHMQSGAAKEIRESMNSL  812

Query  2415  INKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             I+K+Y+RT++S +EE  ++S ELWKKAF+DA ERICPVRAGGHECGCL  LSKLIM+QCV
Sbjct  813   ISKVYRRTATSDNEEHGSYSSELWKKAFKDACERICPVRAGGHECGCLRFLSKLIMEQCV  872

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             ARLDVAMFNAILRESAD+IP+DP+SDPIS+ +VLPIPAG+ASF AGAQLKN +GNWSRWL
Sbjct  873   ARLDVAMFNAILRESADEIPSDPISDPISDADVLPIPAGQASFGAGAQLKNTVGNWSRWL  932

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLS  2954
              DLF I           +    ++  NG   K  D  +K FYLLNA+SDLMMLPKDMLLS
Sbjct  933   TDLFDI--------DDGESLKNSNEENGS--KELDTSAKSFYLLNALSDLMMLPKDMLLS  982

Query  2955  RTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCS  3134
             RT+RKEVCP  G  LI RVLN+F+PDEFC D IP  V E L SE+  E E +SV N+PC+
Sbjct  983   RTMRKEVCPALGPLLIRRVLNIFVPDEFCCDSIPEAVFEVL-SEEPSEAEGDSVTNYPCT  1041

Query  3135  AAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMEN  3314
             AAP+ Y PP  A+    +     S S LTRS SSVLKKSYTSD+EL+ LDSPLN I  + 
Sbjct  1042  AAPVAYMPPPIAS-VAGMLGDGYSYSMLTRSASSVLKKSYTSDEELELLDSPLNFIISDG  1100

Query  3315  SEVTKP--gggsgngngngVRYQLLREVWMSSE  3407
             +E +       S   N    RYQLLREVW++SE
Sbjct  1101  TEASHSLVKQSSMPKNSGRQRYQLLREVWINSE  1133


 Score =   285 bits (729),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 298/458 (65%), Gaps = 19/458 (4%)
 Frame = +3

Query  165   MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
             MV G   KTR  PSVQ +YLI+I EIKPWPPSQSLK+++A+VIQWE+GD+N GST+QV P
Sbjct  1     MVSGLRAKTRKGPSVQVDYLIHIQEIKPWPPSQSLKSVRAIVIQWENGDRN-GSTSQVVP  59

Query  345   MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
              L   SGVG+GRIEFNESF++P+TLL+EIS+K  +G++FQKNC+EFNLYEPRRD TVKGQ
Sbjct  60    FLG--SGVGDGRIEFNESFKLPVTLLKEISNKGGDGNSFQKNCMEFNLYEPRRDKTVKGQ  117

Query  525   LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV-  701
              LGTAVI+ A Y V+KEGLNVS PINC R+YRNT Q LL LKIQ   KGR+ S   +++ 
Sbjct  118   PLGTAVINLAEYAVIKEGLNVSAPINCTRAYRNTTQALLFLKIQPFEKGRVSSSSSSHIL  177

Query  702   RRESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKE  881
              RE S+D +  ES+S L +EE  EEAETAS+TDDD SSHSS+  SSSA  SNC S  Q E
Sbjct  178   TREVSIDRNGVESLSTLTSEECAEEAETASFTDDDGSSHSSVAVSSSANGSNCGSLPQGE  237

Query  882   NGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEPVlslnassssspstalssdlDWIS  1061
             + +EG K+   + E+ H+L S++K  +LD+K V + +  L  S S S +   S    W+S
Sbjct  238   DEAEGVKSNPGQHEDEHLLHSKKKSVDLDEKQVVKSLSDLKGSPSPSSTDLSSDLA-WLS  296

Query  1062  KKIGARNNIKSSTSFEKDSRMECTPNTNVKTNTGEQAEGVDSVVINCENGSQNHSQQRTE  1241
             +KIG   + K STS E +   E + N  V T   E     + ++ N E+  + ++ Q+++
Sbjct  297   RKIGGSGSNKFSTSSENEI-TENSQNPRVMTKHVEP----ERILANSESDGEIYTPQKSD  351

Query  1242  ESIC------DGSLVN--IDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG  1397
             E         +G  ++   D+++   NS  H   ++  ++ ST      ED    V+ NG
Sbjct  352   EGRVNSHPDQEGFPISHITDESKCFMNSASHFSSSENADNASTPIADRHEDVIDIVTKNG  411

Query  1398  LAEGENTEGHQGNTQEL-VTERDKHQETGEGKELIIEK  1508
               EGEN+E +Q   QE  V   + +QE G+ +E++ E+
Sbjct  412   SYEGENSENYQERRQESGVYNIENYQENGKVQEIVEEE  449



>ref|XP_010111604.1| hypothetical protein L484_017629 [Morus notabilis]
 gb|EXC31349.1| hypothetical protein L484_017629 [Morus notabilis]
Length=1085

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/698 (55%), Positives = 468/698 (67%), Gaps = 48/698 (7%)
 Frame = +3

Query  1392  NGLAEGENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCL---QDNTT  1562
             NG  +G   E  +  ++E  T  D    + E  E      +  E E +N  L   QD T 
Sbjct  409   NGKNDGRTKEISRDFSEEAATSEDSFDSSTEDNE------RKKEEERINDELYIEQDVTR  462

Query  1563  KQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQF-------VL  1721
             KQ L  +++       +       ERL HV SV    +S R NG V SNQ        V 
Sbjct  463   KQSLGSDTSPSRANLGINENVLKSERLKHVKSVR--ADSAR-NGLVSSNQHADIKESGVQ  519

Query  1722  RDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFS  1901
              D  +S+  +   + KD KV  ++  + +LE K Q+LE KI+MLEGELREAAAVE+ L+S
Sbjct  520   GDAHSSVGNLRLKERKDAKVFPRDARSAILESKMQQLEHKIKMLEGELREAAAVEVSLYS  579

Query  1902  VVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRL  2081
             +VAEHGSS +KVHAPARRLSRLY HAC+E+S  RR +AARS VSGL+LVAKACGNDVPRL
Sbjct  580   IVAEHGSSGSKVHAPARRLSRLYLHACRESSQSRRANAARSAVSGLVLVAKACGNDVPRL  639

Query  2082  TFWLSNCVLLRAAICKFSEKQQLPLSSEYS--KNAVVK-NERKASPLKWQ-SFPHKKSVG  2249
             TFWLSN V+LR  I + + K +LP S+  S  +N+  K  ++ +SPLKW+ S P K+   
Sbjct  640   TFWLSNSVVLRTIISEAAGKLELPTSAAPSINRNSTQKVKDKVSSPLKWKMSSPSKREAA  699

Query  2250  NDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD----SEI  2417
               L      WE+P  FT ALEK+EAWIFSRI+ESIWWQTFTPHMQS  A   D    S  
Sbjct  700   ELLSSGSGHWEDPNAFTYALEKIEAWIFSRIVESIWWQTFTPHMQSVDAKESDKNDGSGS  759

Query  2418  NKIYQRTSS-SCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
              K Y RTSS S  +E  +FSL+LWKKAFRDA ER+CPVRAGGHECGCL +LS+L+M+QCV
Sbjct  760   TKSYSRTSSISGDQEQGSFSLDLWKKAFRDASERLCPVRAGGHECGCLPMLSRLVMEQCV  819

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             ARLDVA+FNAILRES D+IPTDPVSDPIS+  VLP+PAGK+SF AGAQLK AIGNWSRWL
Sbjct  820   ARLDVAVFNAILRESGDEIPTDPVSDPISDSRVLPVPAGKSSFGAGAQLKTAIGNWSRWL  879

Query  2775  ADLFGIddddedddlveddeNKADNSNGH--ERKAQDACSKPFYLLNAMSDLMMLPKDML  2948
              DLFGI           DDE+  +  NGH  + + QD   K F+LLNA+SDLMMLPKDML
Sbjct  880   TDLFGI-----------DDEDSLEEVNGHDDDDERQDTSFKSFHLLNALSDLMMLPKDML  928

Query  2949  LSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFP  3128
             LS ++RKEVCPTFG  LI R+L  F+PDEFCPDPIP+ V EAL SED  E  E++  NFP
Sbjct  929   LSESIRKEVCPTFGAPLIKRILENFVPDEFCPDPIPDAVFEALESEDASEAGEDAATNFP  988

Query  3129  CSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKM  3308
             CSA+ IVYAPPS A++  ++G++    + L RS SSVL+KSYTSDDELDEL+SPL LI M
Sbjct  989   CSASAIVYAPPSTASIASVIGEVGGGQAHLKRSGSSVLRKSYTSDDELDELNSPLALI-M  1047

Query  3309  ENSEVTKPgggsgn------gngngVRYQLLREVWMSS  3404
             ++   + P     +       N N VRY+LLREVW  S
Sbjct  1048  KDGPHSSPVPTKSSWISKENNNQNAVRYELLREVWTES  1085


 Score =   252 bits (644),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   + R  P+V  +YL++I EIKPWPPSQSL++L+AV+IQWE+GD+ SGST  + P
Sbjct  1    MVLGLKARNRRSPAVHIDYLVHIQEIKPWPPSQSLRSLRAVLIQWENGDRCSGSTNPIVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S VG G+IEFNESFR+P+TL+R++S KS +GD FQKNC+E NLYEPRRD TVKG 
Sbjct  61   SLG--SLVGEGKIEFNESFRLPVTLVRDMSVKSGDGDAFQKNCLELNLYEPRRDKTVKGH  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGR-MKSLVRNNV  701
            LL TA++D A YGV+KE  ++S P+NCKRSYRNT QP+L L +Q+V K R   SL R++ 
Sbjct  119  LLATAIVDLAEYGVLKEVTSISSPMNCKRSYRNTDQPVLYLTLQSVEKARSTSSLSRDSF  178

Query  702  RRESSMDSSAGESVSALMN  758
             R  SMD++ GESVSALMN
Sbjct  179  SRAMSMDNAGGESVSALMN  197



>gb|EYU34792.1| hypothetical protein MIMGU_mgv1a000774mg [Erythranthe guttata]
Length=989

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/578 (62%), Positives = 432/578 (75%), Gaps = 22/578 (4%)
 Frame = +3

Query  1689  NGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELR  1868
             NGS+RSNQF+  D +N  +G  S+++K  K+  KE  N++ + K Q LE+++++LE ELR
Sbjct  423   NGSLRSNQFIAGDTKNHTQGSVSSEYKGAKIYPKEKINLLSDSKVQHLERRMEVLEAELR  482

Query  1869  EAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILV  2048
             EAAA+E+ L+SVVAEHGSS  KVHAPARRLSRLY HA K+NS  RR SAA+S+VSGL+LV
Sbjct  483   EAAAIEVSLYSVVAEHGSSMTKVHAPARRLSRLYLHASKQNSKSRRGSAAKSIVSGLVLV  542

Query  2049  AKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS-----SEYSKNAVVKNERK-ASP  2210
             +KACGNDVPRLTFWLSN ++LR  + K   + +LP+S        +  A  +N +K  SP
Sbjct  543   SKACGNDVPRLTFWLSNSIVLRVVMSKTFGESKLPISVGPVIGTATGTARDRNGKKNPSP  602

Query  2211  LKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSG  2390
             LKW+SF  K  +      + +DWENPL F  ALEKVE WIFSRIIESIWWQTFTPHMQS 
Sbjct  603   LKWESFSGKSPIQE----SSDDWENPLTFLTALEKVEVWIFSRIIESIWWQTFTPHMQSS  658

Query  2391  -AATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLL  2567
              A    DSE +K+Y+RTSSS  +   NFSLELWKKAF DA ERICP+RAGGH CGCL +L
Sbjct  659   NARADADSESSKLYERTSSSLDQRQVNFSLELWKKAFSDACERICPLRAGGHVCGCLPVL  718

Query  2568  SKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKN  2747
             S++IM+Q +ARLDVAMFNA+LRESAD+IPTDPV+DPIS+ EVLPIP GKASF AGAQLKN
Sbjct  719   SRVIMEQLIARLDVAMFNAVLRESADEIPTDPVADPISDAEVLPIPPGKASFGAGAQLKN  778

Query  2748  AIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLM  2927
             AIGNWSRWL DLFGI       D  E  ++  D++   ER + D  SK F+LLNA+SDLM
Sbjct  779   AIGNWSRWLTDLFGI-------DDDEILKDNLDDNEDDERLSDDTSSKSFHLLNALSDLM  831

Query  2928  MLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEE  3107
             MLPKD+LLSRTVRKEVCPTFG  LI RVLN F+PDEFCPDPIP VVLEALNS+D  + EE
Sbjct  832   MLPKDLLLSRTVRKEVCPTFGPPLIRRVLNSFVPDEFCPDPIPAVVLEALNSKDPFDSEE  891

Query  3108  ES-VVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             E  +++FPC AA I Y PPS A+    L     S SQLTRS+SSVLKKS TSDDELDELD
Sbjct  892   EDGIMSFPCGAARIQYQPPSTAS-VANLLGEIQSHSQLTRSKSSVLKKSQTSDDELDELD  950

Query  3285  sPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
             SPL  I ++N + +      G+ + N +RYQLLR+VWM
Sbjct  951   SPLKSIIIDNFQASP--NRDGSRSSNALRYQLLRDVWM  986


 Score =   236 bits (601),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 147/196 (75%), Gaps = 9/196 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MV GP  K+R  PSVQ +Y ++I E+KPWPPS SL+T+++V+IQWEHGDK SGST QV P
Sbjct  1    MVQGPRAKSRKSPSVQLDYTVHIQEVKPWPPSVSLRTIRSVLIQWEHGDKKSGSTNQVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   + +G IEFNESFR+ +TL+RE++   + GD FQKNCIEFNLYEPR D TVKGQ
Sbjct  61   ------SIDDGLIEFNESFRLSLTLIREVT---IKGDGFQKNCIEFNLYEPRMDKTVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTAV+D A +G+++E L +S PI+CKR+YRNT QPLL LKI+   + R  S  R ++ 
Sbjct  112  LLGTAVVDLAEHGMIRESLCISAPISCKRAYRNTAQPLLFLKIEPFERSRTSSSSRESLM  171

Query  705  RESSMDSSAGESVSAL  752
            RE+SMD S  ESVSAL
Sbjct  172  RETSMDRSNFESVSAL  187



>ref|XP_010250787.1| PREDICTED: uncharacterized protein LOC104592935 [Nelumbo nucifera]
 ref|XP_010250788.1| PREDICTED: uncharacterized protein LOC104592935 [Nelumbo nucifera]
Length=1081

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/788 (50%), Positives = 499/788 (63%), Gaps = 68/788 (9%)
 Frame = +3

Query  1170  AEGVDSVVINCENGSQNHSQQRTEESICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTL  1349
             A  + + +++ +  S +  +   EE     S  N+D +      + ++I     +  S+ 
Sbjct  312   ASTLKTSIMDSDQSSSSAYESVQEEVTSSNSTKNLDQDEKVIQEITNVIA----DKASSS  367

Query  1350  SNGIQEDARTGV----------SDNGLAEGENTEGHQGNTQ------ELVTERDKHQ--E  1475
             +  + +D + G+           D+G A     +  QG T         + E+D  Q  E
Sbjct  368   NPDLHKDEKAGLVTIVKNEVNEKDDGEARENIKDRPQGGTTINDQSANCMGEKDGEQSGE  427

Query  1476  TGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCD--ERLNH  1649
              GE K++  EK   +E E  N    + T KQ   G++ I     S+G K      +RL H
Sbjct  428   NGEDKQIEKEKNHSTEDEAFNRSSLEATRKQVASGSNTITFSGRSLGMKGNIQNIDRLKH  487

Query  1650  VSSVHTLGESNRANGSVRSNQFV------------LRDKRNSIEGITSNDWKDTKVRSKE  1793
             V SV +  ES+R+NG    NQ +            L   RNSI    +N     +   +E
Sbjct  488   VKSVRSPLESSRSNGFSNGNQLMEEVKEVDSLEDTLSGSRNSITAERNN----AEAAFRE  543

Query  1794  TSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYF  1973
               N   + K Q+LE +++ LE ELREAAAVEIGL+SVVAEHGSS NKVHAPARRLSRLY 
Sbjct  544   ILNC--QSKVQQLEHRVESLEAELREAAAVEIGLYSVVAEHGSSVNKVHAPARRLSRLYL  601

Query  1974  HACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLP  2153
             HAC++ S   R SAARS +SGL++VAKACGNDVPRLTFWLSN V+LRA + +   + QLP
Sbjct  602   HACRKWSKEHRASAARSAISGLVMVAKACGNDVPRLTFWLSNSVVLRAVVSQAVGELQLP  661

Query  2154  LSS--EYSKNAVVKNERKASPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEA  2324
             +SS      N   K   K S LKW+ S  +KK     L   F+DWE+P  FT ALEK+EA
Sbjct  662   VSSGPHIESNDSKKENDKRSSLKWKDSSLNKKEKIFGLSECFDDWEDPKTFTTALEKIEA  721

Query  2325  WIFSRIIESIWWQTFTPHMQ-SGAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKA  2495
             WIFSRIIES+WWQT TPHMQ +G A+ +   S   K Y   SS C E+  NFSL+LWK+A
Sbjct  722   WIFSRIIESVWWQTLTPHMQPAGRASEISRGSSSGKSYGWRSSLCDEDQGNFSLDLWKRA  781

Query  2496  FRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDP  2675
             F+DA ER+CPVRAGGHECGCL +L++L+M+QCV R DVAMFNAILRESAD+IPTDP+SDP
Sbjct  782   FKDACERLCPVRAGGHECGCLPVLARLVMEQCVGRFDVAMFNAILRESADEIPTDPISDP  841

Query  2676  ISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN  2855
             IS+ +VLPIPAGK+SF AGAQLKNAIGNWSRWL DLFG+           DD++  ++ N
Sbjct  842   ISDSKVLPIPAGKSSFGAGAQLKNAIGNWSRWLTDLFGM-----------DDDDSPEDEN  890

Query  2856  G---HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
             G    +R+  D   K F+LLNA+SDLMMLPKDMLL+R +RKEVCPTFG  LI  +L+ F+
Sbjct  891   GFHDEDRQEYDTSFKSFHLLNALSDLMMLPKDMLLNRDIRKEVCPTFGAPLIRGILSNFV  950

Query  3027  PDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             PDEFCPDPIP +VLEAL+SED +E EEES+ NFPC+AAPIVYAPPSAA+          S
Sbjct  951   PDEFCPDPIPEIVLEALDSEDPLEAEEESLKNFPCNAAPIVYAPPSAAS-LSGFIGEVGS  1009

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEV----TKPg-ggsgngngngVR  3371
              SQL RS SSVL+KSYTS+DELDELDSPL  I  + S V    T P      NG  N VR
Sbjct  1010  HSQLRRSGSSVLRKSYTSEDELDELDSPLASIIADISRVSPTSTVPSWKMKENGGRNTVR  1069

Query  3372  YQLLREVW  3395
             YQLLREVW
Sbjct  1070  YQLLREVW  1077


 Score =   244 bits (622),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 2/197 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ +YL+++ EIKPWPPSQSL++L++V++QWE+GD+NSG T  V P
Sbjct  1    MVLGLRTKNKRGTSVQVDYLVHLQEIKPWPPSQSLRSLRSVLLQWENGDRNSGCTNHVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   SGVG+G+IEFNESFR+P+TL RE+S K  + +TFQKNC+EFNLYEPRRD TVKGQ
Sbjct  61   SLG--SGVGDGKIEFNESFRLPVTLTREVSVKGGDAETFQKNCLEFNLYEPRRDKTVKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGT +ID A YG+VKE + +SVP+NCKRS+RNT QP+L +KIQ   +    SL R  + 
Sbjct  119  LLGTVIIDLAEYGIVKETVCISVPMNCKRSFRNTAQPVLFVKIQPFERSNSSSLQRERLS  178

Query  705  RESSMDSSAGESVSALM  755
            +E   D    ESVS LM
Sbjct  179  KEVPSDKDGKESVSVLM  195



>gb|KDP46310.1| hypothetical protein JCGZ_10150 [Jatropha curcas]
Length=1027

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/656 (54%), Positives = 439/656 (67%), Gaps = 33/656 (5%)
 Frame = +3

Query  1503  EKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIA-GRESVGAKTTCDERLNHVSSVHTLGES  1679
             EK    E EP+++  QD T  +   G   + + G   +   T   +RL HV SV +  +S
Sbjct  384   EKRHFREDEPLDAFPQDGTRNEDSFGTDTVSSSGSFEMKGNTLKIDRLKHVKSVRSSSDS  443

Query  1680  NRANGSVRSNQF-------VLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQ  1838
              R NGSV  N          L D  NS   +  N+WK+ KV  ++    +L  K Q+LE 
Sbjct  444   TRVNGSVSRNHHDELKEVGALADVENSAGSLKVNEWKNAKVYPQDARTSILNGKIQQLEH  503

Query  1839  KIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAA  2018
             KI+MLEGELREAA +E+ L+SVVAEHGSS +KVHAPARRLSRLY HA +E+S  RR SAA
Sbjct  504   KIKMLEGELREAAGIEVALYSVVAEHGSSMSKVHAPARRLSRLYLHAYRESSQPRRGSAA  563

Query  2019  RSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLSSEYSKNAVVK-N  2192
             +S VSGL+LVAKACGNDVPRLTFWLSN V+LRA I +  S+K+         +N   K N
Sbjct  564   KSAVSGLVLVAKACGNDVPRLTFWLSNSVVLRAIISQATSDKEPSSAGQRMERNGGGKGN  623

Query  2193  ERKASPLKWQSFPH-KKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTF  2369
             +  +S LKW+  P  +K   + + G   D ++P  F  ALE+VEAWIFSRI+ESIWWQT 
Sbjct  624   KMTSSILKWRESPSSRKENKSGIYGDLRDLDDPHAFMSALERVEAWIFSRIVESIWWQTL  683

Query  2370  TPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             TPHMQS    ++D  +     K   RTSSSC ++  NFSLELWK+AF+DA ER+CPVRAG
Sbjct  684   TPHMQSADMKAIDKLVGSGSKKSLGRTSSSCDQDQGNFSLELWKQAFKDACERLCPVRAG  743

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L++LIM+QCVARLDVAMFNAILRESAD+IPTDPVSDPIS+P+VLPIPAGK+
Sbjct  744   GHECGCLPMLARLIMEQCVARLDVAMFNAILRESADEIPTDPVSDPISDPKVLPIPAGKS  803

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF AGAQLKNAIGNWS WL D+FG+          +DD  + DN   +    QD   K F
Sbjct  804   SFGAGAQLKNAIGNWSMWLTDVFGM----------DDDLLEDDNDKDNNDDRQDTTFKSF  853

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
             +LLNA+SDLMMLPKDMLLSR++RKEVCPTFG  LI RVL+ F+PDEFCPDPIP+VVLEAL
Sbjct  854   HLLNALSDLMMLPKDMLLSRSIRKEVCPTFGAPLIKRVLDNFVPDEFCPDPIPDVVLEAL  913

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
              SED +EVEE SV   P  AAP +Y PP   A         S +    R   S+L+K YT
Sbjct  914   ESEDPLEVEESSVTTTPYIAAPPLYLPP--LADSVAETFGESGNKLQLRRSVSLLRKMYT  971

Query  3258  sddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWMSSE  3407
             SDDELDEL SPL LI ++ S  + P               N +RY+LLR++WM+SE
Sbjct  972   SDDELDELSSPLTLIFLDGSRPSPPALTKLSWKSKDMSKQNSIRYELLRDIWMNSE  1027


 Score =   222 bits (566),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 5/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MV+G + K +   SV   YLI+I +IKPWPPSQSL++L++V+IQWE+G +NSGST  V P
Sbjct  1    MVIGVNAKNKKGASVHVTYLIHIQDIKPWPPSQSLRSLRSVLIQWENGGRNSGSTDAVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   S VG G+IEFNESFR+P+TL+RE S +  +GD+FQKNC+EFNL EPRRD   K Q
Sbjct  61   SIG--SIVGEGKIEFNESFRLPVTLVRETSGRGKDGDSFQKNCLEFNLCEPRRD---KIQ  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL  AVID A+YGVVKE + VS P+N  RS+RNT QP+L +KIQ V KGR  S   ++  
Sbjct  116  LLANAVIDLADYGVVKEAITVSAPMNSNRSFRNTSQPILYIKIQPVDKGRTSSSSSSDNL  175

Query  705  RESSMDSSAGESVSALMN  758
             + S D + GESVSA MN
Sbjct  176  LKVSQDKNGGESVSAFMN  193



>ref|XP_002509546.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50933.1| conserved hypothetical protein [Ricinus communis]
Length=1002

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/674 (55%), Positives = 454/674 (67%), Gaps = 35/674 (5%)
 Frame = +3

Query  1452  TERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNT-TKQHLEGNS-AIIAGRESVGAKT  1625
              +R KHQE  E  +   EK    E EP+N+  Q+   ++  LE +  A I G E  G   
Sbjct  342   VDRYKHQEDEENNQDGEEKRYFLEDEPINTFPQNGIRSESSLETDPLASIVGIELKGNIL  401

Query  1626  TCDERLNHVSSVHTLGESNRANGSVRSNQ-------FVLRDKRNSIEGITSNDWKDTKVR  1784
               D RL HV SV +  ES + NG V  NQ         + + +N+      N+ K  KV 
Sbjct  402   KID-RLKHVKSVRSSSESAKNNGLVSRNQQDEMKEVGDMGESQNTAGNFKVNERKSAKVY  460

Query  1785  SKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSR  1964
              + T   +L  K Q+LE KI++LEGELREAA VE  L+SVVAEHGSS +KVHAPARRLSR
Sbjct  461   PEHTRAAILSGKIQQLEHKIKILEGELREAAGVEAALYSVVAEHGSSMSKVHAPARRLSR  520

Query  1965  LYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQ  2144
             LY HAC+E+S   R SA RS VSGL+LVAKACGNDVPRLTFWLSN V+LRA +C+    +
Sbjct  521   LYLHACRESSRSMRASAGRSAVSGLVLVAKACGNDVPRLTFWLSNSVVLRAILCQAIGDK  580

Query  2145  QLPLSSEYS--KNAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKALE  2312
             +L  S   S  +N V K N+ K+S LKW ++ P      N + G   DW++P  FT ALE
Sbjct  581   ELSHSGRQSIERNGVGKGNKIKSSSLKWKETSPSTNEHKNVILGDLSDWDDPHTFTSALE  640

Query  2313  KVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEI----NKIYQRTSSSCSEEPENFSLE  2480
             +VEAWIFSR +ESIWWQT TPHMQS AA  +D  I    NK   RTSSS   +  +FSLE
Sbjct  641   RVEAWIFSRTVESIWWQTLTPHMQSAAAKPIDRFIGSGSNKNLGRTSSSGDNDQVDFSLE  700

Query  2481  LWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTD  2660
             LWKKAF+DA ER+CPVRAGGHECGCL +L++LIM+QCVARLDVAMFNAILRESAD+IPTD
Sbjct  701   LWKKAFKDACERLCPVRAGGHECGCLSVLARLIMEQCVARLDVAMFNAILRESADEIPTD  760

Query  2661  PVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNK  2840
             PVSDPIS+ +VLPIPAG++SF AGAQLK  IGNWSRWL DLFGIDDD  +D+  ED +++
Sbjct  761   PVSDPISDSKVLPIPAGRSSFGAGAQLKTTIGNWSRWLTDLFGIDDDLLEDEKDEDGDDE  820

Query  2841  ADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNV  3020
               +++           K F+LLNA+SDLMMLPKDMLLSR++RKEVCP FG  LI RVL+ 
Sbjct  821   RRDTS----------FKSFHLLNALSDLMMLPKDMLLSRSIRKEVCPAFGTPLIKRVLDN  870

Query  3021  FIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             F+ DEFCPDPIP+VVLEAL SED ++VEEESV + PC AAP +Y PP+AA+         
Sbjct  871   FVSDEFCPDPIPDVVLEALGSEDPVDVEEESVTSIPCIAAPPLYLPPAAAS--VGDTIGQ  928

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngng-----  3365
             S +    R   S+L+KSY SDDELDEL SPL  I ++ S  +         +        
Sbjct  929   SGNQSQLRRSGSLLRKSYASDDELDELISPLASIFLDGSRSSPASSTLSWKSKEIGNQNP  988

Query  3366  VRYQLLREVWMSSE  3407
             +RY+LLREVWM+SE
Sbjct  989   IRYELLREVWMNSE  1002


 Score =   202 bits (515),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 143/191 (75%), Gaps = 5/191 (3%)
 Frame = +3

Query  186  KTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESG  365
            K R   SVQ +YLI+I +IKPWPPSQSL++L++V+IQWE+GD+  GST  V P L   S 
Sbjct  4    KNRKGSSVQVDYLIHIQDIKPWPPSQSLRSLRSVLIQWENGDRKFGSTNTVVPSLG--SI  61

Query  366  VGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVI  545
            VG G+IEF+ESFR+P+TL+REIS K  + D FQKN +EFNL EPRRD   K Q+LGTA I
Sbjct  62   VGEGKIEFDESFRLPVTLIREISGKGKDSDLFQKNSLEFNLCEPRRD---KMQILGTAAI  118

Query  546  DFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDS  725
            D A+YGVVKE ++VSVP++  RS+RNT QP+L +KIQ   KGR  S  R++V +  S++ 
Sbjct  119  DLADYGVVKETISVSVPVSSSRSFRNTSQPMLYVKIQPFDKGRTSSSARDSVSKGISLEK  178

Query  726  SAGESVSALMN  758
            + G SVSA+MN
Sbjct  179  NGGMSVSAMMN  189



>ref|XP_006447110.1| hypothetical protein CICLE_v10014104mg [Citrus clementina]
 ref|XP_006447111.1| hypothetical protein CICLE_v10014104mg [Citrus clementina]
 ref|XP_006447112.1| hypothetical protein CICLE_v10014104mg [Citrus clementina]
 ref|XP_006470023.1| PREDICTED: uncharacterized protein LOC102622816 isoform X1 [Citrus 
sinensis]
 ref|XP_006470024.1| PREDICTED: uncharacterized protein LOC102622816 isoform X2 [Citrus 
sinensis]
 ref|XP_006470025.1| PREDICTED: uncharacterized protein LOC102622816 isoform X3 [Citrus 
sinensis]
 gb|ESR60350.1| hypothetical protein CICLE_v10014104mg [Citrus clementina]
 gb|ESR60351.1| hypothetical protein CICLE_v10014104mg [Citrus clementina]
 gb|ESR60352.1| hypothetical protein CICLE_v10014104mg [Citrus clementina]
Length=1100

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/678 (56%), Positives = 477/678 (70%), Gaps = 37/678 (5%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEG-EPVNSCLQDNTTKQHLEGNSAIIAGRE---S  1610
             + V  R + ++ G  +E I EKG+ S G EP+N C ++ T  Q   G+ +    RE   +
Sbjct  435   DFVKYRMEQEDNGLERE-IFEKGRHSAGDEPLNFCSRNATRNQVSLGSDSPSPIREDPVN  493

Query  1611  VGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQ--FVLRDKRNSIEGITSNDWKDTK  1778
              G K      +RL +V SV +  +  R+NG+ +  +   VL D  N      S + KD K
Sbjct  494   FGTKRNLLKSDRLKNVRSVRSSSDIARSNGNQKEAKENGVLGDAPNRAGSFGSPERKDYK  553

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
             V  +++ + V E K Q+LE KI+MLE ELREAAA+E  L+SVVAEHGSS +KVHAPARRL
Sbjct  554   VYPRDSRSAVAESKIQQLEHKIKMLETELREAAAIEASLYSVVAEHGSSMSKVHAPARRL  613

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSE  2138
             SRLY HACKE+   RR SAARS VSGL+LVAKACGNDVPRLTFWLSN ++LRA I + + 
Sbjct  614   SRLYLHACKEDFQSRRASAARSAVSGLVLVAKACGNDVPRLTFWLSNSIVLRAIISQATG  673

Query  2139  KQQLPLSSEYS--KNAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKA  2306
             + + P ++  S  +N+  + N    SPLKW +S   KK   N + G+F+DWE+P     A
Sbjct  674   RLEQPFAAGQSLERNSSQRGNNNITSPLKWKESASRKKDNRNVMRGSFDDWEDPHTLPSA  733

Query  2307  LEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFS  2474
             LEKVEAWIFSRI+ESIWWQT TPHMQS A   +D +I     K  +RTSSS  +E  NFS
Sbjct  734   LEKVEAWIFSRIVESIWWQTLTPHMQSAAERVMDRDIGSCSRKNLERTSSSGDQEQINFS  793

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L+ WKKAF+DA ER+CPVRA GHECGCL LL++LIM+QCVARLDVAMFNAILRESAD+IP
Sbjct  794   LDHWKKAFKDACERLCPVRARGHECGCLPLLARLIMEQCVARLDVAMFNAILRESADEIP  853

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDPVSDPIS+ +VLPIPAGK+SF AGAQLKNAIGNWSRWL+DLFG+           DD+
Sbjct  854   TDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAIGNWSRWLSDLFGM-----------DDD  902

Query  2835  NKADNSNGHER--KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITR  3008
             +  DN N H+   + QD+  K F+LLNA+SDLMMLPKD+LLSR++RKEVCPTFG  LI R
Sbjct  903   DSLDNENEHDADDERQDSSFKSFHLLNALSDLMMLPKDLLLSRSIRKEVCPTFGAPLIKR  962

Query  3009  VLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgil  3188
             VL+ F+PDEFCPDPIP VVLEAL+SED +E  EES+ +FPC AAP +Y PPSA +     
Sbjct  963   VLDNFVPDEFCPDPIPRVVLEALDSED-LEAGEESITSFPCIAAPPLYTPPSADS-VASS  1020

Query  3189  gdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEV----TKPgggsg-ng  3353
                  S+SQL RS SSV++KSYTSDDELDEL+SPL  I + +S      T+P   S  N 
Sbjct  1021  IGDFGSNSQLRRSGSSVVRKSYTSDDELDELNSPLASIFISSSRSFPVPTRPSRISKGNN  1080

Query  3354  ngngVRYQLLREVWMSSE  3407
             N + VRY+LLR++WM+SE
Sbjct  1081  NQSAVRYELLRDIWMTSE  1098


 Score =   231 bits (588),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   S+  +Y I+I +IKPWPPSQSL++L++V+IQW++GD+NSGST  V P
Sbjct  1    MVLGLSAKNRKEASIHVDYQIHIQDIKPWPPSQSLRSLRSVMIQWQNGDRNSGSTKTVGP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESFR+ +TLLR+++ K+ + DTF KNC+EFNLYEPRRD T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFRLRVTLLRDMNVKNKDADTFLKNCLEFNLYEPRRDKT---Q  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK--GRMKSLVRNN  698
            LL TA ID A+YG+VKE L+V+ P+N KRS+RNT QP+L +KIQ   K   R  S +R  
Sbjct  116  LLATATIDLADYGIVKETLSVNAPMNSKRSFRNTAQPVLFIKIQPAEKSVSRTSSSLREG  175

Query  699  VRRESSMDSSAGESVSALMN  758
              RE+S+D + GESVSALMN
Sbjct  176  FSRETSLDKNGGESVSALMN  195



>gb|KDO55628.1| hypothetical protein CISIN_1g001323mg [Citrus sinensis]
Length=1100

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/678 (56%), Positives = 475/678 (70%), Gaps = 37/678 (5%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEG-EPVNSCLQDNTTKQHLEGNSAIIAGRE---S  1610
             + V  R + ++ G  +E I EKG+ S G EP+N C ++ T  Q   G+ +    RE   +
Sbjct  435   DFVKYRMEQEDNGLERE-IFEKGRHSAGDEPLNFCSRNATRNQVSLGSDSPSPIREDPVN  493

Query  1611  VGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQ--FVLRDKRNSIEGITSNDWKDTK  1778
              G K      +RL +V SV +  +  R+NG+ +  +   VL D  N      S + KD K
Sbjct  494   FGTKRNLLKSDRLKNVRSVRSSSDIARSNGNQKEAKENGVLGDAPNRAGSFGSPERKDYK  553

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
             V  ++T + V E K Q+LE KI MLE ELREAAA+E  L+SVVAEHGSS +KVHAPARRL
Sbjct  554   VYPRDTRSAVAESKIQQLEHKINMLETELREAAAIEASLYSVVAEHGSSMSKVHAPARRL  613

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSE  2138
             SRLY HACKE+   RR SAARS VSGL+LVAKACGNDVPRLTFWLSN ++LRA I + + 
Sbjct  614   SRLYLHACKEDFQSRRASAARSAVSGLVLVAKACGNDVPRLTFWLSNSIVLRAIISQATG  673

Query  2139  KQQLPLSSEYS--KNAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKA  2306
             + + P ++  S  +N+  + N    SPLKW +S   KK   N + G+F+DWE+P     A
Sbjct  674   RLEQPFAAGQSLERNSSQRGNNNITSPLKWKESASRKKDNRNVMRGSFDDWEDPHTLPSA  733

Query  2307  LEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFS  2474
             LEKVEAWIFSRI+ESIWWQT TPHMQS A   +D +I     K  +RTSSS  +E  NFS
Sbjct  734   LEKVEAWIFSRIVESIWWQTLTPHMQSAAERVMDRDIGSCSRKNLERTSSSGDQEQINFS  793

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L+ WKKAF+DA ER+CPVRA GHECGCL LL++LIM+QCVARLDVAMFNAILRESAD+IP
Sbjct  794   LDHWKKAFKDACERLCPVRARGHECGCLPLLARLIMEQCVARLDVAMFNAILRESADEIP  853

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDPVSDPIS+ +VLPIPAGK+SF AGAQLKNAIGNWSRWL+DLFG+           DD+
Sbjct  854   TDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAIGNWSRWLSDLFGM-----------DDD  902

Query  2835  NKADNSNGHER--KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITR  3008
             +  DN N H+   + QD+  K F+LLNA+SDLMMLPKD+LLSR++RKEVCPTFG  LI R
Sbjct  903   DSLDNENEHDADDERQDSSFKSFHLLNALSDLMMLPKDLLLSRSIRKEVCPTFGAPLIKR  962

Query  3009  VLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgil  3188
             VL+ F PDEFCPDPIP VVLEAL+SED +E  EES+ +FPC AAP +Y PPSA +     
Sbjct  963   VLDNFCPDEFCPDPIPRVVLEALDSED-LEAGEESITSFPCIAAPPLYTPPSADS-VASS  1020

Query  3189  gdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEV----TKPgggsg-ng  3353
                  S+SQL RS SSV++KSYTSDDELDEL+SPL  I + +S      T+P   S  N 
Sbjct  1021  IGDFGSNSQLRRSGSSVVRKSYTSDDELDELNSPLASIFISSSRSFPVPTRPSRISKGNN  1080

Query  3354  ngngVRYQLLREVWMSSE  3407
             N + VRY+LLR++WM+SE
Sbjct  1081  NQSAVRYELLRDIWMTSE  1098


 Score =   230 bits (587),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   S+  +Y I+I +IKPWPPSQSL++L++V+IQW++GD+NSGST  V P
Sbjct  1    MVLGLSAKNRKEASIHVDYQIHIQDIKPWPPSQSLRSLRSVMIQWQNGDRNSGSTKTVGP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESFR+ +TLLR+++ K+ + DTF KNC+EFNLYEPRRD T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFRLRVTLLRDMNVKNKDADTFLKNCLEFNLYEPRRDKT---Q  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK--GRMKSLVRNN  698
            LL TA ID A+YG+VKE L+V+ P+N KRS+RNT QP+L +KIQ   K   R  S +R  
Sbjct  116  LLATATIDLADYGIVKETLSVNAPMNSKRSFRNTAQPVLFIKIQPAEKSVSRTSSSLREG  175

Query  699  VRRESSMDSSAGESVSALMN  758
              RE+S+D + GESVSALMN
Sbjct  176  FSREASLDKNGGESVSALMN  195



>ref|XP_007031806.1| F28J7.14 protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007031808.1| F28J7.14 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY02732.1| F28J7.14 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY02734.1| F28J7.14 protein, putative isoform 1 [Theobroma cacao]
Length=1090

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/667 (56%), Positives = 451/667 (68%), Gaps = 42/667 (6%)
 Frame = +3

Query  1473  ETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHV  1652
             E G   +   +K   +E EP+N    DN+  Q   GN   I     +       +RL HV
Sbjct  444   ENGHEGQYGEDKRYSTEDEPLNIHSPDNSLSQ---GNLGTIGNVLKI-------DRLKHV  493

Query  1653  SSVHTLGESNRANGSVRSNQF-------VLRDKRN---SIEGITSNDWKDTKVRSKETSN  1802
              SV +  +S R+NG   +NQ        VL D  +   +    + N+ KD KV  K+T +
Sbjct  494   KSVRSSSDSVRSNGLSTNNQHAELKEVGVLGDAPHGGGTFRSKSGNERKDAKVYPKDTRS  553

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
              +L+ K Q+LE KI+MLEGELREAAAVE  L+SVVAEHGSS  KVHAPARRLSRLY HA 
Sbjct  554   AILDNKVQQLELKIKMLEGELREAAAVEAALYSVVAEHGSSMCKVHAPARRLSRLYLHAF  613

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             KE    R  SAARS VSGL LVAKACGNDVPRLTFWLSN V+LRA I +     +LP+S+
Sbjct  614   KEGIQSRGASAARSAVSGLALVAKACGNDVPRLTFWLSNSVVLRAIISESIGDSELPISA  673

Query  2163  EYSK--NAVVKNERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
                +     +  ++ +SPLKW +S   +K     L G+  DW+NP  FT ALE+VEAWIF
Sbjct  674   GPMERIGGGMGKKQVSSPLKWKESSSRRKENKLILYGSSSDWDNPHAFTSALERVEAWIF  733

Query  2334  SRIIESIWWQTFTPHMQSGAATSLD----SEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             SRIIES+WWQT TPHMQS     +D    S  +K Y R SSS  E+  NFSL+ WKKAF+
Sbjct  734   SRIIESVWWQTLTPHMQSADRKEIDRGMGSGSSKSYGRVSSSSDEDQMNFSLDHWKKAFK  793

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA ER+CPVRA GHECGCL LLS+LIM+QCVARLDVAMFNAILR+S D+IPTDPVSDPIS
Sbjct  794   DACERLCPVRAAGHECGCLRLLSRLIMEQCVARLDVAMFNAILRDSGDEIPTDPVSDPIS  853

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             NP VLPIP+GK SF AGAQLKNAIGNWSRWL DLFGI       D  +   ++ D  +  
Sbjct  854   NPLVLPIPSGKTSFGAGAQLKNAIGNWSRWLTDLFGI-------DDDDSVGDENDQDDSD  906

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             ER  QD   K F+LLNA+SDLMMLPKDMLLSR +R+EVCPTFG SLI RVL+ ++PDEFC
Sbjct  907   ER--QDTSLKSFHLLNALSDLMMLPKDMLLSRPIREEVCPTFGASLIKRVLDNYVPDEFC  964

Query  3042  PDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqlt  3221
             PDP+P+VVLEAL SED +E  E SV NFPC A+P VY+ PSA +    +     S SQL 
Sbjct  965   PDPVPDVVLEALESEDPVEAREGSVTNFPCVASPPVYSAPSATS-VASIIGEIGSQSQLR  1023

Query  3222  rsrssVLKKSYTsddeldeldsPLNLIKMENSEV----TKPg-ggsgngngngVRYQLLR  3386
             RS SSVL+KSYTSDDELDEL+SPL  I ++        +KP     GNG  N +RY+LLR
Sbjct  1024  RSGSSVLRKSYTSDDELDELNSPLASIFIDGFRSSPIQSKPNWISKGNGYQNAIRYELLR  1083

Query  3387  EVWMSSE  3407
             +VWM+SE
Sbjct  1084  DVWMNSE  1090


 Score =   216 bits (551),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 147/198 (74%), Gaps = 5/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R  P+V  +YLI+I EIKPWPPSQSL++L++V+IQWE+G+++SGST  V+P
Sbjct  1    MVLGLSAKNRRGPTVHVDYLIHIQEIKPWPPSQSLRSLRSVLIQWENGERSSGSTNTVSP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S VG G+IEFNESF++P+ L+R++S K  + D FQKN +EFNLYEPRRD   K Q
Sbjct  61   TLG--SIVGEGKIEFNESFKLPVNLVRDLSVKGRDADVFQKNSLEFNLYEPRRD---KIQ  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA++D A YG +KE L+++VP+N KRS+ NT QP+L +KI  + KGR  S  R+ + 
Sbjct  116  LLATAIVDLAEYGAIKETLDITVPMNSKRSFSNTAQPILFIKIDRIYKGRNSSSSRSGLS  175

Query  705  RESSMDSSAGESVSALMN  758
             E S+D    ESVSALM+
Sbjct  176  EEQSLDRKGSESVSALMD  193



>emb|CBI40057.3| unnamed protein product [Vitis vinifera]
Length=911

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/618 (58%), Positives = 430/618 (70%), Gaps = 47/618 (8%)
 Frame = +3

Query  1599  GRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTK  1778
             G   + +     +RL HV SV +  +S R+N  V  N                   KDT 
Sbjct  326   GNHELKSNILSSDRLKHVKSVRSSSDSARSNNLVGGNH----------------GRKDTI  369

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
             + + ET N   ERK Q+LE KI+MLEGELREAAA+E  L+SVVAEHGSS NKVHAPARRL
Sbjct  370   IYT-ETRNTFSERKIQQLEDKIKMLEGELREAAAIEAALYSVVAEHGSSMNKVHAPARRL  428

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFS-  2135
             SR+Y HAC+E+S  RR SAARS VSGL LVAKACGNDVPRLTFWLSN V+LRA I +   
Sbjct  429   SRMYLHACRESSQSRRASAARSAVSGLALVAKACGNDVPRLTFWLSNAVVLRAIISQAIG  488

Query  2136  -EKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKAL  2309
               +Q+L   S   +N + K N ++ SPLKW+ FP   S  N    +  DW++P     AL
Sbjct  489   IPRQKLSAGSSNERNGIGKGNNQRLSPLKWKEFP-PSSKENKNASSLGDWKDPYTLISAL  547

Query  2310  EKVEAWIFSRIIESIWWQTFTPHMQSGAATSL----DSEINKIYQRTSSSCSEEPENFSL  2477
             EK+EAWIFSRIIES+WWQT TPHMQS A   +    DS+  K Y RTS S  +E  NF+L
Sbjct  548   EKLEAWIFSRIIESVWWQTLTPHMQSAAMKEIYGDTDSDSRKSYGRTSGSSDQEQVNFAL  607

Query  2478  ELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPT  2657
             +LWKKAF+DA ER+CPVRAGGHECGCL +L+ L+M+QCV RLDVAMFNAILRES D+IPT
Sbjct  608   DLWKKAFKDACERLCPVRAGGHECGCLPVLASLVMEQCVVRLDVAMFNAILRESVDEIPT  667

Query  2658  DPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeN  2837
             DPVSDPIS+ +VLPIPAGK+SF AGAQLKN IGNWSRWL DLFG+D+DD  +        
Sbjct  668   DPVSDPISDSKVLPIPAGKSSFGAGAQLKNVIGNWSRWLTDLFGMDEDDLLE--------  719

Query  2838  KADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLN  3017
               + ++  E + QD   K F+LLNA+SDLMMLPKDMLLSR++RKEVCPTFG  LI RVL+
Sbjct  720   --EGNDDIEDERQDVLFKSFHLLNALSDLMMLPKDMLLSRSIRKEVCPTFGAPLIRRVLD  777

Query  3018  VFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdi  3197
              F+PDEFCPDPIP VV EAL+SED  E  E+S+ NFPC AAPIVYAPP AA+    +   
Sbjct  778   NFVPDEFCPDPIPGVVFEALDSEDPFEAGEDSITNFPCIAAPIVYAPPPAAS-LASILGE  836

Query  3198  sssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPg--------ggsgng  3353
               + S L RS SSVL+KS+TSDDEL+EL+SPL+ I    S+  +P             NG
Sbjct  837   VGNQSHLRRSNSSVLRKSHTSDDELEELNSPLSSII---SDGFRPSPVPTKSNWKSRANG  893

Query  3354  ngngVRYQLLREVWMSSE  3407
             + + VRYQLLREVWM+SE
Sbjct  894   SQSDVRYQLLREVWMNSE  911


 Score =   247 bits (631),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 191/276 (69%), Gaps = 4/276 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG     R   SV  +YLI+I EIKPWPPSQSL++ +AV+IQWEHGD+ SGST+ V P
Sbjct  1    MVLGVRTNNRKSGSVHVDYLIHIQEIKPWPPSQSLRSQRAVLIQWEHGDRTSGSTSSVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   SG+G+G+IEFNESFR+ +TL+RE + KS + DTF KNC++FNLYEPRRD TV+GQ
Sbjct  61   ALG--SGIGDGKIEFNESFRLSVTLVREFALKSGDADTFHKNCLDFNLYEPRRDKTVRGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA++D A+YG+++E  ++S+P+NCKRS+RNT QP+L LKIQ V KGR  S  R+N+ 
Sbjct  119  LLGTAILDLADYGIIREISSISIPMNCKRSFRNTAQPVLFLKIQPVDKGRTSSSSRDNLL  178

Query  705  RESSMDSSAGESVSALMNeeyteeaetasytdddvsshsslvnsssavesncssPHQKE-  881
            +E+S+  + GESVSAL+N E   E    + + DD  S  S +  S+AV+SN   PHQ E 
Sbjct  179  KEASLHKTGGESVSALIN-EEYAEEAEITSSTDDDVSSHSSLAVSTAVQSNGGLPHQNEK  237

Query  882  NGSEGGKNRRAEAENNHVLGSEQKIKNLDKKLVSEP  989
            NGSE   N            S+ ++ N D   + EP
Sbjct  238  NGSERVNNNTGGGNEEQASDSKLRLTNSDTTPIIEP  273



>gb|KHG12394.1| Myosin-H heavy chain [Gossypium arboreum]
Length=1040

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/668 (56%), Positives = 454/668 (68%), Gaps = 48/668 (7%)
 Frame = +3

Query  1470  QETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNH  1649
             QE G   +    K   +E E +N   Q+N+  Q   GN     G +S   K+   +RL H
Sbjct  399   QENGHEGQYWEAKKYYTEDEQLNIHSQENSLSQ---GN----LGTKSNALKS---DRLKH  448

Query  1650  VSSVHTLGESNRANGSVRSNQF-------VLRDKRN---SIEGITSNDWKDTKVRSKETS  1799
             V SV +  +S R+NG V  NQ        VL D ++   ++   +SN  KD KV  K+T 
Sbjct  449   VKSVRSSSDSVRSNGLVSDNQHAESKEAGVLGDVQHGPGTLMNKSSNGSKDAKVYPKDTR  508

Query  1800  NVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
             + +L+ K Q+LE KI MLEGELREAAA+E  LFS+VAEHGSS NKVHAPARRLSRLY HA
Sbjct  509   SAILDNKIQQLENKIMMLEGELREAAAIEAALFSIVAEHGSSMNKVHAPARRLSRLYLHA  568

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS  2159
             CKE    RR SAARS VSGL LVAKACGNDVPRLTFWLSN V+LRA I +      L LS
Sbjct  569   CKEGFQSRRASAARSAVSGLALVAKACGNDVPRLTFWLSNSVVLRAIISESIGDMGLRLS  628

Query  2160  S-EYSKNAVVKNERK-ASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             +     N   K E+  +SPLKW ++ P +K       G+F DW++PL F  ALE+VEAWI
Sbjct  629   AGPMEGNGGGKEEKHVSSPLKWIETSPGRKENKLISYGSFSDWDSPLTFISALERVEAWI  688

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELWKKAF  2498
             FSRIIES+WWQT TPHMQS A   +D  I+    K Y R SS+  ++  NFSL+ WKKAF
Sbjct  689   FSRIIESVWWQTLTPHMQSEAREEVDIGISSASGKSYGRVSSASDQDQMNFSLDHWKKAF  748

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA ER+CPVRA GHECGCLHLLS+LIM+QCVARLDVAMFNA+LR+S D+IPTDP+SDPI
Sbjct  749   KDACERLCPVRAAGHECGCLHLLSRLIMEQCVARLDVAMFNAVLRDSGDEIPTDPMSDPI  808

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
             S+  VLP+PAGKASF AGAQLKNAIGNWSRWL DLFGI             +++ D    
Sbjct  809   SDLLVLPVPAGKASFGAGAQLKNAIGNWSRWLTDLFGI-------------DDEIDQDGS  855

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
              ER  QD   K FYLLNA+SDLMMLPKDMLLSR +R+EVCPTFG +LI RVL+ F+PDEF
Sbjct  856   DER--QDTSIKSFYLLNALSDLMMLPKDMLLSRHIREEVCPTFGATLIKRVLDNFVPDEF  913

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             CPDP+P+VVLEAL +ED  E  E  V +FP  A+P +Y+PPSA +    +     S SQL
Sbjct  914   CPDPVPDVVLEALEAEDPAEAREGFVTSFPYVASPPIYSPPSATS-IASIIGEVGSQSQL  972

Query  3219  trsrssVLKKSYTsddeldeldsPLNLI---KMENSEV-TKPg-ggsgngngngVRYQLL  3383
              RSRSSVL+KSYTSDDELDEL+SPL  I      +S V +KP     GN   N +RY+LL
Sbjct  973   RRSRSSVLRKSYTSDDELDELNSPLASIFNDGFRSSPVKSKPIWISKGNNYQNAIRYELL  1032

Query  3384  REVWMSSE  3407
             R+VW  SE
Sbjct  1033  RDVWKKSE  1040


 Score =   189 bits (480),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = +3

Query  168  VLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPM  347
            +LG S KTR  P+V  +YLI+I EIKPWPPSQSL+++++V+IQWE+G+++SGST  V+P 
Sbjct  1    MLGSSVKTRRGPTVHVDYLIHIQEIKPWPPSQSLRSVRSVLIQWENGERSSGSTKTVSPT  60

Query  348  LETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQL  527
            +   S    G+IEFNESF++P+ L++++S K  + D F KN +EFNLYEPRR+   K QL
Sbjct  61   V--GSVAVEGKIEFNESFKLPVNLVKDMSIKGKDADVFMKNVLEFNLYEPRRE---KIQL  115

Query  528  LGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGR  674
            LGTA++D   YGV+KE L  + P+N KRS  NT QP+L +KI  + KGR
Sbjct  116  LGTAIVDLGEYGVIKETLEDTAPVNSKRSLSNTAQPILFIKIDRIYKGR  164



>ref|XP_002298610.2| hypothetical protein POPTR_0001s34080g [Populus trichocarpa]
 gb|EEE83415.2| hypothetical protein POPTR_0001s34080g [Populus trichocarpa]
Length=1001

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/647 (54%), Positives = 435/647 (67%), Gaps = 50/647 (8%)
 Frame = +3

Query  1503  EKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESN  1682
             E+ Q SE EP+++   D+     L  ++    G   +       +RL HV SV +  +S 
Sbjct  393   EQKQFSEDEPIDNFPYDSRDDDSLGSDTFTSPGGFDMKGNILKIDRLKHVKSVRSSSDSL  452

Query  1683  RANGSVRSNQF----VLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQM  1850
             R+NG    NQ     ++RD  +S   ++ N+ K+ K+  K+T   +L+ K Q+LE KI+M
Sbjct  453   RSNGFGSRNQHNEVGLMRDAHHSAGSLSFNERKNAKIYPKDTRTTILDGKIQQLEHKIKM  512

Query  1851  LEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVV  2030
             LEGEL+EAAA+E  L+SVVAEHGSS +KVHAPARRLSRLY HAC+E+   RR SAARS +
Sbjct  513   LEGELKEAAAIEASLYSVVAEHGSSMSKVHAPARRLSRLYLHACRESFQSRRASAARSAI  572

Query  2031  SGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASP  2210
             SGL+LVAKACGNDVPRLTFWLSN V+LR  I      Q + +S                 
Sbjct  573   SGLVLVAKACGNDVPRLTFWLSNSVVLRTIIS-----QTIEVS-----------------  610

Query  2211  LKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSG  2390
                   P +K   N L     DWE+P  FT ALE+VEAWIFSR IESIWWQT TPHMQ+ 
Sbjct  611   ------PSRKGNKNGLYEDSSDWEDPHVFTSALERVEAWIFSRTIESIWWQTLTPHMQAA  664

Query  2391  AA---TSLDSEINKI-YQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCL  2558
             A      LDS  +K  + RTS    E+  N SLE WKKAF+DA ER+CPVRAGGHECGCL
Sbjct  665   ATKEIAQLDSSGSKKNFGRTSRLVHEDQGNISLEHWKKAFKDACERLCPVRAGGHECGCL  724

Query  2559  HLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQ  2738
              +L++LIM+QCVARLDVAMFNAILRES D+IPTDPVSDPIS+P+VLPIPAG +SF AGAQ
Sbjct  725   PVLARLIMEQCVARLDVAMFNAILRESVDEIPTDPVSDPISDPKVLPIPAGSSSFGAGAQ  784

Query  2739  LKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMS  2918
             LKN IGNWSRWL DLFG+       D  +  E+  +N    ER   D   KPF+LLNA+S
Sbjct  785   LKNVIGNWSRWLTDLFGM-------DDDDLLEDDNENDEIDERP--DTTFKPFHLLNALS  835

Query  2919  DLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME  3098
             DLMMLPKDMLLS+++RKEVCPTF   LI RVL+ F+ DEFCPDPIP+VV EAL++ED +E
Sbjct  836   DLMMLPKDMLLSKSIRKEVCPTFAAPLIKRVLDNFVLDEFCPDPIPDVVFEALDTEDAIE  895

Query  3099  VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddelde  3278
               EESV   PC AAP +Y PPSAA+    +     S S+L +S SS+++KSYTSDDELDE
Sbjct  896   AGEESVTTVPCIAAPPIYLPPSAAS-IAKIIGEFGSQSKLRKSGSSIVRKSYTSDDELDE  954

Query  3279  ldsPLNLIKME----NSEVTKPgggsgngngngVRYQLLREVWMSSE  3407
             L+SPL  I ++    +   TKP   S  G  N +RY+LLRE+WM+SE
Sbjct  955   LNSPLASIILDGVWSSPAPTKPSWKSKKGIDNTIRYELLREIWMNSE  1001


 Score =   239 bits (611),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 153/198 (77%), Gaps = 8/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG +GK R   SVQ +YL++I +IKPWPPSQSL++L++V+IQWE+GD+NSGST  V P
Sbjct  1    MVLGMNGKNRRSSSVQVDYLVHIEDIKPWPPSQSLRSLRSVLIQWENGDRNSGSTNTVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L T   VG G+IEFNESFR+P+TLLRE+  K  + DTFQKNC+EFNLYEPRRD   K Q
Sbjct  61   SLGTV--VGEGKIEFNESFRLPVTLLREVPVKGKDTDTFQKNCLEFNLYEPRRD---KAQ  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TAV+D A+YGV+KE ++++ P+N KRS+R+T QP+L  KI+ + KGR  S   +++ 
Sbjct  116  LLATAVVDLADYGVIKETISLTAPVNSKRSFRSTPQPILYFKIKPIDKGRTTS---SSLS  172

Query  705  RESSMDSSAGESVSALMN  758
            +  SMD + GESVSALMN
Sbjct  173  KGVSMDKNGGESVSALMN  190



>ref|XP_011006910.1| PREDICTED: uncharacterized protein LOC105112767 [Populus euphratica]
Length=1029

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/608 (57%), Positives = 425/608 (70%), Gaps = 32/608 (5%)
 Frame = +3

Query  1635  ERLNHVSSVHTLGESNRANGSVRSNQF----VLRDKRNSIEGITSNDWKDTKVRSKETSN  1802
             +RL HV SV +  +S R+NG    NQ     ++RD  +S   ++ N+ K+ ++  K+T  
Sbjct  437   DRLKHVKSVRSSSDSLRSNGFGIRNQHNEVGLMRDAHHSAGSLSFNERKNAQIYPKDTRT  496

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
              +L+ K  +LE KI+MLEGEL+EAAA+E  L+SVVAEHGSS +KVHAPARRLSRLY HAC
Sbjct  497   NILDGKIHQLEHKIKMLEGELKEAAAIEASLYSVVAEHGSSMSKVHAPARRLSRLYLHAC  556

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             +E+   RR SAARS +SGL+LVAKACGNDVPRLTFWLSN V+LR  I +     +  +SS
Sbjct  557   RESFQSRRASAARSAISGLVLVAKACGNDVPRLTFWLSNSVVLRTIISQTIGDTESKISS  616

Query  2163  ----EYSKNAVVKNERKASPLKWQSF-PHKKSVGNDLPGTFEDWENPLGFTKALEKVEAW  2327
                 E   N ++     AS LKW+   P +K   N L     DWE+P  FT ALE+VEAW
Sbjct  617   GQCTERKGNKII-----ASSLKWKEVSPSRKGNKNGLYEDSSDWEDPHVFTSALERVEAW  671

Query  2328  IFSRIIESIWWQTFTPHMQSGAA---TSLDSE-INKIYQRTSSSCSEEPENFSLELWKKA  2495
             IFSR IESIWWQT TPHMQ+ A      LDS  + K   RTS    E+  N SLE WKKA
Sbjct  672   IFSRTIESIWWQTLTPHMQAAATKEIAQLDSSGLKKNLGRTSRLVHEDQGNISLEHWKKA  731

Query  2496  FRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDP  2675
             F+DA ER+CPVRAGGHECGCL +L++LIM+QCVARLDVAMFNAILRES D+IPTDPVSDP
Sbjct  732   FKDACERLCPVRAGGHECGCLPVLARLIMEQCVARLDVAMFNAILRESVDEIPTDPVSDP  791

Query  2676  ISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN  2855
             IS+P+VLPIPAG +SF AGAQLKN IGNWSRWL DLFG+       D  +  E+  +N  
Sbjct  792   ISDPKVLPIPAGSSSFGAGAQLKNVIGNWSRWLTDLFGM-------DDDDLLEDDNENDE  844

Query  2856  GHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
               ER   D   KPF+LLNA+SDLMMLPKDMLLS+++RKEVCPTF   L+ RVL+ F+ DE
Sbjct  845   IDERP--DTTFKPFHLLNALSDLMMLPKDMLLSKSIRKEVCPTFAAPLMRRVLDNFVLDE  902

Query  3036  FCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             FCPDPIP+VV EAL++ED +E  EESV   PC AAP +Y PPSAA+    +     S S+
Sbjct  903   FCPDPIPDVVFEALDTEDAIEAGEESVTMVPCIAAPPIYLPPSAAS-IAKIIGEFGSQSK  961

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLIKMENSEV----TKPgggsgngngngVRYQLL  3383
             L +  SS+++KSYTSDDELDEL+SPL  I ++ +      TKP   S     N +RY+LL
Sbjct  962   LRKGGSSIVRKSYTSDDELDELNSPLASIILDGARSSPAPTKPSWKSKKDIDNTIRYELL  1021

Query  3384  REVWMSSE  3407
             RE+WM+SE
Sbjct  1022  REIWMNSE  1029


 Score =   241 bits (616),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 153/198 (77%), Gaps = 8/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG +GK R   SVQ +YL++I +IKPWPPSQSL++L++V+IQWE+GD+NSGST  V P
Sbjct  1    MVLGMNGKNRRSSSVQVDYLVHIEDIKPWPPSQSLRSLRSVLIQWENGDRNSGSTNTVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L T   VG G+IEFNESFR+P+TLLRE+  K  + DTFQKNC+EFNLYEPRRD   K Q
Sbjct  61   SLGTV--VGEGKIEFNESFRLPVTLLREVPVKGKDTDTFQKNCLEFNLYEPRRD---KAQ  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TAV+D A+YGV+KE ++++ P+N KRS+R+T QP+L  KIQ + KGR  S   +++ 
Sbjct  116  LLATAVVDLADYGVIKETISLTAPVNSKRSFRSTPQPILYFKIQPIDKGRTNS---SSLS  172

Query  705  RESSMDSSAGESVSALMN  758
            +  SMD + GESVSALMN
Sbjct  173  KGVSMDKNGGESVSALMN  190



>ref|XP_008341316.1| PREDICTED: uncharacterized protein LOC103404206 [Malus domestica]
 ref|XP_008341317.1| PREDICTED: uncharacterized protein LOC103404206 [Malus domestica]
Length=996

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/665 (53%), Positives = 446/665 (67%), Gaps = 52/665 (8%)
 Frame = +3

Query  1455  ERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCD  1634
             ER + +E G+G++   E+    E E  +S   +   K+   G    +   +SV  ++  D
Sbjct  370   ERKQQEENGDGRQSFNEEKHSWESE--SSIAHEANGKEIPIGTKENMKHVKSV--RSPID  425

Query  1635  ERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLE  1814
                N ++ +   GE+    G VR                     KD KV  +++ +V+LE
Sbjct  426   SAKNALTGIQ--GEAQNGAGIVR---------------------KDAKVYPRDSRSVILE  462

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
              K  ++E +I++LEGELREAAAVE  L+SVVAEHGSS +KVHAPARRLSRLY HACKE+S
Sbjct  463   SKIHQMENRIKLLEGELREAAAVEAALYSVVAEHGSSMSKVHAPARRLSRLYLHACKESS  522

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPL----SS  2162
               RR SAA+S+VSGL+LVAKACGNDVPRLT+WLSN ++LR  + + + + +LP+    S 
Sbjct  523   RFRRASAAKSIVSGLVLVAKACGNDVPRLTYWLSNSIVLRTIVSQVAGESKLPMLAGPSI  582

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDL-PGTFEDWENPLGFTKALEKVEAWIFSR  2339
             + +    VKN   +S +KW++    K  G  L  G+F D ENP  F   LEK+E+WIFSR
Sbjct  583   DRNGAGKVKNNVPSS-IKWKAPSSGKKEGMKLLNGSFGDCENPQTFMSTLEKIESWIFSR  641

Query  2340  IIESIWWQTFTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDA  2507
             I+ESIWWQT TPHMQS A  +     DS   K Y+RTSSS  +E  NFSL+LWKKAFRDA
Sbjct  642   IVESIWWQTLTPHMQSVAVKANSEGADSGSRKKYKRTSSSIDQERINFSLDLWKKAFRDA  701

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              ER+CPVRA GHECGCL LL++L+M+Q VARLDVAMFNAILRES+D+IPTDPVSDPIS+ 
Sbjct  702   CERLCPVRAEGHECGCLPLLARLVMEQSVARLDVAMFNAILRESSDEIPTDPVSDPISDL  761

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHER  2867
             +VLPIPAGK+SF AGAQLK+AIGNWSRWL DLFG+DDDD           +  N +    
Sbjct  762   KVLPIPAGKSSFGAGAQLKSAIGNWSRWLTDLFGMDDDDSL---------EDVNDDDDND  812

Query  2868  KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPD  3047
             K QD   K F+LLNA+SDLMMLPKD+LLS+++RKEVCP F   LI R+L+ F+PDEF  D
Sbjct  813   KRQDKSFKSFHLLNALSDLMMLPKDLLLSKSIRKEVCPAFSAPLIKRILDTFVPDEFYTD  872

Query  3048  PIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
             PIP VVL+AL SED +E  E++V N P + A  VY PPS A+    +       SQL RS
Sbjct  873   PIPGVVLQALESEDALEAGEDTVTNVPYTGAGTVYLPPSTAS-VASIIGEVXGQSQLRRS  931

Query  3228  rssVLKKSYTsddeldeldsPLNLIKMENSE----VTKPg-ggsgngngngVRYQLLREV  3392
              SSVL+KSYTSDDELDEL+SPL  I +++S      TKP     GNGN   VRY+LLREV
Sbjct  932   GSSVLRKSYTSDDELDELNSPLASIFIDSSRSSPVATKPSWVSKGNGNQTAVRYELLREV  991

Query  3393  WMSSE  3407
             W +SE
Sbjct  992   WTNSE  996


 Score =   213 bits (542),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K+R   +VQ +Y I+I +IKPWPPSQSL++L+ V+IQWE+GD+NSG+T+ V P
Sbjct  1    MGLGVKAKSRRGSTVQIDYHIHIQDIKPWPPSQSLRSLRTVLIQWENGDRNSGTTSPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNG-DTFQKNCIEFNLYEPRRDTTVKG  521
             +   S VG G+IEFN+SFR+P+TLLR++S K   G DTFQKN +E +LYEPRRD   KG
Sbjct  61   SIG--SVVGEGKIEFNQSFRLPVTLLRDMSVKGGGGSDTFQKNLLELHLYEPRRDNP-KG  117

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
            QLL TA+ID A++G+VKE ++V+ P+N KR+YRNT QP+L +KIQ V KGR  S  R ++
Sbjct  118  QLLATAIIDLADHGIVKETISVTAPMNSKRNYRNTDQPVLYIKIQPVVKGRTSSSSRGSL  177

Query  702  RRESSMDSSAGESVSALMN  758
             R  S+D++  ESVSALMN
Sbjct  178  SRGVSLDNAGSESVSALMN  196



>ref|XP_007217648.1| hypothetical protein PRUPE_ppa001023mg [Prunus persica]
 gb|EMJ18847.1| hypothetical protein PRUPE_ppa001023mg [Prunus persica]
Length=932

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/629 (56%), Positives = 438/629 (70%), Gaps = 39/629 (6%)
 Frame = +3

Query  1599  GRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSN------  1760
             G E +  +    E + HV SV +  +S + N   R++Q     K   I+G   N      
Sbjct  317   GHERLSHEVNDKENIKHVKSVRSAIDSAK-NALPRNDQNA-EVKETGIQGDAQNSAGVAV  374

Query  1761  -----DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSS  1925
                  + KD KV  ++T +V+LE K  +LE +I++LEGELREAAAVE  L+SVVAEHGSS
Sbjct  375   SFRGKERKDAKVYPRDTRSVILESKIHQLEHRIKLLEGELREAAAVEAALYSVVAEHGSS  434

Query  1926  TNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCV  2105
              +KVHAPARRLSRLY HACKE+S  RR SAARS+VSGL+LV KACGNDVPRLT+WLSN +
Sbjct  435   MSKVHAPARRLSRLYLHACKESSRSRRASAARSIVSGLVLVGKACGNDVPRLTYWLSNSI  494

Query  2106  LLRAAICKFSEKQQLPLS--SEYSKNAV--VKNERKASPLKWQSFPHKKSVGNDL-PGTF  2270
             +LR  I + + + +L LS  S   +N    VKN   +SP+KW++    K  G  L  G+F
Sbjct  495   VLRTIISQVTGEPELLLSPGSSIDRNGAGKVKNN-VSSPIKWKASSSGKKEGMKLLNGSF  553

Query  2271  EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSL----DSEINKIYQRT  2438
              D +NP  F   LEK+E+WIFSRI+ESIWWQT TPHMQS AA  L    DS   K Y+RT
Sbjct  554   SDCDNPHTFMSTLEKIESWIFSRIVESIWWQTLTPHMQSVAAKELNEGVDSGSRKNYRRT  613

Query  2439  SSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMF  2618
             SSS  +E  NFSL+LWKKAFRDA ER+CPVRAGGHECGCL LL +L+M+Q VARLDVAMF
Sbjct  614   SSSIDQEQSNFSLDLWKKAFRDACERLCPVRAGGHECGCLPLLGRLVMEQSVARLDVAMF  673

Query  2619  NAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdd  2798
             NAILRES+D+IPTDPVSDPIS+ +VLPIPAGK+SF AGAQLK+AIGNWSRWL DLFG+DD
Sbjct  674   NAILRESSDEIPTDPVSDPISDLKVLPIPAGKSSFGAGAQLKSAIGNWSRWLTDLFGMDD  733

Query  2799  ddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVC  2978
             DD+  + V DD++  +         QD   K F+LLNA+SDLMMLPKD+LLS+++R EVC
Sbjct  734   DDDSLEDVNDDDDNDER--------QDKSFKSFHLLNALSDLMMLPKDLLLSKSIRTEVC  785

Query  2979  PTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAP  3158
             P F   LI R+L+ F+PDEFC DPIP VVLEAL SED +EV EE+V N PC+ A  VY P
Sbjct  786   PAFAAPLIKRILDTFVPDEFCTDPIPGVVLEALESEDTLEVGEEAVTNVPCTGAGTVYLP  845

Query  3159  PSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgg  3338
             PS  +    +       SQL RS SSVL+KSYTSDDELDEL+SPL  I +++S  + P  
Sbjct  846   PSTTS-IASIIGEVGGQSQLRRSGSSVLRKSYTSDDELDELNSPLASIFIDSSR-SSPVA  903

Query  3339  gsgn------gngngVRYQLLREVWMSSE  3407
                +         N +RY+LLR+VWM+SE
Sbjct  904   TKLSWVSKGNSQQNAIRYELLRDVWMNSE  932


 Score =   227 bits (578),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 151/201 (75%), Gaps = 6/201 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K R  P+VQ +YLI+I EIKPWPPSQSL++L++V+IQWE+GD+NSGST  V P
Sbjct  1    MGLGVKAKNRRGPTVQIDYLIHIHEIKPWPPSQSLRSLRSVLIQWENGDRNSGSTNPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGD---TFQKNCIEFNLYEPRRDTTV  515
             L   S VG G+IEFN SFR+P+TLLR++S K   G     FQKNC+EF+LYEPRRD T 
Sbjct  61   SLG--SVVGEGKIEFNHSFRLPVTLLRDMSVKGGGGGDGDAFQKNCLEFHLYEPRRDKT-  117

Query  516  KGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRN  695
            KGQLL TA++D A++GVVKE ++VS P+N KRS+RNT QP+L +KIQ   KGR+ S   +
Sbjct  118  KGQLLATAIVDLADHGVVKETISVSAPMNSKRSFRNTDQPVLLIKIQPFVKGRISSSSGD  177

Query  696  NVRRESSMDSSAGESVSALMN  758
            ++ R +S+D + GESVS L N
Sbjct  178  SLSRGASLDKAGGESVSGLTN  198



>ref|XP_008450078.1| PREDICTED: uncharacterized protein LOC103491774 isoform X1 [Cucumis 
melo]
 ref|XP_008450079.1| PREDICTED: uncharacterized protein LOC103491774 isoform X1 [Cucumis 
melo]
 ref|XP_008450080.1| PREDICTED: uncharacterized protein LOC103491774 isoform X1 [Cucumis 
melo]
 ref|XP_008450081.1| PREDICTED: uncharacterized protein LOC103491774 isoform X1 [Cucumis 
melo]
Length=988

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/608 (56%), Positives = 429/608 (71%), Gaps = 33/608 (5%)
 Frame = +3

Query  1632  DERLNHVSSVHTLGESNRANGSVRSNQFVLRD------KRNSIEGITSNDWKDTKVRSKE  1793
             ++RL HV SV +  ES + NG        + +        NS+E +  ND +D+K  +K+
Sbjct  392   NDRLKHVKSVRSPLESAKCNGFSSKQPTGVEEGGAPVYPDNSLESVRRNDKRDSKPCAKD  451

Query  1794  TSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYF  1973
             T N V + K Q+L+ KI+MLEGELREAAA+E  L+S+VAEHGSS NKVHAPARRLSRLY 
Sbjct  452   TKNSVSDSKVQQLQHKIKMLEGELREAAAIEAALYSIVAEHGSSMNKVHAPARRLSRLYL  511

Query  1974  HACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK--FSEKQQ  2147
             H+CKE+S  R+  AARSVVSG +L+AKACGNDVPRLTFWLSN ++LR  I +   S K Q
Sbjct  512   HSCKESSQSRKAHAARSVVSGFVLIAKACGNDVPRLTFWLSNSIVLRTIISQNAVSLKMQ  571

Query  2148  LPLSSEYSKNAVVKNERKA-SPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
             +   S  SKN   K   KA S LKW+ S P+K+  G+   G+  DWEN   FT ALEKVE
Sbjct  572   VISGSHSSKNGANKESSKAASALKWKVSSPNKRENGSTKHGSSGDWENVQTFTSALEKVE  631

Query  2322  AWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELWK  2489
             AWIFSRIIESIWWQT TPHMQS  A +++   N    K Y+R SSS   +  NFSL+LWK
Sbjct  632   AWIFSRIIESIWWQTLTPHMQSATAKTINQVSNSTSGKSYKRNSSSVDHDQGNFSLDLWK  691

Query  2490  KAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVS  2669
             KAF+DA ERICPVRAGGHECGCL LLSKLIM+QCV RLD AMFNAILR+SAD++PTDPVS
Sbjct  692   KAFKDACERICPVRAGGHECGCLPLLSKLIMEQCVTRLDTAMFNAILRDSADEMPTDPVS  751

Query  2670  DPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADN  2849
             DPIS  +VLPI  GK+SF AGA LKNAIGNWSRWL DLFG+DD+D+ +       ++ DN
Sbjct  752   DPISESKVLPILVGKSSFGAGALLKNAIGNWSRWLTDLFGLDDEDQCE-------DENDN  804

Query  2850  SNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
             + G     +DA + K F+LLNA+SDLMMLPKDMLLS+++RKEVCP+F   +I R+L+ F+
Sbjct  805   TEG-----KDASTLKSFHLLNALSDLMMLPKDMLLSQSIRKEVCPSFSAPVIKRILDHFV  859

Query  3027  PDEFCPDPIPNVVLEALN-SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdiss  3203
             PDEFC DPIP+ VLEAL+  ED  E++++ V++ P +AA + Y PPSAA++   +GD+ +
Sbjct  860   PDEFCEDPIPDAVLEALDIEEDPSELDDKFVMSLPHTAAAVTYHPPSAASVAAFIGDVGT  919

Query  3204  sssqltrsrssVLKKSYTsddeldeldsPL-NLIKMENSEVT--KPgggsgng-ngngVR  3371
                      S VL+KS TSDDELDEL SP  +++ +  S  T  KP   S    N N  R
Sbjct  920   KPELTRSRSS-VLRKSNTSDDELDELCSPFASILDVAISPFTTSKPSRTSEKNCNQNATR  978

Query  3372  YQLLREVW  3395
             Y+LLR+VW
Sbjct  979   YELLRDVW  986


 Score =   213 bits (543),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R    VQ +Y I++ +IKPWPPSQSL +L++V IQWE+GD++SGS+  V P
Sbjct  1    MVLGLKGKHRRGDIVQVDYRIHVQDIKPWPPSQSLMSLRSVFIQWENGDRHSGSSNLVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   S VG G+IEFNESF++P+ L+R++  +  + DTFQ+N +EFNL+E RR+   KGQ
Sbjct  61   TIG--SIVGEGKIEFNESFKLPVGLVRDMPVRGKDADTFQRNILEFNLFESRREKAGKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A +GVVKE  +V+VPI+C+R+++NT+QP+L +KIQ + KGR  + ++  + 
Sbjct  119  LLATATIDLAEFGVVKETTSVTVPIHCQRNFKNTLQPILSIKIQPIDKGRSNNSLKETLS  178

Query  705  RESSMDSSAGESVSALMN  758
            R  S+DS  GES +A M+
Sbjct  179  RRMSLDSFDGESAAASMH  196



>ref|XP_008231148.1| PREDICTED: uncharacterized protein LOC103330360 [Prunus mume]
 ref|XP_008231149.1| PREDICTED: uncharacterized protein LOC103330360 [Prunus mume]
Length=1042

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/617 (56%), Positives = 430/617 (70%), Gaps = 38/617 (6%)
 Frame = +3

Query  1635  ERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEG-----------ITSNDWKDTKV  1781
             E + HV SV +  +S  A  ++  N      K + I+G               + KD KV
Sbjct  438   ENIKHVKSVRSAIDS--AKNALHRNDQNAEVKESGIQGDAQKSAGVAVSFRGKERKDAKV  495

Query  1782  RSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLS  1961
               ++T +V+LE K  +LE +I++LEGELREAAAVE  L+SVVAEHGSS +KVHAPARRLS
Sbjct  496   YPRDTRSVILESKIHQLEHRIKLLEGELREAAAVEAALYSVVAEHGSSMSKVHAPARRLS  555

Query  1962  RLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEK  2141
             RLY HACKE+S  RR SAARS++SGL+LV KACGNDVPRLT+WLSN ++LR  I + + +
Sbjct  556   RLYLHACKESSRSRRASAARSIISGLVLVTKACGNDVPRLTYWLSNSIVLRTIISQVTGE  615

Query  2142  QQLPLS--SEYSKNAVVKNERK-ASPLKWQSFPHKKSVGNDL-PGTFEDWENPLGFTKAL  2309
              +L LS  S   +N   K +   +SP+KW++    K  G  L  G+F D +NP  F   L
Sbjct  616   PELLLSPGSSIDRNGAAKVKNNVSSPIKWKAPSSGKKEGMKLLNGSFGDCDNPHTFMSTL  675

Query  2310  EKVEAWIFSRIIESIWWQTFTPHMQSGAATSL-----DSEINKIYQRTSSSCSEEPENFS  2474
             EK+E+WIFSRI+ESIWWQT TPHMQS AA  L     DS   K Y+RTSSS  +E  NFS
Sbjct  676   EKIESWIFSRIVESIWWQTLTPHMQSVAAKELNEEGIDSGSRKNYRRTSSSIDQEQSNFS  735

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L+LWKKAFRDA ER+CPVRAGGHECGCL LL +L+M+Q VARLDVAMFNAILRES+D+IP
Sbjct  736   LDLWKKAFRDACERLCPVRAGGHECGCLPLLGRLVMEQSVARLDVAMFNAILRESSDEIP  795

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDPVSDPIS+ +VLPIPAGK+SF AGAQLK+AIGNWSRWL DLFG+      DD  +  E
Sbjct  796   TDPVSDPISDLKVLPIPAGKSSFGAGAQLKSAIGNWSRWLTDLFGM------DDDDDSLE  849

Query  2835  NKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVL  3014
             +  D+ +  ER  QD   K F+LLNA+SDLMMLPKD+LLS+++RKEVCP F   LI R+L
Sbjct  850   DVNDDYDNDER--QDKSFKSFHLLNALSDLMMLPKDLLLSKSIRKEVCPAFAAPLIKRIL  907

Query  3015  NVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgd  3194
             + FIPDEFC DPIP VVLEAL SED +EV EE+V N PC+ A  VY PPS  +    +  
Sbjct  908   DTFIPDEFCTDPIPGVVLEALESEDTLEVGEEAVTNVPCTGAGTVYLPPSTTS-VASIIG  966

Query  3195  isssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgn------gn  3356
                  SQL RS SSVL+KSYTSDDELDEL+SPL  I +++S  + P     +        
Sbjct  967   EVGGQSQLRRSGSSVLRKSYTSDDELDELNSPLASIFIDSSR-SSPVATKLSWVSKGNSQ  1025

Query  3357  gngVRYQLLREVWMSSE  3407
              N +RY+LLR+VWM+SE
Sbjct  1026  QNAIRYELLRDVWMNSE  1042


 Score =   228 bits (581),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 150/201 (75%), Gaps = 6/201 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K R  P+VQ +YLI+I EIKPWPPSQSL++L++V+IQWE+GD+NSGST  V P
Sbjct  1    MGLGVKAKNRRGPTVQIDYLIHIHEIKPWPPSQSLRSLRSVLIQWENGDRNSGSTNPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGD---TFQKNCIEFNLYEPRRDTTV  515
             L   S VG G+IEFN SFR+P+TLLR++S K   G     FQKNC+EF+LYEPRRD T 
Sbjct  61   SLG--SVVGEGKIEFNHSFRLPVTLLRDMSVKGGGGGDGDAFQKNCLEFHLYEPRRDKT-  117

Query  516  KGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRN  695
            KGQLL TA++D A++GVVKE ++VS P+N KRS+RNT QP+L +KIQ   KGR  S   +
Sbjct  118  KGQLLATAIVDLADHGVVKETISVSAPMNSKRSFRNTDQPVLFIKIQPFVKGRTSSSSGD  177

Query  696  NVRRESSMDSSAGESVSALMN  758
            ++ R +SMD + GESVS L N
Sbjct  178  SLSRGASMDKAGGESVSGLTN  198



>ref|XP_004303991.1| PREDICTED: uncharacterized protein LOC101295544 [Fragaria vesca 
subsp. vesca]
Length=1051

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/669 (54%), Positives = 452/669 (68%), Gaps = 41/669 (6%)
 Frame = +3

Query  1455  ERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCD  1634
             +R K +E G+ ++   E+    EGEP            H  G   ++   E +      +
Sbjct  406   DRQKQEENGDERQNCDEENHSGEGEPY--------IAGHANGKDVLLGMNEII----VSN  453

Query  1635  ERLNHVSSVHTLGESNRANGSVRSNQFV-----LRDKRNSIEGITSN----DWKDTKVRS  1787
             ++L  V SV ++ + ++ N S R++Q V     ++       G++ N    + K+ KV  
Sbjct  454   DKLKPVKSVRSIADLSK-NISSRNDQHVEVKDGVQGDAQKSAGVSGNLRVKERKEAKVYP  512

Query  1788  KETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRL  1967
             K+T +V+LE K  +LE KI+MLEGELREAAAVE  L+SVVAEHGSS +KVHAPARRLSRL
Sbjct  513   KDTRSVILESKVNQLEHKIKMLEGELREAAAVESALYSVVAEHGSSMSKVHAPARRLSRL  572

Query  1968  YFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQ  2147
             Y HAC E S  RR SAARSVVSGL+LV+KACGNDVPRLTFWLSN ++LR  I +      
Sbjct  573   YLHACGETSRSRRASAARSVVSGLVLVSKACGNDVPRLTFWLSNSIVLRTIISQAIGDPA  632

Query  2148  LPLSSEYS--KNAVVKNERKAS-PLKWQSFPHKKSVGNDL-PGTFEDWENPLGFTKALEK  2315
             LP S+  S  +N   K +  AS PLKW++    K  G  L  G+F DWENP  F   LEK
Sbjct  633   LPKSARSSIDRNGAEKVKHMASSPLKWEAPSSGKKQGMKLLNGSFGDWENPNTFMSTLEK  692

Query  2316  VEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKA  2495
             +E+WIFSRI+ESIWWQT TPHMQS  A + D    K Y+RTS S  +E  +FSL+LWKKA
Sbjct  693   IESWIFSRIVESIWWQTLTPHMQSVTAKATDEGSRKNYRRTSGSVDQEQSDFSLDLWKKA  752

Query  2496  FRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDP  2675
             FRDA ER+CPVRAGGHECGCL LLS+L+M+Q VARLDVAMFNAILRES+D+IP+DPVSDP
Sbjct  753   FRDACERLCPVRAGGHECGCLPLLSRLVMEQSVARLDVAMFNAILRESSDEIPSDPVSDP  812

Query  2676  ISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN  2855
             IS+ +VLPIPAGK+SF AGAQLK+ IGNWSRWL DLFGIDDDD  +D+         N +
Sbjct  813   ISDLKVLPIPAGKSSFGAGAQLKSVIGNWSRWLTDLFGIDDDDSFEDV---------NGD  863

Query  2856  GHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
                 +  D   K F+LLNA+SDLMMLPKDMLLS+++RKEVCPTF   LI R+L+ F+PDE
Sbjct  864   DDNDERHDTSFKSFHLLNALSDLMMLPKDMLLSKSIRKEVCPTFAAPLIKRILDNFVPDE  923

Query  3036  FCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             FC DPIP++VL+ L SED  E+ EE++ N PC+    VY PPS  AL   +       SQ
Sbjct  924   FCTDPIPDIVLKNLESEDTHEIGEEALRNIPCTGLGTVYLPPS-TALVANIIGDGGGQSQ  982

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQL  3380
             L RS SSV++KSYTSDDELDEL+SPL  I + +S  +           GN N N VRY+L
Sbjct  983   LRRSGSSVVRKSYTSDDELDELNSPLASIFIGSSGSSPVASKLNWVPKGNINQNAVRYEL  1042

Query  3381  LREVWMSSE  3407
             LR+VWM+SE
Sbjct  1043  LRDVWMNSE  1051


 Score =   225 bits (573),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 152/203 (75%), Gaps = 7/203 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MV+G   K    P+VQ +YL++I+EIKPWPPSQSLK+L++V+IQWE+G+++SG T  V P
Sbjct  1    MVIGLKAKNHRGPTVQIDYLVHILEIKPWPPSQSLKSLRSVLIQWENGERSSGMTNAVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSK-----SVNGDTFQKNCIEFNLYEPRRDT  509
             +   S VG GRIEFNESF++P+TLLR+++ K     S  GD F KNC+E NLYEPRRD 
Sbjct  61   SIG--SVVGEGRIEFNESFKLPVTLLRDVAVKGGVKGSGEGDAFLKNCLELNLYEPRRDK  118

Query  510  TVKGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLV  689
            T KGQLL TAV+D A+YGVV+E + VS P+N KRS++NT +P+L +KIQ   KGR  S  
Sbjct  119  TAKGQLLATAVVDLADYGVVRESVCVSAPMNSKRSFKNTDKPILYMKIQPFKKGRPSSSS  178

Query  690  RNNVRRESSMDSSAGESVSALMN  758
            R+++ R  S+D + GESVSALM+
Sbjct  179  RDSLSRAVSLDKAGGESVSALMD  201



>ref|XP_004145715.1| PREDICTED: uncharacterized protein LOC101208084 [Cucumis sativus]
 gb|KGN58195.1| hypothetical protein Csa_3G588540 [Cucumis sativus]
Length=988

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/609 (56%), Positives = 424/609 (70%), Gaps = 35/609 (6%)
 Frame = +3

Query  1632  DERLNHVSSVHTLGESNRANGSVRSNQFVLRDK-------RNSIEGITSNDWKDTKVRSK  1790
             ++RL HV SV +  ES + NG   S Q    ++        NS+E +  N+ +D+K  +K
Sbjct  392   NDRLKHVKSVRSPLESAKCNG-FSSKQLTGVEEGGAPVYLDNSLESVRRNEKRDSKPYAK  450

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             +T + V + K Q+L+ KI+MLEGELREAAA+E  L+S+VAEHGSS NKVHAPARRLSRLY
Sbjct  451   DTKSSVWDSKVQQLQHKIKMLEGELREAAAIEAALYSIVAEHGSSMNKVHAPARRLSRLY  510

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK--FSEKQ  2144
              H+CKE+S  R+  AARSVVSG +L AKACGNDVPRLTFWLSN ++LR  + +   S K 
Sbjct  511   LHSCKESSQSRKAHAARSVVSGFVLTAKACGNDVPRLTFWLSNSIVLRTIVSQEDVSLKM  570

Query  2145  QLPLSSEYSKNAVVKNERKA-SPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             Q+   S  SKN   +   KA S LKW+ S P+ +  GN   G+  DWEN   FT ALEKV
Sbjct  571   QVISGSHSSKNGANRESSKAASTLKWKASSPNNRENGNTKHGSSGDWENVQTFTSALEKV  630

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELW  2486
             EAWIFSRIIESIWWQT TPHMQS  A +++   N    K Y+R SSS   +  NFSL+LW
Sbjct  631   EAWIFSRIIESIWWQTLTPHMQSATAKTINQVSNSTSGKSYKRNSSSVDHDQGNFSLDLW  690

Query  2487  KKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPV  2666
             KKAF+DA ERICPVRAGGHECGCL LLS+LIM+QCV RLD AMFNAILR+SAD++PTDPV
Sbjct  691   KKAFKDACERICPVRAGGHECGCLPLLSRLIMEQCVTRLDTAMFNAILRDSADEMPTDPV  750

Query  2667  SDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKAD  2846
             SDPIS  +VLPI  GK+SF AGA LKNAIGNWSRWL DLFG+       D  +  E++ D
Sbjct  751   SDPISESKVLPIQVGKSSFGAGALLKNAIGNWSRWLTDLFGL-------DDDDQCEDEND  803

Query  2847  NSNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVF  3023
             N+ G     +DA + K F+LLNA+SDLMMLPKDMLL++++RKEVCP+F   +I R+L  F
Sbjct  804   NTEG-----KDASTLKSFHLLNALSDLMMLPKDMLLNQSIRKEVCPSFSAQVIKRILEHF  858

Query  3024  IPDEFCPDPIPNVVLEALN-SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             +PDEFC DPIP+ VLEAL+  ED  E++++ V + P +AA + Y PPS A+         
Sbjct  859   VPDEFCEDPIPDAVLEALDIEEDPSELDDKFVTSLPHAAAAVAYHPPSEAS-VAAFIGNV  917

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsPLNLI---KMENSEVTKPgggsg-ngngngV  3368
              ++S+L RSRSSVL+KS TSDDELDEL SP   I    +  S  +KP   S    N N  
Sbjct  918   GTNSELRRSRSSVLRKSNTSDDELDELCSPFASILDVTISPSTTSKPSRTSENTRNQNAT  977

Query  3369  RYQLLREVW  3395
             RY+LLR+VW
Sbjct  978   RYELLRDVW  986


 Score =   212 bits (539),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R    VQ +Y I++ +IKPWPPSQSL +L++V IQWE+GD++SGS+  V P
Sbjct  1    MVLGLKGKHRRGDIVQVDYRIHVQDIKPWPPSQSLMSLRSVFIQWENGDRHSGSSNLVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   S VG G+IEFNESF++P+ L+R++  +  + DTFQ+N +EFNL+E RR+   KGQ
Sbjct  61   TIG--SIVGEGKIEFNESFKLPVGLVRDMPVRGKDADTFQRNILEFNLFESRREKAGKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A +GVVK+  +V+VPI+C+R+++NT+QP+L +KIQ + KGR  + +++ + 
Sbjct  119  LLATATIDLAEFGVVKDTTSVTVPIHCQRNFKNTLQPILSIKIQPIDKGRSNNSLKDTLS  178

Query  705  RESSMDSSAGESVSA  749
            R  S+DS  GES +A
Sbjct  179  RRMSLDSFDGESAAA  193



>ref|XP_004166049.1| PREDICTED: uncharacterized protein LOC101224875 [Cucumis sativus]
Length=988

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/609 (56%), Positives = 424/609 (70%), Gaps = 35/609 (6%)
 Frame = +3

Query  1632  DERLNHVSSVHTLGESNRANGSVRSNQFVLRDK-------RNSIEGITSNDWKDTKVRSK  1790
             ++RL HV SV +  ES + NG   S Q    ++        NS+E +  N+ +D+K  +K
Sbjct  392   NDRLKHVKSVRSPLESAKCNG-FSSKQLTGVEEGGAPVYLDNSLESVRRNEKRDSKPYAK  450

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             +T + V + K Q+L+ KI+MLEGELREAAA+E  L+S+VAEHGSS NKVHAPARRLSRLY
Sbjct  451   DTKSSVWDSKVQQLQHKIKMLEGELREAAAIEAALYSIVAEHGSSMNKVHAPARRLSRLY  510

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK--FSEKQ  2144
              H+CKE+S  R+  AARSVVSG +L AKACGNDVPRLTFWLSN ++LR  + +   S K 
Sbjct  511   LHSCKESSQSRKAHAARSVVSGFVLTAKACGNDVPRLTFWLSNSIVLRTIVSQEDVSLKM  570

Query  2145  QLPLSSEYSKNAVVKNERK-ASPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             Q+   S  SKN   +   K AS LKW+ S P+ +  GN   G+  DWEN   FT ALEKV
Sbjct  571   QVISGSHSSKNGANRESSKTASTLKWKASSPNNRENGNTKHGSSGDWENVQTFTSALEKV  630

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELW  2486
             EAWIFSRIIESIWWQT TPHMQS  A +++   N    K Y+R SSS   +  NFSL+LW
Sbjct  631   EAWIFSRIIESIWWQTLTPHMQSATAKTINQVSNSTSGKSYKRNSSSVDHDQGNFSLDLW  690

Query  2487  KKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPV  2666
             KKAF+DA ERICPVRAGGHECGCL LLS+LIM+QCV RLD AMFNAILR+SAD++PTDPV
Sbjct  691   KKAFKDACERICPVRAGGHECGCLPLLSRLIMEQCVTRLDTAMFNAILRDSADEMPTDPV  750

Query  2667  SDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKAD  2846
             SDPIS  +VLPI  GK+SF AGA LKNAIGNWSRWL DLFG+       D  +  E++ D
Sbjct  751   SDPISESKVLPIQVGKSSFGAGALLKNAIGNWSRWLTDLFGL-------DDDDQCEDEND  803

Query  2847  NSNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVF  3023
             N+ G     +DA + K F+LLNA+SDLMMLPKDMLL++++RKEVCP+F   +I R+L  F
Sbjct  804   NTEG-----KDASTLKSFHLLNALSDLMMLPKDMLLNQSIRKEVCPSFSAQVIKRILEHF  858

Query  3024  IPDEFCPDPIPNVVLEALN-SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             +PDEFC DPIP+ VLEAL+  ED  E++++ V + P +AA + Y PPS A+         
Sbjct  859   VPDEFCEDPIPDAVLEALDIEEDPSELDDKFVTSLPHAAAAVAYHPPSEAS-VAAFIGNV  917

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsPLNLI---KMENSEVTKPgggsg-ngngngV  3368
              ++S+L RSRSSVL+KS TSDDELDEL SP   I    +  S  +KP   S    N N  
Sbjct  918   GTNSELRRSRSSVLRKSNTSDDELDELCSPFASILDVTISPSTTSKPSRTSENTRNQNAT  977

Query  3369  RYQLLREVW  3395
             RY+LLR+VW
Sbjct  978   RYELLRDVW  986


 Score =   212 bits (539),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 144/195 (74%), Gaps = 2/195 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R    VQ +Y I++ +IKPWPPSQSL +L++V IQWE+GD++SGS+  V P
Sbjct  1    MVLGLKGKHRRGDIVQVDYRIHVQDIKPWPPSQSLMSLRSVFIQWENGDRHSGSSNLVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   S VG G+IEFNESF++P+ L+R++  +  + DTFQ+N +EFNL+E RR+   KGQ
Sbjct  61   TIG--SIVGEGKIEFNESFKLPVGLVRDMPVRGKDADTFQRNILEFNLFESRREKAGKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A +GVVK+  +V+VPI+C+R+++NT+QP+L +KIQ + KGR  + +++ + 
Sbjct  119  LLATATIDLAEFGVVKDTTSVTVPIHCQRNFKNTLQPILSIKIQPIDKGRSNNSLKDTLS  178

Query  705  RESSMDSSAGESVSA  749
            R  S+DS  GES +A
Sbjct  179  RRMSLDSFDGESAAA  193



>ref|XP_008379131.1| PREDICTED: uncharacterized protein LOC103442151 isoform X2 [Malus 
domestica]
Length=1007

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/739 (50%), Positives = 468/739 (63%), Gaps = 48/739 (6%)
 Frame = +3

Query  1257  GSLVN----IDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG---LAEGEN  1415
             GS VN    + ++ NSN+ +   + A+   S S   NG  ED+ + +  NG   LA   N
Sbjct  295   GSPVNGNASVANSPNSNSRILKTVGAETLPSPSASFNGKAEDSNSSMRSNGHKHLAHEVN  354

Query  1416  TEGHQG-NTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAI  1592
              +   G    E     D +  + +  E   ++    E +  +        K   EG S+I
Sbjct  355   DKAVDGRGCLEAAVSBDSYDSSAKDNEGKQQEENRHERQSFDE------EKHSREGESSI  408

Query  1593  IAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKD  1772
                           E   HV SV +  +S +      +   V  D +NS  GI     KD
Sbjct  409   AHEANGKQVPIGMKENTKHVKSVRSXXDSXK-----NALTGVQGDAQNSA-GIVR---KD  459

Query  1773  TKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPAR  1952
              KV  ++T +V+LE K  ++E +I++LEGELREAAAVE  L+SVVAEHGSS +KVHAPAR
Sbjct  460   AKVYPRDTRSVILESKIHQMEHRIKLLEGELREAAAVEAALYSVVAEHGSSMSKVHAPAR  519

Query  1953  RLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF  2132
             RLSRLY HACKE+   RR SAA+S+VSG++LVAKACGNDVPRLT+WLSN ++LR  I + 
Sbjct  520   RLSRLYLHACKESPHSRRASAAKSIVSGIVLVAKACGNDVPRLTYWLSNSIVLRTIISQV  579

Query  2133  SEKQQLPLSSEYS--KNAV--VKNERKASPLKWQSFPHKKSVG-NDLPGTFEDWENPLGF  2297
               + + P+ +  S  +N    +KN   +SP+KW++    K  G   L G+  D ENP  F
Sbjct  580   IGESESPMXAXPSIDRNGAGKIKN-NVSSPIKWKASSSGKKEGLKLLNGSXGDCENPQTF  638

Query  2298  TKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSL----DSEINKIYQRTSSSCSEEPE  2465
                LEK+E+WIFSRI+ES WWQT TPHMQ   A  +    DS  +K Y+RTSSS  +E  
Sbjct  639   MSTLEKIESWIFSRIVESXWWQTLTPHMQPVVAKXISEGADSGSSKNYKRTSSSVDQEQS  698

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESAD  2645
               SLELWK AFRDA ER+CPVRA GHECGCL LL++L+M+Q VARLDVAMFNAILRES+D
Sbjct  699   XXSLELWKXAFRDACERLCPVRAEGHECGCLPLLARLVMEQSVARLDVAMFNAILRESSD  758

Query  2646  DIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlve  2825
             +IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLK+AIGNWSRWL DLFGIDDDD       
Sbjct  759   EIPTDPVSDPISDLKVLPIPAGKSSFGVGAQLKSAIGNWSRWLTDLFGIDDDDSL-----  813

Query  2826  ddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLIT  3005
                 +  N +    + QD   K F+LLNA+SDLMMLPKD+LLS+++RKEVCP F   LI 
Sbjct  814   ----EDVNDDXDNDERQDTSFKSFHLLNALSDLMMLPKDLLLSKSIRKEVCPAFSAPLIK  869

Query  3006  RVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgi  3185
             R+L+ F+PDEFC DPIP VVL+AL SED +E  EE+V N PC+ A  VY PP   A    
Sbjct  870   RILDTFVPDEFCTDPIPGVVLQALESEDILEAGEEAVTNVPCTGAGTVYXPP-LTASVAS  928

Query  3186  lgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSE----VTKPg-ggsgn  3350
             +     S SQL RS SSVL+KSYTSDDELDEL+SPL  I +++S     +TKP      N
Sbjct  929   IIGEVXSQSQLRRSGSSVLRKSYTSDDELDELNSPLASIFIDSSRSSPVLTKPCWISKRN  988

Query  3351  gngngVRYQLLREVWMSSE  3407
             GN    RY+LLREVWM+SE
Sbjct  989   GNQTSXRYELLREVWMNSE  1007


 Score =   207 bits (526),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 150/200 (75%), Gaps = 5/200 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K     +V+ +YLI+I +IKPWPPSQSL++L++V+IQWE+GD+NSG+T+ V P
Sbjct  1    MGLGVKAKNHRGSTVRIDYLIHIQDIKPWPPSQSLRSLRSVLIQWENGDRNSGATSPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNG--DTFQKNCIEFNLYEPRRDTTVK  518
             +   S VG G+IEFN+SFR+P+TLLR++S K   G  DTFQKN +E +LYEPRRD   K
Sbjct  61   SIG--SVVGEGKIEFNQSFRLPVTLLRDMSVKGGGGGGDTFQKNLLELHLYEPRRDNP-K  117

Query  519  GQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNN  698
            GQLL TA++D A++G+VKE ++VS P+N  RS+RNT QP+L +KIQ V KGR  S  R +
Sbjct  118  GQLLATAIVDLADHGIVKETISVSAPMNSTRSFRNTDQPVLYIKIQPVVKGRTSSSSRGS  177

Query  699  VRRESSMDSSAGESVSALMN  758
            + R  S+D++  ESVSALMN
Sbjct  178  LSRGVSLDNAGSESVSALMN  197



>ref|XP_008379130.1| PREDICTED: uncharacterized protein LOC103442151 isoform X1 [Malus 
domestica]
Length=1017

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/739 (50%), Positives = 468/739 (63%), Gaps = 48/739 (6%)
 Frame = +3

Query  1257  GSLVN----IDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG---LAEGEN  1415
             GS VN    + ++ NSN+ +   + A+   S S   NG  ED+ + +  NG   LA   N
Sbjct  305   GSPVNGNASVANSPNSNSRILKTVGAETLPSPSASFNGKAEDSNSSMRSNGHKHLAHEVN  364

Query  1416  TEGHQG-NTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAI  1592
              +   G    E     D +  + +  E   ++    E +  +        K   EG S+I
Sbjct  365   DKAVDGRGCLEAAVSBDSYDSSAKDNEGKQQEENRHERQSFDE------EKHSREGESSI  418

Query  1593  IAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKD  1772
                           E   HV SV +  +S +      +   V  D +NS  GI     KD
Sbjct  419   AHEANGKQVPIGMKENTKHVKSVRSXXDSXK-----NALTGVQGDAQNSA-GIVR---KD  469

Query  1773  TKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPAR  1952
              KV  ++T +V+LE K  ++E +I++LEGELREAAAVE  L+SVVAEHGSS +KVHAPAR
Sbjct  470   AKVYPRDTRSVILESKIHQMEHRIKLLEGELREAAAVEAALYSVVAEHGSSMSKVHAPAR  529

Query  1953  RLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF  2132
             RLSRLY HACKE+   RR SAA+S+VSG++LVAKACGNDVPRLT+WLSN ++LR  I + 
Sbjct  530   RLSRLYLHACKESPHSRRASAAKSIVSGIVLVAKACGNDVPRLTYWLSNSIVLRTIISQV  589

Query  2133  SEKQQLPLSSEYS--KNAV--VKNERKASPLKWQSFPHKKSVG-NDLPGTFEDWENPLGF  2297
               + + P+ +  S  +N    +KN   +SP+KW++    K  G   L G+  D ENP  F
Sbjct  590   IGESESPMXAXPSIDRNGAGKIKN-NVSSPIKWKASSSGKKEGLKLLNGSXGDCENPQTF  648

Query  2298  TKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSL----DSEINKIYQRTSSSCSEEPE  2465
                LEK+E+WIFSRI+ES WWQT TPHMQ   A  +    DS  +K Y+RTSSS  +E  
Sbjct  649   MSTLEKIESWIFSRIVESXWWQTLTPHMQPVVAKXISEGADSGSSKNYKRTSSSVDQEQS  708

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESAD  2645
               SLELWK AFRDA ER+CPVRA GHECGCL LL++L+M+Q VARLDVAMFNAILRES+D
Sbjct  709   XXSLELWKXAFRDACERLCPVRAEGHECGCLPLLARLVMEQSVARLDVAMFNAILRESSD  768

Query  2646  DIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlve  2825
             +IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLK+AIGNWSRWL DLFGIDDDD       
Sbjct  769   EIPTDPVSDPISDLKVLPIPAGKSSFGVGAQLKSAIGNWSRWLTDLFGIDDDDSL-----  823

Query  2826  ddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLIT  3005
                 +  N +    + QD   K F+LLNA+SDLMMLPKD+LLS+++RKEVCP F   LI 
Sbjct  824   ----EDVNDDXDNDERQDTSFKSFHLLNALSDLMMLPKDLLLSKSIRKEVCPAFSAPLIK  879

Query  3006  RVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgi  3185
             R+L+ F+PDEFC DPIP VVL+AL SED +E  EE+V N PC+ A  VY PP   A    
Sbjct  880   RILDTFVPDEFCTDPIPGVVLQALESEDILEAGEEAVTNVPCTGAGTVYXPP-LTASVAS  938

Query  3186  lgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSE----VTKPg-ggsgn  3350
             +     S SQL RS SSVL+KSYTSDDELDEL+SPL  I +++S     +TKP      N
Sbjct  939   IIGEVXSQSQLRRSGSSVLRKSYTSDDELDELNSPLASIFIDSSRSSPVLTKPCWISKRN  998

Query  3351  gngngVRYQLLREVWMSSE  3407
             GN    RY+LLREVWM+SE
Sbjct  999   GNQTSXRYELLREVWMNSE  1017


 Score =   206 bits (525),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 150/200 (75%), Gaps = 5/200 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K     +V+ +YLI+I +IKPWPPSQSL++L++V+IQWE+GD+NSG+T+ V P
Sbjct  1    MGLGVKAKNHRGSTVRIDYLIHIQDIKPWPPSQSLRSLRSVLIQWENGDRNSGATSPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNG--DTFQKNCIEFNLYEPRRDTTVK  518
             +   S VG G+IEFN+SFR+P+TLLR++S K   G  DTFQKN +E +LYEPRRD   K
Sbjct  61   SIG--SVVGEGKIEFNQSFRLPVTLLRDMSVKGGGGGGDTFQKNLLELHLYEPRRDNP-K  117

Query  519  GQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNN  698
            GQLL TA++D A++G+VKE ++VS P+N  RS+RNT QP+L +KIQ V KGR  S  R +
Sbjct  118  GQLLATAIVDLADHGIVKETISVSAPMNSTRSFRNTDQPVLYIKIQPVVKGRTSSSSRGS  177

Query  699  VRRESSMDSSAGESVSALMN  758
            + R  S+D++  ESVSALMN
Sbjct  178  LSRGVSLDNAGSESVSALMN  197



>gb|KDO55629.1| hypothetical protein CISIN_1g001323mg [Citrus sinensis]
Length=992

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/566 (58%), Positives = 401/566 (71%), Gaps = 30/566 (5%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEG-EPVNSCLQDNTTKQHLEGNSAIIAGRE---S  1610
             + V  R + ++ G  +E I EKG+ S G EP+N C ++ T  Q   G+ +    RE   +
Sbjct  435   DFVKYRMEQEDNGLERE-IFEKGRHSAGDEPLNFCSRNATRNQVSLGSDSPSPIREDPVN  493

Query  1611  VGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQ--FVLRDKRNSIEGITSNDWKDTK  1778
              G K      +RL +V SV +  +  R+NG+ +  +   VL D  N      S + KD K
Sbjct  494   FGTKRNLLKSDRLKNVRSVRSSSDIARSNGNQKEAKENGVLGDAPNRAGSFGSPERKDYK  553

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
             V  ++T + V E K Q+LE KI MLE ELREAAA+E  L+SVVAEHGSS +KVHAPARRL
Sbjct  554   VYPRDTRSAVAESKIQQLEHKINMLETELREAAAIEASLYSVVAEHGSSMSKVHAPARRL  613

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSE  2138
             SRLY HACKE+   RR SAARS VSGL+LVAKACGNDVPRLTFWLSN ++LRA I + + 
Sbjct  614   SRLYLHACKEDFQSRRASAARSAVSGLVLVAKACGNDVPRLTFWLSNSIVLRAIISQATG  673

Query  2139  KQQLPLSSEYS--KNAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKA  2306
             + + P ++  S  +N+  + N    SPLKW +S   KK   N + G+F+DWE+P     A
Sbjct  674   RLEQPFAAGQSLERNSSQRGNNNITSPLKWKESASRKKDNRNVMRGSFDDWEDPHTLPSA  733

Query  2307  LEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFS  2474
             LEKVEAWIFSRI+ESIWWQT TPHMQS A   +D +I     K  +RTSSS  +E  NFS
Sbjct  734   LEKVEAWIFSRIVESIWWQTLTPHMQSAAERVMDRDIGSCSRKNLERTSSSGDQEQINFS  793

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L+ WKKAF+DA ER+CPVRA GHECGCL LL++LIM+QCVARLDVAMFNAILRESAD+IP
Sbjct  794   LDHWKKAFKDACERLCPVRARGHECGCLPLLARLIMEQCVARLDVAMFNAILRESADEIP  853

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDPVSDPIS+ +VLPIPAGK+SF AGAQLKNAIGNWSRWL+DLFG+           DD+
Sbjct  854   TDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAIGNWSRWLSDLFGM-----------DDD  902

Query  2835  NKADNSNGHER--KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITR  3008
             +  DN N H+   + QD+  K F+LLNA+SDLMMLPKD+LLSR++RKEVCPTFG  LI R
Sbjct  903   DSLDNENEHDADDERQDSSFKSFHLLNALSDLMMLPKDLLLSRSIRKEVCPTFGAPLIKR  962

Query  3009  VLNVFIPDEFCPDPIPNVVLEALNSE  3086
             VL+ F PDEFCPDPIP VVLEAL+SE
Sbjct  963   VLDNFCPDEFCPDPIPRVVLEALDSE  988


 Score =   231 bits (588),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   S+  +Y I+I +IKPWPPSQSL++L++V+IQW++GD+NSGST  V P
Sbjct  1    MVLGLSAKNRKEASIHVDYQIHIQDIKPWPPSQSLRSLRSVMIQWQNGDRNSGSTKTVGP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESFR+ +TLLR+++ K+ + DTF KNC+EFNLYEPRRD T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFRLRVTLLRDMNVKNKDADTFLKNCLEFNLYEPRRDKT---Q  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK--GRMKSLVRNN  698
            LL TA ID A+YG+VKE L+V+ P+N KRS+RNT QP+L +KIQ   K   R  S +R  
Sbjct  116  LLATATIDLADYGIVKETLSVNAPMNSKRSFRNTAQPVLFIKIQPAEKSVSRTSSSLREG  175

Query  699  VRRESSMDSSAGESVSALMN  758
              RE+S+D + GESVSALMN
Sbjct  176  FSREASLDKNGGESVSALMN  195



>ref|XP_009371670.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103960905 
[Pyrus x bretschneideri]
Length=1001

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/735 (50%), Positives = 472/735 (64%), Gaps = 66/735 (9%)
 Frame = +3

Query  1287  NSNNSVGHIIKADIDESFSTLS-NGIQEDARTGVSDNG---LAEGENTEGHQG-------  1433
             NS +S+  I+K    E+  + S NG  +D+ + +  NG   LA   N +   G       
Sbjct  305   NSPSSISRILKTVGAEASPSASFNGKAKDSNSSMGSNGHDHLAHDVNDKVVDGRGCLEAA  364

Query  1434  ---NTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGR  1604
                ++     ER + +E G+G++   E+    E E  +S + +   K+   G    +   
Sbjct  365   VSDDSSTEDNERKQQEENGDGRQSFDEEKHSWERE--SSIVHEANGKEIPIGTKENMKHV  422

Query  1605  ESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVR  1784
             +SV  ++  D   N ++ +   GE+    G VR                     KD KV 
Sbjct  423   KSV--RSPIDLAKNALTGIQ--GEAQNGTGIVR---------------------KDAKVY  457

Query  1785  SKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSR  1964
              +++ +V+LE K  ++E +I++LEGELREAAAVE  L+SVVAEHGSS +K+HAPARRLSR
Sbjct  458   PRDSRSVILESKIHQMENRIKLLEGELREAAAVEAALYSVVAEHGSSISKLHAPARRLSR  517

Query  1965  LYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQ  2144
             LY HACKE+S  RR SAA S+VSGL+LVAKACGNDVPRLT+WLSN ++LR  + + + + 
Sbjct  518   LYLHACKESSHSRRASAAXSIVSGLVLVAKACGNDVPRLTYWLSNSIVLRTIVSQVAGES  577

Query  2145  QLPL----SSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDL-PGTFEDWENPLGFTKAL  2309
             +LP+    S + +    VKN + +S +KW++    K  G  L  G+F D EN   F   L
Sbjct  578   KLPMLAGPSIDRNGAGKVKN-KVSSSIKWKAPSSGKKEGMKLLNGSFGDCENLQTFMSTL  636

Query  2310  EKVEAWIFSRIIESIWWQTFTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSL  2477
             EK+E+WIFSRI+ESIWWQT TPHMQS A  +     +S   K Y+RTSSS  +E  NFSL
Sbjct  637   EKIESWIFSRIVESIWWQTLTPHMQSVAVKANSEGANSGSRKNYKRTSSSIDQEQINFSL  696

Query  2478  ELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPT  2657
             +LWKKAFRDA ER+CPVRA GHECGCL LL++L+M+Q VARLDVAMFNAILRES+D+IPT
Sbjct  697   DLWKKAFRDACERLCPVRAEGHECGCLPLLARLVMEQSVARLDVAMFNAILRESSDEIPT  756

Query  2658  DPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeN  2837
             DPVSDPIS+ +VLPIPAGK+SF AGA LK+AIGNWSRWL DLFG+DDDD           
Sbjct  757   DPVSDPISDLKVLPIPAGKSSFGAGALLKSAIGNWSRWLTDLFGMDDDDSL---------  807

Query  2838  KADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLN  3017
             +  N +    + QD   K F+LLNA+SDLMMLPKD+LLS+ +RKEVCP F   LI R+L+
Sbjct  808   EDVNDDDDNDERQDKSFKSFHLLNALSDLMMLPKDLLLSKAIRKEVCPAFSAPLIKRILD  867

Query  3018  VFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdi  3197
              F+PDEFC DPIP VVL+AL SED +E  E++V N P + A  VY PPS A+    +   
Sbjct  868   TFVPDEFCTDPIPGVVLQALESEDALEAGEDTVTNVPYTGAGTVYLPPSTAS-VASIIGE  926

Query  3198  sssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSE----VTKPgggsg-ngngn  3362
                 SQL RS SSVL+KSYTSDDELDEL+SPL  I +++S      TKP   S  NGN  
Sbjct  927   VGGQSQLRRSGSSVLRKSYTSDDELDELNSPLASIFIDSSRSSPVATKPSRASNGNGNQT  986

Query  3363  gVRYQLLREVWMSSE  3407
              VRY LLREVW +SE
Sbjct  987   AVRYVLLREVWTNSE  1001


 Score =   208 bits (530),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 148/199 (74%), Gaps = 4/199 (2%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K+R   +VQ  Y I+I +IKPWPPSQSL++L+ V+IQWE+GD+NSG+T+ V P
Sbjct  1    MGLGVKAKSRRGSTVQIGYHIHIQDIKPWPPSQSLRSLRTVLIQWENGDRNSGTTSPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNG-DTFQKNCIEFNLYEPRRDTTVKG  521
             +   S VG G+I FN+SFR+P+TLLR++S K   G DTFQKN +E +LYEPRRD   KG
Sbjct  61   SIG--SIVGEGKIVFNQSFRLPVTLLRDMSVKGGGGGDTFQKNLLELHLYEPRRDNP-KG  117

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
            QLL TA ID A++G+VKE ++V+ P+N KRSYRNT QP+L +KIQ V KGR  S  R ++
Sbjct  118  QLLATATIDLADHGIVKETISVTAPMNSKRSYRNTDQPVLYVKIQPVVKGRTSSSSRGSL  177

Query  702  RRESSMDSSAGESVSALMN  758
             R  S+D++  ESVSALMN
Sbjct  178  SRGVSLDNAGSESVSALMN  196



>ref|XP_007031807.1| F28J7.14 protein, putative isoform 2 [Theobroma cacao]
 gb|EOY02733.1| F28J7.14 protein, putative isoform 2 [Theobroma cacao]
Length=985

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 379/555 (68%), Gaps = 36/555 (6%)
 Frame = +3

Query  1473  ETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHV  1652
             E G   +   +K   +E EP+N    DN+  Q   GN   I     +       +RL HV
Sbjct  444   ENGHEGQYGEDKRYSTEDEPLNIHSPDNSLSQ---GNLGTIGNVLKI-------DRLKHV  493

Query  1653  SSVHTLGESNRANGSVRSNQF-------VLRDKRN---SIEGITSNDWKDTKVRSKETSN  1802
              SV +  +S R+NG   +NQ        VL D  +   +    + N+ KD KV  K+T +
Sbjct  494   KSVRSSSDSVRSNGLSTNNQHAELKEVGVLGDAPHGGGTFRSKSGNERKDAKVYPKDTRS  553

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
              +L+ K Q+LE KI+MLEGELREAAAVE  L+SVVAEHGSS  KVHAPARRLSRLY HA 
Sbjct  554   AILDNKVQQLELKIKMLEGELREAAAVEAALYSVVAEHGSSMCKVHAPARRLSRLYLHAF  613

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             KE    R  SAARS VSGL LVAKACGNDVPRLTFWLSN V+LRA I +     +LP+S+
Sbjct  614   KEGIQSRGASAARSAVSGLALVAKACGNDVPRLTFWLSNSVVLRAIISESIGDSELPISA  673

Query  2163  EYSK--NAVVKNERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
                +     +  ++ +SPLKW +S   +K     L G+  DW+NP  FT ALE+VEAWIF
Sbjct  674   GPMERIGGGMGKKQVSSPLKWKESSSRRKENKLILYGSSSDWDNPHAFTSALERVEAWIF  733

Query  2334  SRIIESIWWQTFTPHMQSGAATSLD----SEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             SRIIES+WWQT TPHMQS     +D    S  +K Y R SSS  E+  NFSL+ WKKAF+
Sbjct  734   SRIIESVWWQTLTPHMQSADRKEIDRGMGSGSSKSYGRVSSSSDEDQMNFSLDHWKKAFK  793

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA ER+CPVRA GHECGCL LLS+LIM+QCVARLDVAMFNAILR+S D+IPTDPVSDPIS
Sbjct  794   DACERLCPVRAAGHECGCLRLLSRLIMEQCVARLDVAMFNAILRDSGDEIPTDPVSDPIS  853

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             NP VLPIP+GK SF AGAQLKNAIGNWSRWL DLFGI       D  +   ++ D  +  
Sbjct  854   NPLVLPIPSGKTSFGAGAQLKNAIGNWSRWLTDLFGI-------DDDDSVGDENDQDDSD  906

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             ER  QD   K F+LLNA+SDLMMLPKDMLLSR +R+EVCPTFG SLI RVL+ ++PDEFC
Sbjct  907   ER--QDTSLKSFHLLNALSDLMMLPKDMLLSRPIREEVCPTFGASLIKRVLDNYVPDEFC  964

Query  3042  PDPIPNVVLEALNSE  3086
             PDP+P+VVLEAL SE
Sbjct  965   PDPVPDVVLEALESE  979


 Score =   217 bits (553),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 147/198 (74%), Gaps = 5/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R  P+V  +YLI+I EIKPWPPSQSL++L++V+IQWE+G+++SGST  V+P
Sbjct  1    MVLGLSAKNRRGPTVHVDYLIHIQEIKPWPPSQSLRSLRSVLIQWENGERSSGSTNTVSP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S VG G+IEFNESF++P+ L+R++S K  + D FQKN +EFNLYEPRRD   K Q
Sbjct  61   TLG--SIVGEGKIEFNESFKLPVNLVRDLSVKGRDADVFQKNSLEFNLYEPRRD---KIQ  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA++D A YG +KE L+++VP+N KRS+ NT QP+L +KI  + KGR  S  R+ + 
Sbjct  116  LLATAIVDLAEYGAIKETLDITVPMNSKRSFSNTAQPILFIKIDRIYKGRNSSSSRSGLS  175

Query  705  RESSMDSSAGESVSALMN  758
             E S+D    ESVSALM+
Sbjct  176  EEQSLDRKGSESVSALMD  193



>gb|KHG27738.1| hypothetical protein F383_11185 [Gossypium arboreum]
Length=1689

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/562 (60%), Positives = 407/562 (72%), Gaps = 31/562 (6%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             +SN+ K +KV  K+T +V+L+ K Q+LE KI+MLEGELREAAA E  L+SVVAEHGSS +
Sbjct  1149  SSNERKGSKVYPKDTRSVILDNKVQQLENKIKMLEGELREAAATEAALYSVVAEHGSSMS  1208

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             KVHAPARRLSRLY HACKE S LRR SAA+S VSGL LV KACGNDVPRL FWLSNCV+L
Sbjct  1209  KVHAPARRLSRLYLHACKEGSELRRGSAAKSAVSGLALVVKACGNDVPRLMFWLSNCVVL  1268

Query  2112  RAAICKFSEKQQLPLSSEYSKNAVVKNERKASP-LKWQSFPHKKSVGNDLPGTFEDWENP  2288
             RA I + +  +         +N V K +++ASP LKW+    + S G     +F DW+NP
Sbjct  1269  RAIISESTVGRT-------ERNGVGKGKKQASPPLKWR----ESSPGRKENKSFSDWDNP  1317

Query  2289  LGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD----SEINKIYQRTSSSCSE  2456
             L FT ALE+VE WIFSRIIES+WWQ  TPHMQS     +     S  +K Y    SS ++
Sbjct  1318  LAFTSALERVETWIFSRIIESVWWQALTPHMQSAGKKEIYEGKVSGSSKSYGTIPSSSNQ  1377

Query  2457  EPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRE  2636
             +  NFSL+ WKKAF+DA ER+CPVRA GHECGCL LLSKLIM+QCVARLDVAMFNAILR+
Sbjct  1378  DQVNFSLDHWKKAFKDACERLCPVRAAGHECGCLCLLSKLIMEQCVARLDVAMFNAILRD  1437

Query  2637  SADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddeddd  2816
             S D+IPTDPVSDPIS+  VLPIPAGK SF AGAQLKNAIGNWSRWL DLFGIDDDD   D
Sbjct  1438  SGDEIPTDPVSDPISDTLVLPIPAGKTSFGAGAQLKNAIGNWSRWLTDLFGIDDDDLVGD  1497

Query  2817  lveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLS  2996
               + D+N            Q    K F LLNA+SDLMMLPKDMLLS+ +R+EVCPTF  +
Sbjct  1498  ENDRDDNDEQ---------QITSLKSFNLLNALSDLMMLPKDMLLSKHIREEVCPTFAAT  1548

Query  2997  LITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAl  3176
             LI +VL+ F+PDEFCPDP+PN VLEAL +ED +E  + S+ NFPC A+  VY+ PSA + 
Sbjct  1549  LIKKVLDTFVPDEFCPDPVPNAVLEALEAEDPLEARKGSITNFPCVASLPVYSSPSATS-  1607

Query  3177  dgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKME---NSEV-TKPgggs  3344
                +     S SQL RS SSVL+KS+TSDDELDEL+SPL  I ++   +S V +KP   S
Sbjct  1608  VASIIGEVVSKSQLRRSGSSVLRKSHTSDDELDELNSPLASIFIDGFLSSPVQSKPNRIS  1667

Query  3345  g-ngngngVRYQLLREVWMSSE  3407
               N N   +RY+LLR+VWM+SE
Sbjct  1668  KGNSNQRAIRYKLLRDVWMNSE  1689


 Score =   215 bits (548),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +3

Query  141  DYCGVLAAMVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNS  320
            D   + A MVLG + K R  P+V+ +YLI+I EIKPWPPSQSL++L++V+IQWE+ ++NS
Sbjct  723  DSTSISATMVLGLNAKNRRGPTVRVDYLIHIQEIKPWPPSQSLRSLRSVLIQWENSERNS  782

Query  321  GSTTQVAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPR  500
            GST   +P L   S VG G+IEFNESF++P+ L+R++S K  + D F KN +EFNLYEPR
Sbjct  783  GSTKTTSPTL--GSIVGEGKIEFNESFKLPVNLVRDLSVKGRDVDMFHKNFLEFNLYEPR  840

Query  501  RDTTVKGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMK  680
            R+   K QLL TA++D A YGV+KE L ++VP+N KRSY NT QP+L +KI  + KG+  
Sbjct  841  RE---KIQLLATAIVDLAEYGVIKEPLEITVPMNSKRSYSNTTQPMLLIKIDRISKGQNI  897

Query  681  SLVRNNVRRESSMDSSAGESVSALMN  758
            S  R+ + +E   D    ESVS+LM+
Sbjct  898  SSSRSGLSKELFQDKKGSESVSSLMD  923



>ref|XP_008379132.1| PREDICTED: uncharacterized protein LOC103442151 isoform X3 [Malus 
domestica]
Length=964

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/656 (50%), Positives = 418/656 (64%), Gaps = 42/656 (6%)
 Frame = +3

Query  1257  GSLVN----IDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNG---LAEGEN  1415
             GS VN    + ++ NSN+ +   + A+   S S   NG  ED+ + +  NG   LA   N
Sbjct  305   GSPVNGNASVANSPNSNSRILKTVGAETLPSPSASFNGKAEDSNSSMRSNGHKHLAHEVN  364

Query  1416  TEGHQG-NTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAI  1592
              +   G    E     D +  + +  E     G+  E E  +     +  K   EG S+I
Sbjct  365   DKAVDGRGCLEAAVSBDSYDSSAKDNE-----GKQQE-ENRHERQSFDEEKHSREGESSI  418

Query  1593  IAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKD  1772
                           E   HV SV +  +S +      +   V  D +NS  GI     KD
Sbjct  419   AHEANGKQVPIGMKENTKHVKSVRSXXDSXK-----NALTGVQGDAQNSA-GIVR---KD  469

Query  1773  TKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPAR  1952
              KV  ++T +V+LE K  ++E +I++LEGELREAAAVE  L+SVVAEHGSS +KVHAPAR
Sbjct  470   AKVYPRDTRSVILESKIHQMEHRIKLLEGELREAAAVEAALYSVVAEHGSSMSKVHAPAR  529

Query  1953  RLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF  2132
             RLSRLY HACKE+   RR SAA+S+VSG++LVAKACGNDVPRLT+WLSN ++LR  I + 
Sbjct  530   RLSRLYLHACKESPHSRRASAAKSIVSGIVLVAKACGNDVPRLTYWLSNSIVLRTIISQV  589

Query  2133  SEKQQLPLSSEYS--KNAV--VKNERKASPLKWQSFPHKKSVG-NDLPGTFEDWENPLGF  2297
               + + P+ +  S  +N    +KN   +SP+KW++    K  G   L G+  D ENP  F
Sbjct  590   IGESESPMXAXPSIDRNGAGKIKN-NVSSPIKWKASSSGKKEGLKLLNGSXGDCENPQTF  648

Query  2298  TKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSL----DSEINKIYQRTSSSCSEEPE  2465
                LEK+E+WIFSRI+ES WWQT TPHMQ   A  +    DS  +K Y+RTSSS  +E  
Sbjct  649   MSTLEKIESWIFSRIVESXWWQTLTPHMQPVVAKXISEGADSGSSKNYKRTSSSVDQEQS  708

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESAD  2645
               SLELWK AFRDA ER+CPVRA GHECGCL LL++L+M+Q VARLDVAMFNAILRES+D
Sbjct  709   XXSLELWKXAFRDACERLCPVRAEGHECGCLPLLARLVMEQSVARLDVAMFNAILRESSD  768

Query  2646  DIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlve  2825
             +IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLK+AIGNWSRWL DLFGIDDDD       
Sbjct  769   EIPTDPVSDPISDLKVLPIPAGKSSFGVGAQLKSAIGNWSRWLTDLFGIDDDDSL-----  823

Query  2826  ddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLIT  3005
                 +  N +    + QD   K F+LLNA+SDLMMLPKD+LLS+++RKEVCP F   LI 
Sbjct  824   ----EDVNDDXDNDERQDTSFKSFHLLNALSDLMMLPKDLLLSKSIRKEVCPAFSAPLIK  879

Query  3006  RVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAA  3173
             R+L+ F+PDEFC DPIP VVL+AL SED +E  EE+V N PC+ A  VY PPS A+
Sbjct  880   RILDTFVPDEFCTDPIPGVVLQALESEDILEAGEEAVTNVPCTGAGTVYLPPSTAS  935


 Score =   207 bits (526),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 150/200 (75%), Gaps = 5/200 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M LG   K     +V+ +YLI+I +IKPWPPSQSL++L++V+IQWE+GD+NSG+T+ V P
Sbjct  1    MGLGVKAKNHRGSTVRIDYLIHIQDIKPWPPSQSLRSLRSVLIQWENGDRNSGATSPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNG--DTFQKNCIEFNLYEPRRDTTVK  518
             +   S VG G+IEFN+SFR+P+TLLR++S K   G  DTFQKN +E +LYEPRRD   K
Sbjct  61   SIG--SVVGEGKIEFNQSFRLPVTLLRDMSVKGGGGGGDTFQKNLLELHLYEPRRDNP-K  117

Query  519  GQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNN  698
            GQLL TA++D A++G+VKE ++VS P+N  RS+RNT QP+L +KIQ V KGR  S  R +
Sbjct  118  GQLLATAIVDLADHGIVKETISVSAPMNSTRSFRNTDQPVLYIKIQPVVKGRTSSSSRGS  177

Query  699  VRRESSMDSSAGESVSALMN  758
            + R  S+D++  ESVSALMN
Sbjct  178  LSRGVSLDNAGSESVSALMN  197



>gb|KHG27739.1| hypothetical protein F383_11185 [Gossypium arboreum]
Length=1730

 Score =   589 bits (1519),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 339/562 (60%), Positives = 407/562 (72%), Gaps = 31/562 (6%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             +SN+ K +KV  K+T +V+L+ K Q+LE KI+MLEGELREAAA E  L+SVVAEHGSS +
Sbjct  1190  SSNERKGSKVYPKDTRSVILDNKVQQLENKIKMLEGELREAAATEAALYSVVAEHGSSMS  1249

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             KVHAPARRLSRLY HACKE S LRR SAA+S VSGL LV KACGNDVPRL FWLSNCV+L
Sbjct  1250  KVHAPARRLSRLYLHACKEGSELRRGSAAKSAVSGLALVVKACGNDVPRLMFWLSNCVVL  1309

Query  2112  RAAICKFSEKQQLPLSSEYSKNAVVKNERKASP-LKWQSFPHKKSVGNDLPGTFEDWENP  2288
             RA I + +  +         +N V K +++ASP LKW+    + S G     +F DW+NP
Sbjct  1310  RAIISESTVGRT-------ERNGVGKGKKQASPPLKWR----ESSPGRKENKSFSDWDNP  1358

Query  2289  LGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD----SEINKIYQRTSSSCSE  2456
             L FT ALE+VE WIFSRIIES+WWQ  TPHMQS     +     S  +K Y    SS ++
Sbjct  1359  LAFTSALERVETWIFSRIIESVWWQALTPHMQSAGKKEIYEGKVSGSSKSYGTIPSSSNQ  1418

Query  2457  EPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRE  2636
             +  NFSL+ WKKAF+DA ER+CPVRA GHECGCL LLSKLIM+QCVARLDVAMFNAILR+
Sbjct  1419  DQVNFSLDHWKKAFKDACERLCPVRAAGHECGCLCLLSKLIMEQCVARLDVAMFNAILRD  1478

Query  2637  SADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddeddd  2816
             S D+IPTDPVSDPIS+  VLPIPAGK SF AGAQLKNAIGNWSRWL DLFGIDDDD   D
Sbjct  1479  SGDEIPTDPVSDPISDTLVLPIPAGKTSFGAGAQLKNAIGNWSRWLTDLFGIDDDDLVGD  1538

Query  2817  lveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLS  2996
               + D+N            Q    K F LLNA+SDLMMLPKDMLLS+ +R+EVCPTF  +
Sbjct  1539  ENDRDDNDEQ---------QITSLKSFNLLNALSDLMMLPKDMLLSKHIREEVCPTFAAT  1589

Query  2997  LITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAl  3176
             LI +VL+ F+PDEFCPDP+PN VLEAL +ED +E  + S+ NFPC A+  VY+ PSA + 
Sbjct  1590  LIKKVLDTFVPDEFCPDPVPNAVLEALEAEDPLEARKGSITNFPCVASLPVYSSPSATS-  1648

Query  3177  dgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKME---NSEV-TKPgggs  3344
                +     S SQL RS SSVL+KS+TSDDELDEL+SPL  I ++   +S V +KP   S
Sbjct  1649  VASIIGEVVSKSQLRRSGSSVLRKSHTSDDELDELNSPLASIFIDGFLSSPVQSKPNRIS  1708

Query  3345  g-ngngngVRYQLLREVWMSSE  3407
               N N   +RY+LLR+VWM+SE
Sbjct  1709  KGNSNQRAIRYKLLRDVWMNSE  1730


 Score =   215 bits (548),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = +3

Query  141  DYCGVLAAMVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNS  320
            D   + A MVLG + K R  P+V+ +YLI+I EIKPWPPSQSL++L++V+IQWE+ ++NS
Sbjct  764  DSTSISATMVLGLNAKNRRGPTVRVDYLIHIQEIKPWPPSQSLRSLRSVLIQWENSERNS  823

Query  321  GSTTQVAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPR  500
            GST   +P L   S VG G+IEFNESF++P+ L+R++S K  + D F KN +EFNLYEPR
Sbjct  824  GSTKTTSPTL--GSIVGEGKIEFNESFKLPVNLVRDLSVKGRDVDMFHKNFLEFNLYEPR  881

Query  501  RDTTVKGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMK  680
            R+   K QLL TA++D A YGV+KE L ++VP+N KRSY NT QP+L +KI  + KG+  
Sbjct  882  RE---KIQLLATAIVDLAEYGVIKEPLEITVPMNSKRSYSNTTQPMLLIKIDRISKGQNI  938

Query  681  SLVRNNVRRESSMDSSAGESVSALMN  758
            S  R+ + +E   D    ESVS+LM+
Sbjct  939  SSSRSGLSKELFQDKKGSESVSSLMD  964



>ref|XP_004513997.1| PREDICTED: uncharacterized protein LOC101491530 [Cicer arietinum]
Length=997

 Score =   569 bits (1467),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 341/635 (54%), Positives = 428/635 (67%), Gaps = 54/635 (9%)
 Frame = +3

Query  1563  KQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSI  1742
             + HLE NS             +  ER  +V SV + G+  R+ GS   N +    K N I
Sbjct  397   QNHLEDNSV-------TQGNISKSERSKYVKSVRSSGDLARSIGSHGKNYYA-EVKENGI  448

Query  1743  EG--------ITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLF  1898
              G        I S++ KD K+  ++    VL+ K + LE KI+MLEGELREAA+VE  L+
Sbjct  449   NGDAQNNGGNIRSSERKDVKIYPRDARTTVLDSKIEHLENKIKMLEGELREAASVEAALY  508

Query  1899  SVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPR  2078
             SV AEHGSS +KVHAPARRLSRLYFHACKEN   RR  AA+S VSGL LVAKACGNDVPR
Sbjct  509   SVAAEHGSSMSKVHAPARRLSRLYFHACKENIPARRSGAAKSAVSGLALVAKACGNDVPR  568

Query  2079  LTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVK-----NERKASPLKWQSFPHK-K  2240
             LTFWLSN ++LR  I + + K+  P  S  S+N+  +     N +   PL W+ F  K +
Sbjct  569   LTFWLSNSIVLRTIISQ-TTKEVTP--SNPSQNSARRKSGEGNGKTVQPLTWKGFSKKSE  625

Query  2241  SVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             ++ N+  G F +W++P  F  ALEKVEAWIFSRI+ESIWWQ+ TPHMQ      +D++I 
Sbjct  626   NIANEY-GGFRNWDDPNVFASALEKVEAWIFSRIVESIWWQSLTPHMQL-----VDAKI-  678

Query  2421  KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVAR  2600
                   +SS  +E  N SL++WK AFR++ ERICPVRA GHECGCL +L +L+M+QC+AR
Sbjct  679   ------TSSHDQELGNLSLDIWKNAFRESCERICPVRAEGHECGCLSVLPRLVMEQCIAR  732

Query  2601  LDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLAD  2780
             LDVAMFNAILRESADDIP+DP+SDPIS P+ LPIP GK+SF AGA+LK  +GNWSRWL D
Sbjct  733   LDVAMFNAILRESADDIPSDPISDPISEPKALPIPPGKSSFGAGARLKTVVGNWSRWLTD  792

Query  2781  LFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRT  2960
             LFGIDDDD   D  +D +N  +NS+           K F+LLNA+SDL+MLPKDMLLS +
Sbjct  793   LFGIDDDDSLKDKDDDIDNNDENSS----------FKAFHLLNALSDLLMLPKDMLLSAS  842

Query  2961  VRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAA  3140
             +RKEVC  FG S+I ++L+ F+PDEFCP+PIP  V +AL+S+D +E   ESV +FPC AA
Sbjct  843   IRKEVCLMFGASIIKKILDNFVPDEFCPEPIPTAVFDALDSQDDLEDGNESVNHFPCIAA  902

Query  3141  PIVYAPPSAA--AldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMEN  3314
             PIVY+PP A   A         S  SQL RSRSSV++KSYTSDDELDEL+SPL+ I   N
Sbjct  903   PIVYSPPQATTIANIVGEIRGESKLSQLRRSRSSVVRKSYTSDDELDELNSPLSSILFSN  962

Query  3315  --SEVT-KPg-ggsgngngngVRYQLLREVWMSSE  3407
               S V+ KP      + N   VRY+LLR VW+ SE
Sbjct  963   FPSLVSAKPNLNRKESRNEYAVRYELLRNVWVHSE  997


 Score =   216 bits (549),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 150/189 (79%), Gaps = 5/189 (3%)
 Frame = +3

Query  192  RGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVG  371
            R    VQ +YLI+I E+KPWPPSQSL+++++V+IQWE+G+++SGST  V+P L   S +G
Sbjct  7    RSTGMVQLDYLIHIHELKPWPPSQSLRSIRSVLIQWENGERSSGSTKLVSPSLG--SLIG  64

Query  372  NGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDF  551
             G+IEFNESFR+ +TL++++S K+ + + FQKN +EFNLYEPRRD  VKGQLLG+A+ID 
Sbjct  65   EGKIEFNESFRLSVTLVKDMSVKNSDAEVFQKNVLEFNLYEPRRDKIVKGQLLGSAIIDL  124

Query  552  ANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDSSA  731
            A+ G+ +E L+++VP+NCKR+YRNT QPLL ++I+ V K R +S+++ ++    S ++ +
Sbjct  125  ADGGIARETLSIAVPLNCKRNYRNTDQPLLFVRIEPVEKSRSRSMLKESLL---SKENGS  181

Query  732  GESVSALMN  758
            G+SVSALMN
Sbjct  182  GDSVSALMN  190



>ref|XP_010248936.1| PREDICTED: uncharacterized protein LOC104591675 isoform X4 [Nelumbo 
nucifera]
 ref|XP_010248938.1| PREDICTED: uncharacterized protein LOC104591675 isoform X4 [Nelumbo 
nucifera]
Length=851

 Score =   564 bits (1453),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 335/643 (52%), Positives = 416/643 (65%), Gaps = 48/643 (7%)
 Frame = +3

Query  1548  QDNTTKQHLEGNSAIIAGRESVGAK--TTCDERLNHVSSVHTLGESNRANGSVRSNQF--  1715
             QD   KQ   G S I      +G +  +    RL HV SV +  +++R N  +  NQ   
Sbjct  226   QDAMRKQVAFGTSPIAFDSRDLGVRDNSLTVSRLKHVKSVRSPVDTSRNNELLYGNQLTE  285

Query  1716  ---------VLRDKRNSIEGITSNDWKDT-KVRSKETSNVVLERKCQELEQKIQMLEGEL  1865
                      ++   R+SI    SND +D   V+     NV    K Q+LE +++ LE EL
Sbjct  286   VKEVDVSEDIVSSSRSSITA-ESNDAQDACTVKLNCHYNV----KVQQLEHRVESLEREL  340

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             REAAAVE+GL+SVVAEHGSS NKVHAPARRLSRLY HAC++ S   R +AARS VSGL+L
Sbjct  341   REAAAVEVGLYSVVAEHGSSANKVHAPARRLSRLYHHACRKQSPGHRATAARSAVSGLVL  400

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSE---YSKNAVVKNERKASPLK  2216
             VAKACGND+PRLTFWLSN V+LR  I +   + QL + +     +    + NE+K SPLK
Sbjct  401   VAKACGNDIPRLTFWLSNSVVLREIISQVVGESQLSICAGPQIEANGGKMGNEKKYSPLK  460

Query  2217  WQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAA  2396
             W      K         F++WE+P  F  ALEKVEAWIFSRIIES+WWQT TP+MQS   
Sbjct  461   WNESSLNKKEKFVFSNDFDEWEDPQTFVTALEKVEAWIFSRIIESVWWQTLTPYMQSATR  520

Query  2397  TSLDSEINKIYQRTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSK  2573
                D    K+    S S  ++ + NFSL LWK+AFRDA E++CPVRAGGHECGCL +L++
Sbjct  521   IGND----KVMVSNSGSLGDQEQGNFSLHLWKEAFRDACEKLCPVRAGGHECGCLPVLAR  576

Query  2574  LIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAI  2753
             L+M+QC+ RLDVA+FNAILRESAD+IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLKNAI
Sbjct  577   LVMEQCMNRLDVALFNAILRESADEIPTDPVSDPISDSKVLPIPAGKSSFGNGAQLKNAI  636

Query  2754  GNWSRWLADLFGIddddedddlveddeNKADNSNG---HERKAQDACSKPFYLLNAMSDL  2924
             GNWSR L DLFG+           D++    + NG    +R+  +   K F+LLNA+SDL
Sbjct  637   GNWSRCLIDLFGM-----------DEDGSFKDENGLYDEDRQEPETSFKTFHLLNALSDL  685

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             MMLPKDM+L+R +RKEVCPT  + LI RVL+ F+PDEFC DP+P  VLE L+SED +E E
Sbjct  686   MMLPKDMILNRAIRKEVCPTLSVPLIRRVLSNFVPDEFCSDPVPEFVLETLSSEDPVEAE  745

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             EES+  FPC+AAPIVY PP+ A     +     S  QL RS SS+L+KSYTSDDELDELD
Sbjct  746   EESLRTFPCNAAPIVYKPPTTAT-IVGVVGDVESQLQLRRSGSSMLRKSYTSDDELDELD  804

Query  3285  sPL------NLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             S L       L    +S          NG     RY+LLREVW
Sbjct  805   SSLVSIITDGLWARASSTRVPSWNLKENGGQKAQRYELLREVW  847



>ref|XP_003555120.1| PREDICTED: uncharacterized protein LOC100818584 isoform X1 [Glycine 
max]
 ref|XP_006604088.1| PREDICTED: uncharacterized protein LOC100818584 isoform X2 [Glycine 
max]
Length=1054

 Score =   568 bits (1463),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 331/601 (55%), Positives = 413/601 (69%), Gaps = 23/601 (4%)
 Frame = +3

Query  1635  ERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLE  1814
             ERL +  SV   G+S R N  +  N  +L D +NS  G  SND +D+K+ +KE  +  L+
Sbjct  467   ERLKNTKSVRLPGDSVR-NAELNENG-ILGDAQNS-SGNRSNDRRDSKILAKEIRSGTLD  523

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
              K + LE+KI+MLEGELREAAA+E  L++VVAEHG+ST+KVHAPARRLSRLY HA KEN 
Sbjct  524   GKIEHLEKKIKMLEGELREAAAIEAALYTVVAEHGNSTSKVHAPARRLSRLYLHASKENL  583

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSK  2174
               RR  AA+S VSGL+LV KACGNDVPRLTFWLSN ++LR  I +  +    P  S   K
Sbjct  584   QERRAGAAKSSVSGLVLVTKACGNDVPRLTFWLSNTIVLRTIISQTVKVPPNPAGSGRRK  643

Query  2175  NAVVKNE--RKASPLKWQSFPHKKSVGNDLPGT-FEDWENPLGFTKALEKVEAWIFSRII  2345
                 +    +  + L+ +    +K+    L    F +W++P  F  ALEKVEAWIFSRII
Sbjct  644   KTEGEEGCGKITTSLRVKGLYPRKTENTALGYEGFGNWDDPHIFILALEKVEAWIFSRII  703

Query  2346  ESIWWQTFTPHMQSGAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             ESIWWQT TPHMQ    T+ +  S   K Y+RTSSSC ++  N SL +WK AFR+A ER+
Sbjct  704   ESIWWQTLTPHMQHTMVTNKEVMSATRKDYRRTSSSCDQKQGNLSLYIWKNAFREACERV  763

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+RA GHECGCL +LS+LIM+QCVARLDVAMFNAILRESADDIPTDPVSD IS+P VLP
Sbjct  764   CPIRARGHECGCLSMLSRLIMEQCVARLDVAMFNAILRESADDIPTDPVSDAISDPNVLP  823

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IP GK+SF AGAQLK  IG WSRWL DLFG+       D V+  E+KAD  +  ER  ++
Sbjct  824   IPPGKSSFGAGAQLKTVIGTWSRWLTDLFGM-------DDVDSIEDKADPDHNEER--EN  874

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
                K F +LNA+SDL+MLPKDMLLS ++R EVCP F  +LI ++L+ F+PDE CPDP+P+
Sbjct  875   TFFKSFSILNALSDLLMLPKDMLLSASIRNEVCPMFNATLIKKILDNFVPDELCPDPVPS  934

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssV  3239
              V EALNSE+ ME  +E V NFPC AAPI Y+PP A +    +     S SQL R++SSV
Sbjct  935   NVFEALNSENEMEDGKEYVNNFPCIAAPIAYSPPPATS-IASIVGEIGSKSQLRRNKSSV  993

Query  3240  LKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgng-----ngngVRYQLLREVWMSS  3404
             ++KS+TSDDELDEL SPL+ I    S   K    S        N + VRY+LLR+VWM S
Sbjct  994   VRKSHTSDDELDELKSPLSSIFFSVSSSPKVLTKSSLKFKEIRNQSPVRYELLRDVWMKS  1053

Query  3405  E  3407
             +
Sbjct  1054  D  1054


 Score =   232 bits (591),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 148/198 (75%), Gaps = 11/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R   +VQ ++LI+I EIKPWPPSQSL++L++V+I+W++G+  SGST  VAP
Sbjct  1    MVLGMRGKNRRGVTVQIDFLIHIQEIKPWPPSQSLRSLRSVLIEWKNGECASGSTNLVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G GRIEFNESFR+ +TLLR++S +  + D FQKNC+EFNLYEPRRD TVKGQ
Sbjct  61   SLG--SVIGEGRIEFNESFRLHVTLLRDMSVRGGDADVFQKNCLEFNLYEPRRDKTVKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL T V+D A YG +KE L+ SVP+NCKRSYRNT QPLL +KI+ V + R  +L++    
Sbjct  119  LLATGVVDLAEYGALKESLSTSVPMNCKRSYRNTDQPLLFIKIRPVERNRASALLK----  174

Query  705  RESSMDSSAGESVSALMN  758
                 DS+ G+SVS LMN
Sbjct  175  -----DSNGGDSVSTLMN  187



>gb|KHN24270.1| hypothetical protein glysoja_043203 [Glycine soja]
Length=1054

 Score =   566 bits (1459),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 330/601 (55%), Positives = 413/601 (69%), Gaps = 23/601 (4%)
 Frame = +3

Query  1635  ERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLE  1814
             ERL +  SV   G+S R N  +  N  +L D +NS  G  SND +D+K+ +KE  +  L+
Sbjct  467   ERLKNTKSVRLPGDSVR-NAELNENG-ILGDAQNS-SGNRSNDRRDSKILAKEIRSGTLD  523

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
              K + LE+KI+MLEGELREAAA+E  L++VVAEHG+ST+KVHAPARRLSRLY HA KEN 
Sbjct  524   GKIEHLEKKIKMLEGELREAAAIEAALYTVVAEHGNSTSKVHAPARRLSRLYLHASKENL  583

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSK  2174
               RR  AA+S VSGL+LV KACGNDVPRLTFWLSN ++LR  I +  +    P  S   K
Sbjct  584   QERRAGAAKSSVSGLVLVTKACGNDVPRLTFWLSNTIVLRTIISQTVKVPPNPAGSGRRK  643

Query  2175  NAVVKNE--RKASPLKWQSFPHKKSVGNDLPGT-FEDWENPLGFTKALEKVEAWIFSRII  2345
                 +    +  + L+ +    +K+    L    F +W++P  F  ALEKVEAWIFSRII
Sbjct  644   KTEGEEGCGKITTSLRVKGLYPRKTENTALGYEGFGNWDDPHIFILALEKVEAWIFSRII  703

Query  2346  ESIWWQTFTPHMQSGAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             ESIWWQT TPHMQ    T+ +  S   K Y+RTSSSC ++  N S+ +WK AFR+A ER+
Sbjct  704   ESIWWQTLTPHMQHTMVTNKEVMSATRKDYRRTSSSCDQKQGNLSVYIWKNAFREACERV  763

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+RA GHECGCL +LS+LIM+QCVARLDVAMFNAILRESADDIPTDPVSD IS+P VLP
Sbjct  764   CPIRARGHECGCLSMLSRLIMEQCVARLDVAMFNAILRESADDIPTDPVSDAISDPNVLP  823

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IP GK+SF AGAQLK  IG WSRWL DLFG+       D V+  E+KAD  +  ER  ++
Sbjct  824   IPPGKSSFGAGAQLKTVIGTWSRWLTDLFGM-------DDVDSIEDKADPDHNEER--EN  874

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
                K F +LNA+SDL+MLPKDMLLS ++R EVCP F  +LI ++L+ F+PDE CPDP+P+
Sbjct  875   TFFKSFSILNALSDLLMLPKDMLLSASIRNEVCPMFNATLIKKILDNFVPDELCPDPVPS  934

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssV  3239
              V EALNSE+ ME  +E V NFPC AAPI Y+PP A +    +     S SQL R++SSV
Sbjct  935   NVFEALNSENEMEDGKEYVNNFPCIAAPIAYSPPPATS-IASIVGEIGSKSQLRRNKSSV  993

Query  3240  LKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgng-----ngngVRYQLLREVWMSS  3404
             ++KS+TSDDELDEL SPL+ I    S   K    S        N + VRY+LLR+VWM S
Sbjct  994   VRKSHTSDDELDELKSPLSSIFFSVSSSPKVLTKSSLKFKEIRNQSPVRYELLRDVWMKS  1053

Query  3405  E  3407
             +
Sbjct  1054  D  1054


 Score =   232 bits (591),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 148/198 (75%), Gaps = 11/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R   +VQ ++LI+I EIKPWPPSQSL++L++V+I+W++G+  SGST  VAP
Sbjct  1    MVLGMRGKNRRGVTVQIDFLIHIQEIKPWPPSQSLRSLRSVLIEWKNGECASGSTNLVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G GRIEFNESFR+ +TLLR++S +  + D FQKNC+EFNLYEPRRD TVKGQ
Sbjct  61   SLG--SVIGEGRIEFNESFRLHVTLLRDMSVRGGDADVFQKNCLEFNLYEPRRDKTVKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL T V+D A YG +KE L+ SVP+NCKRSYRNT QPLL +KI+ V + R  +L++    
Sbjct  119  LLATGVVDLAEYGALKESLSTSVPMNCKRSYRNTDQPLLFIKIRPVERNRASALLK----  174

Query  705  RESSMDSSAGESVSALMN  758
                 DS+ G+SVS LMN
Sbjct  175  -----DSNGGDSVSTLMN  187



>ref|XP_010248935.1| PREDICTED: uncharacterized protein LOC104591675 isoform X3 [Nelumbo 
nucifera]
Length=1026

 Score =   564 bits (1453),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 335/643 (52%), Positives = 416/643 (65%), Gaps = 48/643 (7%)
 Frame = +3

Query  1548  QDNTTKQHLEGNSAIIAGRESVGAK--TTCDERLNHVSSVHTLGESNRANGSVRSNQF--  1715
             QD   KQ   G S I      +G +  +    RL HV SV +  +++R N  +  NQ   
Sbjct  401   QDAMRKQVAFGTSPIAFDSRDLGVRDNSLTVSRLKHVKSVRSPVDTSRNNELLYGNQLTE  460

Query  1716  ---------VLRDKRNSIEGITSNDWKDT-KVRSKETSNVVLERKCQELEQKIQMLEGEL  1865
                      ++   R+SI    SND +D   V+     NV    K Q+LE +++ LE EL
Sbjct  461   VKEVDVSEDIVSSSRSSITA-ESNDAQDACTVKLNCHYNV----KVQQLEHRVESLEREL  515

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             REAAAVE+GL+SVVAEHGSS NKVHAPARRLSRLY HAC++ S   R +AARS VSGL+L
Sbjct  516   REAAAVEVGLYSVVAEHGSSANKVHAPARRLSRLYHHACRKQSPGHRATAARSAVSGLVL  575

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSE---YSKNAVVKNERKASPLK  2216
             VAKACGND+PRLTFWLSN V+LR  I +   + QL + +     +    + NE+K SPLK
Sbjct  576   VAKACGNDIPRLTFWLSNSVVLREIISQVVGESQLSICAGPQIEANGGKMGNEKKYSPLK  635

Query  2217  WQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAA  2396
             W      K         F++WE+P  F  ALEKVEAWIFSRIIES+WWQT TP+MQS   
Sbjct  636   WNESSLNKKEKFVFSNDFDEWEDPQTFVTALEKVEAWIFSRIIESVWWQTLTPYMQSATR  695

Query  2397  TSLDSEINKIYQRTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSK  2573
                D    K+    S S  ++ + NFSL LWK+AFRDA E++CPVRAGGHECGCL +L++
Sbjct  696   IGND----KVMVSNSGSLGDQEQGNFSLHLWKEAFRDACEKLCPVRAGGHECGCLPVLAR  751

Query  2574  LIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAI  2753
             L+M+QC+ RLDVA+FNAILRESAD+IPTDPVSDPIS+ +VLPIPAGK+SF  GAQLKNAI
Sbjct  752   LVMEQCMNRLDVALFNAILRESADEIPTDPVSDPISDSKVLPIPAGKSSFGNGAQLKNAI  811

Query  2754  GNWSRWLADLFGIddddedddlveddeNKADNSNG---HERKAQDACSKPFYLLNAMSDL  2924
             GNWSR L DLFG+           D++    + NG    +R+  +   K F+LLNA+SDL
Sbjct  812   GNWSRCLIDLFGM-----------DEDGSFKDENGLYDEDRQEPETSFKTFHLLNALSDL  860

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             MMLPKDM+L+R +RKEVCPT  + LI RVL+ F+PDEFC DP+P  VLE L+SED +E E
Sbjct  861   MMLPKDMILNRAIRKEVCPTLSVPLIRRVLSNFVPDEFCSDPVPEFVLETLSSEDPVEAE  920

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             EES+  FPC+AAPIVY PP+ A     +     S  QL RS SS+L+KSYTSDDELDELD
Sbjct  921   EESLRTFPCNAAPIVYKPPTTAT-IVGVVGDVESQLQLRRSGSSMLRKSYTSDDELDELD  979

Query  3285  sPL------NLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             S L       L    +S          NG     RY+LLREVW
Sbjct  980   SSLVSIITDGLWARASSTRVPSWNLKENGGQKAQRYELLREVW  1022


 Score =   225 bits (573),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            M+LG   K R   SVQ +Y I+I EI+PWPPSQSL++L++V++QWE+GD+NSGST  V P
Sbjct  1    MLLGLRTKNRKGTSVQVDYFIHIQEIEPWPPSQSLRSLRSVLLQWENGDRNSGSTKPVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   SGVG+G+IEFNESFR+P+TL RE+  KS + ++FQKNC+EF LYEPRRD TVKG 
Sbjct  61   SLG--SGVGDGKIEFNESFRLPVTLSREVPIKSGDVESFQKNCLEFTLYEPRRDKTVKGL  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGT +ID A YG+V+E + +S P+NCKR++RNT QP L +KIQ   K    SL R  + 
Sbjct  119  LLGTVMIDLAEYGIVQETICISAPMNCKRNFRNTAQPALFVKIQPFEKNCSSSLQRERLS  178

Query  705  RESSMDSSAGESVSALM  755
            +    D    +SVS LM
Sbjct  179  KVVPRDKDGKDSVSVLM  195



>ref|XP_010496437.1| PREDICTED: uncharacterized protein LOC104773506 [Camelina sativa]
Length=922

 Score =   558 bits (1437),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 309/557 (55%), Positives = 395/557 (71%), Gaps = 34/557 (6%)
 Frame = +3

Query  1767  KDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAP  1946
             K+ KV  K T +  LE K + LE K+  LEGELREAAA+E  L+SVVAEHGSS++KVHAP
Sbjct  390   KEAKVYPKSTRDTTLESKVKNLESKVNKLEGELREAAAIEAALYSVVAEHGSSSSKVHAP  449

Query  1947  ARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAIC  2126
             ARRL RLY HAC+EN + RR +AA+S VSGL+LVAKACGNDVPRLTFWLSN ++LR  I 
Sbjct  450   ARRLLRLYLHACRENHLSRRANAAKSAVSGLVLVAKACGNDVPRLTFWLSNTIVLRTIIS  509

Query  2127  KFSEKQQLPLSSEYS--KNAVVKNERKASPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGF  2297
               + +++LP+S+     K  V +   K S LKW+ S   KK +      +F  W++P+ F
Sbjct  510   DTTAEEELPVSAGPGPRKQKVERETDKQSSLKWKDSSLSKKDIE-----SFGTWDDPVTF  564

Query  2298  TKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD------SEINKIYQRTSSSCSEE  2459
               ALEKVEAWIFSR++ESIWWQT TP MQS AA++ +      S   K + RT SS ++E
Sbjct  565   IAALEKVEAWIFSRVVESIWWQTLTPRMQSSAASTREFDKANGSASKKNFGRTPSSMNQE  624

Query  2460  PENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRES  2639
               +FSLELWKKAFRDA+ER+CP+RA GHECGCL + ++LIM+QCVARLDVAMFNAILR+S
Sbjct  625   QGDFSLELWKKAFRDAHERLCPLRASGHECGCLPVPARLIMEQCVARLDVAMFNAILRDS  684

Query  2640  ADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddl  2819
              ++ PTDPVSDPI++  VLPIP+  +SF +GAQLKN+IGNWSRWL DLFGIDD+DED   
Sbjct  685   DENFPTDPVSDPIADSRVLPIPSTTSSFGSGAQLKNSIGNWSRWLTDLFGIDDEDEDSSD  744

Query  2820  veddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSL  2999
                  +++               K F+LL A+SDLMMLPKDMLL+ +VRKEVCP  G  L
Sbjct  745   ENSYVDRS--------------FKTFHLLKALSDLMMLPKDMLLNSSVRKEVCPMLGAPL  790

Query  3000  ITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAld  3179
             I RVLN F+PDEFCPDP+P+ VLEAL SE+  + E+  + ++PC+A P VY+PPS A++ 
Sbjct  791   IKRVLNNFVPDEFCPDPVPDAVLEALESEE--KAEKGMITSYPCTAPPPVYSPPSGASIS  848

Query  3180  gilgdisssssqlt-rsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngn  3356
              I+GD     +    R RSSV +K+YTSDDELDEL SPL ++ ++ +   K    +  G 
Sbjct  849   TIIGDFGQPQAPQLCRIRSSVTRKAYTSDDELDELSSPLAVVVLQQAGCKK---VNNGGA  905

Query  3357  gngVRYQLLREVWMSSE  3407
                VRYQLL+E WM+ E
Sbjct  906   DETVRYQLLKECWMNGE  922


 Score =   223 bits (568),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 147/198 (74%), Gaps = 7/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K+R   +VQ +YLI+I +IKPWPPSQSL++L++VVIQWE+GD+NSG+TT VAP
Sbjct  1    MVLGLSSKSRRGSTVQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGDRNSGTTTAVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESF++P+TLL++ SS++   D F KN +E NLYEPRR+ T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFKLPLTLLKDASSRNKGADLFFKNVLELNLYEPRREKT--HQ  116

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A+YG+VKE L VS P+N KRSYRNT QP+L L IQ V + R  S   N+++
Sbjct  117  LLATATIDLADYGIVKESLTVSAPMNSKRSYRNTTQPVLYLTIQPVDRRRASSSSINSLK  176

Query  705  RESSMDSSAGESVSALMN  758
             ES    + G SVSALMN
Sbjct  177  DES---KTGGGSVSALMN  191



>ref|XP_010669952.1| PREDICTED: uncharacterized protein LOC104887065 [Beta vulgaris 
subsp. vulgaris]
Length=977

 Score =   559 bits (1440),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 343/684 (50%), Positives = 453/684 (66%), Gaps = 75/684 (11%)
 Frame = +3

Query  1449  VTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTK-----QHLEGNSA--------  1589
             ++ER+   E     +   +  +  +G+ V   + D T K     +H+ GNS+        
Sbjct  329   ISERNSFVEVAATVDF--DDAEVQDGDKVG--IHDQTEKMLEEVKHVVGNSSSNKLSVDA  384

Query  1590  ----IIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITS  1757
                 +++G  S+  K    +R+ HV SV +  ES  +NGS                G+++
Sbjct  385   IENQVLSGSGSLLLK----DRVRHVKSVRSPIESG-SNGSA--------------GGLSA  425

Query  1758  ND-----WKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGS  1922
             N+     +   K+R+   S      K Q LEQ+I++LE ELREAAA+E+ L+SVVAEHGS
Sbjct  426   NNSRLEAYVIEKIRTSSDS------KTQGLEQRIEILERELREAAALEVALYSVVAEHGS  479

Query  1923  STNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNC  2102
             STNKVHAPARRLSRL+  A K    ++R SAA+S+VSGLI+VAKACGNDVPRLTFWLSNC
Sbjct  480   STNKVHAPARRLSRLFLRAGKG---MKRTSAAQSIVSGLIVVAKACGNDVPRLTFWLSNC  536

Query  2103  VLLRAAICKFSEKQQLPLS--SEYSKNAVVKNERKASPLKWQ-SFPHKKSVGNDLPGTFE  2273
             V+LRA +C+   + QLP+S  S   +N   K  +K S LKW+ SF  K++  + + G+FE
Sbjct  537   VVLRAILCEAFAEDQLPVSASSLVERNGAGKRNQKISELKWKVSFSDKQAYRSAVDGSFE  596

Query  2274  DWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIY----QRTS  2441
             D E+   F  ALEKVE+WIFSRI+ES+WWQT TPHMQS AA  +D  ++  +    +R++
Sbjct  597   DLEDSHAFMSALEKVESWIFSRIVESVWWQTLTPHMQSSAAQMIDKVVDSGFWKKNRRST  656

Query  2442  SSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFN  2621
             S+  +E  NFSLELWKKAF+DA ER+CP+RAGGHECGCL LL+KLIM+QCVARLDVAMFN
Sbjct  657   STGDQEQVNFSLELWKKAFKDACERLCPLRAGGHECGCLPLLAKLIMEQCVARLDVAMFN  716

Query  2622  AILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddd  2801
             AILRESADDIPTDPVSDPIS+ +VLP+PAG +SF +GA+LKNAIGNWSRWL DLFG+DDD
Sbjct  717   AILRESADDIPTDPVSDPISDAKVLPVPAGTSSFGSGARLKNAIGNWSRWLTDLFGMDDD  776

Query  2802  dedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCP  2981
             D  +   +DDE++  N N        +  K FYLL ++SDLMMLPKD+LLS +VR+EVCP
Sbjct  777   DPPEAERDDDEDEGLNYN--------SSFKSFYLLKSLSDLMMLPKDLLLSESVRREVCP  828

Query  2982  TFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPP  3161
              FG  LI RVL  F+PDEFC DPIP+ V EAL +E+       S+ N PC+A  + Y+PP
Sbjct  829   AFGAQLIQRVLKFFVPDEFCLDPIPDGVFEALETENVCAEGGGSITNCPCTAPAVFYSPP  888

Query  3162  SAAAldgilgdisssss-qltrsrssVLKKSYTsddeldeldsPLNLIKMEN-----SEV  3323
             S ++L  ++G    + S    R   SVL++S TSDDELDEL+SPL+ I  E      +++
Sbjct  889   SPSSLASVIGLRLGTGSPSQLRRSGSVLRRSNTSDDELDELNSPLHAILNEGIQALPTQM  948

Query  3324  TKPgggsgngngngVRYQLLREVW  3395
              +      N   + +RYQLLREVW
Sbjct  949   KQNWKLVENHRKHVLRYQLLREVW  972


 Score =   231 bits (590),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R  PS Q EY I++ +IKPWPP+QSLK++++V+IQWE+G++NSGST+ VAP
Sbjct  1    MVLGLRSKIRSGPSTQVEYTIHVQDIKPWPPTQSLKSVRSVLIQWENGERNSGSTSSVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             LE      +G I FNESF++ ITL +++S KS + D F KN +EFNLYEPRRD TVKGQ
Sbjct  61   SLE------DGMITFNESFKISITLSKDMSVKSGDTDVFHKNLLEFNLYEPRRDKTVKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA+ID A+YGV++E  +VS P+NC RS+RNT QP+L L+IQ   K R  + +R  + 
Sbjct  115  LLGTAIIDLADYGVIREIRSVSAPMNCTRSFRNTAQPILYLRIQANDKVRSGTSLRGRLA  174

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D +  +SVSALMN
Sbjct  175  KETSLDKNDEDSVSALMN  192



>ref|XP_007151538.1| hypothetical protein PHAVU_004G055300g [Phaseolus vulgaris]
 ref|XP_007151539.1| hypothetical protein PHAVU_004G055300g [Phaseolus vulgaris]
 ref|XP_007151540.1| hypothetical protein PHAVU_004G055300g [Phaseolus vulgaris]
 gb|ESW23532.1| hypothetical protein PHAVU_004G055300g [Phaseolus vulgaris]
 gb|ESW23533.1| hypothetical protein PHAVU_004G055300g [Phaseolus vulgaris]
 gb|ESW23534.1| hypothetical protein PHAVU_004G055300g [Phaseolus vulgaris]
Length=1030

 Score =   560 bits (1443),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 338/687 (49%), Positives = 446/687 (65%), Gaps = 32/687 (5%)
 Frame = +3

Query  1407  GENTEGHQGNTQELVTERDKHQ--ETGEGKE-LIIEKGQCSEGEPVNSCLQDNTTKQHLE  1577
             G +TE  + + +E   ++ +H   E   G E   ++   C + E + +  QD   +  ++
Sbjct  355   GRSTEADKYSMKESGGDKVRHDSVEDMSGNENYALDSQNCIKDEILEA--QDGKDQASMD  412

Query  1578  GNSAIIAGRE-SVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFV-------LRDKR  1733
              N+    G   ++       ERL ++ SV    +  R  GS+ SN  V       L   +
Sbjct  413   SNTYSFGGSNIAMQENILKSERLKNIKSVRIPADIARNTGSLGSNHQVELNENGILGHSK  472

Query  1734  NSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAE  1913
             NS  G  SN+ +D+K+ +KE  N   + K ++LE+KI+MLEGELREAAAVE  L+SVV+E
Sbjct  473   NS-GGNRSNERRDSKIHTKEARNGTSDGKVEQLEKKIKMLEGELREAAAVESALYSVVSE  531

Query  1914  HGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWL  2093
             HG+ST+KVHAPARRLSRLY HACKE    RR  AA+S VSGL+LV KACGNDVPRLTFWL
Sbjct  532   HGNSTSKVHAPARRLSRLYLHACKEKFQGRRAGAAKSSVSGLVLVTKACGNDVPRLTFWL  591

Query  2094  SNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERK-ASPLKWQSFPHKKSVGNDLP-GT  2267
             SN V LR  I +  +    P  S   +    +   K  + L+      +K+    L  G 
Sbjct  592   SNTVALRTIISRTVKDPSNPAGSGRRRKTEEEGHGKITASLRVNGLHPRKNENTALGYGG  651

Query  2268  FEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD--SEINKIYQRTS  2441
             F +W++P     ALEKVEAWIF+RIIESIWWQ   PHMQ     S +  S+  K Y+RTS
Sbjct  652   FGNWDDPQVLISALEKVEAWIFTRIIESIWWQILIPHMQHTKFNSKEVVSDSRKSYRRTS  711

Query  2442  SSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFN  2621
             SSC +E  N SL +WK AFR+A ERICP+RAGG+ECGCL +LS+LIM+QCVARLDVAMFN
Sbjct  712   SSCDQEQGNLSLYIWKNAFREACERICPIRAGGNECGCLPMLSRLIMEQCVARLDVAMFN  771

Query  2622  AILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddd  2801
             AILRES D+IPTDPVSD +S+P+VLPIP  K SF AGAQLK  IG WSRWL+DL G+   
Sbjct  772   AILRESYDEIPTDPVSDAVSDPKVLPIPPAKISFGAGAQLKTVIGTWSRWLSDLCGM---  828

Query  2802  dedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCP  2981
                 D  +  E+KA+  N  +R  Q A  KPF LLNA+SDL+MLPKDMLL+ ++R EVCP
Sbjct  829   ----DDDDSIEDKAETDNNEQR--QTASLKPFSLLNALSDLLMLPKDMLLTASIRNEVCP  882

Query  2982  TFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPP  3161
                 +LI ++L+ F+PDE C DP+P+ V EAL+SE+ ME  +E V NFPC AAPIVY+PP
Sbjct  883   MLNATLIKKILHNFVPDELCSDPVPSGVFEALDSENDMEDGKELVNNFPCIAAPIVYSPP  942

Query  3162  SAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPggg  3341
             + +++  I+G++ S    L R+RSS+++KS+TSDDELDEL SPL+ I + +S   K    
Sbjct  943   TPSSIAIIVGEMGSKYHHLRRNRSSIVRKSHTSDDELDELKSPLSSIFLTSSSSQKVSTK  1002

Query  3342  sg-----ngngngVRYQLLREVWMSSE  3407
             S        N + VRY+LLR+VW++SE
Sbjct  1003  STFNFKELTNQSPVRYELLRDVWINSE  1029


 Score =   233 bits (595),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 148/198 (75%), Gaps = 11/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R   +VQ ++LI+I EIKPWPPSQSL++L++V+I+W++G+  SGST   AP
Sbjct  1    MVLGMRGKNRRGFTVQIDFLIHIQEIKPWPPSQSLRSLRSVLIEWKNGECASGSTALAAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G GRIEFNESFR+ +TLLR++S +S + D FQKNC+EFNLYEPRRD T+KGQ
Sbjct  61   SLG--SVIGEGRIEFNESFRLHVTLLRDMSVRSGDTDVFQKNCLEFNLYEPRRDRTIKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA+ID A YG +KE L  SVP+NCKRSYRNT QPLL LKIQ + + R  S       
Sbjct  119  LLGTAIIDLAEYGTLKESLITSVPMNCKRSYRNTEQPLLFLKIQPLERNRASS-------  171

Query  705  RESSMDSSAGESVSALMN  758
              SS +++ GESVS LMN
Sbjct  172  --SSKENNGGESVSTLMN  187



>ref|XP_002884258.1| hypothetical protein ARALYDRAFT_317012 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60517.1| hypothetical protein ARALYDRAFT_317012 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score =   556 bits (1433),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 393/558 (70%), Gaps = 32/558 (6%)
 Frame = +3

Query  1761  DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVH  1940
             D K+ KV  K T +  LE K + LE ++Q LEGELREAAA+E  L+SVVAEHGSS+NKVH
Sbjct  389   DRKEAKVYPKSTYDTTLENKIKNLESRVQKLEGELREAAAIEAALYSVVAEHGSSSNKVH  448

Query  1941  APARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAA  2120
             APARRL RLY HAC+E  + RR +AA+S VSGL+LVAKACGNDVPRLTFWLSN ++LR  
Sbjct  449   APARRLLRLYLHACRETHLSRRANAAKSAVSGLVLVAKACGNDVPRLTFWLSNTIVLRTI  508

Query  2121  ICKFSEKQQLPLSSEYS--KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLG  2294
             I   S +++LP+S+     K  V +   K S LKW+  P  K    D+  +F   ++P+ 
Sbjct  509   ISDTSAEEELPVSAGPGPRKQKVERETEKRSSLKWKDSPLSK---KDI-ESFGACDDPVT  564

Query  2295  FTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD------SEINKIYQRTSSSCSE  2456
             F  ALEKVEAWIFSR++ESIWWQT TP MQS AA++ +      S   K + RT SS ++
Sbjct  565   FITALEKVEAWIFSRVVESIWWQTLTPRMQSSAASTREFDKANGSASKKNFGRTPSSMNQ  624

Query  2457  EPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRE  2636
             E  +FSLELWKKAFR+A+ER+CP+R  GHECGCL + ++LIM+QCVARLDVAMFNAILR+
Sbjct  625   EQGDFSLELWKKAFREAHERLCPLRGSGHECGCLPVPARLIMEQCVARLDVAMFNAILRD  684

Query  2637  SADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddeddd  2816
             S D+ PTDPVSDPI++  VLPIP+  +SF +GAQLKN+IGNWSRWL DLFGIDD+D+D  
Sbjct  685   SDDNFPTDPVSDPIADLRVLPIPSTTSSFGSGAQLKNSIGNWSRWLTDLFGIDDEDDDSS  744

Query  2817  lveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLS  2996
                   +++               K F LL A+SDLMMLPKDMLL+R+VRKEVCP FG  
Sbjct  745   DENSYVDRS--------------FKTFNLLKALSDLMMLPKDMLLNRSVRKEVCPMFGSP  790

Query  2997  LITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPS-AAA  3173
             LI RVLN F+PDEFCPDP+P+ VL++L SE+  E E+  + ++PC+A P VY+PPS  + 
Sbjct  791   LIKRVLNNFVPDEFCPDPVPDAVLKSLESEE--EAEKSMITSYPCTAPPPVYSPPSRTSI  848

Query  3174  ldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgng  3353
                I       + +L+R RSS+ +K+YTSDDELDEL SPL ++ ++     K    +  G
Sbjct  849   STIIGDFGQPQAPELSRIRSSITRKAYTSDDELDELSSPLAVVVLQQEGSKK---INNGG  905

Query  3354  ngngVRYQLLREVWMSSE  3407
             +   VRYQLLRE WM+ E
Sbjct  906   SDEIVRYQLLRECWMNGE  923


 Score =   201 bits (512),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 143/200 (72%), Gaps = 8/200 (4%)
 Frame = +3

Query  165  MVLGPSGKT-RGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVA  341
            MVLG S K  R    VQ +YLI+I +IKPWPPSQSL++L++V+IQWE+GD+NSG+TT VA
Sbjct  1    MVLGLSSKNNRRCSPVQVDYLIHIHDIKPWPPSQSLRSLRSVLIQWENGDRNSGTTTVVA  60

Query  342  PMLETESGVGNGRIEFNESFRVPITLLREISSKSV-NGDTFQKNCIEFNLYEPRRDTTVK  518
            P L   S +G G+IEFNESF++P+TLL++ S+++   GD F KN +E NLYEPRR+ T  
Sbjct  61   PSL--GSVIGEGKIEFNESFKLPLTLLKDASARNKGGGDLFFKNVLELNLYEPRREKT--  116

Query  519  GQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNN  698
             QLL TA ID A YG+VKE  +++  +N KRSYRN  QP+L L IQ VG+ R  S    N
Sbjct  117  HQLLATATIDLAVYGIVKESFSLTAQMNSKRSYRNATQPVLYLTIQPVGRRRASSSSSIN  176

Query  699  VRRESSMDSSAGESVSALMN  758
              ++ + +   GESVSALMN
Sbjct  177  SFKDETKN--GGESVSALMN  194



>ref|XP_008783793.1| PREDICTED: uncharacterized protein LOC103702930 [Phoenix dactylifera]
Length=1128

 Score =   561 bits (1446),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 302/527 (57%), Positives = 377/527 (72%), Gaps = 42/527 (8%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             REAAA+EIGL+S+VAEHGSS++KVH PARRLSRLY HA K+ S  R+  AARS VSGL++
Sbjct  624   REAAAIEIGLYSIVAEHGSSSHKVHTPARRLSRLYIHASKQWSRARQAGAARSAVSGLVV  683

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLP-----LSSEYSKNAVVKNERKASP  2210
              AKACGNDVPRLTFWLSN V+LRA I +      +P      S+E+S   V K  RK+S 
Sbjct  684   AAKACGNDVPRLTFWLSNSVVLRAIITRTVRSSDIPKPFGPYSTEHSSITVPK--RKSSS  741

Query  2211  LKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSG  2390
             LKW+S P KK   + +   F+DWE+P  FT ALEK+E WIFSRI+ES+WWQT TP MQS 
Sbjct  742   LKWESVPRKKEKLS-IAEEFDDWEDPDTFTSALEKIETWIFSRIVESVWWQTLTPRMQSA  800

Query  2391  AATSLDSEIN----KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCL  2558
                S D E+     K + RT S    +  N S  +WKKAF+DA ER+CPVRAGGHECGCL
Sbjct  801   ---SEDGELKMGSKKFHGRTPSRSDRQQANSSFGIWKKAFKDACERLCPVRAGGHECGCL  857

Query  2559  HLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQ  2738
              +L++L+M+QCVARLDVAMFNAILRES D+IPTDPVSDPIS+P+VLPIP+GK+SF +GAQ
Sbjct  858   PMLARLVMEQCVARLDVAMFNAILRESDDEIPTDPVSDPISDPKVLPIPSGKSSFGSGAQ  917

Query  2739  LKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD------ACSKPFY  2900
             LKNAIGNWSRWL DLFG+                 D++  +E K  D      A  K F+
Sbjct  918   LKNAIGNWSRWLTDLFGM---------------DVDDTPQNEDKQDDDRLDFAASFKSFH  962

Query  2901  LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALN  3080
             LLNA+SDL+MLPKDMLL +++R+EVCPTF  S+I R+L+ F+PDEFCPDPIP+ VL+AL+
Sbjct  963   LLNALSDLLMLPKDMLLEKSIREEVCPTFSASMIKRILDSFLPDEFCPDPIPDAVLKALD  1022

Query  3081  SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTs  3260
             SED +E +EE + N PC+A+PI+Y+PPS A+    +     S+  L RS SSV++K +TS
Sbjct  1023  SEDPLESDEERIRNAPCNASPIIYSPPSVAS-VESIIGDVQSAPLLRRSGSSVVRKCHTS  1081

Query  3261  ddeldeldsPLN--LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DDELDE+DSPL   LI   ++   KP     +   N VRYQLLREVW
Sbjct  1082  DDELDEVDSPLASILIDKSSAPAAKP---KEHSYANAVRYQLLREVW  1125


 Score =   226 bits (575),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 146/198 (74%), Gaps = 6/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SV  +Y+I+I EIKPWPPSQSLK++++VVIQWE+GD +SGST  V P
Sbjct  1    MVLGLRSKNKKGASVHVDYIIHIQEIKPWPPSQSLKSVRSVVIQWENGDHSSGSTNPVTP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   +    G+IEFNESF++ ITLLRE S+K     TFQKN +EFNLYEPRRD TVKGQ
Sbjct  61   SLGVSAA--EGKIEFNESFKLQITLLREGSAKG----TFQKNVLEFNLYEPRRDKTVKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LG+ VID A +G++KE ++VS+P+NCKRS+RNT QPLL +KIQ  GK    S  R ++ 
Sbjct  115  HLGSVVIDLAEHGIIKETVSVSIPVNCKRSFRNTAQPLLYVKIQPFGKDNRSSSSRESLS  174

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D    ESVSALMN
Sbjct  175  KEASLDKDGKESVSALMN  192



>ref|XP_010930139.1| PREDICTED: uncharacterized protein LOC105051397 isoform X1 [Elaeis 
guineensis]
 ref|XP_010930140.1| PREDICTED: uncharacterized protein LOC105051397 isoform X1 [Elaeis 
guineensis]
 ref|XP_010930141.1| PREDICTED: uncharacterized protein LOC105051397 isoform X2 [Elaeis 
guineensis]
Length=1132

 Score =   559 bits (1441),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 294/523 (56%), Positives = 379/523 (72%), Gaps = 34/523 (7%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             REAAA+E+GL+S+VAEHGSS+ KVH PARRLSRLY HA K+ S  ++ SAARS VSGL++
Sbjct  628   REAAAIEMGLYSIVAEHGSSSQKVHTPARRLSRLYIHASKQWSREKQASAARSAVSGLVV  687

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLP-----LSSEYSKNAVVKNERKASP  2210
              AKACGNDVPRLTFWLSN V+LRA I +  +   +P      S+E+S  +++  ++ +SP
Sbjct  688   AAKACGNDVPRLTFWLSNSVVLRAIITRTIKSSDIPKPFGPYSTEHS--SIMVRKKNSSP  745

Query  2211  LKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSG  2390
             LKW+S   KK   + +   F+DWE+P  FT ALEK+E WIFSRI+ES+WWQT TPHMQS 
Sbjct  746   LKWESISRKKEKLS-ITEEFDDWEDPDTFTSALEKIETWIFSRIVESVWWQTLTPHMQSA  804

Query  2391  AAT-SLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLL  2567
             +    L     K Y++T S    +  N S+ +WKKAF+DA ER+CPVRAGGHECGCL +L
Sbjct  805   SVNHELKRGSKKSYEKTPSRSDCQQANSSIGIWKKAFKDASERLCPVRAGGHECGCLPML  864

Query  2568  SKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKN  2747
             ++L+M+ CVARLDVAMFNAILRES D+IPTDPVSDPIS+P+VLPIP+GK+SF +GAQLKN
Sbjct  865   ARLVMEHCVARLDVAMFNAILRESDDEIPTDPVSDPISDPKVLPIPSGKSSFGSGAQLKN  924

Query  2748  AIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD------ACSKPFYLLN  2909
             AIGNWSRWL DLFG+                 D++  +E K  D      A  K F+LLN
Sbjct  925   AIGNWSRWLTDLFGM---------------DVDDTPQNEDKQDDDRLDVAASFKSFHLLN  969

Query  2910  AMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSED  3089
             A+SDL+MLPKDMLL +++RKEVCPTF  S+I R+L+ F+PDEFCPDPIP VVL+AL+SED
Sbjct  970   ALSDLLMLPKDMLLEKSIRKEVCPTFSASMIKRILDSFLPDEFCPDPIPEVVLKALDSED  1029

Query  3090  HMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsdde  3269
              +E +EE + N PC+A+PI+Y+PPS A+    +      +  L RS SSV++K +TSDDE
Sbjct  1030  PLESDEERIRNAPCNASPIIYSPPSVAS-VESIIGDVQGAPLLRRSGSSVVRKCHTSDDE  1088

Query  3270  ldeldsPLNLIKMENSEVTKPgggsgngngn-gVRYQLLREVW  3395
             LDELDSPL  I ++  +++ P     + +    VRYQLLREVW
Sbjct  1089  LDELDSPLASILID--KLSAPTTKRKDHSYANAVRYQLLREVW  1129


 Score =   218 bits (554),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SV  +Y+I+I EIKPWPPSQSLK++++VV+QWE+GD +SGST  + P
Sbjct  1    MVLGLRSKNKKGASVHVDYIIHIQEIKPWPPSQSLKSVRSVVLQWENGDNSSGSTNPITP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   +    G+IEFNESF++  +LLRE S+K     TFQKN +EFN+YEPRRD TVKGQ
Sbjct  61   SLGVTAA--EGKIEFNESFKLQASLLREGSAKGNGMSTFQKNVLEFNMYEPRRDKTVKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LG+ VID A +G++KE ++VS+P+NCKRS+RNTVQPLL + IQ   K    S    ++ 
Sbjct  119  HLGSVVIDLAEHGMIKETVSVSIPVNCKRSFRNTVQPLLYVNIQPFQKENRSSSSGESLS  178

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D    ESVSALMN
Sbjct  179  KEASLDKDGRESVSALMN  196



>gb|KDO81961.1| hypothetical protein CISIN_1g0039202mg, partial [Citrus sinensis]
Length=757

 Score =   545 bits (1405),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 320/601 (53%), Positives = 400/601 (67%), Gaps = 28/601 (5%)
 Frame = +3

Query  1632  DERLNHV-SSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVV  1808
             D++L HV S +H   ES ++N  + S++F+ ++K+N I               +E +   
Sbjct  175   DDKLKHVKSQLHF--ESAKSNRLLSSSEFMGKEKKNDISKDVYKAGMTNAHNGREETTKG  232

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
                +   LE KI+ML+ ELREAAA+E+GL+SVVAEHGSST+KVH PARRL R YFHAC+ 
Sbjct  233   FSNRNVGLEFKIEMLQDELREAAALEVGLYSVVAEHGSSTSKVHTPARRLCRFYFHACRA  292

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL---PLS  2159
              S  +R SAAR+ +SGL+LV+KACGNDVPRLTFWLSN VLLRA +       QL   P +
Sbjct  293   MSKAKRASAARTAISGLVLVSKACGNDVPRLTFWLSNTVLLRAIVSHAIGGMQLSDGPST  352

Query  2160  SEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSR  2339
             +   K  + +   + +P + +S    +   N++ G  +DWEN   F  ALEK+EAWIFSR
Sbjct  353   NNGDKKGLAE---RFTPKRQESISEIEK--NNVIGESDDWENLQTFIVALEKLEAWIFSR  407

Query  2340  IIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             I+ES+WWQT TPHMQS A     S   K   R +    +E  NFS+ELWKKAF+DA ER+
Sbjct  408   IVESVWWQTLTPHMQSAAVKG--SSSRKASGRRNGLGDQEQGNFSIELWKKAFKDACERL  465

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CPVRAGGHECGCL +L+KL+M+Q V RLDVAMFNAILRESA+++PTDPVSDPIS+P+VLP
Sbjct  466   CPVRAGGHECGCLPVLAKLVMEQLVGRLDVAMFNAILRESAEEMPTDPVSDPISDPKVLP  525

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IPAGK+SF AGAQLKNAIGNWSRWL DLFGIDD+D  +D+ E  ++K           +D
Sbjct  526   IPAGKSSFGAGAQLKNAIGNWSRWLTDLFGIDDNDPPEDVNEVCDDKG--------IGRD  577

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
                KPF LLNA+SDLMMLP +ML     RKEVCPTFG  LI RVLN F+PDEF PDPI  
Sbjct  578   TSFKPFQLLNALSDLMMLPCEMLADNYTRKEVCPTFGAPLIKRVLNNFVPDEFNPDPISP  637

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssV  3239
              V EAL+SE   E EE S+ +FPC A P VY+P  AA+           +  L RS S+V
Sbjct  638   SVFEALDSEVPCEDEEGSLTSFPCMATPTVYSPAPAAS--LSGIVGEVGNQALQRSGSTV  695

Query  3240  LKKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLLREVWMSS  3404
             L+KSYTSDDELDELDS +  I  +NS  +           G G    +RY+LLREVW   
Sbjct  696   LRKSYTSDDELDELDSSITSIIADNSHPSPLSAAPNWMPKGKGGRKVIRYKLLREVWKDG  755

Query  3405  E  3407
             E
Sbjct  756   E  756



>ref|XP_010655431.1| PREDICTED: uncharacterized protein LOC100254476 [Vitis vinifera]
Length=1068

 Score =   555 bits (1430),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 344/668 (51%), Positives = 433/668 (65%), Gaps = 39/668 (6%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQ-HLEGNSAIIAGR--ESV  1613
             +L  E  + QE G+G++ + +K   SE E V+   QD T KQ  L  N+     R  E  
Sbjct  427   DLDKEEKEQQENGQGEQNLEKKKHSSENELVSKFTQDVTRKQVALRSNTLAFNKRVPEMQ  486

Query  1614  GAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKV-RSK  1790
             G+  T + +L HV SV    E  +  G +  +  + ++K   I+  +  D K       K
Sbjct  487   GSLAT-NHKLKHVKSVQLSYERAKPVGLLEHSPLMEKEKEIDIQEDSHKDAKGFAASERK  545

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             E  N   + K  E+E +I+MLE ELREAAA+E+GL+SVVAEHGSSTNKVHAPARRLSR Y
Sbjct  546   ERINNFSDSKV-EVESRIKMLEEELREAAAIEVGLYSVVAEHGSSTNKVHAPARRLSRFY  604

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL  2150
              HACK  +  +R SAAR+  SGL+LV+KACGNDVPRLTFWLSN ++LRA + +     ++
Sbjct  605   LHACKARTQAKRASAARAAASGLVLVSKACGNDVPRLTFWLSNSIVLRATVSQ--AVVEM  662

Query  2151  PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             PLS+  S  +     R           + K   N    + +DWE+P  F   LEK+E WI
Sbjct  663   PLSAGPSTRSGGGRNR-----------YNKEENNARESS-DDWEDPQTFILVLEKIEGWI  710

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLD----SEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             FSRIIES+WWQT TP+MQS AA   D    S   K Y R  S   +E  NFS+ELWK+AF
Sbjct  711   FSRIIESVWWQTLTPYMQSTAAKISDGSRGSNSRKTYGRRHSLGDQEQGNFSIELWKRAF  770

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA ER+CP RAGGHECGCL +LS+L+M+Q V+RLDV MFNAILRESA+++PTDPVSDPI
Sbjct  771   KDACERLCPTRAGGHECGCLPVLSRLVMEQLVSRLDVGMFNAILRESAEEMPTDPVSDPI  830

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              + +VLPIPAGK+SF AGAQLKNA+GNWSRWL DLFGIDD+D   D  E  ++K      
Sbjct  831   CDSKVLPIPAGKSSFGAGAQLKNAVGNWSRWLTDLFGIDDNDAPGDTNEFSDDK------  884

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
               R   +   K F+LLNA+SDLMMLP +ML  R+ RKEVCPTFG+ +I RVL+ F+PDEF
Sbjct  885   --RLKCETSFKVFHLLNALSDLMMLPFEMLADRSTRKEVCPTFGVPIIRRVLDNFVPDEF  942

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             CPDPIP V+ E L+SED +E  EES+ +FPC A P VY+PPSAA+           S  L
Sbjct  943   CPDPIPEVIFETLDSEDSLEGAEESITSFPCIATPPVYSPPSAAS--FASIIGEVGSQSL  1000

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSE----VTKPg-ggsgngngngVRYQLL  3383
              RS SS+L+KSY SDDELDELDSP+  I  +NS      TKP     G G  + VRY+LL
Sbjct  1001  QRSGSSLLRKSYISDDELDELDSPITSIIGDNSRGTPTSTKPSWLPKGKGGRDVVRYRLL  1060

Query  3384  REVWMSSE  3407
             REVW   E
Sbjct  1061  REVWRDGE  1068


 Score =   201 bits (511),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 140/198 (71%), Gaps = 11/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R    V+ +Y++++ EIKPWPPSQSL+++++VV QWE+GD+ SG  +    
Sbjct  1    MVLGLRTKNRKGVLVKVDYIVHVQEIKPWPPSQSLRSVQSVVFQWENGDQASGFLS----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VGNGRIEF+ESFR+P+ L ++   KS   D+FQKNC+EFNLYEPR+D   KGQ
Sbjct  57   -----CSVGNGRIEFSESFRLPVALYKD--GKSRGRDSFQKNCLEFNLYEPRKDKAGKGQ  109

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            +LG+A+I+ A+YG+++E + +S P++CK+S+RN VQP++ LKIQ   K    S    ++ 
Sbjct  110  VLGSAIINLADYGIIEEAITISTPLSCKKSHRNMVQPVIFLKIQPFAKDSTSSSSVVSLS  169

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D   GESVS LM+
Sbjct  170  KEASLDQDGGESVSELMS  187



>ref|XP_006484067.1| PREDICTED: uncharacterized protein LOC102623857 isoform X1 [Citrus 
sinensis]
 ref|XP_006484068.1| PREDICTED: uncharacterized protein LOC102623857 isoform X2 [Citrus 
sinensis]
Length=925

 Score =   548 bits (1412),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 327/608 (54%), Positives = 407/608 (67%), Gaps = 44/608 (7%)
 Frame = +3

Query  1635  ERLNHV-SSVHTLGESNRANGSVRSNQFVLRDKRNSIE------GITS--NDWKDTKVRS  1787
             ++L HV S +H   ES ++N  + S++F+ ++K+N I       G+T+  N W++T  + 
Sbjct  344   DKLKHVKSQLHF--ESAKSNRLLSSSEFMGKEKKNDISKDVYKAGMTNAHNGWEET-TKG  400

Query  1788  KETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRL  1967
               T NV        LE KI+ML+ ELREAAA+E+GL+SVVAEHGSST+KVH PARRLSR 
Sbjct  401   LSTRNV-------GLEFKIEMLQDELREAAALEVGLYSVVAEHGSSTSKVHTPARRLSRF  453

Query  1968  YFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQ  2147
             YFHAC+     +R SAAR+ +SGL+LV+KACGNDVPRLTFWLSN VLLRA +       Q
Sbjct  454   YFHACRAMFKAKRASAARTAISGLVLVSKACGNDVPRLTFWLSNTVLLRAIVSHAIGGMQ  513

Query  2148  L---PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             L   P ++   K  + +   + +P + +S    +   N++ G  +DWEN   F  ALEK+
Sbjct  514   LSDGPSTNNGDKKGLAE---RFTPKRQESISEIEK--NNVIGESDDWENLQTFIVALEKL  568

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             EAWIFSRI+ES+WWQT TPHMQS A     S   K   R +    +E  NFS+ELWKKAF
Sbjct  569   EAWIFSRIVESVWWQTLTPHMQSAAVKG--SSSRKASGRRNGLGDQEQGNFSIELWKKAF  626

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA ER+CPVRAGGHECGCL +L+KL+M+Q V RLDVAMFNAILRESA+++PTDPVSDPI
Sbjct  627   KDACERLCPVRAGGHECGCLPVLAKLVMEQLVGRLDVAMFNAILRESAEEMPTDPVSDPI  686

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
             S+P+VLPIPAGK+SF AGAQLKNAIGNWSRWL DLFGI     DD+   +D N+  +  G
Sbjct  687   SDPKVLPIPAGKSSFGAGAQLKNAIGNWSRWLTDLFGI-----DDNDPLEDVNEVCDEKG  741

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
              ER   D   KPF LLNA+SDLMMLP +ML     RKEVCPTFG  LI RVLN F+PDEF
Sbjct  742   IER---DRSFKPFQLLNALSDLMMLPCEMLADNYTRKEVCPTFGAPLIKRVLNNFVPDEF  798

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
              PDPI   V EAL+SE   E EE S+ +FPC A P VY+P  AA+           +  L
Sbjct  799   NPDPISPSVFEALDSEVPCEDEEGSLTSFPCMATPTVYSPAPAAS--LSGIVGEVGNQAL  856

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLL  3383
              RS S+VL+KSYTSDDELDELDS +  I  +NS  +           G G    +RY+LL
Sbjct  857   QRSGSAVLRKSYTSDDELDELDSSITSIIADNSHPSPLSAAPNWMPKGQGGRKVIRYKLL  916

Query  3384  REVWMSSE  3407
             REVW   E
Sbjct  917   REVWKDGE  924


 Score =   185 bits (469),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 129/198 (65%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ +YLIN+ EI+PWPPSQSL ++ +V++QWE+GD NSGS      
Sbjct  1    MVLGLKTKNKKRGSVQVDYLINLQEIRPWPPSQSLVSVHSVLLQWENGDLNSGSLA----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG G+IEFNE FR+ +TL  E S K +  D+FQKN +E  LYE  ++  VKGQ
Sbjct  57   -----SSVGGGKIEFNERFRISVTLYGEASRKGIANDSFQKNYLEIYLYETGKEKRVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++KEG+ +S PIN K+S RN  QP+  L I+   K    + + +++ 
Sbjct  112  LLGSAVINLADYGIIKEGIAISAPINFKKSSRNMAQPIFYLVIEPFYKDNSSAALNSSLL  171

Query  705  RESSMDSSAGESVSALMN  758
            +E S+D    E+ S L N
Sbjct  172  KEVSLDKDGSETFSELTN  189



>gb|EPS67291.1| hypothetical protein M569_07484, partial [Genlisea aurea]
Length=858

 Score =   545 bits (1404),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 300/550 (55%), Positives = 377/550 (69%), Gaps = 50/550 (9%)
 Frame = +3

Query  1767  KDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAP  1946
             KD+K   KE      +R+   L +++QMLE EL+ +A +E  ++SVVAEHGSS NKVHAP
Sbjct  352   KDSKSFDKEK-----DRRIHHLMRRLQMLEAELQGSAVLEASVYSVVAEHGSSMNKVHAP  406

Query  1947  ARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAIC  2126
             ARRL R Y HA K N+   R SAARSVVSGL+LVAKAC +DVPRLTFWLSNC++LR  + 
Sbjct  407   ARRLLRFYLHAGKLNTESTRASAARSVVSGLVLVAKACASDVPRLTFWLSNCIVLRVIVS  466

Query  2127  KFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHK-KSVGNDLPGTFEDWENPLGFTK  2303
               +      + S++  + +V+ E+K S    +SFP K  + G+ +     DW     F  
Sbjct  467   MST------VDSKFPDDFLVQMEKKQS----ESFPRKNAAAGHRIVDDMYDWSTTSTFAA  516

Query  2304  ALEKVEAWIFSRIIESIWWQTFTPHMQSGAA----TSLDSEINKIYQRTSSSCSEEPENF  2471
             ALEKVE WIFSRIIES+WWQTFTPHMQSGAA    TS+DSE ++ +   S S   +  N 
Sbjct  517   ALEKVETWIFSRIIESLWWQTFTPHMQSGAAREIHTSMDSETSRSFSMKSKSTQLQQLNS  576

Query  2472  SLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDI  2651
             S+ELWK+AF+DA+ RICP+RA GH+CGCL +LSKLIM+Q ++RLDVAMFNAILRES+D++
Sbjct  577   SVELWKRAFKDAFRRICPIRAEGHDCGCLPVLSKLIMEQLISRLDVAMFNAILRESSDEM  636

Query  2652  PTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedd  2831
             PTDPV+DPIS+P+VLPIPAG+ASF AGAQLK AIG+WSRWL DLFGIDDDD++       
Sbjct  637   PTDPVADPISDPKVLPIPAGEASFGAGAQLKTAIGSWSRWLTDLFGIDDDDDEI------  690

Query  2832  eNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRV  3011
                 + +   +     +  K FYLLN++SDLMMLPKDMLLS+TVRKEVCP FG  LI R+
Sbjct  691   --PRNAAADDDDSDVASSLKSFYLLNSLSDLMMLPKDMLLSQTVRKEVCPAFGPPLIRRI  748

Query  3012  LNVFIPDEFCPDPIPNVVLEALNS-EDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgil  3188
             LN F+PDEFCPDPIP VV+EAL+S ED+  VEE+ +   PC A  IVY PPS +A     
Sbjct  749   LNSFVPDEFCPDPIPGVVIEALHSEEDYFNVEEDEISQLPCGATGIVYRPPSTSA-----  803

Query  3189  gdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngV  3368
                           ++V+KKS TS+DELDEL SPLN I               +    GV
Sbjct  804   --------VEGSCFATVVKKSQTSEDELDELTSPLNSIVGSQHH--------HHHQNRGV  847

Query  3369  RYQLLREVWM  3398
             R++LLREVWM
Sbjct  848   RHRLLREVWM  857


 Score =   202 bits (514),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (73%), Gaps = 5/186 (3%)
 Frame = +3

Query  168  VLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPM  347
            VL    KT     VQ EY+I+I +IKPWPPSQSL++++ V+I W+HGDK SGST QV P 
Sbjct  1    VLIMKTKTGKATPVQLEYIIHIQQIKPWPPSQSLRSIRNVLILWDHGDKISGSTAQVVPS  60

Query  348  LETESGVGNGRIEFNESFRVPITLLREISSK-SVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
            L T SG+G+GRIEFNESF++ +TL R+++ K S +G+ F KN IEFNLYEPRR+   K  
Sbjct  61   LGTGSGIGDGRIEFNESFKLQVTLTRDMTIKGSRSGEHFLKNYIEFNLYEPRRE---KAL  117

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG AV+D A YG V++ L+++VPINCKR+YRNTVQPLL + IQ   +  M SL +N++ 
Sbjct  118  LLGNAVLDLAEYGKVRQNLSITVPINCKRTYRNTVQPLLFIMIQPTRRS-MSSLSKNSMV  176

Query  705  RESSMD  722
             E   D
Sbjct  177  TEEYGD  182



>ref|XP_002514952.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47506.1| conserved hypothetical protein [Ricinus communis]
Length=1059

 Score =   551 bits (1420),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 296/539 (55%), Positives = 377/539 (70%), Gaps = 41/539 (8%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             ELE +++MLE EL EAAAVE+GL+SVVAEHGSSTNKVHAPARRLSR Y HACK  S   R
Sbjct  550   ELETRVEMLEEELIEAAAVEVGLYSVVAEHGSSTNKVHAPARRLSRFYLHACKARSQDYR  609

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+++SGL+LV+KACGNDVPRLTFWLSN +LLRA + +  EK Q+P S+  +KN   
Sbjct  610   GNAARAIISGLVLVSKACGNDVPRLTFWLSNSILLRAIVSQAVEKLQVPASTSINKNG--  667

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                +++ P   QS  H+ +  N    + ++WE    F  ALE+VEAWIFSRI+ S+WWQT
Sbjct  668   --GQRSRP---QSSFHEDNETNK-SKSCDEWEEAQTFVAALERVEAWIFSRIVASVWWQT  721

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHE  2546
              TPHMQS A     S+  K + R      ++  NF+++LWKKAF+DA ER+CP+RAGGHE
Sbjct  722   LTPHMQSTAVKGSGSK--KTHARRYGLGDQDQGNFAIDLWKKAFKDACERLCPIRAGGHE  779

Query  2547  CGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFA  2726
             CGCL +L++L+M+Q V RLDVAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAGK+SF 
Sbjct  780   CGCLPVLARLVMEQLVHRLDVAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGKSSFG  839

Query  2727  AGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD-------AC  2885
             AGAQLKNA+GNWSRWL D+FGI                 D+S+  ++   D       A 
Sbjct  840   AGAQLKNAVGNWSRWLTDIFGI-----------------DDSDSDDKVELDSNRLESGAS  882

Query  2886  SKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVV  3065
              K F+LLNA+SDLMMLP +ML  ++ RKEVCPTFG  +I RVLN F+PDEF PDPIP+ +
Sbjct  883   FKVFHLLNALSDLMMLPFEMLADKSTRKEVCPTFGAHIIERVLNNFVPDEFNPDPIPDAI  942

Query  3066  LEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLK  3245
              E+L+SED  +  +ES+ +FPC A P +Y+PPS A+           +  L RS S++LK
Sbjct  943   FESLDSEDLAKDGKESITSFPCIATPTIYSPPSTAS--LTNIIGEVGNQTLQRSGSALLK  1000

Query  3246  KSYTsddeldeldsPLNLIKMENSEVTKPgggsg-----ngngngVRYQLLREVWMSSE  3407
             KSYTSDDELDELDSPL  I ++NS V+     S       G    VRYQLLR++W   E
Sbjct  1001  KSYTSDDELDELDSPLTSIIIDNSRVSPASTASNWTPKGKGGRKVVRYQLLRQIWKDGE  1059


 Score =   169 bits (427),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 131/199 (66%), Gaps = 16/199 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVP-SVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVA  341
            MVLG   K R    S Q +YLI+++EIKPWPPSQSLK++++V + WE+GD +SGS T   
Sbjct  1    MVLGLRSKNRKRHFSAQVDYLIHVLEIKPWPPSQSLKSIESVFLLWENGDHSSGSFT---  57

Query  342  PMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKG  521
                  S VG+G+IE +ESFR+P+TL  E   +     + QKN +EF+LYE R+D  +KG
Sbjct  58   ------SNVGDGKIEISESFRLPVTLYSEAPRRGTVRASSQKNYLEFSLYETRKDKAMKG  111

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
            QLLG+AVI+ A+YG++K+ + +S  IN K++ ++TVQP+L + IQ   +         ++
Sbjct  112  QLLGSAVINLADYGIIKDAVTISTLINFKKNSKSTVQPVLSVNIQPFERD------STSL  165

Query  702  RRESSMDSSAGESVSALMN  758
             +E+S+D    ESVS + N
Sbjct  166  SKEASLDKDGSESVSEVTN  184



>ref|XP_006299859.1| hypothetical protein CARUB_v10016062mg [Capsella rubella]
 gb|EOA32757.1| hypothetical protein CARUB_v10016062mg [Capsella rubella]
Length=906

 Score =   546 bits (1407),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 310/556 (56%), Positives = 393/556 (71%), Gaps = 32/556 (6%)
 Frame = +3

Query  1767  KDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAP  1946
             K+TKV  K T +  LE K + LE K++ LEGELREAAA+E  L+SVVAEHGSS++KVHAP
Sbjct  374   KETKVYPKSTRDTTLESKVKNLENKVKKLEGELREAAAIEAALYSVVAEHGSSSSKVHAP  433

Query  1947  ARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAIC  2126
             ARRL RLY HA +EN + RR +AA+S VSGL+LVAKACGNDVPRLTFWLSN ++LR  + 
Sbjct  434   ARRLLRLYLHASRENHLSRRANAAKSAVSGLVLVAKACGNDVPRLTFWLSNTIVLRTIVS  493

Query  2127  KFSEKQQLPLSSE--YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFT  2300
               S  ++LP+S+     K  V +   K S LKW+  P ++    D+   F  W++P+ F 
Sbjct  494   DTSAGEELPVSAGPGSRKQKVERETDKQSSLKWKDSPLRR---KDI-EIFGTWDDPVTFI  549

Query  2301  KALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD------SEINKIYQRTSSSCSEEP  2462
              ALEKVEAWIFSR++ESIWWQT TP MQS AA++ +      S   KI+ R+ SS ++E 
Sbjct  550   AALEKVEAWIFSRVVESIWWQTLTPRMQSSAASTREFDKANGSASKKIFGRSPSSVNQEQ  609

Query  2463  ENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESA  2642
              +FSLELWKKAFRDA+ER+CP+RA GHECGCL + ++LIM+QCVARLDVAMFNAILR+S 
Sbjct  610   GDFSLELWKKAFRDAHERLCPLRASGHECGCLPVPARLIMEQCVARLDVAMFNAILRDSD  669

Query  2643  DDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlv  2822
             D+ PTDPVSDPI++  VLPIP+  +SF +GAQLKN+IGNWSRWL DLFGIDD+DED+   
Sbjct  670   DNFPTDPVSDPIADSRVLPIPSTTSSFGSGAQLKNSIGNWSRWLTDLFGIDDEDEDNSDE  729

Query  2823  eddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
                               D   K F+LL A+SDLMMLPKDMLL+ +VRKEVCP FG  LI
Sbjct  730   NSYV--------------DTSFKTFHLLKALSDLMMLPKDMLLNSSVRKEVCPMFGAPLI  775

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldg  3182
              RVLN F+PDEFCPDP+P+ VLEAL SE   E E+  + ++PC+A P +Y+PPS  ++  
Sbjct  776   KRVLNNFVPDEFCPDPVPDAVLEALESE--EEAEKAMITSYPCTAPPPLYSPPSGTSIST  833

Query  3183  ilgdisssssqlt-rsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngng  3359
             I+G+          R RSSV +K+YTSDDELDEL SPL ++ ++ +   K    +  G  
Sbjct  834   IIGEFGQPQVPQLCRIRSSVTRKAYTSDDELDELSSPLAVVVLQQTGCKK---VNNGGAD  890

Query  3360  ngVRYQLLREVWMSSE  3407
               VRYQLLRE WM+ E
Sbjct  891   ETVRYQLLRECWMNGE  906


 Score =   201 bits (510),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 136/199 (68%), Gaps = 24/199 (12%)
 Frame = +3

Query  165  MVLGPSGKTR-GVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVA  341
            MVLG S K R G  ++Q +YLI+I +IKPWPPSQSL +L++VVIQWE+GD+NSG+T  VA
Sbjct  1    MVLGLSSKNRRGSSTIQVDYLIHIHDIKPWPPSQSLTSLRSVVIQWENGDRNSGTTNAVA  60

Query  342  PMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKG  521
            P L        G+IEFNESF++P+TL+++ S+++   D F KN +E NLYEPRR+ T   
Sbjct  61   PSL------AQGKIEFNESFKLPLTLIKDASARNKPADLFFKNLLELNLYEPRREKT--H  112

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
            QLL TA ID A+YG++K+ L VS P+N KRSYRNT QP+L L IQ V + R K       
Sbjct  113  QLLATATIDLADYGILKDALTVSAPMNSKRSYRNTTQPVLFLTIQPVDRRRPK-------  165

Query  702  RRESSMDSSAGESVSALMN  758
                    + G SVSALMN
Sbjct  166  --------TGGGSVSALMN  176



>ref|XP_006438080.1| hypothetical protein CICLE_v10030641mg [Citrus clementina]
 gb|ESR51320.1| hypothetical protein CICLE_v10030641mg [Citrus clementina]
Length=925

 Score =   546 bits (1407),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 328/608 (54%), Positives = 409/608 (67%), Gaps = 44/608 (7%)
 Frame = +3

Query  1635  ERLNHV-SSVHTLGESNRANGSVRSNQFVLRDKRNSIE------GITS--NDWKDTKVRS  1787
             ++L HV S +H   ES ++N  + S++F+ ++K+N I       G+T+  N W++T  + 
Sbjct  344   DKLKHVKSQLHF--ESAKSNRRLSSSEFMGKEKKNDISKDVYKAGMTNAHNGWEET-TKG  400

Query  1788  KETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRL  1967
               T NV        LE KI+ML+ ELREAAA+E+GL+SVVAEHGSST+KVH PARRLSR 
Sbjct  401   LSTRNV-------GLEFKIEMLQDELREAAALEVGLYSVVAEHGSSTSKVHTPARRLSRF  453

Query  1968  YFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQ  2147
             YFHAC+  S  +R SAAR+ +SGL+LV+KACGNDVPRLTFWLSN VLLRA +       Q
Sbjct  454   YFHACRAMSKAKRASAARTAISGLVLVSKACGNDVPRLTFWLSNTVLLRAIVSHAIGGMQ  513

Query  2148  L---PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             L   P ++   K  + +   + +P + +S    +   N++ G  +DWEN   F  ALEK+
Sbjct  514   LSDGPSTNNGDKKGLAE---RFTPKRQESISEIEK--NNVIGESDDWENLQTFIVALEKL  568

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             EAWIFSRI+ES+WWQT TPHMQS A     S   K   R +    +E  NFS+ELWKKAF
Sbjct  569   EAWIFSRIVESVWWQTLTPHMQSAAVKG--SSSRKASGRRNGLGDQEQGNFSIELWKKAF  626

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA ER+CPV+AGGHECGCL +L+KL+M+Q V RLDVAMFNAILRESA+++PTDPVSDPI
Sbjct  627   KDACERLCPVQAGGHECGCLPVLAKLVMEQLVGRLDVAMFNAILRESAEEMPTDPVSDPI  686

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
             S+P+VLPIPAGK+SF AGAQLKNAIGNWSRWL DLFGIDD+D  +D+ E  + KA     
Sbjct  687   SDPKVLPIPAGKSSFGAGAQLKNAIGNWSRWLTDLFGIDDNDPLEDVNEVCDEKA-----  741

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
              ER       KPF LLNA+SDLMMLP +ML     RKEVCPTFG  LI RVLN F+PDEF
Sbjct  742   IERY---TSFKPFQLLNALSDLMMLPCEMLADNYTRKEVCPTFGAPLIKRVLNNFVPDEF  798

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
              PDPI   V EAL+SE   E EE S+ +FPC A P VY+P  AA+           +  L
Sbjct  799   NPDPISPSVFEALDSEGPCEDEEGSLTSFPCMATPTVYSPAPAAS--LSGIVGEVGNQAL  856

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLL  3383
              RS S+VL+KSYTSDDELDELDS +  I  +NS  +           G G    +RY+LL
Sbjct  857   QRSGSAVLRKSYTSDDELDELDSSITSIIADNSHPSPLSAAPNWMPKGQGGRKVIRYKLL  916

Query  3384  REVWMSSE  3407
             REVW   E
Sbjct  917   REVWKDGE  924


 Score =   183 bits (465),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 128/198 (65%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ +YLIN+ EI+PWPPSQSL ++ +V++QWE+GD NSGS      
Sbjct  1    MVLGLKTKNKKRGSVQVDYLINLQEIRPWPPSQSLVSVHSVLLQWENGDLNSGSLA----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG G+IEFNE FR+ +TL  E S K +  D+FQKN +E  LYE  ++  VKGQ
Sbjct  57   -----SSVGGGKIEFNERFRISVTLYGEASKKGIANDSFQKNYLEIYLYETGKEKRVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++KEG+ +S PIN K+S RN  QP   L I+   K    + + +++ 
Sbjct  112  LLGSAVINLADYGIIKEGIAISAPINFKKSSRNVAQPNFYLVIEPFYKDNSSAALNSSLL  171

Query  705  RESSMDSSAGESVSALMN  758
            +E S+D    E+ S L N
Sbjct  172  KEVSLDKDGSETFSELTN  189



>ref|XP_007225287.1| hypothetical protein PRUPE_ppa001362mg [Prunus persica]
 gb|EMJ26486.1| hypothetical protein PRUPE_ppa001362mg [Prunus persica]
Length=844

 Score =   543 bits (1399),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 330/629 (52%), Positives = 402/629 (64%), Gaps = 29/629 (5%)
 Frame = +3

Query  1548  QDNTTKQHLEGNSAIIAGRESVG---AKTTCDERLNHVSSVHTLGESNRANGSVRSNQFV  1718
             QD T KQ    +      R +VG   +K   +E L HV S+     S + N    +N+FV
Sbjct  236   QDATRKQVRLKSETFTISRNTVGVQGSKVKSNE-LKHVKSLQLPFVSAQNNRLPSNNEFV  294

Query  1719  LRDKRNSI-EGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGL  1895
              + K   I E I            +ET+    + K  +LE  I++L+ ELREAAAVE+GL
Sbjct  295   EKSKEADIPEDIHVCGMISGTSEREETTTRFSDSKV-DLESTIELLKEELREAAAVEVGL  353

Query  1896  FSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVP  2075
             +SV AEHGSS NK+HAPARRLSR YF+ACK +S  ++ +AAR+ ++GLILV+KACGNDVP
Sbjct  354   YSVAAEHGSSANKIHAPARRLSRFYFNACKTSSQAKKGNAARAAITGLILVSKACGNDVP  413

Query  2076  RLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGND  2255
             RLTFWLSN ++LR  I +   K Q+        NA      K        FP  K   + 
Sbjct  414   RLTFWLSNSIVLRGIISQSLGKPQISARPRTKINAGGLLSAK------NGFPLHKEENDR  467

Query  2256  LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQR  2435
                +F+ WE+P  F  ALEK E WIFSRI+ES+WWQ  TP+MQS AA    S   K Y R
Sbjct  468   TLESFDTWEDPQIFMAALEKFEGWIFSRIVESVWWQNMTPYMQSAAAKG--SSSRKTYGR  525

Query  2436  TSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAM  2615
                    E  NFS+ELWKKAF+DA ER+CP RAGGHECGCL LL++L+M++ V RLDVAM
Sbjct  526   KYGLGGHEQGNFSMELWKKAFKDACERLCPARAGGHECGCLPLLARLVMERLVDRLDVAM  585

Query  2616  FNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGId  2795
             FNAILRE+A+++PTDPVSDPIS+ +VLPIPAGK+SF AGAQLKNAIG+WSRWL DLFGID
Sbjct  586   FNAILRENAEEMPTDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAIGSWSRWLTDLFGID  645

Query  2796  dddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEV  2975
             D D  DD  E  + K  N         D   K F LLNA+SDLMMLP DML  ++ RKEV
Sbjct  646   DSDAPDDDTELSDQKRLNC--------DTSFKAFRLLNALSDLMMLPFDMLADKSTRKEV  697

Query  2976  CPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYA  3155
             CPTFG  LI RVL  F+ DEFCPDPIP  V EAL+ E+++E E ES  +FPC+A P VY+
Sbjct  698   CPTFGAPLIKRVLYNFVSDEFCPDPIPEAVFEALDYEENLEAEIESASSFPCAANPTVYS  757

Query  3156  PPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEV----  3323
             PP AA+   I       S  L RS SSV+KKSYTSDDELDELDSP+  I ++NS V    
Sbjct  758   PPPAAS--IIGIIGEVGSPTLLRSGSSVVKKSYTSDDELDELDSPMTAIIIDNSPVSPGS  815

Query  3324  -TKPgggsgngngngVRYQLLREVWMSSE  3407
              T        G    VRYQLLREVW  SE
Sbjct  816   LTANSVLKSKGGRKVVRYQLLREVWKDSE  844


 Score =   182 bits (463),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 135/198 (68%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   +VQ +YLI++ EIKPWP S++L+++++V++QWE+GD+ SGS T    
Sbjct  1    MVLGIRTKSRKSTAVQVDYLIHVQEIKPWPSSKALRSVQSVLLQWENGDQVSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG+G+IEF ESF +P+TL RE S KS   DT+QKN +EF LYEPR+D  VKGQ
Sbjct  57   -----CNVGDGKIEFGESFTLPVTLYREKSRKSTVRDTYQKNNLEFYLYEPRKDKAVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL +AVI+ A+YG++ E  NVS P+N K+S++++ QP+L + +Q   K       + ++ 
Sbjct  112  LLASAVINLADYGIIIETRNVSTPLNWKKSFKSSAQPVLYVNVQPCVKPSSSLSPKGSLS  171

Query  705  RESSMDSSAGESVSALMN  758
            RE S+++   ESV   MN
Sbjct  172  REVSLENDGTESVPESMN  189



>ref|XP_006438081.1| hypothetical protein CICLE_v10030641mg [Citrus clementina]
 gb|ESR51321.1| hypothetical protein CICLE_v10030641mg [Citrus clementina]
Length=954

 Score =   546 bits (1407),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 325/608 (53%), Positives = 406/608 (67%), Gaps = 44/608 (7%)
 Frame = +3

Query  1635  ERLNHV-SSVHTLGESNRANGSVRSNQFVLRDKRNSIE------GITS--NDWKDTKVRS  1787
             ++L HV S +H   ES ++N  + S++F+ ++K+N I       G+T+  N W++T  + 
Sbjct  373   DKLKHVKSQLHF--ESAKSNRRLSSSEFMGKEKKNDISKDVYKAGMTNAHNGWEET-TKG  429

Query  1788  KETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRL  1967
               T NV        LE KI+ML+ ELREAAA+E+GL+SVVAEHGSST+KVH PARRLSR 
Sbjct  430   LSTRNV-------GLEFKIEMLQDELREAAALEVGLYSVVAEHGSSTSKVHTPARRLSRF  482

Query  1968  YFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQ  2147
             YFHAC+  S  +R SAAR+ +SGL+LV+KACGNDVPRLTFWLSN VLLRA +       Q
Sbjct  483   YFHACRAMSKAKRASAARTAISGLVLVSKACGNDVPRLTFWLSNTVLLRAIVSHAIGGMQ  542

Query  2148  L---PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             L   P ++   K  + +   + +P + +S    +   N++ G  +DWEN   F  ALEK+
Sbjct  543   LSDGPSTNNGDKKGLAE---RFTPKRQESISEIEK--NNVIGESDDWENLQTFIVALEKL  597

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             EAWIFSRI+ES+WWQT TPHMQS A     S   K   R +    +E  NFS+ELWKKAF
Sbjct  598   EAWIFSRIVESVWWQTLTPHMQSAAVKG--SSSRKASGRRNGLGDQEQGNFSIELWKKAF  655

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA ER+CPV+AGGHECGCL +L+KL+M+Q V RLDVAMFNAILRESA+++PTDPVSDPI
Sbjct  656   KDACERLCPVQAGGHECGCLPVLAKLVMEQLVGRLDVAMFNAILRESAEEMPTDPVSDPI  715

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
             S+P+VLPIPAGK+SF AGAQLKNAIGNWSRWL DLFGI     DD+   +D N+  +   
Sbjct  716   SDPKVLPIPAGKSSFGAGAQLKNAIGNWSRWLTDLFGI-----DDNDPLEDVNEVCDEKA  770

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
              ER       KPF LLNA+SDLMMLP +ML     RKEVCPTFG  LI RVLN F+PDEF
Sbjct  771   IERY---TSFKPFQLLNALSDLMMLPCEMLADNYTRKEVCPTFGAPLIKRVLNNFVPDEF  827

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
              PDPI   V EAL+SE   E EE S+ +FPC A P VY+P  AA+           +  L
Sbjct  828   NPDPISPSVFEALDSEGPCEDEEGSLTSFPCMATPTVYSPAPAAS--LSGIVGEVGNQAL  885

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLL  3383
              RS S+VL+KSYTSDDELDELDS +  I  +NS  +           G G    +RY+LL
Sbjct  886   QRSGSAVLRKSYTSDDELDELDSSITSIIADNSHPSPLSAAPNWMPKGQGGRKVIRYKLL  945

Query  3384  REVWMSSE  3407
             REVW   E
Sbjct  946   REVWKDGE  953


 Score =   183 bits (464),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 128/198 (65%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ +YLIN+ EI+PWPPSQSL ++ +V++QWE+GD NSGS      
Sbjct  1    MVLGLKTKNKKRGSVQVDYLINLQEIRPWPPSQSLVSVHSVLLQWENGDLNSGSLA----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG G+IEFNE FR+ +TL  E S K +  D+FQKN +E  LYE  ++  VKGQ
Sbjct  57   -----SSVGGGKIEFNERFRISVTLYGEASKKGIANDSFQKNYLEIYLYETGKEKRVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++KEG+ +S PIN K+S RN  QP   L I+   K    + + +++ 
Sbjct  112  LLGSAVINLADYGIIKEGIAISAPINFKKSSRNVAQPNFYLVIEPFYKDNSSAALNSSLL  171

Query  705  RESSMDSSAGESVSALMN  758
            +E S+D    E+ S L N
Sbjct  172  KEVSLDKDGSETFSELTN  189



>ref|XP_008222064.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103321987 
[Prunus mume]
Length=1016

 Score =   548 bits (1411),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 347/724 (48%), Positives = 438/724 (60%), Gaps = 44/724 (6%)
 Frame = +3

Query  1269  NIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTG-VSDNGLAEGENTEGH-QGNTQ  1442
             NI DNR             I ++ S  S  + E+++ G ++ N   EG ++    Q +T 
Sbjct  326   NIKDNR-------------IHKTLSNSSARMHENSQVGNIASNHATEGASSSTPIQEDTD  372

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVG--  1616
              +       Q   E   L+  K    + +  +   QD+T KQ    +     GR +VG  
Sbjct  373   SVFASNADSQANREDGHLLKVKEYSFDDKLSSRFSQDSTRKQVRLKSETFTIGRNTVGVQ  432

Query  1617  -AKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSI-EGITSNDWKDTKVRSK  1790
              +K   +E L HV S+     S + N    +N+FV + K   I E +            +
Sbjct  433   GSKVKSNE-LKHVKSLQLPFVSAQNNRLPSNNEFVEKLKEADIPEDVHVCGMISGTSERE  491

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             ET+    + K  +LE  I++L+ ELREAAAVE+GL+SV AEHGSS NK+HAPARRLSR Y
Sbjct  492   ETTTRFSDSKV-DLESTIELLKEELREAAAVEVGLYSVAAEHGSSANKIHAPARRLSRFY  550

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL  2150
              +ACK +S  ++ +AAR+ ++GLILV+KACGNDVPRLTFWLSN ++LR  I +   K Q+
Sbjct  551   LNACKASSQAKKGNAARAAITGLILVSKACGNDVPRLTFWLSNSIVLRGIISQTLGKPQI  610

Query  2151  PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
                     NA      K        FP  K   +    +F++WE+P  F   LEK E WI
Sbjct  611   SARPRTKINAGGLLSAK------NGFPPHKEENDRTLESFDNWEDPQIFMATLEKFEGWI  664

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             FSRI+ES+WWQ  TP+MQS AA    S   K Y R       E  NFS+ELWKKAF+DA 
Sbjct  665   FSRIVESVWWQNMTPYMQSAAAKGSSSR--KTYGRKYGLGGHEQGNFSMELWKKAFKDAC  722

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             ER+CP RAGGHECGCL LL++L+M+Q V RLDVAMFNAILRE+A+++PTDPVSDPIS+ +
Sbjct  723   ERLCPARAGGHECGCLPLLARLVMEQLVDRLDVAMFNAILRENAEEMPTDPVSDPISDSK  782

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAGK+SF AGAQLKNAIG+WSRWL DLFGIDD D  DD  E  + K  N       
Sbjct  783   VLPIPAGKSSFGAGAQLKNAIGSWSRWLTDLFGIDDSDAPDDDTELSDQKRLNC------  836

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
               +   K F LLNA+SDLMMLP DML  ++ RKEVCPTFG  LI RVL  F+ DEFCPDP
Sbjct  837   --ETSFKAFRLLNALSDLMMLPFDMLADKSTRKEVCPTFGAPLIKRVLYNFVSDEFCPDP  894

Query  3051  IPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsr  3230
             IP  V EAL+ E+++E E ES  +FPC+A P VY+PP AA+   I       S  L RS 
Sbjct  895   IPEAVFEALDYEENLEAEVESASSFPCAANPTVYSPPPAAS--LIGIIGEVGSPTLLRSG  952

Query  3231  ssVLKKSYTsddeldeldsPLNLIKMENSEV-----TKPgggsgngngngVRYQLLREVW  3395
             SSV+KKSYTSDDELDELDSP+  I ++NS V     T        G    VRYQLLREVW
Sbjct  953   SSVVKKSYTSDDELDELDSPMTAIIIDNSPVSPSSLTANSVLKSKGGRKVVRYQLLREVW  1012

Query  3396  MSSE  3407
               SE
Sbjct  1013  KDSE  1016


 Score =   185 bits (470),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 136/198 (69%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   +VQ +YLI+++EIKPWP SQ+L+++++V++QWE+GD+ SGS T    
Sbjct  1    MVLGIRTKSRKSTAVQVDYLIHVLEIKPWPSSQALRSVQSVLLQWENGDQVSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG+G+IEF ESF +P+TL RE S KS   DT+QKN +EF LYEPR+D  VKGQ
Sbjct  57   -----CNVGDGKIEFGESFTLPVTLYREKSRKSTVRDTYQKNNLEFYLYEPRKDKAVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL +AVI+ A+YG++ E  NVS P+N K+S++++ QP+L + +Q   K       + ++ 
Sbjct  112  LLASAVINLADYGIIIETRNVSTPLNWKKSFKSSAQPVLYVNVQPCVKPSSSLSPKGSLS  171

Query  705  RESSMDSSAGESVSALMN  758
            RE S+++   +SV   MN
Sbjct  172  REVSLENDGTQSVPESMN  189



>emb|CBI27581.3| unnamed protein product [Vitis vinifera]
Length=744

 Score =   537 bits (1383),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 334/642 (52%), Positives = 416/642 (65%), Gaps = 58/642 (9%)
 Frame = +3

Query  1521  EGEPVNSCLQDNTTKQ-HLEGNSAIIAGR--ESVGAKTTCDERLNHVSSVHTLGESNRAN  1691
             E E V+   QD T KQ  L  N+     R  E  G+  T + +L HV SV    E  +  
Sbjct  148   ENELVSKFTQDVTRKQVALRSNTLAFNKRVPEMQGSLAT-NHKLKHVKSVQLSYERAKPE  206

Query  1692  GSVRSNQ-FVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELR  1868
              S +  + F   +++  I     N++ D+KV               E+E +I+MLE ELR
Sbjct  207   DSHKDAKGFAASERKERI-----NNFSDSKV---------------EVESRIKMLEEELR  246

Query  1869  EAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILV  2048
             EAAA+E+GL+SVVAEHGSSTNKVHAPARRLSR Y HACK  +  +R SAAR+  SGL+LV
Sbjct  247   EAAAIEVGLYSVVAEHGSSTNKVHAPARRLSRFYLHACKARTQAKRASAARAAASGLVLV  306

Query  2049  AKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSF  2228
             +KACGNDVPRLTFWLSN ++LRA + +     ++PLS+  S  +     R          
Sbjct  307   SKACGNDVPRLTFWLSNSIVLRATVSQ--AVVEMPLSAGPSTRSGGGRNR----------  354

Query  2229  PHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD  2408
              + K   N    + +DWE+P  F   LEK+E WIFSRIIES+WWQT TP+MQS AA   D
Sbjct  355   -YNKEENNARESS-DDWEDPQTFILVLEKIEGWIFSRIIESVWWQTLTPYMQSTAAKISD  412

Query  2409  ----SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKL  2576
                 S   K Y R  S   +E  NFS+ELWK+AF+DA ER+CP RAGGHECGCL +LS+L
Sbjct  413   GSRGSNSRKTYGRRHSLGDQEQGNFSIELWKRAFKDACERLCPTRAGGHECGCLPVLSRL  472

Query  2577  IMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIG  2756
             +M+Q V+RLDV MFNAILRESA+++PTDPVSDPI + +VLPIPAGK+SF AGAQLKNA+G
Sbjct  473   VMEQLVSRLDVGMFNAILRESAEEMPTDPVSDPICDSKVLPIPAGKSSFGAGAQLKNAVG  532

Query  2757  NWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLP  2936
             NWSRWL DLFGIDD+D   D  E  ++K        R   +   K F+LLNA+SDLMMLP
Sbjct  533   NWSRWLTDLFGIDDNDAPGDTNEFSDDK--------RLKCETSFKVFHLLNALSDLMMLP  584

Query  2937  KDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESV  3116
              +ML  R+ RKEVCPTFG+ +I RVL+ F+PDEFCPDPIP V+ E L+SED +E  EES+
Sbjct  585   FEMLADRSTRKEVCPTFGVPIIRRVLDNFVPDEFCPDPIPEVIFETLDSEDSLEGAEESI  644

Query  3117  VNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLN  3296
              +FPC A P VY+PPSAA+           S  L RS SS+L+KSY SDDELDELDSP+ 
Sbjct  645   TSFPCIATPPVYSPPSAAS--FASIIGEVGSQSLQRSGSSLLRKSYISDDELDELDSPIT  702

Query  3297  LIKMENSE----VTKPg-ggsgngngngVRYQLLREVWMSSE  3407
              I  +NS      TKP     G G  + VRY+LLREVW   E
Sbjct  703   SIIGDNSRGTPTSTKPSWLPKGKGGRDVVRYRLLREVWRDGE  744



>ref|NP_186830.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001189790.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF03435.1|AC010797_11 hypothetical protein [Arabidopsis thaliana]
 dbj|BAC42049.1| unknown protein [Arabidopsis thaliana]
 gb|AEE73717.1| uncharacterized protein AT3G01810 [Arabidopsis thaliana]
 gb|AEE73719.1| uncharacterized protein AT3G01810 [Arabidopsis thaliana]
Length=921

 Score =   542 bits (1397),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 309/590 (52%), Positives = 402/590 (68%), Gaps = 35/590 (6%)
 Frame = +3

Query  1665  TLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKI  1844
             ++ E +R   SVRS+  +  ++ NS   + S + K+ KV    T +  LE K + LE ++
Sbjct  358   SIVEKSRKVKSVRSSLDI--NRSNSRLSLFS-ERKEAKVYPNSTHDTTLESKIKNLESRV  414

Query  1845  QMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARS  2024
             + LEGEL EAAA+E  L+SVVAEHGSS++KVHAPARRL RLY HAC+E  + RR +AA S
Sbjct  415   KKLEGELCEAAAIEAALYSVVAEHGSSSSKVHAPARRLLRLYLHACRETHLSRRANAAES  474

Query  2025  VVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS--KNAVVKNER  2198
              VSGL+LVAKACGNDVPRLTFWLSN ++LR  I   S +++LP+S+     K    +   
Sbjct  475   AVSGLVLVAKACGNDVPRLTFWLSNTIVLRTIISDTSAEEELPVSAGPGPRKQKAERETE  534

Query  2199  KASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPH  2378
             K S LKW+  P  K    D+  +F  W++P+ F  ALEKVEAWIFSR++ESIWWQT TP 
Sbjct  535   KRSSLKWKDSPLSK---KDI-KSFGAWDDPVTFITALEKVEAWIFSRVVESIWWQTLTPR  590

Query  2379  MQSGAATSLD------SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGG  2540
             MQS AA++ +      S   K + RT SS ++E  +FSLELWKKAFR+A+ER+CP+R  G
Sbjct  591   MQSSAASTREFDKGNGSASKKTFGRTPSSTNQELGDFSLELWKKAFREAHERLCPLRGSG  650

Query  2541  HECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKAS  2720
             HECGCL + ++LIM+QCVARLDVAMFNAILR+S D+ PTDPVSDPI++  VLPIP+  +S
Sbjct  651   HECGCLPIPARLIMEQCVARLDVAMFNAILRDSDDNFPTDPVSDPIADLRVLPIPSRTSS  710

Query  2721  FAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFY  2900
             F +GAQLKN+IGNWSRWL DLFGIDD+D+D         K+               K F 
Sbjct  711   FGSGAQLKNSIGNWSRWLTDLFGIDDEDDDSSDENSYVEKS--------------FKTFN  756

Query  2901  LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALN  3080
             LL A+SDLMMLPKDMLL+ +VRKEVCP FG  LI RVLN F+PDEFCPDP+P+ VL++L 
Sbjct  757   LLKALSDLMMLPKDMLLNSSVRKEVCPMFGAPLIKRVLNNFVPDEFCPDPVPDAVLKSLE  816

Query  3081  SEDHMEVEEESVVNFPCSAAPIVYAPPS-AAAldgilgdisssssqltrsrssVLKKSYT  3257
             SE+  E E+  + ++PC+A   VY PPS  +    I       + QL+R RSS+ +K+YT
Sbjct  817   SEE--EAEKSIITSYPCTAPSPVYCPPSRTSISTIIGNFGQPQAPQLSRIRSSITRKAYT  874

Query  3258  sddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWMSSE  3407
             SDDELDEL SPL ++ ++ +   K    +       +RYQLLRE WM+ E
Sbjct  875   SDDELDELSSPLAVVVLQQAGSKK---INNGDADETIRYQLLRECWMNGE  921


 Score =   212 bits (539),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 7/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   SVQ +YLI+I +IKPWPPSQSL++L++VVIQWE+GD+NSG+T+ VAP
Sbjct  1    MVLGLSSKNRRCSSVQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGDRNSGTTSVVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESF++P+TLL+++S++   GD F KN +E NLYEPRR+ T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFKLPLTLLKDVSARGKGGDVFFKNVLELNLYEPRREKT--HQ  116

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A YGVVKE  +++  +N KRSYRN  QP+L L IQ V + R  S   N+++
Sbjct  117  LLATATIDLAVYGVVKESFSLTAQMNSKRSYRNATQPVLYLTIQPVSRRRASSSSMNSLK  176

Query  705  RESSMDSSAGESVSALMN  758
             E+    + GESVSALMN
Sbjct  177  DEA---KNGGESVSALMN  191



>dbj|BAE98842.1| hypothetical protein [Arabidopsis thaliana]
Length=920

 Score =   541 bits (1395),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 309/590 (52%), Positives = 402/590 (68%), Gaps = 36/590 (6%)
 Frame = +3

Query  1665  TLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKI  1844
             ++ E +R   SVRS+  +  ++ NS   + S + K+ KV    T +  LE K + LE ++
Sbjct  358   SIVEKSRKVKSVRSSLDI--NRSNSRLSLFS-ERKEAKVYPNSTHDTTLESKIKNLESRV  414

Query  1845  QMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARS  2024
             + LEGEL EAAA+E  L+SVVAEHGSS++KVHAPARRL RLY HAC+E  + RR +AA S
Sbjct  415   KKLEGELCEAAAIEAALYSVVAEHGSSSSKVHAPARRLLRLYLHACRETHLSRRANAAES  474

Query  2025  VVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS--KNAVVKNER  2198
              VSGL+LVAKACGNDVPRLTFWLSN ++LR  I   S +++LP+S+     K    +   
Sbjct  475   AVSGLVLVAKACGNDVPRLTFWLSNTIVLRTIISDTSAEEELPVSAGPGPRKQKAERETE  534

Query  2199  KASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPH  2378
             K S LKW+  P  K    D+  +F  W++P+ F  ALEKVEAWIFSR++ESIWWQT TP 
Sbjct  535   KRSSLKWKDSPLSK---KDI-KSFGAWDDPVTFITALEKVEAWIFSRVVESIWWQTLTPR  590

Query  2379  MQSGAATSLD------SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGG  2540
             MQS AA++ +      S   K + RT SS ++E  +FSLELWKKAFR+A+ER+CP+R  G
Sbjct  591   MQSSAASTREFDKGNGSASKKTFGRTPSSTNQELGDFSLELWKKAFREAHERLCPLRGSG  650

Query  2541  HECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKAS  2720
             HECGCL + ++LIM+QCVARLDVAMFNAILR+S D+ PTDPVSDPI++  VLPIP+  +S
Sbjct  651   HECGCLPIPARLIMEQCVARLDVAMFNAILRDSDDNFPTDPVSDPIADLRVLPIPSRTSS  710

Query  2721  FAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFY  2900
             F +GAQLKN+IGNWSRWL DLFGIDD+D+D         K+               K F 
Sbjct  711   FGSGAQLKNSIGNWSRWLTDLFGIDDEDDDSSDENSYVEKS--------------FKTFN  756

Query  2901  LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALN  3080
             LL A+SDLMMLPKDMLL+ +VRKEVCP FG  LI RVLN F+PDEFCPDP+P+ VL++L 
Sbjct  757   LLKALSDLMMLPKDMLLNSSVRKEVCPMFGAPLIKRVLNNFVPDEFCPDPVPDAVLKSLE  816

Query  3081  SEDHMEVEEESVVNFPCSAAPIVYAPPS-AAAldgilgdisssssqltrsrssVLKKSYT  3257
             SE   E E+  + ++PC+A   VY PPS  +    I       + QL+R RSS+ +K+YT
Sbjct  817   SE---EAEKSIITSYPCTAPSPVYCPPSRTSISTIIGNFGQPQAPQLSRIRSSITRKAYT  873

Query  3258  sddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWMSSE  3407
             SDDELDEL SPL ++ ++ +   K    + +     +RYQLLRE WM+ E
Sbjct  874   SDDELDELSSPLAVVVLQQAGSKK---INNDDADETIRYQLLRECWMNGE  920


 Score =   212 bits (540),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 7/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   SVQ +YLI+I +IKPWPPSQSL++L++VVIQWE+GD+NSG+T+ VAP
Sbjct  1    MVLGLSSKNRRCSSVQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGDRNSGTTSVVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESF++P+TLL+++S++   GD F KN +E NLYEPRR+ T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFKLPLTLLKDVSARGKGGDVFFKNVLELNLYEPRREKT--HQ  116

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A YGVVKE  +++  +N KRSYRN  QP+L L IQ V + R  S   N+++
Sbjct  117  LLATATIDLAVYGVVKESFSLTAQMNSKRSYRNATQPVLYLTIQPVSRRRASSSSMNSLK  176

Query  705  RESSMDSSAGESVSALMN  758
             E+    + GESVSALMN
Sbjct  177  DEA---KNGGESVSALMN  191



>ref|XP_006408550.1| hypothetical protein EUTSA_v10020012mg [Eutrema salsugineum]
 gb|ESQ50003.1| hypothetical protein EUTSA_v10020012mg [Eutrema salsugineum]
Length=919

 Score =   535 bits (1379),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 303/559 (54%), Positives = 387/559 (69%), Gaps = 37/559 (7%)
 Frame = +3

Query  1767  KDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAP  1946
             K+ +V  K T +  LE K + LE K++ LEGEL EAAA+E  L+SVVAEHGSS+ KVHAP
Sbjct  386   KEARVYPKSTRDTTLESKVKNLESKVKKLEGELCEAAAIEAALYSVVAEHGSSSTKVHAP  445

Query  1947  ARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAIC  2126
             ARRL RLY HAC+E  + RR +AA+S VSGL+LVAKACGNDVPRLTFWLSN ++LR  I 
Sbjct  446   ARRLLRLYLHACREKHLSRRANAAKSAVSGLVLVAKACGNDVPRLTFWLSNTIILREIIS  505

Query  2127  KFSEKQQLPLSS----EYSKNAVVKNERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPL  2291
               + +++LP+S+      SK  + + E+++S L+W +S   KK +      +F  W++P 
Sbjct  506   DANAEEELPVSAGPGPRRSKTQIEETEKRSS-LRWKESSLSKKDIE-----SFGAWDDPK  559

Query  2292  GFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD------SEINKIYQRTSSSCS  2453
              F  ALEKVEAWIFSR++ESIWWQT TP MQS AA+S +      S   K + RT SS +
Sbjct  560   TFITALEKVEAWIFSRVVESIWWQTLTPRMQSSAASSREFDKANGSASKKSFGRTPSSVN  619

Query  2454  EEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILR  2633
             +E  +FSLELWKKAFRDA+ER+CP+RA GHECGCL + ++LIM+QCVARLDVAMFNAILR
Sbjct  620   QEQGDFSLELWKKAFRDAHERLCPLRASGHECGCLPVPARLIMEQCVARLDVAMFNAILR  679

Query  2634  ESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedd  2813
             +S ++ PTDPVSDPI +  VLPIP   +SF +GAQLKN+IGNWSRWL DLFGI       
Sbjct  680   DSDENFPTDPVSDPIGDSRVLPIPCTTSSFGSGAQLKNSIGNWSRWLTDLFGI-------  732

Query  2814  dlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGL  2993
                    +  D  +  E    D   K F LL A+SDLMMLPKDMLL+ +VRKEVCP FG 
Sbjct  733   -------DDEDGCSSDENSYVDRSFKTFNLLKALSDLMMLPKDMLLNSSVRKEVCPMFGA  785

Query  2994  SLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAA  3173
              +I RVL  F+PDEFCPDP+P+ VLEAL S    E E+  + ++PC+A P+VY+PPS  +
Sbjct  786   PVIKRVLKNFVPDEFCPDPVPDAVLEALES--EEEAEKAMITSYPCTAPPLVYSPPSGTS  843

Query  3174  ldgilgdisssssqlt-rsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgn  3350
             +  ILGD     +    R RSSV +K+YTSDDELDEL SPL+++ ++ +   K    +  
Sbjct  844   ISAILGDFGQPQAPQLCRIRSSVTRKAYTSDDELDELSSPLDVVVLQQAGSKK---VNNG  900

Query  3351  gngngVRYQLLREVWMSSE  3407
             G    VRYQLLRE W + E
Sbjct  901   GADETVRYQLLRECWTNRE  919


 Score =   213 bits (543),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 149/198 (75%), Gaps = 7/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   S+Q +YLI+I +IKPWPPSQSL++L++VVIQWE+GD+NSG+T  VAP
Sbjct  1    MVLGLSSKNRRGSSIQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGDRNSGTTNVVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESF++P+TLL++ S+++  GD F KN +E NLYEPRR+ T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFKLPVTLLKDASARNKGGDVFFKNVLELNLYEPRREKT--HQ  116

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A+YG+VK+ L+++ P+NCKRSYRNT QP+L L +Q V + R  S  RN+ +
Sbjct  117  LLATATIDLADYGIVKDSLSLTAPMNCKRSYRNTTQPVLFLTVQPVDRRRASSSSRNSSK  176

Query  705  RESSMDSSAGESVSALMN  758
             E+   ++  ESVSALMN
Sbjct  177  DEA---TNGCESVSALMN  191



>ref|XP_008360127.1| PREDICTED: uncharacterized protein LOC103423821 [Malus domestica]
 ref|XP_008360128.1| PREDICTED: uncharacterized protein LOC103423821 [Malus domestica]
Length=1018

 Score =   538 bits (1386),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 321/611 (53%), Positives = 394/611 (64%), Gaps = 49/611 (8%)
 Frame = +3

Query  1614  GAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRN------SIEG-ITSNDWKD  1772
             G+K   +E L HV SV     S + N    +N+F+ + K        S+ G I+S    +
Sbjct  444   GSKAKSNE-LKHVESVQLPLVSAQNNRQSSNNEFLKKSKEAETPEDASVHGWISSTSESE  502

Query  1773  TKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPAR  1952
              K+ S   S V       +LE  I++L+ ELREAAAVE+GL+SV AEHGS TNK+HAPAR
Sbjct  503   QKIVSFSDSKV-------DLESTIELLKEELREAAAVEVGLYSVAAEHGSHTNKIHAPAR  555

Query  1953  RLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF  2132
             RLSR YFHACK +S   + +AAR+ ++GLILV+KACGNDV RLTFWLSN ++LRA I   
Sbjct  556   RLSRFYFHACKTSSRANKANAARAAITGLILVSKACGNDVARLTFWLSNSIVLRAII---  612

Query  2133  SEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALE  2312
                 Q    ++ +    +K +          FP  K   N    +F+DWE+P  F  ALE
Sbjct  613   ---SQTLSCNKINAEGFLKPK--------NGFPPHKEENNSTVESFDDWEDPQIFMAALE  661

Query  2313  KVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKK  2492
             K E WIFSRI+ES+WWQ  TP+MQS AA    S   K   R     S E  NFS+ELWKK
Sbjct  662   KFEGWIFSRIVESVWWQNMTPYMQSAAAKG--SSSRKASGRRHGLGSHEQGNFSMELWKK  719

Query  2493  AFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSD  2672
             AF+DA ER+CP RAGGHECGCL LL++L+M+Q V RLDVAMFNAILRE+A+++PTDPVSD
Sbjct  720   AFKDACERLCPARAGGHECGCLPLLARLVMEQLVDRLDVAMFNAILRENAEEMPTDPVSD  779

Query  2673  PISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS  2852
             PIS+ +VLPIPAG  SF AG QLKNAIG+WSRWL DLFGIDD D  D          DN+
Sbjct  780   PISDSKVLPIPAGNLSFGAGVQLKNAIGSWSRWLTDLFGIDDTDAPD----------DNT  829

Query  2853  NGHERKAQ--DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
                + K Q  +   K F LLNA+SDLMMLP DML  ++ RKEVCPTFG SLI RVL  F+
Sbjct  830   ELSDHKGQECETSFKAFRLLNALSDLMMLPLDMLADKSTRKEVCPTFGASLIKRVLYNFV  889

Query  3027  PDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             PDEFCPDPIP  V EAL+ E+ +E E ES  +FPC+A P VY+PP AA+   +       
Sbjct  890   PDEFCPDPIPEAVFEALDYEEDLEAEAESAASFPCNANPTVYSPPPAAS--LLGIIGDVG  947

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngn----gngVRY  3374
             S   +RS SSVLKKSYTSDDELDELDSP+  I ++NS  +     +           VRY
Sbjct  948   SPTFSRSGSSVLKKSYTSDDELDELDSPMTSIIIDNSPFSPSPLAASTPKWKGGQKAVRY  1007

Query  3375  QLLREVWMSSE  3407
             QLLREVW  SE
Sbjct  1008  QLLREVWKDSE  1018


 Score =   175 bits (444),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   +V+ +YLI++ E+KPWP SQ+LK++++V++QWE+GD+ SGS      
Sbjct  1    MVLGIRAKSRKSAAVEVDYLIHVQELKPWPSSQALKSVQSVLLQWENGDQVSGSCI----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG+G+IE  ESF +P+TL +E S KS   D++ KN +EF LYEPR+D  VKGQ
Sbjct  57   -----CNVGDGKIEIGESFTLPVTLYKEKSRKSAVRDSYLKNNLEFYLYEPRKDKGVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++ E  NVS P+N K+S++++ QP+L + IQ  GK       ++++ 
Sbjct  112  LLGSAVINLADYGIIVETRNVSTPLNWKKSFKSSSQPVLYVTIQPCGKSSSSLTPKSSLS  171

Query  705  RESSMDSSAGESV  743
            RE S+++   ESV
Sbjct  172  REVSLENDGTESV  184



>ref|XP_010436731.1| PREDICTED: uncharacterized protein LOC104720537 [Camelina sativa]
Length=685

 Score =   525 bits (1352),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 260/449 (58%), Positives = 322/449 (72%), Gaps = 28/449 (6%)
 Frame = +3

Query  1767  KDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAP  1946
             K+ KV  K T +  LE K + LE K+  LEGELREAAA+E  L+SVVAEHGSS++KVHAP
Sbjct  250   KEAKVYPKSTRDTTLESKVKNLESKVNKLEGELREAAAIEAALYSVVAEHGSSSSKVHAP  309

Query  1947  ARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAIC  2126
             ARRL RLY HAC+EN + RR +AA+S VSGL+LVAKACGNDVPRLTFWLSN ++LR  I 
Sbjct  310   ARRLLRLYLHACRENHLSRRANAAKSAVSGLVLVAKACGNDVPRLTFWLSNTIVLRTIIS  369

Query  2127  KFSEKQQLPLSSEYS--KNAVVKNERKASPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGF  2297
               + +++LP+S+     K  V +   K S LKW+ S   KK +      +F  W++P+ F
Sbjct  370   DTTAEEELPVSAGPGPRKQKVERETDKKSSLKWKDSSLSKKDIE-----SFGTWDDPVTF  424

Query  2298  TKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD------SEINKIYQRTSSSCSEE  2459
               ALEKVEAWIFSR++ESIWWQT TP  QS AA++ +      S   K + RT SS ++E
Sbjct  425   IAALEKVEAWIFSRVVESIWWQTLTPRTQSSAASTTEFDKANGSASKKNFGRTPSSMNQE  484

Query  2460  PENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRES  2639
               +FSLELWKKAFRDA+ER+CP+RA GHECGCL + ++LIM+QCVARLDVAMFNAILR+S
Sbjct  485   QGDFSLELWKKAFRDAHERLCPLRASGHECGCLPVPARLIMEQCVARLDVAMFNAILRDS  544

Query  2640  ADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddl  2819
              ++ PTDPVSDPI++  VLPIP   +SF +GAQLKN+IGNWSRWL DLFGI         
Sbjct  545   DENFPTDPVSDPIADSRVLPIPCTTSSFGSGAQLKNSIGNWSRWLTDLFGI---------  595

Query  2820  veddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSL  2999
                  +  D  +  E    D   K F+LL A+SDLMMLPKDMLL+ +VRKEVCP  G  L
Sbjct  596   -----DDEDEGSSDENSYVDRSFKTFHLLKALSDLMMLPKDMLLNSSVRKEVCPMLGAPL  650

Query  3000  ITRVLNVFIPDEFCPDPIPNVVLEALNSE  3086
             I RVLN F+PDEFCPDP+P+ V+EAL SE
Sbjct  651   IKRVLNNFVPDEFCPDPVPDAVIEALESE  679



>ref|XP_002312634.2| hypothetical protein POPTR_0008s17750g [Populus trichocarpa]
 gb|EEE90001.2| hypothetical protein POPTR_0008s17750g [Populus trichocarpa]
Length=978

 Score =   531 bits (1367),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 319/646 (49%), Positives = 420/646 (65%), Gaps = 37/646 (6%)
 Frame = +3

Query  1494  LIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLG  1673
             L +EK    E  P     +D + KQ    ++ +   R ++G + T  +++ H+ SV    
Sbjct  362   LEVEKPSLEEKLP-GQLPEDASKKQAKLRSNTLALNRTAIGVQGTRRDKMKHLKSVQLQF  420

Query  1674  ESNRANGSVRSNQFVLRDKR-NSIEGIT--SNDWKDTKVRSKETSNVVLERKCQELEQKI  1844
              S   +    + + + + K+ N  E +   +  ++  +  S  + N V      EL+ K+
Sbjct  421   HSAEGDDPFINRKLIEKPKKINVSENVNKGAKGYEHKQTESNFSGNKV------ELQLKV  474

Query  1845  QMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARS  2024
             +MLE EL EAA VE+GL+SVVAEHGSS NKV APARRLSR Y HACK  S ++R ++AR+
Sbjct  475   EMLEEELMEAATVEVGLYSVVAEHGSSINKVLAPARRLSRFYLHACKARSRVKRANSARA  534

Query  2025  VVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKA  2204
             ++SGLILV+KACGNDVPRLTFWLSN ++LRA + +  EK QL        N   K   ++
Sbjct  535   IISGLILVSKACGNDVPRLTFWLSNSIVLRAIVTQDVEKLQLASVPSIINNGGPKGRHES  594

Query  2205  SPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQ  2384
             SP + +          D   + ++W  P     AL+KVEAWIFSRI+ES+WWQT TPHMQ
Sbjct  595   SPGEVEK--------TDRTESSDEWAEPQPCIAALKKVEAWIFSRIVESVWWQTLTPHMQ  646

Query  2385  SGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHL  2564
             S A  S  S   K   R      +E +NF+++LWKKAFRDA ER+CPVRAGGHECGCL +
Sbjct  647   STAVKS--SHSRKTNARRHGLGDQEQDNFAIDLWKKAFRDACERLCPVRAGGHECGCLPV  704

Query  2565  LSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLK  2744
             LS+L+M+Q V RLDVAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF AGAQLK
Sbjct  705   LSRLVMEQLVGRLDVAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFGAGAQLK  764

Query  2745  NAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDL  2924
             NA+GNWSRWL DLFGI     DD+   +++++ D+S    R+  +   K F LLNA+SDL
Sbjct  765   NAVGNWSRWLTDLFGI-----DDNDSPEEKDELDSS----RRECETSFKAFQLLNALSDL  815

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             MMLP +ML  R+ RKEVCPTFG+ +I RVL+ F+PDEF PDP+P  +LEAL+SED  +  
Sbjct  816   MMLPFEMLGDRSTRKEVCPTFGVPIINRVLDNFVPDEFNPDPVPETILEALDSEDLADSG  875

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             EES+ NFPC AAP +Y+PP AA+              L RSRS++L+KSY SDDELDELD
Sbjct  876   EESITNFPCIAAPTIYSPPPAAS--LTNIIGEVGGQTLQRSRSAMLRKSYASDDELDELD  933

Query  3285  sPLNLIKMENSEVTKPggg-----sgngngngVRYQLLREVWMSSE  3407
             SP+  I ++NS+V+           G      VRYQLLREVW   E
Sbjct  934   SPMTSI-IDNSKVSPTSTAWNWMQKGKAGRKVVRYQLLREVWKDGE  978


 Score =   176 bits (445),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 132/198 (67%), Gaps = 15/198 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   SVQ +Y I++ EIKPWPPSQSLK+++++++QWE+GD++SGS T    
Sbjct  1    MVLGLRSKNRKGTSVQVDYTIHVQEIKPWPPSQSLKSVQSLLLQWENGDQSSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+G++EF ESFR+  TL +E+S K    D+F KN +EFN YE R+D  +KGQ
Sbjct  57   -----SNVGDGKVEFIESFRLSATLCKEVSRKGTARDSFLKNYLEFNFYESRKDKAMKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++ + + ++ PIN K+S R+TV  +L + IQ   +       ++ + 
Sbjct  112  LLGSAVINLADYGIIMDAVTINAPINFKKSSRSTVPAVLYVNIQPFDRD------KSTLS  165

Query  705  RESSMDSSAGESVSALMN  758
            +E S+D    E+VS + N
Sbjct  166  KEVSLDKDGSETVSEVAN  183



>ref|XP_009372322.1| PREDICTED: uncharacterized protein LOC103961496 [Pyrus x bretschneideri]
 ref|XP_009372323.1| PREDICTED: uncharacterized protein LOC103961496 [Pyrus x bretschneideri]
Length=1024

 Score =   531 bits (1367),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 321/630 (51%), Positives = 404/630 (64%), Gaps = 39/630 (6%)
 Frame = +3

Query  1548  QDNTTKQHLEGNSAIIAGRESVG---AKTTCDERLNHVSSVHTLGESNRANGSVRSNQFV  1718
             QD T KQ    +     GR  VG   +K   +E L HV SV     S + N     N+ +
Sbjct  424   QDATRKQVRLKSETFTPGRRVVGVQGSKVKSNE-LKHVKSVQLPLVSAQNNRQSSINELL  482

Query  1719  LRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLF  1898
              + K            + +    +E   V       +LE  I++L+ ELRE+AAVEIGL+
Sbjct  483   EKSKEAETPKDAYVHGRISATSEREQKTVSFSDGKVDLESTIELLKEELRESAAVEIGLY  542

Query  1899  SVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPR  2078
             SVVAEHGS TNK+HAPARRLSR YFHACK +S  ++ +AAR+ ++GLILV+KACGNDV R
Sbjct  543   SVVAEHGSHTNKIHAPARRLSRFYFHACKTSSGAKKANAARAAITGLILVSKACGNDVAR  602

Query  2079  LTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDL  2258
             L FWLSN ++LRA +C     Q LP S   ++ A+     KA   K    PHK+     L
Sbjct  603   LIFWLSNSIVLRAIVC-----QSLPCSKGGAEGAL-----KA---KNGFLPHKEENNCTL  649

Query  2259  PGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRT  2438
               +F+DWE+P  F  ALE+ E WIFSRI+ES+WWQ  TP+MQS AA    S   K   R 
Sbjct  650   E-SFDDWEDPQIFMAALERFEGWIFSRIVESVWWQNMTPYMQSAAAKGSSSR--KANGRK  706

Query  2439  SSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMF  2618
                   E  NFS+ELWKKAF+DA ER+CP RAGGHECG L LL++L+M+Q V RLDVAMF
Sbjct  707   HGLGGHEQGNFSMELWKKAFKDACERLCPARAGGHECGWLPLLARLVMEQLVDRLDVAMF  766

Query  2619  NAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdd  2798
             NAILRE+A+++PTDPVSDPIS+ +VLPIPAGK+SF AGAQLKNAIG+WSRWL DLFGIDD
Sbjct  767   NAILRENAEEMPTDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAIGSWSRWLTDLFGIDD  826

Query  2799  ddedddlveddeNKADNSNGHERKAQDACS--KPFYLLNAMSDLMMLPKDMLLSRTVRKE  2972
              D  D          DN+   + K Q+  +  K F LLNA+SDLMMLP DML  ++ R+E
Sbjct  827   TDAPD----------DNTELSDHKGQECPTSFKAFRLLNALSDLMMLPFDMLADKSTRQE  876

Query  2973  VCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVY  3152
             VCPTFG SLI RV+  F+PDEFCPDPIP  V EAL+ E++ + +  S  +FPC+A P +Y
Sbjct  877   VCPTFGASLIKRVIYNFVPDEFCPDPIPTAVFEALDYEENSDAKTGSAASFPCNANPTIY  936

Query  3153  APPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP  3332
             +PP AA+   +       S  L+RS  SVLKKSYTSDDELDELDSP+  I ++NS  +  
Sbjct  937   SPPPAAS--LLSIIGEVGSLTLSRSGPSVLKKSYTSDDELDELDSPMTSIIIDNSPFSPS  994

Query  3333  gggsgngng-----ngVRYQLLREVWMSSE  3407
                + +        N VRYQLLREVW  S+
Sbjct  995   PLAANSTPKWKGGRNAVRYQLLREVWKDSD  1024


 Score =   175 bits (443),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 134/198 (68%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   +V+ +YLI++ E+KPWP SQ+L+++++V++QWE+GD+ SGS      
Sbjct  1    MVLGIRSKSRKSAAVEVDYLIHVQELKPWPSSQALRSVQSVMLQWENGDQVSGSCI----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG+ +IEF ESF +P+TL +E S K+   DT+QKN +EF LYEPR+D  VKGQ
Sbjct  57   -----CNVGDAKIEFGESFTLPVTLYKEKSRKNAVRDTYQKNNLEFYLYEPRKDKGVKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+A I+ A+YG++ E  NVS P+N K+S++++ + +L + IQ  GK       ++++ 
Sbjct  112  LLGSADINLADYGIIVETRNVSTPLNWKKSFKSSAETVLSVSIQPCGKPSSSLTPKSSLS  171

Query  705  RESSMDSSAGESVSALMN  758
            RE S+++   ESV   +N
Sbjct  172  REESLENGGTESVPGSVN  189



>gb|KDO55630.1| hypothetical protein CISIN_1g001323mg [Citrus sinensis]
Length=993

 Score =   527 bits (1357),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 376/541 (70%), Gaps = 30/541 (6%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEG-EPVNSCLQDNTTKQHLEGNSAIIAGRE---S  1610
             + V  R + ++ G  +E I EKG+ S G EP+N C ++ T  Q   G+ +    RE   +
Sbjct  435   DFVKYRMEQEDNGLERE-IFEKGRHSAGDEPLNFCSRNATRNQVSLGSDSPSPIREDPVN  493

Query  1611  VGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQ--FVLRDKRNSIEGITSNDWKDTK  1778
              G K      +RL +V SV +  +  R+NG+ +  +   VL D  N      S + KD K
Sbjct  494   FGTKRNLLKSDRLKNVRSVRSSSDIARSNGNQKEAKENGVLGDAPNRAGSFGSPERKDYK  553

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
             V  ++T + V E K Q+LE KI MLE ELREAAA+E  L+SVVAEHGSS +KVHAPARRL
Sbjct  554   VYPRDTRSAVAESKIQQLEHKINMLETELREAAAIEASLYSVVAEHGSSMSKVHAPARRL  613

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSE  2138
             SRLY HACKE+   RR SAARS VSGL+LVAKACGNDVPRLTFWLSN ++LRA I + + 
Sbjct  614   SRLYLHACKEDFQSRRASAARSAVSGLVLVAKACGNDVPRLTFWLSNSIVLRAIISQATG  673

Query  2139  KQQLPLSSEYS--KNAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKA  2306
             + + P ++  S  +N+  + N    SPLKW +S   KK   N + G+F+DWE+P     A
Sbjct  674   RLEQPFAAGQSLERNSSQRGNNNITSPLKWKESASRKKDNRNVMRGSFDDWEDPHTLPSA  733

Query  2307  LEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFS  2474
             LEKVEAWIFSRI+ESIWWQT TPHMQS A   +D +I     K  +RTSSS  +E  NFS
Sbjct  734   LEKVEAWIFSRIVESIWWQTLTPHMQSAAERVMDRDIGSCSRKNLERTSSSGDQEQINFS  793

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L+ WKKAF+DA ER+CPVRA GHECGCL LL++LIM+QCVARLDVAMFNAILRESAD+IP
Sbjct  794   LDHWKKAFKDACERLCPVRARGHECGCLPLLARLIMEQCVARLDVAMFNAILRESADEIP  853

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedde  2834
             TDPVSDPIS+ +VLPIPAGK+SF AGAQLKNAIGNWSRWL+DLFG+           DD+
Sbjct  854   TDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAIGNWSRWLSDLFGM-----------DDD  902

Query  2835  NKADNSNGHER--KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITR  3008
             +  DN N H+   + QD+  K F+LLNA+SDLMMLPKD+LLSR++RKEV   F L+LI  
Sbjct  903   DSLDNENEHDADDERQDSSFKSFHLLNALSDLMMLPKDLLLSRSIRKEVSTRFLLALIVY  962

Query  3009  V  3011
             +
Sbjct  963   L  963


 Score =   231 bits (588),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   S+  +Y I+I +IKPWPPSQSL++L++V+IQW++GD+NSGST  V P
Sbjct  1    MVLGLSAKNRKEASIHVDYQIHIQDIKPWPPSQSLRSLRSVMIQWQNGDRNSGSTKTVGP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESFR+ +TLLR+++ K+ + DTF KNC+EFNLYEPRRD T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFRLRVTLLRDMNVKNKDADTFLKNCLEFNLYEPRRDKT---Q  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK--GRMKSLVRNN  698
            LL TA ID A+YG+VKE L+V+ P+N KRS+RNT QP+L +KIQ   K   R  S +R  
Sbjct  116  LLATATIDLADYGIVKETLSVNAPMNSKRSFRNTAQPVLFIKIQPAEKSVSRTSSSLREG  175

Query  699  VRRESSMDSSAGESVSALMN  758
              RE+S+D + GESVSALMN
Sbjct  176  FSREASLDKNGGESVSALMN  195



>gb|KCW53022.1| hypothetical protein EUGRSUZ_J02316 [Eucalyptus grandis]
Length=693

 Score =   515 bits (1327),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 306/559 (55%), Positives = 373/559 (67%), Gaps = 38/559 (7%)
 Frame = +3

Query  1761  DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVH  1940
             D K  KV  K+T   +++ K Q LE KIQMLEGELRE AA+E+ L+SVVAEHG S +K H
Sbjct  163   DIKVDKVYPKDTKRTLMDAKLQRLENKIQMLEGELRETAAIEVALYSVVAEHGGSMSKFH  222

Query  1941  APARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAA  2120
             APARRLSR Y +A  E     R +A RS+V+GL +VA+ACG+DVPRLT+WLSN V+LRA 
Sbjct  223   APARRLSRFYRYAFGELPQASRANAGRSIVAGLFVVARACGSDVPRLTYWLSNSVVLRAI  282

Query  2121  ICKFSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLG  2294
             I +      +  PLSS+                  +S+P KK  GN    T +D EN   
Sbjct  283   ISQMIPNGNIGVPLSSKSK----------------ESYPRKK--GNKNARTDDDSENVHE  324

Query  2295  FTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEP  2462
                 LEKVEAWIFSRI+ES+WWQ+ TP+MQS AA  L S       K  ++ + +  +E 
Sbjct  325   LISELEKVEAWIFSRIVESLWWQSLTPYMQSSAAKLLGSAKGSSSIKNNRKVTYAEDQEQ  384

Query  2463  ENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESA  2642
              N S++LWKKAF DA ER+CPVR GGHECGCL +L+KL+M+ CVARLDVAMFNAILRESA
Sbjct  385   GNISVDLWKKAFTDACERLCPVRGGGHECGCLPVLAKLLMEHCVARLDVAMFNAILRESA  444

Query  2643  DDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlv  2822
             ++IPTDPVSDPIS+P+VLPIPAG++SF AG QLKNAIGNWSRWL          +   L 
Sbjct  445   NEIPTDPVSDPISDPKVLPIPAGRSSFHAGVQLKNAIGNWSRWLT---------DLFGLD  495

Query  2823  eddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
             +DD +   N    E + +DA  K FYLLNA+SDLMMLPKDMLLSR+ RKEVCPTFG SLI
Sbjct  496   DDDLHGDKNKIVDEDETRDATFKSFYLLNALSDLMMLPKDMLLSRSTRKEVCPTFGASLI  555

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldg  3182
              RVL+ F PDEFCPDP+P  VLEAL SED  EV EE V ++P  AA  VY PPSAA+   
Sbjct  556   KRVLDNFSPDEFCPDPVPKAVLEALASEDPFEVGEELVTSYPYIAANPVYPPPSAAS-VA  614

Query  3183  ilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPg----ggsgn  3350
                    + S+L RSRSSVL+K+  SDDELDEL+SPL  I +  S  +            
Sbjct  615   GFLGELGNQSRLRRSRSSVLEKAQNSDDELDELNSPLTSIFLNESSSSTSAEPIQMNGKG  674

Query  3351  gngngVRYQLLREVWMSSE  3407
                  +RY+LLREVWM+ E
Sbjct  675   HRRQPLRYRLLREVWMNCE  693



>ref|XP_010029012.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 ref|XP_010029013.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 ref|XP_010029014.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 ref|XP_010029015.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 ref|XP_010029016.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 ref|XP_010029018.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 ref|XP_010029019.1| PREDICTED: uncharacterized protein LOC104419151 [Eucalyptus grandis]
 gb|KCW55848.1| hypothetical protein EUGRSUZ_I01660 [Eucalyptus grandis]
Length=1060

 Score =   526 bits (1354),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 323/636 (51%), Positives = 413/636 (65%), Gaps = 33/636 (5%)
 Frame = +3

Query  1551  DNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDK  1730
             D  ++Q    N    +G ES G K     RL    SV +  +  ++ G+  +N     +K
Sbjct  441   DAASEQSFLTNDEFSSGGESHGMKGHVIGRLRCAKSVRSPPDIAKSIGTASANLLASHNK  500

Query  1731  RNSIEGI-----TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGL  1895
               ++  I      S + +D KV + +T + +LE K Q+LE +I MLEGEL EAAAVE+ L
Sbjct  501   EGAVTPIGIRSFRSIERRDAKVYTTDTRSALLEAKVQQLENRINMLEGELVEAAAVEVAL  560

Query  1896  FSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVP  2075
             FSVVAEHGSS  KVHAPARRLSRLY HAC+E S  RR SAARS VSGL+LVAKACGNDVP
Sbjct  561   FSVVAEHGSSMAKVHAPARRLSRLYIHACRELSHSRRASAARSAVSGLVLVAKACGNDVP  620

Query  2076  RLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKA---SPLKWQSFPHKKSV  2246
             RL +WLSN V+LR  I +  +K  + LSS    +     ++     S LKW+S   +   
Sbjct  621   RLMYWLSNSVVLRTIISEMMQKMDVSLSSSTQSSKDFAGKQSVEIPSSLKWKSSSRRN--  678

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS---LDSEI  2417
             GN   GT  DWE+   F  ALE+VEAWIFSR IESIWWQT TP+MQS A  +   +DS +
Sbjct  679   GNANGGTACDWEDHHTFVSALERVEAWIFSRAIESIWWQTLTPYMQSTAIKATVIMDSSL  738

Query  2418  NKIYQRTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             N+  ++      E+ + + SL+ WKKAFRDA ER+CPVRA GHECGCL +L++LIM+QCV
Sbjct  739   NESSEKV---IHEDVQGDISLDHWKKAFRDACERLCPVRAVGHECGCLPMLARLIMEQCV  795

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
              RLDVAMFNAILR+SA++IP+DP+SDPI +P+VLPIPAG +SF  GAQLK  IGNWSR L
Sbjct  796   GRLDVAMFNAILRDSANEIPSDPISDPIGDPKVLPIPAGISSFGIGAQLKKTIGNWSRCL  855

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLS  2954
              DLFG           +  +   D     +   +D+  + F+ L+A+SDLMMLPKDMLLS
Sbjct  856   TDLFG----------RDGTDLPEDEGEYVDEGRKDSSFESFHHLSALSDLMMLPKDMLLS  905

Query  2955  RTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCS  3134
             R++RKEVCP F  SLI RVL+ F+PDEF P+PIP+VVLEAL SE H    +ES+ ++P  
Sbjct  906   RSIRKEVCPMFTASLIKRVLDNFVPDEFFPEPIPDVVLEALESEVHSLDADESIADYPYL  965

Query  3135  AAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMEN  3314
             AAP +Y PP  A+  G +     + +QL R  SSV++KSY S+DELDEL+SPL  I M+ 
Sbjct  966   AAPAIYTPP-LASTVGGIIGEVVTDAQLARCGSSVMRKSYASNDELDELNSPLASISMDG  1024

Query  3315  SEVT----KPg-ggsgngngngVRYQLLREVWMSSE  3407
                +    KP      N N N VRY LLREVW + E
Sbjct  1025  PRSSPVSIKPSWTLKQNANQNTVRYDLLREVWTNCE  1060


 Score =   227 bits (579),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 149/197 (76%), Gaps = 12/197 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   SV+  YLI+I EI+PWPPSQSLK++++V+IQWE+G+K+SGST+ V P
Sbjct  1    MVLGLRAKARRSASVKRHYLIHIQEIRPWPPSQSLKSVRSVLIQWENGEKHSGSTSSVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   SG  +G+IEF+ESFR+P+TLLR+ + KS +GD FQKNC+EF+LYEPRRD ++KGQ
Sbjct  61   YLG--SGANDGKIEFSESFRLPVTLLRDAAVKSGDGDAFQKNCLEFHLYEPRRDRSLKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA +D A+YGV+K+ ++++  +NC+R++RNT QP+L +KIQ + K            
Sbjct  119  LLGTASVDLADYGVIKDAISITAQMNCQRNFRNTAQPVLYVKIQPLDKS----------S  168

Query  705  RESSMDSSAGESVSALM  755
             +SSMD +  ESV+ALM
Sbjct  169  SQSSMDKNGSESVAALM  185



>ref|XP_009406405.1| PREDICTED: uncharacterized protein LOC103989324 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406406.1| PREDICTED: uncharacterized protein LOC103989324 [Musa acuminata 
subsp. malaccensis]
Length=1138

 Score =   528 bits (1359),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 291/532 (55%), Positives = 373/532 (70%), Gaps = 20/532 (4%)
 Frame = +3

Query  1818  KCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV  1997
             K  ELE ++++LE ELREAAA+EIGL+S+VAEHGSS +KVH PARRLSRLY HA ++ S 
Sbjct  617   KVHELEFRVKLLEAELREAAAIEIGLYSIVAEHGSSAHKVHTPARRLSRLYNHASRQWST  676

Query  1998  LRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY--S  2171
              RR SAARS+ SGL LVAKACGNDV RLTFWLSN ++LRA + + S+   +P S+    +
Sbjct  677   KRRASAARSIASGLALVAKACGNDVARLTFWLSNTIVLRAIVTETSKYPDIPKSASIRST  736

Query  2172  KNAVVKNER-KASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIE  2348
              N  VK  + K+SPLKW+S  HK          F DW++P     ALE++E WIFSR +E
Sbjct  737   NNGSVKLPKSKSSPLKWESISHKNEKFY-FSEEFGDWDDPDTLISALERIENWIFSRTVE  795

Query  2349  SIWWQTFTPHMQSGAATS---LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             S+WWQT TP MQSG   S   L S   K Y RT S   ++  N S+E+W +AFRDA ER+
Sbjct  796   SVWWQTLTPCMQSGYEGSDQQLGSYSQKSYGRTPS-MGDQQGNLSVEIWNRAFRDASERL  854

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+R+ GHECGCLH+L++L+M+QCVARLDVAMFNAILRES D+IPTDPVSDPI + +VLP
Sbjct  855   CPLRSEGHECGCLHMLARLVMEQCVARLDVAMFNAILRESDDEIPTDPVSDPIGDSKVLP  914

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IP  + SF AGAQLKN IGNWSRWL DLFG+           DD +  +N    ++    
Sbjct  915   IPTSELSFGAGAQLKNGIGNWSRWLTDLFGM---------DVDDFDTEENDQDDDKIPIS  965

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
                K F+LLNA+SDL+MLPKD+LL +++RKEVCPTF  S+I  +L+ F+PDEFCPDPIP+
Sbjct  966   VSFKSFHLLNALSDLLMLPKDLLLEKSIRKEVCPTFSASMIKHILSRFLPDEFCPDPIPD  1025

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssV  3239
              VL+AL SE+  E  +E + N PC A+PI+Y+PPSA +    +      +S L R  SSV
Sbjct  1026  AVLQALESEEPFESSQEEIRNIPCDASPIIYSPPSATS-IKNIVGEVRRTSFLRRIGSSV  1084

Query  3240  LKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             L+K +TSDDEL+ELDSPL  I  +N   + P   + + + + +RYQLLREVW
Sbjct  1085  LRKCHTSDDELEELDSPLATIITDN--FSSPKIETKHASSSFIRYQLLREVW  1134


 Score =   206 bits (523),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 144/198 (73%), Gaps = 5/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SV  +Y+I+I+EIKPWPPSQSLK+L++VV+ WE+GD++SGST+ V P
Sbjct  1    MVLGLRSKHKKGASVHVDYIIHILEIKPWPPSQSLKSLRSVVLHWENGDRSSGSTSIVTP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S    GRIEFNESF++ +TLL++ SSK  +   FQKN +EFNLYEPRRD + KGQ
Sbjct  61   NL--GSSATEGRIEFNESFKLDVTLLKDGSSKVNDKGAFQKNLLEFNLYEPRRDKS-KGQ  117

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LG+A+ID A++GV+K+ +N  + ++ KRS+RNT QP+L ++IQ +  G + S  R  + 
Sbjct  118  HLGSALIDLADHGVIKDTMNAGILVSSKRSFRNTAQPVLYVRIQPLNNGSISSSSRETLS  177

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D    ESVS LMN
Sbjct  178  KEASLD--GKESVSDLMN  193



>ref|XP_008804456.1| PREDICTED: uncharacterized protein LOC103717740 isoform X1 [Phoenix 
dactylifera]
Length=709

 Score =   513 bits (1322),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 296/604 (49%), Positives = 388/604 (64%), Gaps = 44/604 (7%)
 Frame = +3

Query  1626  TCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNV  1805
             T D+ +  V  +  L E+   + SV +++  +  + N+++   ++ ++            
Sbjct  134   TDDKTIEEVKEIDVLDEAPNGDQSVGTDEETVDMEENNLDDDRASTYQ------------  181

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
                 K +E+EQ+I+ LE ELRE AA+EI L+S+V EHGSS +KVH PARRLSRLY HACK
Sbjct  182   ----KIEEMEQRIEKLEEELREVAALEISLYSMVPEHGSSAHKVHTPARRLSRLYIHACK  237

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLS  2159
               S  +R + A++ VSGL+L+AK+CGNDVPRLTFWLSN V+LR  I + F     + P  
Sbjct  238   HLSQDKRATVAKNTVSGLVLIAKSCGNDVPRLTFWLSNTVVLREIISQTFGIASYVNPTM  297

Query  2160  SEYSKNAVVK-NERKASPLKWQSFP---HKKSVGNDLPGTFEDWENPLGFTKALEKVEAW  2327
               +  N V K +E K++PLKW+        KS G  L    +DW+    FT ALEK+E+W
Sbjct  298   RAFDSNGVAKKDEGKSTPLKWKIIAGNKQGKSFG--LMQQIDDWQETSTFTAALEKIESW  355

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFR  2501
             IFSRI+ES+WWQT TPHMQS      +    K Y R        ++  +FS+ LWK AF 
Sbjct  356   IFSRIVESVWWQTLTPHMQSPVE---EMYTTKGYGRLLGPALGDQQQGSFSVNLWKSAFH  412

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++++M+QCV+RLDVAMFNAILRESA++IPTDPVSDPI 
Sbjct  413   DAFTRLCPVRAGGHECGCLPVLARMVMEQCVSRLDVAMFNAILRESANEIPTDPVSDPII  472

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIPAG  SF +GAQLKN+IGNWSRWL DLFGID DD   D     E+        
Sbjct  473   DPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDLFGIDADDSIKDGQVAGED-------D  525

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             +R+     SK F LLN +SDL+MLPKDMLL R VRKEVCP+  L LITR+L  F PDEFC
Sbjct  526   DRREGTPGSKSFCLLNELSDLLMLPKDMLLERVVRKEVCPSIDLPLITRILCNFTPDEFC  585

Query  3042  PDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssss  3212
             PDP+P +VLE LNSE  +E    +++   +FP +AAP+VY+PPS A         +S  +
Sbjct  586   PDPVPGIVLEELNSESLLERRLSDKDLASSFPRAAAPVVYSPPSPA-DVAEKVGDASGKA  644

Query  3213  qltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP---gggsgngngngVRYQLL  3383
             +L R  S V +K YTSD+EL  LDSPL  I ++ +    P    G          RY+LL
Sbjct  645   ELDRKASMVQRKGYTSDEELYHLDSPLASI-IDKTPPVSPILRDGTQKESKQANARYKLL  703

Query  3384  REVW  3395
             REVW
Sbjct  704   REVW  707



>ref|XP_002315621.2| hypothetical protein POPTR_0010s06780g [Populus trichocarpa]
 gb|EEF01792.2| hypothetical protein POPTR_0010s06780g [Populus trichocarpa]
Length=909

 Score =   519 bits (1337),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 297/540 (55%), Positives = 368/540 (68%), Gaps = 43/540 (8%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             ELE K++MLE EL EAAAVE+GL+SVVAEHGSS NKV APARRLSR Y +AC+  S  +R
Sbjct  400   ELESKVEMLEEELMEAAAVEVGLYSVVAEHGSSINKVLAPARRLSRFYLYACEAGSWAKR  459

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+++SGLILV+KACGNDVPRLTFWLSN ++LRA + +  EK QL        N   
Sbjct  460   ANAARAIISGLILVSKACGNDVPRLTFWLSNSIVLRAIVSQAVEKLQLASVPSSINNGGP  519

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
             K  ++++  + +     +S+        ++W  P  +  ALEKVEAWIFSRI+ES+WWQT
Sbjct  520   KGRQESTLTEGEKTNKTESL--------DEWAEPQPYIAALEKVEAWIFSRIVESVWWQT  571

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHE  2546
              TPHMQS A  S +S   K + +      +E  NF+++LWKKAFRDA ER+CPVRAGGHE
Sbjct  572   LTPHMQSTAVKSSNSR--KTHAKRHGLGDQEQGNFAIDLWKKAFRDACERLCPVRAGGHE  629

Query  2547  CGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFA  2726
             CGCL +LS+L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF 
Sbjct  630   CGCLPVLSRLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFG  689

Query  2727  AGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE--------RKAQDA  2882
             AGAQLKNA+GNWSRWL DLFGI                 D+S+  E        R+  + 
Sbjct  690   AGAQLKNAVGNWSRWLTDLFGI-----------------DDSDSSEEKDELCSIRRVSET  732

Query  2883  CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNV  3062
               K F LLNA+SDLMMLP +ML  R+ RKEVCP+F   +I RVLN F+PDEF PDPIP  
Sbjct  733   SFKAFQLLNALSDLMMLPFEMLADRSTRKEVCPSFDAPMIKRVLNNFVPDEFNPDPIPET  792

Query  3063  VLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVL  3242
             + EAL+SED  E  EES+ NFPC A P +Y+PP AA+           S  L RS S++L
Sbjct  793   IFEALDSEDFAEAGEESITNFPCIAVPTIYSPPPAAS--LTNIIGEVGSQTLQRSGSAML  850

Query  3243  KKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLLREVWMSSE  3407
             +KSYTSDDELDELDSP+  I +ENS+V            G      VRYQLLREVW   E
Sbjct  851   RKSYTSDDELDELDSPMTSI-IENSKVFPSSTAWNWMQKGKAGRKVVRYQLLREVWKDGE  909


 Score =   160 bits (405),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 133/198 (67%), Gaps = 15/198 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   SVQ +YLI + EIKPWPPSQSLK+ +++++QWE+GD++SGS T    
Sbjct  1    MVLGLRSKNRKGSSVQLDYLILVQEIKPWPPSQSLKSSQSLLLQWENGDQSSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+GR+EF+ESFR+  TL +E+S K    D+F KN +EFNLYE R+D  +KGQ
Sbjct  57   -----SNVGDGRVEFSESFRLSATLCKEVSRKGTARDSFLKNYLEFNLYESRKDKAMKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++ + + ++ PI+ K+S R+ V  +L + IQ   +       R+++ 
Sbjct  112  LLGSAVINLADYGIIMDAVTINAPIHFKKSSRSMVPAVLYVNIQPFARD------RSSLS  165

Query  705  RESSMDSSAGESVSALMN  758
            ++ S+D    E+VS + N
Sbjct  166  KQVSLDKDGSETVSEVTN  183



>ref|XP_010033393.1| PREDICTED: uncharacterized protein LOC104422695 [Eucalyptus grandis]
 ref|XP_010033394.1| PREDICTED: uncharacterized protein LOC104422695 [Eucalyptus grandis]
 gb|KCW53020.1| hypothetical protein EUGRSUZ_J02316 [Eucalyptus grandis]
Length=922

 Score =   518 bits (1334),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 306/559 (55%), Positives = 373/559 (67%), Gaps = 38/559 (7%)
 Frame = +3

Query  1761  DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVH  1940
             D K  KV  K+T   +++ K Q LE KIQMLEGELRE AA+E+ L+SVVAEHG S +K H
Sbjct  392   DIKVDKVYPKDTKRTLMDAKLQRLENKIQMLEGELRETAAIEVALYSVVAEHGGSMSKFH  451

Query  1941  APARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAA  2120
             APARRLSR Y +A  E     R +A RS+V+GL +VA+ACG+DVPRLT+WLSN V+LRA 
Sbjct  452   APARRLSRFYRYAFGELPQASRANAGRSIVAGLFVVARACGSDVPRLTYWLSNSVVLRAI  511

Query  2121  ICKFSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLG  2294
             I +      +  PLSS+                  +S+P KK  GN    T +D EN   
Sbjct  512   ISQMIPNGNIGVPLSSKSK----------------ESYPRKK--GNKNARTDDDSENVHE  553

Query  2295  FTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEP  2462
                 LEKVEAWIFSRI+ES+WWQ+ TP+MQS AA  L S       K  ++ + +  +E 
Sbjct  554   LISELEKVEAWIFSRIVESLWWQSLTPYMQSSAAKLLGSAKGSSSIKNNRKVTYAEDQEQ  613

Query  2463  ENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESA  2642
              N S++LWKKAF DA ER+CPVR GGHECGCL +L+KL+M+ CVARLDVAMFNAILRESA
Sbjct  614   GNISVDLWKKAFTDACERLCPVRGGGHECGCLPVLAKLLMEHCVARLDVAMFNAILRESA  673

Query  2643  DDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlv  2822
             ++IPTDPVSDPIS+P+VLPIPAG++SF AG QLKNAIGNWSRWL          +   L 
Sbjct  674   NEIPTDPVSDPISDPKVLPIPAGRSSFHAGVQLKNAIGNWSRWLT---------DLFGLD  724

Query  2823  eddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
             +DD +   N    E + +DA  K FYLLNA+SDLMMLPKDMLLSR+ RKEVCPTFG SLI
Sbjct  725   DDDLHGDKNKIVDEDETRDATFKSFYLLNALSDLMMLPKDMLLSRSTRKEVCPTFGASLI  784

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldg  3182
              RVL+ F PDEFCPDP+P  VLEAL SED  EV EE V ++P  AA  VY PPSAA+   
Sbjct  785   KRVLDNFSPDEFCPDPVPKAVLEALASEDPFEVGEELVTSYPYIAANPVYPPPSAAS-VA  843

Query  3183  ilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgn----  3350
                    + S+L RSRSSVL+K+  SDDELDEL+SPL  I +  S  +            
Sbjct  844   GFLGELGNQSRLRRSRSSVLEKAQNSDDELDELNSPLTSIFLNESSSSTSAEPIQMNGKG  903

Query  3351  gngngVRYQLLREVWMSSE  3407
                  +RY+LLREVWM+ E
Sbjct  904   HRRQPLRYRLLREVWMNCE  922


 Score =   218 bits (555),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLGP    R   SVQ +Y+I++ EI PWPPS +L++L++V+IQW++G++ SG+T  V P
Sbjct  1    MVLGPGANARKSASVQLDYIIHVQEIAPWPPSPTLRSLRSVLIQWQNGERTSGATKPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S VG G+IEFNESFR+  TLL+EI  K+ NG  FQKN +EFNLYEPRRD  +KGQ
Sbjct  61   FLG--SNVGEGKIEFNESFRLSATLLKEIKVKAGNGGAFQKNYLEFNLYEPRRDNIMKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVR-NNV  701
            L+GTA+I+ A+YGV+ E LN+S  +NCKR++RN  QP+L +KIQ V KGR  S++R +++
Sbjct  119  LIGTAMINLADYGVIDEPLNISAAMNCKRNFRNMAQPILYVKIQPVDKGRTGSMLRGSSL  178

Query  702  RRESSMDSSAGESV  743
             +E S+ ++  ESV
Sbjct  179  SKEVSLGTNDCESV  192



>ref|XP_006845237.1| hypothetical protein AMTR_s00005p00258190 [Amborella trichopoda]
 gb|ERN06912.1| hypothetical protein AMTR_s00005p00258190 [Amborella trichopoda]
Length=839

 Score =   514 bits (1323),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 289/555 (52%), Positives = 373/555 (67%), Gaps = 27/555 (5%)
 Frame = +3

Query  1776  KVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARR  1955
             K  S+E S++  + K Q LE KI+ LE ELREAAA E+ L+S+VAEHGSS++KVHAPARR
Sbjct  297   KYVSRERSSIFSDTKIQRLELKIEALEAELREAAATEVALYSIVAEHGSSSHKVHAPARR  356

Query  1956  LSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFS  2135
             LSRL+ HACK     RR S A+S+VSGL+LVAKACGNDVPRLTFW SN V+LRA I +  
Sbjct  357   LSRLFIHACKHWPTYRRASTAKSIVSGLVLVAKACGNDVPRLTFWWSNYVVLRAIIAQGF  416

Query  2136  EKQQLPLSSEYSK--NAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTK  2303
              K   P ++E+    N   K N+RK SPL W ++ P  ++  + L    +DW++   F  
Sbjct  417   GKSNFPKAAEHFNKLNDTDKGNDRKYSPLNWKENSPKNQAKKSGLTQLSDDWQDINTFKS  476

Query  2304  ALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSE----INKIYQRTSSSCSEEPENF  2471
             ALEK+E+WIFSRIIES+WWQT TP+MQ      L+ +    +++ ++R  S   ++  +F
Sbjct  477   ALEKIESWIFSRIIESVWWQTLTPYMQPYNGEGLEGKFCLNLHRSFRRLPSLGDQQQGSF  536

Query  2472  SLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDI  2651
             S+ LWKKAF DA+ER+CPVRAGGHECGCL +L+KL+M+QCV RLDVAMFNAILRES D++
Sbjct  537   SINLWKKAFEDAFERLCPVRAGGHECGCLSVLAKLVMEQCVNRLDVAMFNAILRESEDEM  596

Query  2652  PTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedd  2831
             PTDPV DPI + +VLPI AG  S  AGA+LK A+G WSRWL DLFGID DD   D  + D
Sbjct  597   PTDPVCDPIGDLKVLPIQAGNLSLGAGAKLKTAVGTWSRWLTDLFGIDADDSPADDDDLD  656

Query  2832  eNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRV  3011
             +++ D S            K F+LLNA+SDL+MLPKD+LL  ++RKEVCPTFG  LI RV
Sbjct  657   DDRQDTSKA---------LKTFHLLNALSDLLMLPKDILLDPSIRKEVCPTFGAPLIKRV  707

Query  3012  LNVFIPDEFCPDPIPNVVLEALNSE----DHMEVEEESVVNFPCSAAPIVYAPPSAAAld  3179
             L  F PDEFCPDP+P+ +L AL+SE       +   + +  FPC AAPI Y+PP  A+  
Sbjct  708   LCNFGPDEFCPDPVPDDLLVALDSEVPPKQQFDGRNDQIGGFPCVAAPITYSPPFVAS--  765

Query  3180  gilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgng  3353
                G++  +        SS+L+K +TSDDELDEL  PL  I  K+  S            
Sbjct  766   --TGEVVGAVDFGRSPSSSLLRKGHTSDDELDELTVPLASIIDKIPESPKETSMEKRWKE  823

Query  3354  ngngVRYQLLREVWM  3398
              G  VRYQLL++VW+
Sbjct  824   RGPNVRYQLLQDVWL  838



>ref|XP_006361551.1| PREDICTED: uncharacterized protein LOC102578599 [Solanum tuberosum]
Length=1040

 Score =   520 bits (1339),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 333/726 (46%), Positives = 434/726 (60%), Gaps = 65/726 (9%)
 Frame = +3

Query  1305  GHIIKADIDESFSTLSNGIQEDARTGVSDNGLAEGENTEGHQGNTQELVTERDKHQET--  1478
             GH+ +   + S+   SN    D     SD      +  +GH G+T      +D H     
Sbjct  354   GHVHRFASNLSYLDESNEDNSDPADSYSDRCQDSRDKPKGHTGST----VLKDLHVGVVN  409

Query  1479  GEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESV---GAKTTCDERLNH  1649
             G+G EL+                QD  + + +   S + +GR+     G     ++ L  
Sbjct  410   GKGMELL-------------EIDQDEVSLKEIPHFSEVKSGRKHSFLKGDTLNSNKVLGL  456

Query  1650  VSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTK------VRSKETSNVVL  1811
               S  T G+S  A    +S+Q      R+ + G + N  K  K       RS    N  +
Sbjct  457   QGSSITNGKSKHA----KSHQLNDLANRSGLPGNSQNPEKSAKQHVSEDARSNGKGNKPM  512

Query  1812  ----ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
                 +RK  E + +I+ LE ELREAA VE+ L+SVVAEHGSS +KVHAPARRLSR Y HA
Sbjct  513   NGSPDRK-NEGKSRIETLEEELREAAVVEVSLYSVVAEHGSSAHKVHAPARRLSRFYVHA  571

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS  2159
             C+  S  ++  AAR+ VSGL+LV+KACGNDVPRLTFWLSN V+LRA + + +  ++    
Sbjct  572   CRAKSRAKQAGAARASVSGLVLVSKACGNDVPRLTFWLSNSVMLRAIVSQAAGGRRED-D  630

Query  2160  SEYSKNAVVKNERKASPLKWQS-FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
               Y+++ + K       LK ++     K+V + L     DWE+   F  ALE+VEAWIFS
Sbjct  631   RPYAESNMGKTSLNGRSLKKRNEVSFNKAVNDSLTEELGDWEDIETFMLALEQVEAWIFS  690

Query  2337  RIIESIWWQTFTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRD  2504
             RI+ES+WWQT TPHMQ+ AA S    + S + K Y R  S   +E  NFS++LWKKAF+D
Sbjct  691   RIVESVWWQTLTPHMQNTAANSGGRSMSSSVKKTYGRRCSLGDQEQGNFSIDLWKKAFKD  750

Query  2505  AYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISN  2684
             A ER+CPVRAGGHECGCL L ++L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPI +
Sbjct  751   ACERLCPVRAGGHECGCLPLPARLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPICD  810

Query  2685  PEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE  2864
              +VLPIPAGK+SF AGAQLKNAIG+WSRWL+ LFGI               + D+S  +E
Sbjct  811   AKVLPIPAGKSSFGAGAQLKNAIGDWSRWLSTLFGI--------------EENDSSGDNE  856

Query  2865  RKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCP  3044
              KA    +KPF LLNA+SDLMMLP +ML     RKEVCP  G +LI+RVLN F+PDEFCP
Sbjct  857   DKAP-GPAKPFRLLNALSDLMMLPFEMLADPQTRKEVCPILGPTLISRVLNGFVPDEFCP  915

Query  3045  DPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
              P+P  VL AL+SED  +  EES+   P +A+P  Y PPS  +         + +  L R
Sbjct  916   IPVPPEVLRALDSEDAEDTPEESISTVPFTASPTTYLPPSVRS--IKTFLGETGNQSLQR  973

Query  3225  srssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgg-----gsgngngngVRYQLLRE  3389
             S SSVLKKSYTSDDELDELDSPL+ I  +    +           G G+   VRYQLLR+
Sbjct  974   SSSSVLKKSYTSDDELDELDSPLSSIVADRLRGSPNLAKINLIAKGKGDRKVVRYQLLRQ  1033

Query  3390  VWMSSE  3407
             VW + E
Sbjct  1034  VWRAEE  1039


 Score =   157 bits (397),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 123/194 (63%), Gaps = 17/194 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ EY+I + EIKPWPPSQSLK++++V++QWE+  +NSGS      
Sbjct  1    MVLGLRSKHKKGASVQVEYVIQVDEIKPWPPSQSLKSVQSVLLQWENDGQNSGSVV----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+G IEF +SF + +TL RE  +     D FQKN ++F LYE R+D T +GQ
Sbjct  57   -----STVGDGTIEFKDSFTLSLTLCREKKAH----DKFQKNFLDFYLYELRKDKTTRGQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMK----SLVR  692
            LLGT+VI+ A++G+++E +++  P++CK+S +N+ QP L + I    +G        + R
Sbjct  108  LLGTSVINLADFGLIEEVVSIYTPVSCKKSSKNSEQPALFVSIHPTERGSSSSSQVGVTR  167

Query  693  NNVRRESSMDSSAG  734
                +ES +DS  G
Sbjct  168  EGDGQESVVDSVNG  181



>ref|XP_010913133.1| PREDICTED: uncharacterized protein LOC105038912 [Elaeis guineensis]
 ref|XP_010913134.1| PREDICTED: uncharacterized protein LOC105038912 [Elaeis guineensis]
Length=709

 Score =   509 bits (1311),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 286/544 (53%), Positives = 366/544 (67%), Gaps = 34/544 (6%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K +E+EQ+I+ LE ELRE AA+EI L+S+V EHGSS +KVH PARRLSRL+ HACK  S
Sbjct  181   QKIEEMEQRIEKLEEELREVAALEISLYSMVPEHGSSAHKVHTPARRLSRLFIHACKHWS  240

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEY  2168
               +R + A++ VSGL+L+AK+CGNDVPRLTFWLSN V+LR  I + F     L P    +
Sbjct  241   QDKRATVAKNTVSGLVLIAKSCGNDVPRLTFWLSNTVVLREIISQTFGIVSHLNPTMRAF  300

Query  2169  SKNAVVKN-ERKASPLKWQSFPHKKSVGNDLPGTF------EDWENPLGFTKALEKVEAW  2327
               N   K  E +++ L+W     K + GN    +F      +DW+    FT ALE++E+W
Sbjct  301   ESNGGAKKAEGRSTLLQW-----KINAGNKQAKSFGFMQQIDDWQETSTFTAALERIESW  355

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFR  2501
             IFSRI+ES+WWQT TPHMQS      +    K Y R        ++  +FS+ LWK AF 
Sbjct  356   IFSRIVESVWWQTLTPHMQSPVE---EMYATKGYGRLLGPALGDQQQGSFSVNLWKSAFH  412

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++++M+QCV+RLDVAMFNAILRESA +IPTDPVSDPI 
Sbjct  413   DAFTRLCPVRAGGHECGCLPVLARMVMEQCVSRLDVAMFNAILRESAYEIPTDPVSDPIV  472

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIPAG  SF +GAQLKN+IGNWSRWL DLFG+D DD   D        AD  +  
Sbjct  473   DPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDLFGMDADDSIKDGQV-----ADEDD--  525

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             +R      SK F+LLN +SDL+MLPKDMLL R VRKEVCP+ GL LITR+L  F PDEFC
Sbjct  526   DRSEGTPGSKSFHLLNELSDLLMLPKDMLLQRVVRKEVCPSIGLPLITRILCNFTPDEFC  585

Query  3042  PDPIPNVVLEALNSE---DHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssss  3212
             PDP+P +VLE LNSE   +H   E++ + +FPC+AAP+VY+PPS  A         S  +
Sbjct  586   PDPVPGIVLEELNSESLLEHRLSEKDLISSFPCTAAPVVYSPPS-PADVAEKVGDVSGRA  644

Query  3213  qltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP---gggsgngngngVRYQLL  3383
             +L R  S V +K YTSD++LD+LDSPL  I ++ +    P    G          RY+LL
Sbjct  645   ELDRKASMVRRKGYTSDEDLDDLDSPLTSI-IDRTPPVSPILRDGTQKESKQANARYKLL  703

Query  3384  REVW  3395
             REVW
Sbjct  704   REVW  707



>ref|XP_011041529.1| PREDICTED: uncharacterized protein LOC105137480 isoform X1 [Populus 
euphratica]
 ref|XP_011041530.1| PREDICTED: uncharacterized protein LOC105137480 isoform X1 [Populus 
euphratica]
 ref|XP_011041531.1| PREDICTED: uncharacterized protein LOC105137480 isoform X2 [Populus 
euphratica]
 ref|XP_011041532.1| PREDICTED: uncharacterized protein LOC105137480 isoform X1 [Populus 
euphratica]
Length=1015

 Score =   519 bits (1337),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 302/540 (56%), Positives = 368/540 (68%), Gaps = 43/540 (8%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             ELE K++MLE EL EAAAVE+GL+SVVAEHGSS NKV APARRLSR Y +ACK  S  +R
Sbjct  506   ELESKVEMLEEELMEAAAVEVGLYSVVAEHGSSINKVLAPARRLSRFYLYACKAGSWAKR  565

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+++SGLILV+KACGNDVPRLTFWLSN ++LRA + +  EK Q P S   S N   
Sbjct  566   ANAARAIISGLILVSKACGNDVPRLTFWLSNSIVLRAIVSQAVEKLQ-PASVPSSINNGG  624

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                R+ S L      +K         + ++W  P  +  ALEKVEAWIFSRI+ES+WWQT
Sbjct  625   PKGRQESTLTEGEKTNKTE-------SLDEWAEPQPYIAALEKVEAWIFSRIVESVWWQT  677

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHE  2546
              TPHMQS A  S +S   K + +      +E  NF+++LWKKAFRDA ER+CPVRAGGHE
Sbjct  678   LTPHMQSTAVKSSNSR--KTHAKRHGLGDQEQGNFAIDLWKKAFRDACERLCPVRAGGHE  735

Query  2547  CGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFA  2726
             CGCL +LS+L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF 
Sbjct  736   CGCLPVLSRLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFG  795

Query  2727  AGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE--------RKAQDA  2882
             AGAQLKNA+GNWSRWL DLFGI                 D+S+  E        R+  + 
Sbjct  796   AGAQLKNAVGNWSRWLTDLFGI-----------------DDSDSSEEKDELCSTRRVSET  838

Query  2883  CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNV  3062
               K F+LLNA+SDLMMLP +ML  R+ RKEVCP+F   +I RVLN F+PDEF PDPIP  
Sbjct  839   SFKAFHLLNALSDLMMLPFEMLADRSTRKEVCPSFDAPMIKRVLNNFVPDEFNPDPIPET  898

Query  3063  VLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVL  3242
             + EAL+SED  E  EES+ NFP  A P +Y+PP AA+           S  L RSRS++L
Sbjct  899   IFEALDSEDFAEAGEESLTNFPRIAVPTIYSPPPAAS--LTNIIGELGSQTLQRSRSAML  956

Query  3243  KKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLLREVWMSSE  3407
             +KSYTSDDELDELDSP+  I +ENS+V            G      VRYQLLREVW   E
Sbjct  957   RKSYTSDDELDELDSPMTSI-IENSKVFPASTAWNWMQKGKAGRKVVRYQLLREVWKDGE  1015


 Score =   177 bits (448),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 130/198 (66%), Gaps = 15/198 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   SVQ +YLI + EIKPWPPSQSLK+ +++++QWE+GD++SGS T    
Sbjct  1    MVLGLRSKNRKGSSVQLDYLILVQEIKPWPPSQSLKSAQSLLLQWENGDQSSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+GR+EF+ESFR+  TL +E+S K    D+F KN +EFN+YE R+D  +KGQ
Sbjct  57   -----SNVGDGRVEFSESFRLSATLCKEVSRKGTARDSFLKNYLEFNVYESRKDKAMKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++ + + ++ PI  K+S R+ V   L + IQ   +       R+ + 
Sbjct  112  LLGSAVINLADYGIIMDAVTINAPIQFKKSSRSMVPAFLYVNIQPFDRD------RSGLS  165

Query  705  RESSMDSSAGESVSALMN  758
            R+ S+D    E+VS + N
Sbjct  166  RQVSLDKDGSETVSEVTN  183



>ref|XP_011041533.1| PREDICTED: uncharacterized protein LOC105137480 isoform X3 [Populus 
euphratica]
Length=1014

 Score =   519 bits (1337),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 302/540 (56%), Positives = 368/540 (68%), Gaps = 43/540 (8%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             ELE K++MLE EL EAAAVE+GL+SVVAEHGSS NKV APARRLSR Y +ACK  S  +R
Sbjct  505   ELESKVEMLEEELMEAAAVEVGLYSVVAEHGSSINKVLAPARRLSRFYLYACKAGSWAKR  564

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+++SGLILV+KACGNDVPRLTFWLSN ++LRA + +  EK Q P S   S N   
Sbjct  565   ANAARAIISGLILVSKACGNDVPRLTFWLSNSIVLRAIVSQAVEKLQ-PASVPSSINNGG  623

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                R+ S L      +K         + ++W  P  +  ALEKVEAWIFSRI+ES+WWQT
Sbjct  624   PKGRQESTLTEGEKTNKTE-------SLDEWAEPQPYIAALEKVEAWIFSRIVESVWWQT  676

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHE  2546
              TPHMQS A  S +S   K + +      +E  NF+++LWKKAFRDA ER+CPVRAGGHE
Sbjct  677   LTPHMQSTAVKSSNSR--KTHAKRHGLGDQEQGNFAIDLWKKAFRDACERLCPVRAGGHE  734

Query  2547  CGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFA  2726
             CGCL +LS+L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF 
Sbjct  735   CGCLPVLSRLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFG  794

Query  2727  AGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE--------RKAQDA  2882
             AGAQLKNA+GNWSRWL DLFGI                 D+S+  E        R+  + 
Sbjct  795   AGAQLKNAVGNWSRWLTDLFGI-----------------DDSDSSEEKDELCSTRRVSET  837

Query  2883  CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNV  3062
               K F+LLNA+SDLMMLP +ML  R+ RKEVCP+F   +I RVLN F+PDEF PDPIP  
Sbjct  838   SFKAFHLLNALSDLMMLPFEMLADRSTRKEVCPSFDAPMIKRVLNNFVPDEFNPDPIPET  897

Query  3063  VLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVL  3242
             + EAL+SED  E  EES+ NFP  A P +Y+PP AA+           S  L RSRS++L
Sbjct  898   IFEALDSEDFAEAGEESLTNFPRIAVPTIYSPPPAAS--LTNIIGELGSQTLQRSRSAML  955

Query  3243  KKSYTsddeldeldsPLNLIKMENSEVTKPggg-----sgngngngVRYQLLREVWMSSE  3407
             +KSYTSDDELDELDSP+  I +ENS+V            G      VRYQLLREVW   E
Sbjct  956   RKSYTSDDELDELDSPMTSI-IENSKVFPASTAWNWMQKGKAGRKVVRYQLLREVWKDGE  1014


 Score =   177 bits (448),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 130/198 (66%), Gaps = 15/198 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   SVQ +YLI + EIKPWPPSQSLK+ +++++QWE+GD++SGS T    
Sbjct  1    MVLGLRSKNRKGSSVQLDYLILVQEIKPWPPSQSLKSAQSLLLQWENGDQSSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+GR+EF+ESFR+  TL +E+S K    D+F KN +EFN+YE R+D  +KGQ
Sbjct  57   -----SNVGDGRVEFSESFRLSATLCKEVSRKGTARDSFLKNYLEFNVYESRKDKAMKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++ + + ++ PI  K+S R+ V   L + IQ   +       R+ + 
Sbjct  112  LLGSAVINLADYGIIMDAVTINAPIQFKKSSRSMVPAFLYVNIQPFDRD------RSGLS  165

Query  705  RESSMDSSAGESVSALMN  758
            R+ S+D    E+VS + N
Sbjct  166  RQVSLDKDGSETVSEVTN  183



>ref|XP_010103204.1| hypothetical protein L484_006756 [Morus notabilis]
 gb|EXB94990.1| hypothetical protein L484_006756 [Morus notabilis]
Length=992

 Score =   518 bits (1333),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 307/650 (47%), Positives = 409/650 (63%), Gaps = 43/650 (7%)
 Frame = +3

Query  1482  EGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTC--DERLNHVS  1655
             EG E I +  Q ++ E  N   +    ++    N +       +G   +   + +L HV 
Sbjct  378   EGAERIHKDLQATQEEDKNVWRRTEDGQEEASTNDSSTYSSRHIGVARSIVKNNKLKHVK  437

Query  1656  SVHTLGESNRANGSV--RSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQE  1829
             SV    E+ + +  +   + +F+ + KR  +   T +D     +  +E +   +  +  E
Sbjct  438   SVQLPSETTKTSRPLVFDNTEFIEKPKRAELSKGTHDDGMTNALSIEEETKSSVSNRKGE  497

Query  1830  LEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRL  2009
             L+ +I+ML+ ELREAAAVE+GL+SVVAEHGSSTNK+HAPARR+SR YFHACK +S+ ++ 
Sbjct  498   LKAEIEMLKEELREAAAVEVGLYSVVAEHGSSTNKIHAPARRISRFYFHACKASSLAKKA  557

Query  2010  SAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK----FSEKQQLPLSSEYSKN  2177
             +A R+ VSG ILV+KACGNDVPRLTFWLSN ++LRA + +     S+   +        N
Sbjct  558   NAVRAAVSGFILVSKACGNDVPRLTFWLSNSIMLRAIVSQTVGNLSDGPGV-------DN  610

Query  2178  AVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
             + +  +   +P + +    K+S+        +DW++   F  ALEK E+WIFSRI+ES+W
Sbjct  611   SGILGQNGFTPQREEKKAKKESI--------DDWDDHQTFLIALEKFESWIFSRIVESVW  662

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQT TPHMQ  AA    S   K   +       E  N S+ELWKKAF+DA +R+CP RAG
Sbjct  663   WQTMTPHMQPAAAKG--SSSRKSSGKKYGFGDHERGNISIELWKKAFKDACQRLCPSRAG  720

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL ++++L+M+Q V RLDVAMFNAILRE+A+++PTDPVSDPIS+ +VLPIPAG++
Sbjct  721   GHECGCLPVIARLVMEQLVDRLDVAMFNAILRENAEEMPTDPVSDPISDSKVLPIPAGRS  780

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF AGAQLKNAIG+WSR L D+F I          +  ENK +  N  E+       K F
Sbjct  781   SFGAGAQLKNAIGSWSRCLTDIFDI---------DDAPENK-NELNDEEKPESQRSFKAF  830

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLNA+SDLMM+P +ML  ++ RKEVCP     LI  VL  F+PDEFCP+PIP+ VL AL
Sbjct  831   RLLNALSDLMMIPFEMLADKSTRKEVCPALTPPLIRMVLYNFVPDEFCPNPIPDAVLAAL  890

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
             +SED  EV+EESV +FP +A P VYAPPSAA+           S  L RS SSVL+KSYT
Sbjct  891   DSEDDFEVDEESVTSFPFTANPTVYAPPSAAS--LSHIIGEVGSQTLLRSGSSVLRKSYT  948

Query  3258  sddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWMSSE  3407
             SDDELDELDSP+  I  EN +  +        N   VRYQLLREVW  SE
Sbjct  949   SDDELDELDSPIISIIKENMQEKR------KDNRPVVRYQLLREVWKDSE  992


 Score =   182 bits (462),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 133/194 (69%), Gaps = 9/194 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   +++ +YLI++ EIKPW   QS K+  +V +QWE+GD+ SGS T    
Sbjct  1    MVLGIRSKSRKSVTIEVDYLIHVQEIKPWSLPQSQKSALSVFLQWENGDQASGSLT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 SGVG+G+IEF ESFR+P+ L +E S K    +++QKN +EF LYE R+D  +KGQ
Sbjct  57   -----SGVGDGKIEFAESFRLPVVLCKEASKKGQARESYQKNNLEFYLYETRKDKAMKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG+++E ++V+ P+NCK+S +N+ QP+L + IQ  G     S    ++ 
Sbjct  112  LLGSAVINLADYGIIRETISVTAPVNCKKSSKNSGQPVLYINIQPFGNASSGSSPMGSLS  171

Query  705  RESSMDSSAGESVS  746
            +E+S+D+  GE+VS
Sbjct  172  KEASLDNDGGETVS  185



>ref|XP_010524262.1| PREDICTED: uncharacterized protein LOC104802377 [Tarenaya hassleriana]
 ref|XP_010524263.1| PREDICTED: uncharacterized protein LOC104802377 [Tarenaya hassleriana]
Length=892

 Score =   514 bits (1325),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 277/504 (55%), Positives = 348/504 (69%), Gaps = 39/504 (8%)
 Frame = +3

Query  1674  ESNRANGSVRSNQFVLRDKRNSIEGI-TSNDWKDTKVRSKETSNVVLERKCQELEQKIQM  1850
             E +R   SVRS+  + R    S  G   SN+ K+ KV  K   +  +  K + LE K++ 
Sbjct  361   ERSRIVKSVRSSLDISR----STSGCGVSNEQKEVKVHPKGNRDADMVIKIKNLESKVKK  416

Query  1851  LEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVV  2030
             LEGELREAAA+E  L++VVAEHGSST+KVHAPARRLSRLY  +          +AA+S V
Sbjct  417   LEGELREAAAIEAALYTVVAEHGSSTSKVHAPARRLSRLYLQSPSSRRA----AAAKSAV  472

Query  2031  SGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS---SEYSKNAVVKNERK  2201
             SGL+LVAKACGNDVPRLTFWLSN V+LRA I +   +++LP+S       + A  + E+K
Sbjct  473   SGLVLVAKACGNDVPRLTFWLSNAVVLRAIISESGLEEELPVSVGPRTLRQKAEREIEKK  532

Query  2202  ASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHM  2381
               PLKW+  P  K  G  + G    W+NP  FT ALEKVEAWIF+R++ESIWWQTFTPHM
Sbjct  533   RLPLKWKDSPPNKRDGERIGG----WDNPSTFTLALEKVEAWIFTRVVESIWWQTFTPHM  588

Query  2382  QSGAAT---SLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECG  2552
             QS A     ++ SE  K ++RT SS ++E  +FS+ELWKKAFRDA ER+CP+RA GHECG
Sbjct  589   QSAARAFDKAIGSESRKNFRRTPSSVNQEQSDFSIELWKKAFRDACERLCPLRASGHECG  648

Query  2553  CLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAG  2732
             CL + ++LIM+QCVARLDVAMFNAILR+S D IPTDPVSDPI +  VLP+P+GK+SF +G
Sbjct  649   CLPVTARLIMEQCVARLDVAMFNAILRDSDDSIPTDPVSDPIGDTRVLPVPSGKSSFGSG  708

Query  2733  AQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNA  2912
             AQLKNA+GNW RWL+DLFGI              ++ D  NG +    D   K F LLNA
Sbjct  709   AQLKNAVGNWLRWLSDLFGI--------------DEDDVENGED----DRSFKAFNLLNA  750

Query  2913  MSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDH  3092
             +SDLMMLPKDMLL+ +VRKEVCP FG  LI RVL+ F  DEFCPDP+PN +LEAL +E+ 
Sbjct  751   LSDLMMLPKDMLLNSSVRKEVCPGFGGPLIKRVLSNFEADEFCPDPLPNHLLEALENEER  810

Query  3093  MEVEEESVVNFPCSAAPIVYAPPS  3164
              +     + ++PC+  P VY  PS
Sbjct  811   DKASW--ITDYPCTVPPPVYEAPS  832


 Score =   200 bits (508),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 144/199 (72%), Gaps = 8/199 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K +   S+  +YLI+I EIKPWPPSQSL++L++VVI WE+G++NSGST  V P
Sbjct  1    MVLGLSSKNKKGSSIHTDYLIHIHEIKPWPPSQSLRSLRSVVIHWENGERNSGSTNVVTP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSK-SVNGDTFQKNCIEFNLYEPRRDTTVKG  521
             L   S +G G+IEF+ESF++P+TLLR++S++ + + D+F KN +EFNLYEPRR+ T   
Sbjct  61   SL--GSVIGEGKIEFSESFKLPVTLLRDVSTRNNKDSDSFLKNILEFNLYEPRRERT--H  116

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNV  701
            QLL TA ID A++GV+K+ L+++ P+N KRSYRNT QP+L + IQ   + +  S  RN  
Sbjct  117  QLLATATIDLADFGVIKDSLSITAPMNSKRSYRNTSQPVLFITIQPHERHQANSSPRNGS  176

Query  702  RRESSMDSSAGESVSALMN  758
            +    +  +  ESVSALMN
Sbjct  177  K---DVCKNGSESVSALMN  192



>ref|XP_010278999.1| PREDICTED: uncharacterized protein LOC104613015 isoform X1 [Nelumbo 
nucifera]
Length=813

 Score =   510 bits (1314),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 311/693 (45%), Positives = 419/693 (60%), Gaps = 66/693 (10%)
 Frame = +3

Query  1398  LAEGENTEGHQGNTQELVTERDKHQETGEGKELI----IEKGQCSEGEP-VNS-CLQDNT  1559
             LA+ E++E    ++    T R  HQET + + +         + S+G P VNS  L DN 
Sbjct  158   LAKKESSESRPHSS----TIRKNHQETSKSQNVSNNTSKRSTKSSQGSPKVNSKGLSDNK  213

Query  1560  TKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNS  1739
             +      N  +     S  ++   D+ ++ V  ++TL E+     S+ S+      ++N 
Sbjct  214   S-----NNMKVPPKPSSESSEGVDDKAIDEVKDINTLDEAPSGAHSIGSDDETAGTEKNG  268

Query  1740  IEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHG  1919
             +E                    ++  K +E+EQ+I+ LE ELRE AA+EI L+SVV EHG
Sbjct  269   LE----------------EQREIVNHKIEEMEQRIEKLEEELREIAALEISLYSVVPEHG  312

Query  1920  SSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSN  2099
             SS +KVH PARRLSRLY HACK  +  +R + AR+  SGL+L+AK+CGNDV RLTFWLSN
Sbjct  313   SSAHKVHTPARRLSRLYIHACKHWTQDKRATIARNTASGLVLIAKSCGNDVSRLTFWLSN  372

Query  2100  CVLLRAAICK-FSEKQQL-PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPG---  2264
              ++LR  I + F       P++     N    +E K S LKW++ P  K V    PG   
Sbjct  373   TIVLREIISQAFGNSHHSNPITRFVEANGAKISEGKPSSLKWKASPGPKQVKK--PGFMQ  430

Query  2265  TFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSS  2444
               +DW+    F  ALEKVE+WIFSRI+ES+WWQT TPHMQ       +   NK + +   
Sbjct  431   IVDDWQETSTFIMALEKVESWIFSRIVESVWWQTLTPHMQPPVE---EMHTNKSFGKLLG  487

Query  2445  SC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMF  2618
                  ++  +FS+ LWK AF+DA++R+CPVRA GHECGCL +L++++M+QCVARLDVAMF
Sbjct  488   PALGDQQQGSFSINLWKSAFQDAFQRVCPVRAEGHECGCLPVLARMVMEQCVARLDVAMF  547

Query  2619  NAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdd  2798
             NAILRESA +IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSRWL+DLFG+  
Sbjct  548   NAILRESAHEIPTDPVSDPIVDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDLFGM--  605

Query  2799  ddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVC  2978
                  D  +  +++A + +   R+  DA  K FYLLNA+SDL+MLPKDML+ R++RKEVC
Sbjct  606   -----DADDSVKDQASDEDDF-RRVGDAEPKSFYLLNALSDLLMLPKDMLMDRSIRKEVC  659

Query  2979  PTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIV  3149
             P+ GL L+ R+L  F PDEFCPDP+P  VLEALN+E  +E      +S  +FP  A+P+V
Sbjct  660   PSIGLPLVKRILCNFTPDEFCPDPVPGAVLEALNAESIVEWRLSNGDSNSSFPYIASPVV  719

Query  3150  YAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEV  3323
             Y PP+  A        +    QL R+ S V +K YTSD+ELDELDSPL  I  KM  S  
Sbjct  720   YTPPT-QADVAEKVADAGGKPQLGRNVSVVQRKGYTSDEELDELDSPLTCIIDKMPPSPT  778

Query  3324  TK---------PgggsgngngngVRYQLLREVW  3395
                            +    G  VRY+LLREVW
Sbjct  779   LANGKMGNGNGKHKETTGYGGGNVRYELLREVW  811



>ref|XP_010279000.1| PREDICTED: uncharacterized protein LOC104613015 isoform X2 [Nelumbo 
nucifera]
Length=748

 Score =   508 bits (1307),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 311/693 (45%), Positives = 419/693 (60%), Gaps = 66/693 (10%)
 Frame = +3

Query  1398  LAEGENTEGHQGNTQELVTERDKHQETGEGKELI----IEKGQCSEGEP-VNS-CLQDNT  1559
             LA+ E++E    ++    T R  HQET + + +         + S+G P VNS  L DN 
Sbjct  93    LAKKESSESRPHSS----TIRKNHQETSKSQNVSNNTSKRSTKSSQGSPKVNSKGLSDNK  148

Query  1560  TKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNS  1739
             +      N  +     S  ++   D+ ++ V  ++TL E+     S+ S+      ++N 
Sbjct  149   S-----NNMKVPPKPSSESSEGVDDKAIDEVKDINTLDEAPSGAHSIGSDDETAGTEKNG  203

Query  1740  IEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHG  1919
             +E                    ++  K +E+EQ+I+ LE ELRE AA+EI L+SVV EHG
Sbjct  204   LE----------------EQREIVNHKIEEMEQRIEKLEEELREIAALEISLYSVVPEHG  247

Query  1920  SSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSN  2099
             SS +KVH PARRLSRLY HACK  +  +R + AR+  SGL+L+AK+CGNDV RLTFWLSN
Sbjct  248   SSAHKVHTPARRLSRLYIHACKHWTQDKRATIARNTASGLVLIAKSCGNDVSRLTFWLSN  307

Query  2100  CVLLRAAICK-FSEKQQL-PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFE  2273
              ++LR  I + F       P++     N    +E K S LKW++ P  K V    PG  +
Sbjct  308   TIVLREIISQAFGNSHHSNPITRFVEANGAKISEGKPSSLKWKASPGPKQVKK--PGFMQ  365

Query  2274  ---DWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSS  2444
                DW+    F  ALEKVE+WIFSRI+ES+WWQT TPHMQ       +   NK + +   
Sbjct  366   IVDDWQETSTFIMALEKVESWIFSRIVESVWWQTLTPHMQPPVE---EMHTNKSFGKLLG  422

Query  2445  SC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMF  2618
                  ++  +FS+ LWK AF+DA++R+CPVRA GHECGCL +L++++M+QCVARLDVAMF
Sbjct  423   PALGDQQQGSFSINLWKSAFQDAFQRVCPVRAEGHECGCLPVLARMVMEQCVARLDVAMF  482

Query  2619  NAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdd  2798
             NAILRESA +IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSRWL+DLFG+  
Sbjct  483   NAILRESAHEIPTDPVSDPIVDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDLFGM--  540

Query  2799  ddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVC  2978
                  D  +  +++A + +   R+  DA  K FYLLNA+SDL+MLPKDML+ R++RKEVC
Sbjct  541   -----DADDSVKDQASDEDDF-RRVGDAEPKSFYLLNALSDLLMLPKDMLMDRSIRKEVC  594

Query  2979  PTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIV  3149
             P+ GL L+ R+L  F PDEFCPDP+P  VLEALN+E  +E      +S  +FP  A+P+V
Sbjct  595   PSIGLPLVKRILCNFTPDEFCPDPVPGAVLEALNAESIVEWRLSNGDSNSSFPYIASPVV  654

Query  3150  YAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEV  3323
             Y PP+  A        +    QL R+ S V +K YTSD+ELDELDSPL  I  KM  S  
Sbjct  655   YTPPT-QADVAEKVADAGGKPQLGRNVSVVQRKGYTSDEELDELDSPLTCIIDKMPPSPT  713

Query  3324  TK---------PgggsgngngngVRYQLLREVW  3395
                            +    G  VRY+LLREVW
Sbjct  714   LANGKMGNGNGKHKETTGYGGGNVRYELLREVW  746



>ref|NP_001078088.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE73718.1| uncharacterized protein AT3G01810 [Arabidopsis thaliana]
Length=859

 Score =   511 bits (1316),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 344/492 (70%), Gaps = 29/492 (6%)
 Frame = +3

Query  1665  TLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKI  1844
             ++ E +R   SVRS+  +  ++ NS   + S + K+ KV    T +  LE K + LE ++
Sbjct  358   SIVEKSRKVKSVRSSLDI--NRSNSRLSLFS-ERKEAKVYPNSTHDTTLESKIKNLESRV  414

Query  1845  QMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARS  2024
             + LEGEL EAAA+E  L+SVVAEHGSS++KVHAPARRL RLY HAC+E  + RR +AA S
Sbjct  415   KKLEGELCEAAAIEAALYSVVAEHGSSSSKVHAPARRLLRLYLHACRETHLSRRANAAES  474

Query  2025  VVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS--KNAVVKNER  2198
              VSGL+LVAKACGNDVPRLTFWLSN ++LR  I   S +++LP+S+     K    +   
Sbjct  475   AVSGLVLVAKACGNDVPRLTFWLSNTIVLRTIISDTSAEEELPVSAGPGPRKQKAERETE  534

Query  2199  KASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPH  2378
             K S LKW+  P  K    D+  +F  W++P+ F  ALEKVEAWIFSR++ESIWWQT TP 
Sbjct  535   KRSSLKWKDSPLSK---KDI-KSFGAWDDPVTFITALEKVEAWIFSRVVESIWWQTLTPR  590

Query  2379  MQSGAATSLD------SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGG  2540
             MQS AA++ +      S   K + RT SS ++E  +FSLELWKKAFR+A+ER+CP+R  G
Sbjct  591   MQSSAASTREFDKGNGSASKKTFGRTPSSTNQELGDFSLELWKKAFREAHERLCPLRGSG  650

Query  2541  HECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKAS  2720
             HECGCL + ++LIM+QCVARLDVAMFNAILR+S D+ PTDPVSDPI++  VLPIP+  +S
Sbjct  651   HECGCLPIPARLIMEQCVARLDVAMFNAILRDSDDNFPTDPVSDPIADLRVLPIPSRTSS  710

Query  2721  FAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFY  2900
             F +GAQLKN+IGNWSRWL DLFGIDD+D+D         K+               K F 
Sbjct  711   FGSGAQLKNSIGNWSRWLTDLFGIDDEDDDSSDENSYVEKS--------------FKTFN  756

Query  2901  LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALN  3080
             LL A+SDLMMLPKDMLL+ +VRKEVCP FG  LI RVLN F+PDEFCPDP+P+ VL++L 
Sbjct  757   LLKALSDLMMLPKDMLLNSSVRKEVCPMFGAPLIKRVLNNFVPDEFCPDPVPDAVLKSLE  816

Query  3081  SEDHMEVEEESV  3116
             SE    V  +++
Sbjct  817   SEKLRRVSSQAI  828


 Score =   213 bits (541),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 7/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   SVQ +YLI+I +IKPWPPSQSL++L++VVIQWE+GD+NSG+T+ VAP
Sbjct  1    MVLGLSSKNRRCSSVQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGDRNSGTTSVVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESF++P+TLL+++S++   GD F KN +E NLYEPRR+ T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFKLPLTLLKDVSARGKGGDVFFKNVLELNLYEPRREKT--HQ  116

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A YGVVKE  +++  +N KRSYRN  QP+L L IQ V + R  S   N+++
Sbjct  117  LLATATIDLAVYGVVKESFSLTAQMNSKRSYRNATQPVLYLTIQPVSRRRASSSSMNSLK  176

Query  705  RESSMDSSAGESVSALMN  758
             E+    + GESVSALMN
Sbjct  177  DEA---KNGGESVSALMN  191



>ref|XP_011029662.1| PREDICTED: uncharacterized protein LOC105129350 isoform X2 [Populus 
euphratica]
Length=1055

 Score =   517 bits (1331),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 286/512 (56%), Positives = 355/512 (69%), Gaps = 27/512 (5%)
 Frame = +3

Query  1887  IGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGN  2066
             +GL+SVVAEHGSS NKV APARRLSR Y HACK  S ++  +AAR+++SGLILV+KACGN
Sbjct  566   VGLYSVVAEHGSSINKVLAPARRLSRFYLHACKARSRVKSANAARAIISGLILVSKACGN  625

Query  2067  DVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSV  2246
             DVPRLTFWLSN ++LRA + +  EK Q         N   K   ++SP + Q     K+ 
Sbjct  626   DVPRLTFWLSNSIVLRAIVTQAVEKLQFASVPSIINNGSPKGRHESSPSEVQ-----KTD  680

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKI  2426
             G +   + +DW  P  +  AL+K+EAWIFSRI+ S+WWQT TPHMQS A  S +S   K 
Sbjct  681   GTE---SSDDWAEPEPYIAALKKIEAWIFSRIVTSVWWQTLTPHMQSTAVKSSNSR--KT  735

Query  2427  YQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLD  2606
               R      +E  NF+++LWKKAFRDA ER+CPVRAGGHECGCL +LS+L+M+Q V RLD
Sbjct  736   NARRHGLGDQEQGNFAIDLWKKAFRDACERLCPVRAGGHECGCLPVLSRLVMEQLVGRLD  795

Query  2607  VAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLF  2786
             VAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF AGAQLKNA+GNWSRWL DLF
Sbjct  796   VAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFGAGAQLKNAVGNWSRWLTDLF  855

Query  2787  GIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVR  2966
             GIDDDD  ++  E D N         R+  +   K F LLNA+SDLMMLP +ML  R+ R
Sbjct  856   GIDDDDSPEEKDELDRN---------RRECETSFKAFQLLNALSDLMMLPFEMLGDRSTR  906

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPI  3146
             KEVCPTFG+ +I RVL+ F+PDEF PDP+P  +LE+ NSED  +  EES+ NFPC AAP 
Sbjct  907   KEVCPTFGVPIIKRVLDNFVPDEFNPDPVPETILESFNSEDLADSGEESITNFPCIAAPA  966

Query  3147  VYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVT  3326
             +Y+PP AA               L RSRS++L+KSY SDDELDELDSP+  I +++S+V+
Sbjct  967   IYSPPPAA--LLTNIIGEVGGQTLHRSRSAMLRKSYASDDELDELDSPMTSI-IDSSKVS  1023

Query  3327  KPggg-----sgngngngVRYQLLREVWMSSE  3407
                        G      VRYQLLREVW   E
Sbjct  1024  PTATAWNWMQKGKAGRKVVRYQLLREVWKDGE  1055


 Score =   171 bits (433),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 133/201 (66%), Gaps = 18/201 (9%)
 Frame = +3

Query  165  MVLGPSGKTR---GVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQ  335
            MVLG   K R      SVQ +Y+I++ EIKPWPPSQSLK+++++++QWE+GD++SGS T 
Sbjct  1    MVLGLRSKNRKGTSDSSVQVDYIIHVQEIKPWPPSQSLKSVQSLLLQWENGDQSSGSFT-  59

Query  336  VAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTV  515
                    S VG+G++EF ESFR+  TL +E+S K    D+F KN +EFN YE R+D  +
Sbjct  60   --------SNVGDGKVEFIESFRLSATLCKEVSRKGTARDSFLKNYLEFNFYESRKDKAM  111

Query  516  KGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRN  695
            KGQLLG+A+I+ A+YG++ + + ++ PIN K+S R+ V  +L L IQ   +       ++
Sbjct  112  KGQLLGSALINLADYGIIMDAVTINAPINFKKSSRSAVPAVLYLNIQPFDRD------KS  165

Query  696  NVRRESSMDSSAGESVSALMN  758
            ++ +E S+D    E+VS + N
Sbjct  166  SLSKEVSLDKDGSETVSEVAN  186



>gb|KHN07401.1| hypothetical protein glysoja_012699 [Glycine soja]
Length=807

 Score =   509 bits (1311),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 363/545 (67%), Gaps = 23/545 (4%)
 Frame = +3

Query  1800  NVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
             +   E K +E+E +I+ LE ELRE AA+E+ L+S+  EHGSS +KVH PARRLSRLY HA
Sbjct  271   DTAAELKIEEMELRIEKLEEELREVAALEVSLYSIAPEHGSSAHKVHTPARRLSRLYIHA  330

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEK-QQLP  2153
             CK  +  RR + A++ VSGLILVA++CGNDV RLTFWLSN ++LR  I + F    Q  P
Sbjct  331   CKHWTQKRRATIAKNTVSGLILVARSCGNDVSRLTFWLSNTIVLREIISQAFGNSCQASP  390

Query  2154  LSSEYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             L      NA  K N+ K+  LKW+     K+ GN      EDW+    FT ALE+VE+WI
Sbjct  391   LKRLAESNAAGKRNDGKSMALKWKGSSSGKA-GNGFMPLVEDWQETGTFTFALERVESWI  449

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             FSRI+ES+WWQ  TP+MQS    S +  I K+        ++   NFS+ LW+ AF+DA+
Sbjct  450   FSRIVESVWWQALTPYMQSPVGNSSNKSIGKLMGPALGDHNQG--NFSINLWRNAFQDAF  507

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRAGGHECGCL +L++++M+QC+ARLDVAMFNA+LRESA DIPTDP+SDPI + +
Sbjct  508   QRLCPVRAGGHECGCLPVLARMVMEQCIARLDVAMFNALLRESALDIPTDPISDPIVDSK  567

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSR L D+FGID +D      +      +NS   E++
Sbjct  568   VLPIPAGDLSFGSGAQLKNSVGNWSRLLTDMFGIDAEDCLLQEDQ------ENSENDEKQ  621

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
              +D+  KPF LLN +SDL+MLPKDML+ R +R EVCPT  LSLI RVL  F PDEFCPDP
Sbjct  622   GRDSEPKPFVLLNDLSDLLMLPKDMLIDRNIRHEVCPTINLSLIIRVLCNFTPDEFCPDP  681

Query  3051  IPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
             +P  VLEALN+E  +E  +  ES  +FP  A P+VY  PS+A         ++  S L R
Sbjct  682   VPGTVLEALNAETIIERRLSAESARSFPYVAEPVVYMAPSSA-NVAEKVAEAAGKSHLAR  740

Query  3225  srssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngn------gngVRYQL  3380
             + S+V ++ YTSD+EL+ELDSPL  I  K+ +S      G   N            RYQL
Sbjct  741   NVSAVQRRGYTSDEELEELDSPLTFIIDKLPSSPTVTENGKGNNHKEQGGNPTTNARYQL  800

Query  3381  LREVW  3395
             LREVW
Sbjct  801   LREVW  805



>ref|XP_011029659.1| PREDICTED: uncharacterized protein LOC105129350 isoform X1 [Populus 
euphratica]
 ref|XP_011029661.1| PREDICTED: uncharacterized protein LOC105129350 isoform X1 [Populus 
euphratica]
Length=1056

 Score =   517 bits (1331),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 286/512 (56%), Positives = 355/512 (69%), Gaps = 27/512 (5%)
 Frame = +3

Query  1887  IGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGN  2066
             +GL+SVVAEHGSS NKV APARRLSR Y HACK  S ++  +AAR+++SGLILV+KACGN
Sbjct  567   VGLYSVVAEHGSSINKVLAPARRLSRFYLHACKARSRVKSANAARAIISGLILVSKACGN  626

Query  2067  DVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSV  2246
             DVPRLTFWLSN ++LRA + +  EK Q         N   K   ++SP + Q     K+ 
Sbjct  627   DVPRLTFWLSNSIVLRAIVTQAVEKLQFASVPSIINNGSPKGRHESSPSEVQ-----KTD  681

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKI  2426
             G +   + +DW  P  +  AL+K+EAWIFSRI+ S+WWQT TPHMQS A  S +S   K 
Sbjct  682   GTE---SSDDWAEPEPYIAALKKIEAWIFSRIVTSVWWQTLTPHMQSTAVKSSNSR--KT  736

Query  2427  YQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLD  2606
               R      +E  NF+++LWKKAFRDA ER+CPVRAGGHECGCL +LS+L+M+Q V RLD
Sbjct  737   NARRHGLGDQEQGNFAIDLWKKAFRDACERLCPVRAGGHECGCLPVLSRLVMEQLVGRLD  796

Query  2607  VAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLF  2786
             VAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF AGAQLKNA+GNWSRWL DLF
Sbjct  797   VAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFGAGAQLKNAVGNWSRWLTDLF  856

Query  2787  GIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVR  2966
             GIDDDD  ++  E D N         R+  +   K F LLNA+SDLMMLP +ML  R+ R
Sbjct  857   GIDDDDSPEEKDELDRN---------RRECETSFKAFQLLNALSDLMMLPFEMLGDRSTR  907

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPI  3146
             KEVCPTFG+ +I RVL+ F+PDEF PDP+P  +LE+ NSED  +  EES+ NFPC AAP 
Sbjct  908   KEVCPTFGVPIIKRVLDNFVPDEFNPDPVPETILESFNSEDLADSGEESITNFPCIAAPA  967

Query  3147  VYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVT  3326
             +Y+PP AA               L RSRS++L+KSY SDDELDELDSP+  I +++S+V+
Sbjct  968   IYSPPPAA--LLTNIIGEVGGQTLHRSRSAMLRKSYASDDELDELDSPMTSI-IDSSKVS  1024

Query  3327  KPggg-----sgngngngVRYQLLREVWMSSE  3407
                        G      VRYQLLREVW   E
Sbjct  1025  PTATAWNWMQKGKAGRKVVRYQLLREVWKDGE  1056


 Score =   171 bits (434),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 133/201 (66%), Gaps = 18/201 (9%)
 Frame = +3

Query  165  MVLGPSGKTR---GVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQ  335
            MVLG   K R      SVQ +Y+I++ EIKPWPPSQSLK+++++++QWE+GD++SGS T 
Sbjct  1    MVLGLRSKNRKGTSDSSVQVDYIIHVQEIKPWPPSQSLKSVQSLLLQWENGDQSSGSFT-  59

Query  336  VAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTV  515
                    S VG+G++EF ESFR+  TL +E+S K    D+F KN +EFN YE R+D  +
Sbjct  60   --------SNVGDGKVEFIESFRLSATLCKEVSRKGTARDSFLKNYLEFNFYESRKDKAM  111

Query  516  KGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRN  695
            KGQLLG+A+I+ A+YG++ + + ++ PIN K+S R+ V  +L L IQ   +       ++
Sbjct  112  KGQLLGSALINLADYGIIMDAVTINAPINFKKSSRSAVPAVLYLNIQPFDRD------KS  165

Query  696  NVRRESSMDSSAGESVSALMN  758
            ++ +E S+D    E+VS + N
Sbjct  166  SLSKEVSLDKDGSETVSEVAN  186



>ref|XP_006576839.1| PREDICTED: uncharacterized protein LOC100777738 isoform X1 [Glycine 
max]
 ref|XP_006576840.1| PREDICTED: uncharacterized protein LOC100777738 isoform X2 [Glycine 
max]
 ref|XP_006576841.1| PREDICTED: uncharacterized protein LOC100777738 isoform X3 [Glycine 
max]
 ref|XP_006576842.1| PREDICTED: uncharacterized protein LOC100777738 isoform X4 [Glycine 
max]
Length=807

 Score =   509 bits (1311),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 363/545 (67%), Gaps = 23/545 (4%)
 Frame = +3

Query  1800  NVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
             +   E K +E+E +I+ LE ELRE AA+E+ L+S+  EHGSS +KVH PARRLSRLY HA
Sbjct  271   DTAAELKIEEMELRIEKLEEELREVAALEVSLYSIAPEHGSSAHKVHTPARRLSRLYIHA  330

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEK-QQLP  2153
             CK  +  RR + A++ VSGLILVA++CGNDV RLTFWLSN ++LR  I + F    Q  P
Sbjct  331   CKHWTQKRRATIAKNTVSGLILVARSCGNDVSRLTFWLSNTIVLREIISQAFGNSCQASP  390

Query  2154  LSSEYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             L      NA  K N+ K+  LKW+     K+ GN      EDW+    FT ALE+VE+WI
Sbjct  391   LKRLAESNAAGKRNDGKSMALKWKGSSSGKA-GNGFMPLVEDWQETGTFTFALERVESWI  449

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             FSRI+ES+WWQ  TP+MQS    S +  I K+        ++   NFS+ LW+ AF+DA+
Sbjct  450   FSRIVESVWWQALTPYMQSPVGNSSNKSIGKLMGPALGDHNQG--NFSINLWRNAFQDAF  507

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRAGGHECGCL +L++++M+QC+ARLDVAMFNA+LRESA DIPTDP+SDPI + +
Sbjct  508   QRLCPVRAGGHECGCLPVLARMVMEQCIARLDVAMFNALLRESALDIPTDPISDPIVDSK  567

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSR L D+FGID +D      +      +NS   E++
Sbjct  568   VLPIPAGDLSFGSGAQLKNSVGNWSRLLTDMFGIDAEDCLLQEDQ------ENSENDEKQ  621

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
              +D+  KPF LLN +SDL+MLPKDML+ R +R EVCPT  LSLI RVL  F PDEFCPDP
Sbjct  622   GRDSEPKPFVLLNDLSDLLMLPKDMLIDRNIRHEVCPTINLSLIIRVLCNFTPDEFCPDP  681

Query  3051  IPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
             +P  VLEALN+E  +E  +  ES  +FP  A P+VY  PS+A         ++  S L R
Sbjct  682   VPGTVLEALNAETIIERRLSAESARSFPYVAEPVVYMAPSSA-NVAEKVAEAAGKSHLAR  740

Query  3225  srssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngn------gngVRYQL  3380
             + S+V ++ YTSD+EL+ELDSPL  I  K+ +S      G   N            RYQL
Sbjct  741   NVSAVQRRGYTSDEELEELDSPLTFIIDKLPSSPTVTENGKGNNHKEQGGNPTTNARYQL  800

Query  3381  LREVW  3395
             LREVW
Sbjct  801   LREVW  805



>ref|XP_010928480.1| PREDICTED: uncharacterized protein LOC105050237 isoform X1 [Elaeis 
guineensis]
 ref|XP_010928481.1| PREDICTED: uncharacterized protein LOC105050237 isoform X1 [Elaeis 
guineensis]
 ref|XP_010928482.1| PREDICTED: uncharacterized protein LOC105050237 isoform X1 [Elaeis 
guineensis]
Length=708

 Score =   505 bits (1300),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 275/544 (51%), Positives = 352/544 (65%), Gaps = 37/544 (7%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K  E+EQ+I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK  S
Sbjct  181   QKISEMEQRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWS  240

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL---PLSSE  2165
               +R + A++ VSGL L+AK+CGNDVPRLTFWLSN V+LR  I +      L    + S 
Sbjct  241   QDKRATVAKNTVSGLALIAKSCGNDVPRLTFWLSNTVVLREIISQTFGNMSLLNPTMRSF  300

Query  2166  YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTF------EDWENPLGFTKALEKVEAW  2327
              S     K E K +PLKW     + + GN L   F      +DW+     T ALEK+E+W
Sbjct  301   ESNGGAKKTEGKLTPLKW-----RNNAGNRLAKVFGFMQQIDDWQETSTLTAALEKIESW  355

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFR  2501
             IF+RI+ES+WWQT TPHMQS       +   K Y R        ++  +FS  LWK AF 
Sbjct  356   IFARIVESVWWQTLTPHMQSPVEEMYTA---KGYGRLLGPALGDQQQGSFSSNLWKSAFH  412

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++++++QCV+RLDVAMFNAILRESA++IPTDPVSDPI 
Sbjct  413   DAFTRLCPVRAGGHECGCLPVLARMVIEQCVSRLDVAMFNAILRESANEIPTDPVSDPIV  472

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIPAG  SF +GAQLKN+IGNWSRWL  LFGI               +  + +G 
Sbjct  473   DPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTGLFGI------YADDSIKYGQLADEDGD  526

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
              R+     SK F LLN +SDL+MLPKDMLL R++RKE CP+ GL LITR+L  F PDEFC
Sbjct  527   RREGAPE-SKSFCLLNELSDLLMLPKDMLLERSIRKEFCPSIGLPLITRILCNFTPDEFC  585

Query  3042  PDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssss  3212
             PDP+P ++LE LNSE  +E    +E+ + +FPC+AAP+VY+PPS A    +      +  
Sbjct  586   PDPVPGILLEELNSESLLERQLSDEDLISSFPCTAAPVVYSPPSPADAAEVGDAGGKAKL  645

Query  3213  qltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP---gggsgngngngVRYQLL  3383
                 S    + + YTSD++LD+LDSPL  I M+ +    P               RY+LL
Sbjct  646   DQRAS----MVQGYTSDEDLDDLDSPLTSI-MDKTPPVSPILRDVNQKESKHANARYKLL  700

Query  3384  REVW  3395
             REVW
Sbjct  701   REVW  704



>ref|XP_006576843.1| PREDICTED: uncharacterized protein LOC100777738 isoform X5 [Glycine 
max]
Length=716

 Score =   505 bits (1300),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 281/541 (52%), Positives = 362/541 (67%), Gaps = 23/541 (4%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             E K +E+E +I+ LE ELRE AA+E+ L+S+  EHGSS +KVH PARRLSRLY HACK  
Sbjct  184   ELKIEEMELRIEKLEEELREVAALEVSLYSIAPEHGSSAHKVHTPARRLSRLYIHACKHW  243

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEK-QQLPLSSE  2165
             +  RR + A++ VSGLILVA++CGNDV RLTFWLSN ++LR  I + F    Q  PL   
Sbjct  244   TQKRRATIAKNTVSGLILVARSCGNDVSRLTFWLSNTIVLREIISQAFGNSCQASPLKRL  303

Query  2166  YSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
                NA  K N+ K+  LKW+     K+ GN      EDW+    FT ALE+VE+WIFSRI
Sbjct  304   AESNAAGKRNDGKSMALKWKGSSSGKA-GNGFMPLVEDWQETGTFTFALERVESWIFSRI  362

Query  2343  IESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERIC  2522
             +ES+WWQ  TP+MQS    S +  I K+        ++   NFS+ LW+ AF+DA++R+C
Sbjct  363   VESVWWQALTPYMQSPVGNSSNKSIGKLMGPALGDHNQG--NFSINLWRNAFQDAFQRLC  420

Query  2523  PVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPI  2702
             PVRAGGHECGCL +L++++M+QC+ARLDVAMFNA+LRESA DIPTDP+SDPI + +VLPI
Sbjct  421   PVRAGGHECGCLPVLARMVMEQCIARLDVAMFNALLRESALDIPTDPISDPIVDSKVLPI  480

Query  2703  PAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDA  2882
             PAG  SF +GAQLKN++GNWSR L D+FGID +D      +      +NS   E++ +D+
Sbjct  481   PAGDLSFGSGAQLKNSVGNWSRLLTDMFGIDAEDCLLQEDQ------ENSENDEKQGRDS  534

Query  2883  CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNV  3062
               KPF LLN +SDL+MLPKDML+ R +R EVCPT  LSLI RVL  F PDEFCPDP+P  
Sbjct  535   EPKPFVLLNDLSDLLMLPKDMLIDRNIRHEVCPTINLSLIIRVLCNFTPDEFCPDPVPGT  594

Query  3063  VLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrss  3236
             VLEALN+E  +E  +  ES  +FP  A P+VY  PS+A         ++  S L R+ S+
Sbjct  595   VLEALNAETIIERRLSAESARSFPYVAEPVVYMAPSSA-NVAEKVAEAAGKSHLARNVSA  653

Query  3237  VLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngn------gngVRYQLLREV  3392
             V ++ YTSD+EL+ELDSPL  I  K+ +S      G   N            RYQLLREV
Sbjct  654   VQRRGYTSDEELEELDSPLTFIIDKLPSSPTVTENGKGNNHKEQGGNPTTNARYQLLREV  713

Query  3393  W  3395
             W
Sbjct  714   W  714



>ref|XP_003553424.1| PREDICTED: uncharacterized protein LOC100804499 isoform X1 [Glycine 
max]
 ref|XP_006604374.1| PREDICTED: uncharacterized protein LOC100804499 isoform X2 [Glycine 
max]
 ref|XP_006604375.1| PREDICTED: uncharacterized protein LOC100804499 isoform X3 [Glycine 
max]
 ref|XP_006604376.1| PREDICTED: uncharacterized protein LOC100804499 isoform X4 [Glycine 
max]
 ref|XP_006604377.1| PREDICTED: uncharacterized protein LOC100804499 isoform X5 [Glycine 
max]
 ref|XP_006604378.1| PREDICTED: uncharacterized protein LOC100804499 isoform X6 [Glycine 
max]
 gb|KHN26351.1| hypothetical protein glysoja_029305 [Glycine soja]
Length=810

 Score =   507 bits (1306),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 360/545 (66%), Gaps = 24/545 (4%)
 Frame = +3

Query  1800  NVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
             N   E K +E+E +I+ LE ELRE AA+E+ L+S+  EHGSST+KVH PARRLSRLY HA
Sbjct  275   NAAAELKIEEMELRIEKLEEELREVAALEVSLYSIAPEHGSSTHKVHTPARRLSRLYIHA  334

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEK-QQLP  2153
             CK  +  RR + A++ VSGL+LVAK+CGNDV RLTFW SN ++LR  I + F    Q  P
Sbjct  335   CKHWTQKRRATIAKNTVSGLVLVAKSCGNDVSRLTFWFSNTIVLREIISQAFGNSCQASP  394

Query  2154  LSSEYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             L      NA  K N+ K+  LKW+   + K  GN      EDW+    FT ALE+VE+WI
Sbjct  395   LKRLVESNAAGKRNDGKSMALKWKGSSNGKP-GNGFMPLVEDWQETGTFTFALERVESWI  453

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             FSRI+ES+WWQ  TP+M S    S +  I K+        ++   NFS+ LW+ AF+DA+
Sbjct  454   FSRIVESVWWQALTPYMHSPVGDSSNKPIGKLMGPALGDHNQG--NFSINLWRNAFQDAF  511

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRAGGHECGCL +L++++M+QC+ARLDVAMFNA+LRESA +IPTDP+SDPI N +
Sbjct  512   QRLCPVRAGGHECGCLPVLARMVMEQCIARLDVAMFNALLRESALEIPTDPISDPIVNSK  571

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSRWL D+FG+D +D   +         +NS   E++
Sbjct  572   VLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMFGMDAEDCLQEDQ-------ENSENDEKQ  624

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
               D   K F LLN +SDL+MLPKDML+ R +R+EVCPT  LSLI RVL  F PDEFCPDP
Sbjct  625   GGDGEPKSFVLLNDLSDLLMLPKDMLIDRNIRQEVCPTIILSLIIRVLCNFTPDEFCPDP  684

Query  3051  IPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
             +P  VLEALN+E  +E  +  ES  +FP  AAP+VY  PS +A        +   S L R
Sbjct  685   VPGTVLEALNAETIIERRLSAESARSFPYVAAPVVYMAPS-SANVAEKVAETEGKSHLAR  743

Query  3225  srssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngn------gngVRYQL  3380
             + S+V  + YTSD+EL+ELDSPL  I  K+ +S      G   N            RYQL
Sbjct  744   NVSAVQSRGYTSDEELEELDSPLTSIIDKLPSSPTVTENGKGNNHKEQGGHPTTNARYQL  803

Query  3381  LREVW  3395
             LREVW
Sbjct  804   LREVW  808



>gb|KHN05077.1| hypothetical protein glysoja_013984 [Glycine soja]
Length=988

 Score =   512 bits (1319),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 298/665 (45%), Positives = 416/665 (63%), Gaps = 49/665 (7%)
 Frame = +3

Query  1446  LVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKT  1625
             ++ +++K +E  +G+E    + +  E E VN+   D++TK+    ++  +  ++     T
Sbjct  362   VMDDKEKTKEGRKGQEQFTMRNELLENELVNNLSDDDSTKKGKFNSTTHLLNKKLHDHPT  421

Query  1626  TC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETS  1799
             +   +++   V++V +  +S    G      F+     N  E I + +         E  
Sbjct  422   SILMNDKTEDVTNVKSPPQSAENYG-----LFISSQTHNQAEEINTMNDVHVGTACHEDV  476

Query  1800  NV--VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYF  1973
             NV         EL+ +++ML  ELREAAA+E+ ++SV+AEHGSS+NKVHAPARRLSR YF
Sbjct  477   NVNGSFHNNETELKAEVEMLREELREAAALEVSMYSVIAEHGSSSNKVHAPARRLSRFYF  536

Query  1974  HACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK------FS  2135
             HAC+  S     +AA+S VSG +LV+KACGNDVPRLTFW SN +LLRA + K      F 
Sbjct  537   HACRVGSPATMATAAQSAVSGFVLVSKACGNDVPRLTFWFSNLILLRAIVSKEVENIHFG  596

Query  2136  EKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEK  2315
             +   +   S+ + N + K E+                 ++    F  WE+P  F  ALEK
Sbjct  597   DGPCINSESDGTGNTLHKEEK-----------------DNTEKHFHRWEDPETFLVALEK  639

Query  2316  VEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKA  2495
             VEAWIFSRI+ES+WWQT TP+MQS AA   +S   K Y+R      ++  +FS++LWK+A
Sbjct  640   VEAWIFSRIVESVWWQTLTPYMQSAAAK--NSSSRKAYERRYRVGDQDQGSFSIDLWKRA  697

Query  2496  FRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDP  2675
             F+DA ERICP+RAGGHECGCL ++++L+M+Q V+RLDVAMFNAILRESA+++P DP+SDP
Sbjct  698   FKDACERICPLRAGGHECGCLLVIARLVMEQLVSRLDVAMFNAILRESAEEMPMDPISDP  757

Query  2676  ISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN  2855
             IS+  VLPIPAGK+ F AGAQLKNAIG+WSRWL+DLF I           DD +  + SN
Sbjct  758   ISDSMVLPIPAGKSGFGAGAQLKNAIGDWSRWLSDLFSI-----------DDSDSREVSN  806

Query  2856  GHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
              +     ++  KPF  LNA+SDLMMLP DML   ++ KEVCP FG+SLI RV+  F+PDE
Sbjct  807   ENNESKCESSFKPFQFLNALSDLMMLPLDMLADGSMIKEVCPKFGISLIKRVVYNFVPDE  866

Query  3036  FCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             F P PIP+ V +AL++ED ++  E ++ +FPC A   +YAPP A++   +       +  
Sbjct  867   FSPGPIPDAVYDALDNED-IQDGEGAITSFPCPAGFTLYAPPPASS--VVGKLQEVGNKT  923

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLIKMENSEV-TKPgggsgngngngVRYQLLREV  3392
               R+ S VLKK YTSDDELDELDSPL+ + M++S + +K       G    VRY+LLRE 
Sbjct  924   SLRTGSFVLKKLYTSDDELDELDSPLSALGMDDSSLSSKEKLALVKGGRKVVRYELLREA  983

Query  3393  WMSSE  3407
             W +SE
Sbjct  984   WKTSE  988


 Score =   167 bits (424),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 113/164 (69%), Gaps = 13/164 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K++   S+Q  Y+I++ EIKPWPPSQSL++++ V++QWE+GD+NSGS    A 
Sbjct  1    MVLGIRSKSKKSVSIQVHYIIHVQEIKPWPPSQSLRSVQTVLLQWENGDQNSGSLPSTA-  59

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                    GNG+IEFNESFR+ + + RE S K  + +TFQKNC+EF LY    D TVK Q
Sbjct  60   --------GNGKIEFNESFRLSVLMCREASKKGKHRETFQKNCLEFYLY----DKTVKSQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            LLG+A I+ A++G++KE   +S+  NCK+S R + QP L + IQ
Sbjct  108  LLGSATINLADFGIIKETKALSIQFNCKKSSRISSQPFLYVNIQ  151



>ref|XP_006604379.1| PREDICTED: uncharacterized protein LOC100804499 isoform X7 [Glycine 
max]
Length=719

 Score =   503 bits (1296),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 360/545 (66%), Gaps = 24/545 (4%)
 Frame = +3

Query  1800  NVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
             N   E K +E+E +I+ LE ELRE AA+E+ L+S+  EHGSST+KVH PARRLSRLY HA
Sbjct  184   NAAAELKIEEMELRIEKLEEELREVAALEVSLYSIAPEHGSSTHKVHTPARRLSRLYIHA  243

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEK-QQLP  2153
             CK  +  RR + A++ VSGL+LVAK+CGNDV RLTFW SN ++LR  I + F    Q  P
Sbjct  244   CKHWTQKRRATIAKNTVSGLVLVAKSCGNDVSRLTFWFSNTIVLREIISQAFGNSCQASP  303

Query  2154  LSSEYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             L      NA  K N+ K+  LKW+   + K  GN      EDW+    FT ALE+VE+WI
Sbjct  304   LKRLVESNAAGKRNDGKSMALKWKGSSNGKP-GNGFMPLVEDWQETGTFTFALERVESWI  362

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             FSRI+ES+WWQ  TP+M S    S +  I K+        ++   NFS+ LW+ AF+DA+
Sbjct  363   FSRIVESVWWQALTPYMHSPVGDSSNKPIGKLMGPALGDHNQG--NFSINLWRNAFQDAF  420

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRAGGHECGCL +L++++M+QC+ARLDVAMFNA+LRESA +IPTDP+SDPI N +
Sbjct  421   QRLCPVRAGGHECGCLPVLARMVMEQCIARLDVAMFNALLRESALEIPTDPISDPIVNSK  480

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSRWL D+FG+D +D   +         +NS   E++
Sbjct  481   VLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMFGMDAEDCLQEDQ-------ENSENDEKQ  533

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
               D   K F LLN +SDL+MLPKDML+ R +R+EVCPT  LSLI RVL  F PDEFCPDP
Sbjct  534   GGDGEPKSFVLLNDLSDLLMLPKDMLIDRNIRQEVCPTIILSLIIRVLCNFTPDEFCPDP  593

Query  3051  IPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
             +P  VLEALN+E  +E  +  ES  +FP  AAP+VY  PS +A        +   S L R
Sbjct  594   VPGTVLEALNAETIIERRLSAESARSFPYVAAPVVYMAPS-SANVAEKVAETEGKSHLAR  652

Query  3225  srssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngn------gngVRYQL  3380
             + S+V  + YTSD+EL+ELDSPL  I  K+ +S      G   N            RYQL
Sbjct  653   NVSAVQSRGYTSDEELEELDSPLTSIIDKLPSSPTVTENGKGNNHKEQGGHPTTNARYQL  712

Query  3381  LREVW  3395
             LREVW
Sbjct  713   LREVW  717



>gb|KDP26777.1| hypothetical protein JCGZ_17935 [Jatropha curcas]
Length=1062

 Score =   514 bits (1323),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 289/532 (54%), Positives = 371/532 (70%), Gaps = 26/532 (5%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             ELE K++MLE EL EAAA+E GL+S+VAEHGSSTNKVHAPARRLSR Y HACK  S  +R
Sbjct  552   ELESKVEMLEEELMEAAALEAGLYSIVAEHGSSTNKVHAPARRLSRFYLHACKARSQAKR  611

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              SAAR+++SG +LV+KACGNDVPRLTFWLSN ++LRA + +  EK QL  +   +K+   
Sbjct  612   ASAARAIISGFVLVSKACGNDVPRLTFWLSNSIMLRAIVSQVVEKLQLAAAPSVNKSDSQ  671

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
             +        + +S P++    N+   + ++WE P  F +ALE++EAWIF RI+ES+WWQT
Sbjct  672   QG-------RHESKPNEGEETNETCSS-DEWEEPRTFIEALERIEAWIFLRIVESVWWQT  723

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHE  2546
              TPHMQS       S+  K + R      +E  +F+++LW+KAF+DA ER+CP+RAGGHE
Sbjct  724   LTPHMQSTVVKGSSSK--KTHARKYGLGDQEQGHFAIDLWEKAFKDACERLCPIRAGGHE  781

Query  2547  CGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFA  2726
             CGCL +L++L+M+Q V RLDVAMFNAILRESAD++PTDPVSDPIS+P+VLPIPAGK+SF 
Sbjct  782   CGCLPVLARLVMEQLVHRLDVAMFNAILRESADEMPTDPVSDPISDPKVLPIPAGKSSFG  841

Query  2727  AGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLL  2906
             AGAQLKNA+GNWSRWL DLFGIDD D   D+         N  G   +  ++  K F+LL
Sbjct  842   AGAQLKNAVGNWSRWLTDLFGIDDSDSLGDI---------NELGSNSQECESSFKAFHLL  892

Query  2907  NAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSE  3086
              A+SDLMMLP +ML   + RKEVCP FG  +I RVLN F+PDEF P+PIP  + E+L+SE
Sbjct  893   RALSDLMMLPFEMLADSSTRKEVCPIFGARIIERVLNNFVPDEFNPEPIPEAIFESLDSE  952

Query  3087  DHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsdd  3266
             D  E  +ES+ +FPC A+P +Y+PPSAA            +  L R  S++L+KSYTSDD
Sbjct  953   DLAEDGKESITSFPCIASPTIYSPPSAA--LLTNIIGEVETHTLQRCGSALLRKSYTSDD  1010

Query  3267  eldeldsPLNLIKMENSE-----VTKPgggsgngngngVRYQLLREVWMSSE  3407
             ELDELDSP+  I ++NS              GNG    VRYQLLR+VW   E
Sbjct  1011  ELDELDSPMTSIIIDNSRNSPVPTVSNWAPKGNGGRKVVRYQLLRQVWKDGE  1062


 Score =   184 bits (467),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 132/198 (67%), Gaps = 18/198 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   S+Q +YLI I EIKPWPP QSLK++++V++QWE+GD+NSGS T    
Sbjct  1    MVLGLRSKNRKGTSMQVDYLIYIQEIKPWPPLQSLKSIESVLLQWENGDQNSGSFT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S V NG++EF+ESFR+P+T  RE S K    D+FQKN +E +LYEPR+D  +K Q
Sbjct  57   -----SSVENGKVEFSESFRLPVTFYREASRKGAESDSFQKNYLELSLYEPRKDKAMKSQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YG++K+   +S PIN K+S ++ VQ +L + IQ          V  ++ 
Sbjct  112  LLGSAVINLADYGIIKDATTISTPINFKKSSKSAVQSVLYINIQPFD-------VDKSLS  164

Query  705  RESSMDSSAGESVSALMN  758
            +E S+D S  ESVS + N
Sbjct  165  KEVSLDGS--ESVSEVTN  180



>ref|XP_010025335.1| PREDICTED: uncharacterized protein LOC104415699 [Eucalyptus grandis]
 ref|XP_010025336.1| PREDICTED: uncharacterized protein LOC104415699 [Eucalyptus grandis]
 ref|XP_010025337.1| PREDICTED: uncharacterized protein LOC104415699 [Eucalyptus grandis]
 gb|KCW61974.1| hypothetical protein EUGRSUZ_H04658 [Eucalyptus grandis]
Length=1007

 Score =   511 bits (1317),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 289/534 (54%), Positives = 362/534 (68%), Gaps = 42/534 (8%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             +LE +I MLE ELREAAA+E  L+SVVAEHGSS+NKVH+PARRLSR YFHACK NS  +R
Sbjct  509   KLENRIAMLEEELREAAAIEASLYSVVAEHGSSSNKVHSPARRLSRFYFHACKLNSPSKR  568

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              SAAR+VVSGL+LV+KACGNDVPRLTFWLSN + LRA I   + K    L  E   N V 
Sbjct  569   GSAARAVVSGLVLVSKACGNDVPRLTFWLSNAITLRAIITLAAGKL---LGEECVGNKVN  625

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFED-WENPLGFTKALEKVEAWIFSRIIESIWWQ  2363
             K     S ++         +  D    + D WENPL F  ALE+VE+WIFSRI+ES+WWQ
Sbjct  626   KETLVGSSVR--------GIDKDDVSEYADVWENPLAFAVALERVESWIFSRIVESVWWQ  677

Query  2364  TFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGH  2543
             T TPHMQ  AA   +S   KI+            NFS++LWKKAF+DA ER+CP+RAGGH
Sbjct  678   TVTPHMQPSAAKGSNSR--KIHG-----------NFSVDLWKKAFKDARERLCPIRAGGH  724

Query  2544  ECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASF  2723
             ECGCL LL++L+M+Q + RLDVAMFNAILR S D++PTDPVSDPIS+ +VLPIPAGK+ F
Sbjct  725   ECGCLPLLARLVMEQVIGRLDVAMFNAILRGSDDEMPTDPVSDPISDSKVLPIPAGKSGF  784

Query  2724  AAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS-KPFY  2900
                 QLKNAIG+WSRWLADLF ID+DD  +D          N NG  +K +   S K F 
Sbjct  785   RPAIQLKNAIGDWSRWLADLFDIDEDDSLEDR---------NKNGGSKKQEGGTSFKAFP  835

Query  2901  LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALN  3080
             LLNA+SDLM LP D+L  R+ RKE+CP FG+ LI RVL+ F+PDE+ P+P+P  ++E L+
Sbjct  836   LLNALSDLMKLPFDLLADRSARKELCPAFGVPLIMRVLDNFVPDEYSPNPVPEALIETLD  895

Query  3081  SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTs  3260
             SEDH++ +E+ + + P  A+P  YAPP A++           +  L+R+ SSVL+KSYTS
Sbjct  896   SEDHLDEDEQLITSIPHIASPTAYAPPPASS--LGAVIGDMGNQSLSRTGSSVLRKSYTS  953

Query  3261  ddeldeldsPLNLIKMENSEV--TKPg---ggsgngngngVRYQLLREVWMSSE  3407
             DDELDELDSP++ I  +   V  T P              VRY+LL+EVW   E
Sbjct  954   DDELDELDSPIDSIIHDGGRVLPTSPLPNWMLERKSGRKVVRYRLLKEVWRDGE  1007


 Score =   145 bits (366),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   ++  +YLI++ +IKPWP  QS  + ++V++QWE+ D +SGS    A 
Sbjct  1    MVLGLRSKSRKSVALHVDYLIHVEQIKPWP--QSPISAQSVLVQWEN-DDSSGSFPCSAE  57

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                     +G+I   ES ++P+TL +E S +  + D FQKNC+EF+LYE  ++  VKGQ
Sbjct  58   ---------DGKIVIGESLKLPVTLCKEASKRRSSSDGFQKNCLEFSLYESLKNRAVKGQ  108

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AVI+ A+YGV++E  N S+P++CK+S +N  QP+L + IQ        S  ++ + 
Sbjct  109  LLGSAVINLADYGVIQETANASIPVSCKKSLKNAAQPVLYISIQPCDVDSSSSSPKSRLS  168

Query  705  RESSMDSSAGESVSALMN  758
            +E S++     SV A +N
Sbjct  169  KEVSLEKPGNGSVLAQVN  186



>ref|XP_004239198.1| PREDICTED: uncharacterized protein LOC101265024 [Solanum lycopersicum]
 ref|XP_010320998.1| PREDICTED: uncharacterized protein LOC101265024 [Solanum lycopersicum]
Length=1031

 Score =   511 bits (1315),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 291/537 (54%), Positives = 362/537 (67%), Gaps = 28/537 (5%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             E + +I+ LE ELREAA VE+ L+SVVAEHGSS +KVHAPARRLSR Y HAC+  S  ++
Sbjct  512   EGKSRIETLEEELREAAVVEVSLYSVVAEHGSSAHKVHAPARRLSRFYVHACRAKSRAKQ  571

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
               AAR+ VSGL+LV+KACGNDVPRLTFWLSN V+LRA + + +  ++      Y+++ + 
Sbjct  572   AGAARAAVSGLVLVSKACGNDVPRLTFWLSNSVMLRAIVSQAAGGRRED-DRPYAESNMG  630

Query  2187  KNERKASPLK-WQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQ  2363
             K       LK        K V + L     DWE+   F  ALE+VEAWIFSRI+ES+WWQ
Sbjct  631   KTSLNGRSLKKGNEVSFNKGVNDSLTEELSDWEDIETFMLALEQVEAWIFSRIVESVWWQ  690

Query  2364  TFTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVR  2531
             T TPHMQ+ AA S    + S + K Y R SS   +E  NFS+ELWKKAF+DA ER+CPVR
Sbjct  691   TLTPHMQNTAANSGGRSMSSSVKKTYGRRSSLGDQEQGNFSIELWKKAFKDACERLCPVR  750

Query  2532  AGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAG  2711
             AGGHECGCL L ++L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPI + +VLPIPAG
Sbjct  751   AGGHECGCLPLPARLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPIFDSKVLPIPAG  810

Query  2712  KASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSK  2891
             K+SF AGAQLKNAIG+WSRWL+ LFGI               + D S  +E KA    +K
Sbjct  811   KSSFGAGAQLKNAIGDWSRWLSTLFGI--------------EENDASGDNEDKAP-GPAK  855

Query  2892  PFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLE  3071
             PF LLNA+SDLMMLP +ML     RKEVCP  G +LI+RVL+ F+PDEFCP P+P  VL 
Sbjct  856   PFRLLNALSDLMMLPFEMLADPQTRKEVCPILGPTLISRVLSGFVPDEFCPTPVPPEVLR  915

Query  3072  ALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             AL+SED  +  EES+   P +A+P  Y PPS  +         + +    RS SSVLKKS
Sbjct  916   ALDSEDAEDTPEESISTVPFTASPTTYLPPSVRS--IKTFLGETGNQSFQRSSSSVLKKS  973

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPgg-----gsgngngngVRYQLLREVWMSSE  3407
             YTSDDELDELDSPL+ I  +    +           G G+   VRYQLLR+VW + E
Sbjct  974   YTSDDELDELDSPLSSIVADRFRGSPNLAKINLIAKGRGDRKVVRYQLLRQVWRAEE  1030


 Score =   142 bits (358),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 124/195 (64%), Gaps = 14/195 (7%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ EY+I + EIKPWPPSQSLK++++V++QWE+  +NSGS      
Sbjct  1    MVLGLRLKHKKGASVQVEYVIQVDEIKPWPPSQSLKSVQSVLLQWENDGQNSGSVV----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+G IEF +SF + +TL RE  +     D FQKN ++F LYE R+D T +GQ
Sbjct  57   -----STVGDGTIEFKDSFTLSLTLCREKKAH----DKFQKNFLDFYLYELRKDKTTRGQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGT+VI+ A++G+++E +++  P++CK+S +++ QP L + I    +G   S  +  V 
Sbjct  108  LLGTSVINLADFGLIEEVVSIYTPVSCKKSSKSSEQPALFVSIHPTERGSSSS-SQIGVS  166

Query  705  RESSMDSSAGESVSA  749
            RE     S  +SV+ 
Sbjct  167  REGDGQESVADSVNG  181



>ref|XP_003625192.1| hypothetical protein MTR_7g092460 [Medicago truncatula]
 gb|ABN08141.1| hypothetical protein MtrDRAFT_AC155881g14v1 [Medicago truncatula]
 gb|AES81410.1| nucleolar gar2-like protein [Medicago truncatula]
Length=710

 Score =   500 bits (1288),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 279/543 (51%), Positives = 364/543 (67%), Gaps = 26/543 (5%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             ++ K +E+E +I+ LE ELRE AA+E+ L+S+V EHGSS +KVH PARRLSRLY HACK 
Sbjct  178   MKSKIKEMESRIENLEEELREVAALEVSLYSIVPEHGSSAHKVHTPARRLSRLYIHACKH  237

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSS  2162
              +  R+ + A++ VSGLILVAK+CGNDV RLTFWLSN ++LR  I + F    Q+ P+  
Sbjct  238   WTPKRKATIAKNAVSGLILVAKSCGNDVSRLTFWLSNTIVLREIISQAFGNSGQVSPIMR  297

Query  2163  EYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSR  2339
                 N  VK N+ K++ LKW+  P+ KS GN    T EDW+    FT ALE+VE+WIFSR
Sbjct  298   LAGSNGSVKRNDGKSASLKWKGIPNGKS-GNGFMQTGEDWQETGTFTLALERVESWIFSR  356

Query  2340  IIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYE  2513
             ++ES+WWQ  TP+MQS      DS  NK   R            NFS+ LW+ AF+DA++
Sbjct  357   LVESVWWQALTPYMQSSVG---DSCSNKSAGRLLGPALGDHNQGNFSINLWRNAFQDAFQ  413

Query  2514  RICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEV  2693
             R+CP+RAGGHECGCL ++++++M+QC+ RLDVAMFNAILRESA +IPTDP+SDPI + +V
Sbjct  414   RLCPLRAGGHECGCLPVMARMVMEQCIDRLDVAMFNAILRESALEIPTDPISDPIVDSKV  473

Query  2694  LPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKA  2873
             LPIPAG  SF +GAQLKN++GNWSR L D+FGID +D  ++         +NS   ER+ 
Sbjct  474   LPIPAGNLSFGSGAQLKNSVGNWSRLLTDMFGIDAEDCSEEY-------PENSENDERRG  526

Query  2874  QDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
                  K F LLN +SDL+MLPKDML+ R V +EVCP+  LSLI RVL  F PDEFCPD +
Sbjct  527   GPGEQKSFALLNDLSDLLMLPKDMLMDRQVSQEVCPSISLSLIIRVLCNFTPDEFCPDAV  586

Query  3054  PNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
             P  VLEALN E  +E  +  ES+ +FP SAAP+VY PPS +         +     LTR+
Sbjct  587   PGAVLEALNGETIVERRMSAESIRSFPYSAAPVVYMPPS-SVNVAEKVAEAGGKCHLTRN  645

Query  3228  rssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPg-----ggsgngngngVRYQLLR  3386
              S+V ++ YTSD+EL+ELDSPL+ I  K+ +S              G+      RYQLLR
Sbjct  646   VSAVQRRGYTSDEELEELDSPLSSIIDKVPSSPTVATNGNGNHEEQGSQTTTNARYQLLR  705

Query  3387  EVW  3395
             EVW
Sbjct  706   EVW  708



>ref|XP_007045031.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY00863.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1033

 Score =   511 bits (1315),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 321/582 (55%), Positives = 392/582 (67%), Gaps = 34/582 (6%)
 Frame = +3

Query  1677  SNRANGSVRSNQFVLRDKRNSI-EGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQML  1853
             S ++ G +  + F+   K N I E I ++   DT   S+ET+N +   K  E E KI+ML
Sbjct  474   SAKSYGLLNKSLFMEMAKENDISEKIHNSTTIDTHNESEETANSLSNGKV-ERESKIEML  532

Query  1854  EGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVS  2033
             E ELREAA VE  L+S+VAEHGSSTNKVHAPARRLSR Y HACK ++  +R SAAR+ VS
Sbjct  533   EEELREAAVVEASLYSIVAEHGSSTNKVHAPARRLSRFYLHACKASTQDKRASAARAAVS  592

Query  2034  GLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL--PLSSEYSKNAVVKNERKAS  2207
             GLILV+KACGNDVPRLTFWLSN ++LRA +    E+ QL   L    S+   V  E  +S
Sbjct  593   GLILVSKACGNDVPRLTFWLSNSIVLRAILSHAIEEMQLFSGLCLNCSRGGKVL-EDTSS  651

Query  2208  PLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQS  2387
               K +    + S         +DW +P  F  ALEK EAWIFSRIIES+WWQT TPHMQS
Sbjct  652   LDKEERSAMESS---------DDWVDPRTFLLALEKFEAWIFSRIIESVWWQTLTPHMQS  702

Query  2388  GAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLL  2567
              AA S +S   K   R      +E  NFS+ELWKKAF+DA ER+CP+RA GHECGCL +L
Sbjct  703   AAAKSSNSR--KTPTRRYGLGDQEQGNFSVELWKKAFKDACERLCPIRACGHECGCLAVL  760

Query  2568  SKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKN  2747
             +KL+M+Q V RLDVAMFNAILRES +++PTDPVSDPIS+P+VLPIPAGK+SF AG  LKN
Sbjct  761   AKLVMEQLVGRLDVAMFNAILRESDEEMPTDPVSDPISDPKVLPIPAGKSSFGAGVHLKN  820

Query  2748  AIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ-DACSKPFYLLNAMSDL  2924
             A+GNWSRWL DLFGIDD+D           +  N  G+++ A  +A  K F LLN++SDL
Sbjct  821   AVGNWSRWLTDLFGIDDNDGP---------EDSNEVGNDKNAGCEASFKAFCLLNSLSDL  871

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             MMLP +ML  R++RKEVCP F   LI+ VLN F+PDEF P+P+P  V EAL+ E+  E  
Sbjct  872   MMLPSEMLADRSMRKEVCPKFSTPLISMVLNNFVPDEFNPNPVPEAVFEALD-ENLSEAG  930

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             EES+ NFPC A P VY+PPS A+           S  L RSRSSVL+KSYTSDDELDELD
Sbjct  931   EESITNFPCMATPTVYSPPSPAS--LTGIIGEVGSEALQRSRSSVLRKSYTSDDELDELD  988

Query  3285  sPLNLIKMEN---SEVTKPg--ggsgngngngVRYQLLREVW  3395
             S +  I +EN   S  +K       G G  N VRYQLLRE+W
Sbjct  989   SLITSIVIENPRDSPTSKAPNWMRMGKGGRNVVRYQLLREIW  1030


 Score =   191 bits (484),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 137/198 (69%), Gaps = 11/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   S Q +Y++++ EI PW PSQSL+++++V++QWE+GD++ GS T    
Sbjct  1    MVLGLRSKNRKGSSFQIDYIVSVKEINPWMPSQSLRSVQSVLLQWENGDQSFGSLT----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S +G+G+IEF+ESFR+P+TL RE S KS N D+FQKNC+EF LYEPR+D   KGQ
Sbjct  57   -----SSIGSGKIEFSESFRLPVTLCREASRKSTNRDSFQKNCLEFYLYEPRKDKVAKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AV++ A+YG++KE + +S+PIN K+S RNT Q +L L IQ        S  + ++ 
Sbjct  112  LLGSAVVNLADYGIIKETITISIPINLKKSSRNTQQSVLYLNIQPFDS--SSSSTKGSLS  169

Query  705  RESSMDSSAGESVSALMN  758
            ++ S+D    ESVS  +N
Sbjct  170  KDLSLDKDGSESVSESIN  187



>ref|XP_011033284.1| PREDICTED: uncharacterized protein LOC105131817 isoform X1 [Populus 
euphratica]
Length=802

 Score =   503 bits (1296),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 322/757 (43%), Positives = 443/757 (59%), Gaps = 60/757 (8%)
 Frame = +3

Query  1248  ICDGSLVNIDDNRNSNNSVGHIIKADIDESFSTLSNGIQEDARTGVSDNGLAEGENTEGH  1427
             +CD  +++  DN N +       KAD       ++     D  +G  D    EG+  E  
Sbjct  63    VCDSFVIHYVDNVNRSEEAPQDSKAD--SMIDIVNKDEASDDHSGDLDRESKEGKEDESD  120

Query  1428  QGNTQELVTERDKHQETGEGKEL---------IIEKGQCSEGEPVNSCLQ----------  1550
                TQ+ V+ +     T EG+++         +  K     G P  S ++          
Sbjct  121   SETTQDSVSSQ-GDSVTAEGEKVENVSIVPKTVSNKNLSESGPPRGSRVKSDRKTSISRS  179

Query  1551  ---DNTTKQHLEGNSAII-AGRESVGAKTTCDERLNHVSSVHTL-GESNRANGSVRSNQF  1715
                +NT K+  + N   +    +S   K + D R+ H  S+ +  G  ++    V+   F
Sbjct  180   KAVNNTPKKPAKTNKGPLKVTSKSSFDKNSKDMRVPHKPSLESSEGVDDKPAEDVKEIDF  239

Query  1716  VLRDKRNSIEGITSNDWKDTKVRSKETSNVV-LERKCQELEQKIQMLEGELREAAAVEIG  1892
              L +  N  + +  ++  D    + E  +   L ++ +++E +I  LE ELRE AA+EI 
Sbjct  240   -LDEASNGTQSVAIDNETDAAEENGEHEDEAELNQRIEDMEMRIGKLEAELREVAALEIS  298

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARRLSRLY HACK  ++++R + AR+ VSGL+L++K+CGNDV
Sbjct  299   LYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWTLVKRATVARNTVSGLVLISKSCGNDV  358

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSV  2246
             PRLTFWLSN ++LR  I +   S +   PL+ + S     K+E K + LKW+     K V
Sbjct  359   PRLTFWLSNTIVLREIISQAFGSSRHSSPLARQ-SNGGSKKSEGKPTALKWKGGSGSKQV  417

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKI  2426
              N      +DW+    FT ALE+VE+WIFSR++ES WWQ  TPHMQS A    D   NK 
Sbjct  418   -NGFMQFADDWQETGTFTAALERVESWIFSRVVESEWWQALTPHMQSPAG---DLSSNKT  473

Query  2427  YQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVAR  2600
               R        ++  +FS+ LWK AF+DA +R+CPVRAGGHECGCL ++++++M+QCVAR
Sbjct  474   TGRLHGPALGDQQQGSFSINLWKNAFQDALQRLCPVRAGGHECGCLPVIARMVMEQCVAR  533

Query  2601  LDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLAD  2780
             LDVAMFNAILRESA +IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSR L D
Sbjct  534   LDVAMFNAILRESAHEIPTDPVSDPILDSKVLPIPAGDLSFGSGAQLKNSVGNWSRRLTD  593

Query  2781  LFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRT  2960
             +FGID DD           K D     +   QD  +KPF LLN +SDL+MLPKDML+ R+
Sbjct  594   MFGIDADDCL---------KEDQHVSEDDDKQDGETKPFLLLNGLSDLLMLPKDMLMDRS  644

Query  2961  VRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCS  3134
             +RKEVCP+ GL L+ R+L  F PDEFCPDP+P  VLEALNSE  +E  +  ++  NFP +
Sbjct  645   IRKEVCPSIGLPLVKRILCNFTPDEFCPDPVPGAVLEALNSESTVEWRLSGDAARNFPYT  704

Query  3135  AAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLN------  3296
             AAP+VY PPS +A        + + SQL+R+ S+V +K YTSD+EL+ELDSPL       
Sbjct  705   AAPVVYTPPS-SADVAEKVAEAGTKSQLSRNVSAVQRKGYTSDEELEELDSPLTSIIERL  763

Query  3297  ----LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
                  I M N         +   +    RY+LLREVW
Sbjct  764   PSSPAINMANGNGKHKEYAAAGDSMANARYELLREVW  800



>ref|XP_006850138.1| hypothetical protein AMTR_s00022p00233300 [Amborella trichopoda]
 gb|ERN11719.1| hypothetical protein AMTR_s00022p00233300 [Amborella trichopoda]
Length=791

 Score =   503 bits (1295),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 282/545 (52%), Positives = 369/545 (68%), Gaps = 25/545 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
             + +  K +++E++++ LEGELRE AA+EI L+SVVAEHGSS +KVHAPARRLSRLY HAC
Sbjct  254   IAVADKIEDMEKRVEKLEGELRETAALEIALYSVVAEHGSSAHKVHAPARRLSRLYIHAC  313

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K     RR S ARS V GL+LV+KACGNDVPRLTFWLSN V+LR  I + F+      L+
Sbjct  314   KYWGQDRRASVARSAVLGLVLVSKACGNDVPRLTFWLSNTVVLREIISQAFNNSHNSNLA  373

Query  2160  SEYSKNAVVKNERKASPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
             +   ++      RK+S L W+ +  +K+          +DW+    FT ALEK+E+WIFS
Sbjct  374   TRIVESNG-GGRRKSSALTWKGNSGNKQGKTTGFMQFVDDWQETSTFTGALEKIESWIFS  432

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYER  2516
             RI ES+WWQ   PHMQS     L +E   +     +   ++  +FS++LWK AF +A +R
Sbjct  433   RITESVWWQALAPHMQS-PEEDLFTEKRHVRVLGPALGDQKQGSFSIDLWKGAFLEAQQR  491

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             +CPVRAGGHECGCL +L++++M+QCV+RLD+AMFNAILRES +++PTDPVSDPI +P+VL
Sbjct  492   LCPVRAGGHECGCLPVLARMVMEQCVSRLDIAMFNAILRESVNEMPTDPVSDPICDPKVL  551

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PIPAG  SF AGAQLKNA+GNWSR L DLFGI+ DD   D       K DN N  ER+  
Sbjct  552   PIPAGDLSFGAGAQLKNAVGNWSRCLNDLFGIEADDSPSDA------KTDNEN-DERQGN  604

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
             D  SK F+L++ +SDL+MLPKDML  + +RKEVCP FGL LI R+L  F PDEFCPD +P
Sbjct  605   DMASKSFHLISILSDLLMLPKDMLTDKMIRKEVCPAFGLPLIMRILCNFTPDEFCPDAVP  664

Query  3057  NVVLEALNSEDHME---------VEEESVVN-FPCSAAPIVYAPPSAAAldgilgdisss  3206
               VLEALNSE   E          E + ++N  PC+A+ IVY+PPSAA +   +GD    
Sbjct  665   GAVLEALNSEIISERVISERRPSAENKELINSIPCTASSIVYSPPSAANVAEKVGDSHFQ  724

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPg--ggsgngngngVRYQL  3380
              + L R+ S VL+K +TSD+EL+ELD P  L+ +    +  P       +G G+ VRY+L
Sbjct  725   RAGLNRTTSMVLRKGHTSDEELEELDFP--LVSVIEKALVSPTILNVGDHGGGSNVRYEL  782

Query  3381  LREVW  3395
             LREVW
Sbjct  783   LREVW  787



>ref|XP_011033285.1| PREDICTED: uncharacterized protein LOC105131817 isoform X2 [Populus 
euphratica]
Length=713

 Score =   499 bits (1286),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 365/545 (67%), Gaps = 31/545 (6%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             L ++ +++E +I  LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK 
Sbjct  182   LNQRIEDMEMRIGKLEAELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKH  241

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPLSS  2162
              ++++R + AR+ VSGL+L++K+CGNDVPRLTFWLSN ++LR  I +   S +   PL+ 
Sbjct  242   WTLVKRATVARNTVSGLVLISKSCGNDVPRLTFWLSNTIVLREIISQAFGSSRHSSPLAR  301

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
             + S     K+E K + LKW+     K V N      +DW+    FT ALE+VE+WIFSR+
Sbjct  302   Q-SNGGSKKSEGKPTALKWKGGSGSKQV-NGFMQFADDWQETGTFTAALERVESWIFSRV  359

Query  2343  IESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYER  2516
             +ES WWQ  TPHMQS A    D   NK   R        ++  +FS+ LWK AF+DA +R
Sbjct  360   VESEWWQALTPHMQSPAG---DLSSNKTTGRLHGPALGDQQQGSFSINLWKNAFQDALQR  416

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             +CPVRAGGHECGCL ++++++M+QCVARLDVAMFNAILRESA +IPTDPVSDPI + +VL
Sbjct  417   LCPVRAGGHECGCLPVIARMVMEQCVARLDVAMFNAILRESAHEIPTDPVSDPILDSKVL  476

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PIPAG  SF +GAQLKN++GNWSR L D+FGID DD           K D     +   Q
Sbjct  477   PIPAGDLSFGSGAQLKNSVGNWSRRLTDMFGIDADDCL---------KEDQHVSEDDDKQ  527

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
             D  +KPF LLN +SDL+MLPKDML+ R++RKEVCP+ GL L+ R+L  F PDEFCPDP+P
Sbjct  528   DGETKPFLLLNGLSDLLMLPKDMLMDRSIRKEVCPSIGLPLVKRILCNFTPDEFCPDPVP  587

Query  3057  NVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsr  3230
               VLEALNSE  +E  +  ++  NFP +AAP+VY PPS +A        + + SQL+R+ 
Sbjct  588   GAVLEALNSESTVEWRLSGDAARNFPYTAAPVVYTPPS-SADVAEKVAEAGTKSQLSRNV  646

Query  3231  ssVLKKSYTsddeldeldsPLN----------LIKMENSEVTKPgggsgngngngVRYQL  3380
             S+V +K YTSD+EL+ELDSPL            I M N         +   +    RY+L
Sbjct  647   SAVQRKGYTSDEELEELDSPLTSIIERLPSSPAINMANGNGKHKEYAAAGDSMANARYEL  706

Query  3381  LREVW  3395
             LREVW
Sbjct  707   LREVW  711



>ref|XP_004493542.1| PREDICTED: uncharacterized protein LOC101494561 isoform X1 [Cicer 
arietinum]
 ref|XP_004493543.1| PREDICTED: uncharacterized protein LOC101494561 isoform X2 [Cicer 
arietinum]
Length=703

 Score =   499 bits (1284),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 363/549 (66%), Gaps = 29/549 (5%)
 Frame = +3

Query  1785  SKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSR  1964
             S+    + LE K +E+E +I+ LE ELRE AA+E+ L+SVV EHGSS +KVH PARRLSR
Sbjct  170   SEHEDRMALELKIKEMESRIENLEEELREVAALEVSLYSVVPEHGSSAHKVHTPARRLSR  229

Query  1965  LYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQ  2144
             LY HACK  +  R+ + A++ VSGLILVAK+CGNDV RLTFWLSN ++LR  I      Q
Sbjct  230   LYIHACKHWTQKRKATIAKNTVSGLILVAKSCGNDVSRLTFWLSNTIVLREIIS-----Q  284

Query  2145  QLPLSSEYSK-NAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
              L  SS+ S    + ++  K++ LKW+   + KS GND   T EDW+    FT ALE+VE
Sbjct  285   ALGNSSQVSPIMRLAESNGKSAALKWKGISNGKS-GNDFMQTGEDWQETGTFTFALERVE  343

Query  2322  AWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKA  2495
             +WIFSR++ES+WWQ  TP+MQS      D   NK   R            NFS+ +W+ A
Sbjct  344   SWIFSRLVESVWWQALTPYMQSSVG---DCGSNKSIGRLLGPALGDHNQGNFSINVWRSA  400

Query  2496  FRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDP  2675
             F+DA++R+CPVRAGGHECGCL +++++IM+QC+ RLDVAMFNAILRESA +IPTDP+SDP
Sbjct  401   FQDAFQRVCPVRAGGHECGCLPVMARMIMEQCIDRLDVAMFNAILRESALEIPTDPISDP  460

Query  2676  ISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN  2855
             I + +VLPIPAG  SF +GAQLKN++GNWSR L D+FGID +D  ++         +N  
Sbjct  461   IVDSKVLPIPAGNLSFGSGAQLKNSVGNWSRLLTDMFGIDAEDYLEEYQ-------ENGE  513

Query  2856  GHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
               ER   D   K F LLN +SDL+MLPKDML+ R VR+EVCP+  LSLI RVL  F PDE
Sbjct  514   NEERHGGDGEPKSFVLLNDLSDLLMLPKDMLIDRQVRQEVCPSISLSLIIRVLCNFTPDE  573

Query  3036  FCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdissss  3209
             FCPD +P  VLEALN E  +E  +  ESV +FP +AA +VY PPS+A         +   
Sbjct  574   FCPDAVPGAVLEALNGETIVERKLSAESVRSFPYAAAQVVYTPPSSA-NVAEKVAEAGGK  632

Query  3210  sqltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEVTKP-----gggsgngngngV  3368
               LTR+ S+V +K YTSD+EL+ELDSP+  I  K+ +S +             +      
Sbjct  633   CHLTRNVSAVQRKGYTSDEELEELDSPITSIIDKLPSSPIVTTNGEGNRKEQRSHTTTNA  692

Query  3369  RYQLLREVW  3395
             RYQLLREVW
Sbjct  693   RYQLLREVW  701



>emb|CDX91925.1| BnaC03g32270D [Brassica napus]
Length=865

 Score =   504 bits (1298),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 296/564 (52%), Positives = 379/564 (67%), Gaps = 46/564 (8%)
 Frame = +3

Query  1731  RNSIEGITSN-DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVV  1907
             R+S+E   SN + K+ KV  + T+   LE K ++LE +++ LEGEL EAA +E  L+SVV
Sbjct  335   RSSLEISRSNSERKEAKVFPRNTT--TLESKVKDLESRVKKLEGELCEAAGIEAALYSVV  392

Query  1908  AEHGSSTNKVHAPARRLSRLYFHACKENSVL--RRLSAARSVVSGLILVAKACGNDVPRL  2081
             AEH SS+ KVHAPARRL RLY HAC+ ++ L  RR +AA+S VSGL+ VAKACGNDVPRL
Sbjct  393   AEHASSSAKVHAPARRLLRLYLHACRGDNHLISRRANAAKSAVSGLVTVAKACGNDVPRL  452

Query  2082  TFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERK-ASPLKWQ--SFPHKKSVGN  2252
             T+WLSN ++LRA I   +  ++LP+S+  S     K +R+ +S L W+  S   K + G 
Sbjct  453   TYWLSNTIILRAIISD-NHSEELPVSAGQSGP---KTQRQGSSSLTWKDSSLRKKDTTGG  508

Query  2253  DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQ  2432
                     W++P  F  ALEKVEAWIFSR++ESIWWQT TP MQS AA    +   K + 
Sbjct  509   --------WDDPGAFITALEKVEAWIFSRVVESIWWQTLTPRMQSSAANGSAASKKKNFG  560

Query  2433  RTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVA  2612
             R+ SS ++E  +FSLELWKKAFRDA+ER+CP+RA GHECGCL L ++LIM+QCVARLDVA
Sbjct  561   RSPSSVNQEQGDFSLELWKKAFRDAHERLCPLRASGHECGCLPLPARLIMEQCVARLDVA  620

Query  2613  MFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGI  2792
             MFNAILR+S ++ PTDP+SDPI++  VLPIP    SF +GA LKN+IGNWSRWL D FGI
Sbjct  621   MFNAILRDSDENFPTDPLSDPIADSRVLPIPCSITSFGSGALLKNSIGNWSRWLTDSFGI  680

Query  2793  ddddedddlveddeNKADNSNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVRK  2969
                                 +  E  +    S K F LL A+SDLMMLPKDMLL+  VRK
Sbjct  681   -------------------DDDEENSSYVGTSFKTFILLKALSDLMMLPKDMLLNTCVRK  721

Query  2970  EVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIV  3149
             EVCP FG  LI RVLN F+PDEFCPDP+P  VLEAL SE+  E E+  + ++P +A P +
Sbjct  722   EVCPMFGAPLIKRVLNHFVPDEFCPDPVPVAVLEALVSEEEGE-EKAMITSYPYTAPPPM  780

Query  3150  YAPPSAAAldgilgdisssssqlt--rsrssVLKKSYTsddeldeldsPLNLIKMENSEV  3323
             Y+PPS  ++  I+GD     +     R RSSV +KSYTSDDELDEL SPL ++ ++ ++ 
Sbjct  781   YSPPSGTSISTIIGDFGQPQAPTKLCRIRSSVTRKSYTSDDELDELSSPLAVVLLQQADS  840

Query  3324  TKPgggsgngngngVRYQLLREVW  3395
              K    +       VRYQLLRE W
Sbjct  841   NK---VNNGCADETVRYQLLRECW  861


 Score =   187 bits (474),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 135/204 (66%), Gaps = 23/204 (11%)
 Frame = +3

Query  165  MVLGPSGKTR---GVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQ  335
            MVLG S K R      S+Q +YLI+I +IKPWPPSQSL++L++VVIQWE+G++NSG+T  
Sbjct  1    MVLGLSSKNRRGSSSSSIQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGERNSGTTDA  60

Query  336  VAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGD---TFQKNCIEFNLYEPRRD  506
            VAP L      G G+IEFN SF++P+TLL++ S+ + N      F KN +E NLYE RR+
Sbjct  61   VAPSL------GEGKIEFNHSFKLPLTLLKDASASARNKGCDVVFFKNVLELNLYEARRE  114

Query  507  TTVKGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSL  686
             T   QLL TA ID A YG+VK+ L+++ P+N KRSYRNT QP+L L IQ +      S 
Sbjct  115  KT--HQLLATATIDLAEYGIVKDTLSLTAPMNSKRSYRNTTQPVLHLSIQPIRATSSSS-  171

Query  687  VRNNVRRESSMDSSAGESVSALMN  758
                  R  S D   GESVSALMN
Sbjct  172  ------RNGSKD--GGESVSALMN  187



>ref|XP_009615808.1| PREDICTED: uncharacterized protein LOC104108475 [Nicotiana tomentosiformis]
 ref|XP_009615809.1| PREDICTED: uncharacterized protein LOC104108475 [Nicotiana tomentosiformis]
 ref|XP_009615810.1| PREDICTED: uncharacterized protein LOC104108475 [Nicotiana tomentosiformis]
Length=1053

 Score =   509 bits (1311),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 305/597 (51%), Positives = 384/597 (64%), Gaps = 34/597 (6%)
 Frame = +3

Query  1677  SNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETS----------NVVLERKCQ  1826
             +N  +  V+S+Q      R+ + G + N  K TK+   E +          N   +R+  
Sbjct  470   TNGKSKHVKSHQLTDLPNRSGLPGSSQNPEKATKLHVSEDARSYGKGNKPMNGSPDRR-N  528

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             E + +I+ LE ELREAAAVE+ L+SVVAEHGSS +KVHAPARRLSR Y HAC   S  ++
Sbjct  529   EWKARIETLEEELREAAAVEVSLYSVVAEHGSSAHKVHAPARRLSRFYAHACTAKSRAKQ  588

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
               AAR+ VSGL+LV+KACGNDVPRLTFWLSN V+LRA + + +  ++    S    N   
Sbjct  589   AGAARAAVSGLVLVSKACGNDVPRLTFWLSNSVMLRAIVSQAAGGRKEGDRSYAESNRGK  648

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
              +    S  K   F   K + N L     DWE+   F  ALE+VEAWIFSRI+ES+WWQT
Sbjct  649   SSLNGRSLKKRNEFSSNKDLNNSLTDELGDWEDTETFMLALEQVEAWIFSRIVESVWWQT  708

Query  2367  FTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRA  2534
              TPHMQ+ AA S    + + + K Y R  S   +E  NFS+ELWKKAF+DA ER+CPVRA
Sbjct  709   LTPHMQNTAANSGGRSMSTSVKKTYGRRCSLGDQEQGNFSIELWKKAFKDACERLCPVRA  768

Query  2535  GGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGK  2714
             GGHECGCL LL++L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPI + +VLP+PAGK
Sbjct  769   GGHECGCLPLLARLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPICDSKVLPVPAGK  828

Query  2715  ASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKP  2894
             +SF +GAQLKNAIG+WSRWL++LFGI+D+D   D  +    KA              +KP
Sbjct  829   SSFGSGAQLKNAIGDWSRWLSNLFGIEDNDFSGDSEDLVHEKA-----------PGPAKP  877

Query  2895  FYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEA  3074
             F LLNA+SDLMMLP +ML     RKEVCP  G +LI RVLN F+PDEFCP P+P  VL A
Sbjct  878   FRLLNALSDLMMLPFEMLADPQTRKEVCPILGPTLIRRVLNGFVPDEFCPIPVPPDVLRA  937

Query  3075  LNS-EDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             L+S ED ++  EE V   PC+A+P  Y PPS  +   I     + +  L RS SSVLKKS
Sbjct  938   LDSQEDAVDAPEEPVSTVPCTASPTSYLPPSVRS--IITFLGETGNQSLQRSGSSVLKKS  995

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPgggsgngngng-----VRYQLLREVWMSSE  3407
             YTSDDELDELDSPL  I  +    +         +        VRYQLLR+VW   E
Sbjct  996   YTSDDELDELDSPLTSIVADRFRGSPNLAKLNLVSKGKGDRNIVRYQLLRQVWRDEE  1052


 Score =   152 bits (385),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 111/164 (68%), Gaps = 13/164 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   + +   SVQ EY+I + EIKPWPPSQSLK++++V++ WE+  +NSGS      
Sbjct  1    MVLGLRSRHKKGASVQVEYVIQVDEIKPWPPSQSLKSVQSVLLLWENDGQNSGSIV----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+  IEF E F +P+TL RE   K  N D FQKN ++F LYE R+D T KGQ
Sbjct  57   -----SSVGDTNIEFREFFTLPLTLCRE---KKAN-DKFQKNFLDFYLYELRKDKTTKGQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            LLGT+VI+ A++G+++E +++  P+NCK+S +N+ QP L + I 
Sbjct  108  LLGTSVINLADFGLLEEIVSIYTPLNCKKSSKNSEQPALFVNIH  151



>gb|KHG22020.1| Phospholipid--sterol O-acyltransferase -like protein [Gossypium 
arboreum]
Length=1150

 Score =   511 bits (1316),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 309/586 (53%), Positives = 392/586 (67%), Gaps = 36/586 (6%)
 Frame = +3

Query  1677  SNRANGSVRSNQFVLRDKRNSI-EGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQML  1853
             S  + G +++ +F+ + K + I E I +   KDT   S+E SN     K  ELE KI+ML
Sbjct  591   SGNSYGPLKNTKFMEKAKESDIPEEIHNGSTKDTCNESEEDSNSFSNSKV-ELESKIEML  649

Query  1854  EGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVS  2033
             E ELREAA VE  L+SV+AEHG S NKVHAPARRLSR Y HAC+ ++  +R +AAR+ VS
Sbjct  650   EQELREAAVVEASLYSVIAEHGGSINKVHAPARRLSRFYIHACRTSNPDKRANAARAAVS  709

Query  2034  GLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL---PLSSEYSKNAVVKNERKA  2204
             GL+LV+KACGNDVPRLTFWLSN ++LRA +       QL   P  +  S+  V+++    
Sbjct  710   GLVLVSKACGNDVPRLTFWLSNSIVLRAIVSNAIGGIQLYSGPCLNSSSEGMVLEDNS--  767

Query  2205  SPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQ  2384
                      H +   N    +FE+W +P  F  ALEK E WIFSRIIES+WWQT TPHMQ
Sbjct  768   ---------HLQEECNSTE-SFEEWVDPRTFLLALEKFETWIFSRIIESVWWQTLTPHMQ  817

Query  2385  SGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHL  2564
             S AA S  S      +       EE  NFS++LW+KAF+DA ER+CP+RA GHECGCL +
Sbjct  818   SAAAKSSSSRKTSTKRYELGD--EEQGNFSVKLWEKAFKDACERLCPIRACGHECGCLSM  875

Query  2565  LSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLK  2744
             L+KL+M+Q V RLDVAMFNAILRES D++PTDPVSDPI + +VLPIPAGK+SF AG QLK
Sbjct  876   LAKLVMEQLVGRLDVAMFNAILRESVDEMPTDPVSDPIRDSKVLPIPAGKSSFGAGVQLK  935

Query  2745  NAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDL  2924
             NAIGNWSRWL DLFGI     DD+   +D N+ D+    ++   +A  K F LLNA+SDL
Sbjct  936   NAIGNWSRWLTDLFGI-----DDNDGLEDSNEVDDD---KKAGFEASFKAFGLLNALSDL  987

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             MMLP DML++R++RKEVCP F   LI +VLN F+PDEF P+ +   V E+L+ ED  EV 
Sbjct  988   MMLPSDMLVNRSLRKEVCPKFSPRLIIKVLNNFVPDEFNPNLVSEAVFESLD-EDISEVG  1046

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
             ++S+ NFPC AAP VY+PPSAA+   ++G +    SQ  R   SVL+KSYTSDDELDELD
Sbjct  1047  DKSITNFPCMAAPTVYSPPSAAS---LIGIVGEVGSQALRRSRSVLRKSYTSDDELDELD  1103

Query  3285  sPLNLIKMEN-SEVTKPgg----gsgngngngVRYQLLREVWMSSE  3407
             SP+  I +EN S+ T          G G    +RYQL+RE+W   E
Sbjct  1104  SPITSIIIENRSDSTHSKSLNWMRMGKGERKVIRYQLIREIWKEGE  1149


 Score =   162 bits (409),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 119/198 (60%), Gaps = 14/198 (7%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R     Q  Y +N+ EI PW P QS ++ ++V++QWE GDK+SGS      
Sbjct  1    MVLGLRTKNRKGCLHQLVYTVNVKEINPWTPLQSPRSAQSVLLQWETGDKSSGSIA----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S + NG+I FNESF++P+TL +E S KS N  +F KNC+EF LY  R++   K Q
Sbjct  57   -----STIDNGKIAFNESFKLPLTLRKEASRKSTNHLSFHKNCLEFYLYVSRKENVSKAQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+A+++ A+YG++KE +++S P N K+S RN   P+L L IQ   K    +L      
Sbjct  112  LLGSAIVNLADYGIIKEAISISAPFNLKKSSRNIEHPVLYLNIQPFDKDSSSAL-----S  166

Query  705  RESSMDSSAGESVSALMN  758
            +E S+D    E VS  +N
Sbjct  167  KEVSLDKDGSECVSEFIN  184



>ref|XP_008795713.1| PREDICTED: uncharacterized protein LOC103711377 [Phoenix dactylifera]
 ref|XP_008795714.1| PREDICTED: uncharacterized protein LOC103711377 [Phoenix dactylifera]
 ref|XP_008795715.1| PREDICTED: uncharacterized protein LOC103711377 [Phoenix dactylifera]
 ref|XP_008795716.1| PREDICTED: uncharacterized protein LOC103711377 [Phoenix dactylifera]
 ref|XP_008795717.1| PREDICTED: uncharacterized protein LOC103711377 [Phoenix dactylifera]
Length=701

 Score =   497 bits (1280),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 272/544 (50%), Positives = 354/544 (65%), Gaps = 44/544 (8%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K  E+EQ+++ LE ELRE AA+EI L+S+V EHGSS +KVH PARRLSRLY HACK  S
Sbjct  181   QKINEMEQRMKKLEEELREVAALEISLYSMVPEHGSSAHKVHTPARRLSRLYIHACKHWS  240

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL--PLSSEY  2168
               +R + A++ VSGL L+AK+CGNDVPRLTFWLSN V+LR  I +      L  P    +
Sbjct  241   RDKRATVAKNTVSGLALIAKSCGNDVPRLTFWLSNTVVLREIISQTFGNMSLLNPTMRAF  300

Query  2169  SKNA-VVKNERKASPLKWQSFPHKKSVGNDLPGTF------EDWENPLGFTKALEKVEAW  2327
               N    K E K +PLKW     + + GN     F      +DW+    FT ALEK+E+W
Sbjct  301   ESNGGAKKTEGKLTPLKW-----RNNAGNRQAKVFGFMQQIDDWQETSTFTAALEKIESW  355

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFR  2501
             IF+RIIES+WWQ  TPHMQS    + +    K Y R        ++  +FS+ LWK AF 
Sbjct  356   IFARIIESVWWQILTPHMQS---PTEEMYTTKGYGRLLGPALGDQQQGSFSINLWKSAFH  412

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++++M+QC +RLDVAMFNAILRESA++IPTDPVSDPI 
Sbjct  413   DAFTRLCPVRAGGHECGCLPVLARMVMEQCASRLDVAMFNAILRESANEIPTDPVSDPIV  472

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIPAG+ SF +GAQLKN IG+WSRWL DLFGI                AD  +  
Sbjct  473   DPKVLPIPAGELSFGSGAQLKNFIGSWSRWLTDLFGIY---------------ADEDD--  515

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             +R+      K   LLN +S+L+MLPKDMLL R++RKE CP+ GL LITR+L  F PDEFC
Sbjct  516   DRREGSPELKSIRLLNELSNLLMLPKDMLLERSIRKEFCPSIGLPLITRILCNFTPDEFC  575

Query  3042  PDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssss  3212
             PDP+P ++LE LNSE  +E    +++ + +FPC AAP+VY+PPS  A        +   +
Sbjct  576   PDPVPGILLEELNSESLLERQPTDKDLISSFPCKAAPVVYSPPS-PADVVEKVGEAGGKA  634

Query  3213  qltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP---gggsgngngngVRYQLL  3383
             +L +  S V +K YTSD++LD+LDSPL  I ++ +    P               RY+LL
Sbjct  635   ELDQRASMVQRKGYTSDEDLDDLDSPLTSI-IDKTPPVSPILRDVNQKESKHANARYRLL  693

Query  3384  REVW  3395
             REVW
Sbjct  694   REVW  697



>ref|XP_010257255.1| PREDICTED: uncharacterized protein LOC104597431 [Nelumbo nucifera]
 ref|XP_010257256.1| PREDICTED: uncharacterized protein LOC104597431 [Nelumbo nucifera]
Length=815

 Score =   501 bits (1289),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 289/583 (50%), Positives = 375/583 (64%), Gaps = 36/583 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSND-WKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             VL +  NS   + S+D   D +    E    +  ++ +E+EQ+I+ LE ELRE AA+EI 
Sbjct  244   VLDEALNSAHSLGSDDEMVDAEENGFEEDREIFNQRMEEMEQRIEKLEQELREIAALEIS  303

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARRLSRLY HACK  +  +R + AR+  SGL+L+AK+CGNDV
Sbjct  304   LYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWTQDKRATVARNTASGLVLIAKSCGNDV  363

Query  2073  PRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA-VVKNERKASPLKWQSFPHKKS  2243
             PRLTFWLSN ++LR  I + F     L P++     N  V K+E K+  LKW+     K 
Sbjct  364   PRLTFWLSNTIVLREIIAQAFGNSHHLSPVAKVVESNGGVKKSEGKSLSLKWKGSSGSKQ  423

Query  2244  VGN-DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             V         +DW+    FT ALEK+E+WIFSRI+ES+WWQT TPHMQS      D   N
Sbjct  424   VKKLGFMQVVDDWQETTTFTTALEKIESWIFSRIVESVWWQTLTPHMQSPLD---DLYTN  480

Query  2421  KIYQRTSSSCSEEPE--NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             K + +       + +  +FS+ LWK AF+DA++R+CPVRAGGHECGCL +L++++M+QCV
Sbjct  481   KSFGKLLGPALGDLQQGSFSINLWKSAFQDAFQRLCPVRAGGHECGCLPVLARMVMEQCV  540

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             ARLDVAMFNAILRESA +IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSRWL
Sbjct  541   ARLDVAMFNAILRESAHEIPTDPVSDPIVDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWL  600

Query  2775  ADLFGIddddedddlveddeNKADNSNGHE--RKAQDACSKPFYLLNAMSDLMMLPKDML  2948
              DLFG+D DD           K D ++  +  R+  +A  K F LLN +SDL+MLPKDML
Sbjct  601   TDLFGMDTDDSP---------KDDQTSTEDDFRRGGNAEPKSFRLLNELSDLLMLPKDML  651

Query  2949  LSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE---EESVV  3119
             + R++R+EVCP+  L L+ R+L  F PDEFCPDP+P  VLEALN+E  +E      +S  
Sbjct  652   MERSIREEVCPSISLPLLKRILCNFTPDEFCPDPVPGAVLEALNAESIVERRLSNGDSNS  711

Query  3120  NFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNL  3299
             +FP  AAP+VY PPS  +        +   SQL R+ S V +K YTSD+ELDELDSPL  
Sbjct  712   SFPFPAAPVVYTPPS-HSDVAEKVADAGWKSQLERNVSIVQRKGYTSDEELDELDSPLTS  770

Query  3300  I--KMENSEV---------TKPgggsgngngngVRYQLLREVW  3395
             I  KM  +                 +    G   RY+LLREVW
Sbjct  771   IIDKMPRTPTFANGKVGNGNGKHKETTGYGGGNARYELLREVW  813



>ref|XP_007144029.1| hypothetical protein PHAVU_007G123200g [Phaseolus vulgaris]
 ref|XP_007144030.1| hypothetical protein PHAVU_007G123200g [Phaseolus vulgaris]
 gb|ESW16023.1| hypothetical protein PHAVU_007G123200g [Phaseolus vulgaris]
 gb|ESW16024.1| hypothetical protein PHAVU_007G123200g [Phaseolus vulgaris]
Length=1572

 Score =   520 bits (1338),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 288/545 (53%), Positives = 370/545 (68%), Gaps = 46/545 (8%)
 Frame = +3

Query  1794  TSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYF  1973
             TS   L  K  EL+ +++ML  ELREAAA+E+ ++SV+AEHGSS+NKVHAPARRLSR YF
Sbjct  1067  TSGSFLSNKT-ELKAEVEMLREELREAAALEVSMYSVIAEHGSSSNKVHAPARRLSRFYF  1125

Query  1974  HACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLP  2153
             HAC+  S     SAA+S VSG +LV+KACGNDVPRLTFW SN +LLRA + K  E + +P
Sbjct  1126  HACRVGSPATIASAAQSAVSGFVLVSKACGNDVPRLTFWFSNLLLLRAIVSK--EVENIP  1183

Query  2154  LSSEYSKNAVVKNERKASPLKWQSFPHKKSVGN-------DLPGTFEDWENPLGFTKALE  2312
                 +   + + +E  A             VGN       D    F  WE+P  F  ALE
Sbjct  1184  ----FGDGSCINSECDA-------------VGNTLHEEEKDKEKQFHSWEDPKTFLIALE  1226

Query  2313  KVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKK  2492
             KVEAWIFSRI+ES+WWQT TP+MQS AA S +S+  K+ +R       +  +FS++LWK+
Sbjct  1227  KVEAWIFSRIVESVWWQTLTPYMQSAAAKSSNSK--KVDERRPRVGDPDQGSFSVDLWKR  1284

Query  2493  AFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSD  2672
             AF+DA ER+CPVR GGHECGCL ++++L+M+Q V+RLD+AMFNAILRESA+++P DPVSD
Sbjct  1285  AFKDACERLCPVRTGGHECGCLAVIARLVMEQLVSRLDLAMFNAILRESAEEMPMDPVSD  1344

Query  2673  PISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS  2852
             PIS+ +VLPIPAGK+ FAAGAQLKNAIG+WSRWL+DLF IDD +             + S
Sbjct  1345  PISDSKVLPIPAGKSGFAAGAQLKNAIGDWSRWLSDLFSIDDSES-----------CEVS  1393

Query  2853  NGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPD  3032
             N ++    ++  KPF LLN++SDLMMLP DML   ++RKEVCP FG+SLI RVLN F+PD
Sbjct  1394  NENDEPKCESSFKPFLLLNSLSDLMMLPLDMLADESMRKEVCPRFGISLIKRVLNNFVPD  1453

Query  3033  EFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssss  3212
             EF P PIP+ V +ALN+ED +E +E ++ + PCSA    YAP  A++   ++      + 
Sbjct  1454  EFSPGPIPDAVFDALNNED-IEDDEGAITSLPCSAGATFYAPLPASS--IVVMLQEVGTK  1510

Query  3213  qltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREV  3392
                RS S  LKK YTSDDELDELDSPL+ + M+ S   K       G    VRY+LLRE 
Sbjct  1511  TSLRSGSFALKKLYTSDDELDELDSPLSALGMDES---KEKSALVKGGRKVVRYELLRES  1567

Query  3393  WMSSE  3407
             W SSE
Sbjct  1568  WKSSE  1572


 Score =   160 bits (404),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 112/164 (68%), Gaps = 13/164 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   SVQ  Y I++ EI PWPPSQSL++++ V++QWE+GD+ SGS    A 
Sbjct  1    MVLGIRSKSRKTVSVQVHYTIHVQEINPWPPSQSLRSVQTVLLQWENGDQISGSLASTA-  59

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                    G G+I+FNESFR+ + + RE S KS + ++FQKN +EF+LY    D T K Q
Sbjct  60   --------GIGKIQFNESFRLSVLMWREASKKSKHRESFQKNYLEFSLY----DKTTKSQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            LLG+A ++FA++G++KE   +S+ +NCK+S +N+ QP L + IQ
Sbjct  108  LLGSATVNFADFGIIKETKALSIVLNCKKSSKNSSQPFLYISIQ  151



>ref|XP_004310056.1| PREDICTED: uncharacterized protein LOC101302325 [Fragaria vesca 
subsp. vesca]
Length=1027

 Score =   506 bits (1302),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 296/587 (50%), Positives = 378/587 (64%), Gaps = 28/587 (5%)
 Frame = +3

Query  1677  SNRANGSVRSNQFVLRDKRNSIEGITSNDWK-----DTKVRSKETSNVVLERKCQELEQK  1841
             S + NG +R ++     K+ S E  T  D         K + +ET+    + K  ELE  
Sbjct  459   SAKNNGLLRKHEL----KKKSKEAETPEDGHVGGIISAKSKREETTTSSSDSK-NELEST  513

Query  1842  IQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAAR  2021
             I+ML+ ELREAAAVE+ L+S+ AEHG + NK+HAPARRLSR Y HACK  S  ++ +AAR
Sbjct  514   IEMLKDELREAAAVEVALYSIAAEHGGNANKIHAPARRLSRFYIHACKMGSQAKKANAAR  573

Query  2022  SVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERK  2201
             + V+GLILV+KACGNDVPRLTFWLSN ++LRA + +   K Q+      +     ++   
Sbjct  574   AAVTGLILVSKACGNDVPRLTFWLSNSIVLRAVVSQGLVKAQVSNGKRTTIKGGGQHLAG  633

Query  2202  ASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHM  2381
                 +       K   N++  + ++WE+P  F  ALEK EAWIFSRI+ES+WWQ  TPHM
Sbjct  634   GRLSEKDRIRTHKDEKNNILKSTDNWEDPHIFMVALEKFEAWIFSRIVESVWWQNITPHM  693

Query  2382  QSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLH  2561
             Q  AA    S   K   R +    +E  NFS+ELW KAF+ A ER+CPVRAGGHECGCL 
Sbjct  694   QPAAAKG--SSTRKGNGRKNGLGDQEQGNFSIELWTKAFKGACERLCPVRAGGHECGCLP  751

Query  2562  LLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQL  2741
             LL++L+M+Q V RLDVAMFNAILRE+A+++PTDPVSDPIS+ +VLPIPAGK+SF AGAQL
Sbjct  752   LLARLVMEQLVNRLDVAMFNAILRENAEEMPTDPVSDPISDSKVLPIPAGKSSFGAGAQL  811

Query  2742  KNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSD  2921
             KN IG+WSRWL DLF +           D  +  D    H+ +  +   K F LLNA+SD
Sbjct  812   KNVIGSWSRWLTDLFDM--------DDTDVPDNEDELTDHKGQECETTFKAFRLLNALSD  863

Query  2922  LMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEV  3101
             LMMLP +ML  ++ R+EVCPTFG SLI RVL  F+ DEFCPDPIP  V EAL+ E+++E 
Sbjct  864   LMMLPSEMLADKSTREEVCPTFGASLIKRVLYNFVTDEFCPDPIPEAVFEALDDEENLEA  923

Query  3102  EEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldel  3281
             E ESV +FP  A P  Y+PP A A   ++G      S   +S SSVLKKSYTSDDELDEL
Sbjct  924   ETESVTSFPFIANPTFYSPPPATA--SLIGIAGEVGSPALKSGSSVLKKSYTSDDELDEL  981

Query  3282  dsPLNLIKMENSEVTKPgggsgngng-----ngVRYQLLREVWMSSE  3407
             DSP+  I +ENS V+     +            VRYQLLR+VW  S+
Sbjct  982   DSPMTSI-VENSLVSPKSLTANPMLKWKGGRKVVRYQLLRQVWKDSD  1027


 Score =   155 bits (392),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 116/168 (69%), Gaps = 9/168 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK+R   +V+ +Y+I+++EIKPWP SQ+LK++++V +QWE+GD+ SGS  +   
Sbjct  1    MVLGIRGKSRKSAAVEVDYVIHVLEIKPWPSSQALKSVQSVFLQWENGDQASGSFFR---  57

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG+ RIEF ESFR+P+ L +E S KS   D+FQKN +EF L EPR+D   KG 
Sbjct  58   ------NVGDERIEFGESFRLPVVLYKEKSRKSSASDSFQKNILEFYLSEPRKDKAAKGH  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK  668
             LG+AVI+ A+Y    E  +VSVP++ K+S +++ QP+L + +Q  GK
Sbjct  112  GLGSAVINLADYANAAETTSVSVPLSLKKSSKSSAQPVLYVSVQPCGK  159



>ref|XP_002282962.2| PREDICTED: uncharacterized protein LOC100253823 [Vitis vinifera]
 ref|XP_010653816.1| PREDICTED: uncharacterized protein LOC100253823 [Vitis vinifera]
 ref|XP_010653817.1| PREDICTED: uncharacterized protein LOC100253823 [Vitis vinifera]
Length=715

 Score =   495 bits (1274),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 285/580 (49%), Positives = 375/580 (65%), Gaps = 31/580 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L    N ++ + S+D   DT+   +    V L+++ +E+E +I+ LE ELRE AA+EI 
Sbjct  149   LLDGASNGVQSVGSDDETVDTEENGEHEDKVALDQRIEEMEMRIEKLEEELREVAALEIS  208

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARRLSRLY HA K  +  +R + A++ VSGL+L+AK+CGNDV
Sbjct  209   LYSVVPEHGSSAHKVHTPARRLSRLYIHASKHWAQHKRATIAKNTVSGLVLIAKSCGNDV  268

Query  2073  PRLTFWLSNCVLLRAAICK-FSEK-QQLPLSSEYSKNAVVKNERKAS-PLKWQSFPHKKS  2243
             PRLTFW+SN V+LR  I + F    Q  P+      N   K     S  LKW+     K 
Sbjct  269   PRLTFWMSNTVVLREIISQAFGNSCQSSPVVRFSESNGSGKKSDGTSLTLKWKGSSGGKQ  328

Query  2244  VGN-DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             V         +DW+    FT ALEKVE+WIFSRI+ES+WWQT TPHMQ       DS   
Sbjct  329   VNKLGFVQFVDDWQETRTFTSALEKVESWIFSRIVESVWWQTLTPHMQPPVK---DSYTK  385

Query  2421  KIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             K  +R        ++  +FS+ LWK AF+DA++R+CPVRAGGHECGCL ++++++M+QCV
Sbjct  386   KTIERLLGPALGDQQQGSFSINLWKNAFQDAFQRLCPVRAGGHECGCLPVIARMVMEQCV  445

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             +RLDVAMFNAILRESA +IPTDP+SDPI + +VLPIPAG  SF +GAQLKN++G WSRWL
Sbjct  446   SRLDVAMFNAILRESAHEIPTDPISDPIVDSKVLPIPAGDLSFGSGAQLKNSVGTWSRWL  505

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKP--FYLLNAMSDLMMLPKDML  2948
              DLFG+D DD   ++           NG + ++Q    +P  F+LLNA+SDL+MLPKDML
Sbjct  506   TDLFGMDVDDSLGEVQI---------NGEDGESQGGHDEPKSFHLLNALSDLLMLPKDML  556

Query  2949  LSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVN  3122
             + R++RKEVCP+  L L+ R+L  F PDEFCPDP+P  VLEA+N+E  +E  +  +S  +
Sbjct  557   MDRSIRKEVCPSISLPLLKRILCNFTPDEFCPDPVPGAVLEAVNAESIVERRLSGDSASS  616

Query  3123  FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI  3302
             FP  A P++YAPPS+A         +   SQL R+ S V KK YTSD+EL+ELDSPL  I
Sbjct  617   FPYPATPVLYAPPSSA-DVAEKVAEAGGKSQLARNASMVQKKGYTSDEELEELDSPLTSI  675

Query  3303  --KMENSEVT-----KPgggsgngngngVRYQLLREVWMS  3401
               KM  S                 NG   RY+LLREVW S
Sbjct  676   IEKMPPSPSVVRNGNGKHSEETGHNGLNARYELLREVWSS  715



>ref|XP_002526750.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35664.1| conserved hypothetical protein [Ricinus communis]
Length=796

 Score =   498 bits (1281),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 284/577 (49%), Positives = 378/577 (66%), Gaps = 33/577 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             VL +  N  + + S N+  D +   +    V L ++  E+E K+  LE ELRE AA+EI 
Sbjct  232   VLDETSNGTQSVASDNETVDAEENGEHEDEVALNQRIGEMEIKVGKLEEELREVAALEIS  291

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARRLSRLY HACK  +  +R + A++ VSGL+L++K+CGNDV
Sbjct  292   LYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWAQDKRATIAKNTVSGLVLISKSCGNDV  351

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNA-VVKNERKASPLKWQSFPHKKS  2243
             PRLTFWLSN ++LR  I +   S +    L+   + N    KNE KA+ LKW+     + 
Sbjct  352   PRLTFWLSNTIMLREIISQAFGSSRNSSALTKCSAPNGGSKKNEGKAAALKWKGGSGSRQ  411

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINK  2423
             V N      +DW+    +T ALEKVE+WIFSRI+ES+WWQ  TPHMQS   T L S  NK
Sbjct  412   V-NGFMQLVDDWQETGTYTAALEKVESWIFSRIVESVWWQAVTPHMQSPGGT-LSS--NK  467

Query  2424  IYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVA  2597
              + R         +  +FS+ LW  AFRDA++R+CPVRAGGHECGCL ++++++M+QCV+
Sbjct  468   SFGRLMGPALGDHQQGSFSINLWNNAFRDAFQRLCPVRAGGHECGCLPIIARMVMEQCVS  527

Query  2598  RLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLA  2777
             RLDVAMFNAILRESA DIPTDPVSDPI + +VLPIPAG  SF +GAQLKN++G WSRWL 
Sbjct  528   RLDVAMFNAILRESAHDIPTDPVSDPIVDSKVLPIPAGDLSFGSGAQLKNSVGTWSRWLT  587

Query  2778  DLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSR  2957
             D+FG+D DD   +          +S+  ERK+ +   K F LLN +SDL+MLPKDML+ R
Sbjct  588   DMFGMDSDDSLKEDQL-------SSDDDERKSGEP--KAFNLLNELSDLLMLPKDMLMDR  638

Query  2958  TVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPC  3131
             ++RKEVCP+  L L+ R+L  F PDEFCPD +P  +LEALN+E  +E  +  +S  NFP 
Sbjct  639   SIRKEVCPSICLPLVKRILCNFTPDEFCPDAVPGDLLEALNAESIVERRLSGDSTRNFPY  698

Query  3132  SAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKME  3311
             +A P+VYAPPS +A          + S+L+R+ S+V +K YTSD+EL+ELDSPL  I +E
Sbjct  699   TAGPVVYAPPS-SADVSEKVAEVGAKSELSRNVSAVQRKGYTSDEELEELDSPLTSI-IE  756

Query  3312  NSEVTKPgg---------gsgngngngVRYQLLREVW  3395
             NS ++ P                     R +LLR+VW
Sbjct  757   NS-LSSPTSVPKGNGNHLEHTGYIVTNARNELLRQVW  792



>gb|KHG27481.1| Pre-mRNA-processing factor 19 [Gossypium arboreum]
Length=1012

 Score =   504 bits (1297),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 305/584 (52%), Positives = 374/584 (64%), Gaps = 61/584 (10%)
 Frame = +3

Query  1674  ESNRANGSVRSNQFVLRDKRNSI-EGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQM  1850
             +S  + G ++  +F  + K N I E I  +   DT  + KE +      K  ELE KI+M
Sbjct  484   DSGNSYGPLKKTEFAKKAKENDIPEKIHHSSTSDTCNKRKENTKSFSNSKV-ELESKIEM  542

Query  1851  LEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVV  2030
             LE ELREAA VE  L+S+VAEHGSSTNKVHAPARRLSR Y HACK N+  +R SAAR+ +
Sbjct  543   LEEELREAAVVEASLYSIVAEHGSSTNKVHAPARRLSRFYLHACKANTQDKRASAARAAI  602

Query  2031  SGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASP  2210
             SGL+LV+KACGNDVPRLTFWLSN ++LRA +     + QL                    
Sbjct  603   SGLVLVSKACGNDVPRLTFWLSNSIVLRATVSHAIGEMQL--------------------  642

Query  2211  LKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSG  2390
                       S G+D      DW +P  F  AL+K EAWIFSRI+ES+WWQT TP+MQS 
Sbjct  643   ---------FSEGSD------DWVDPRTFLLALQKFEAWIFSRIVESVWWQTLTPYMQST  687

Query  2391  AATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLS  2570
             AA SL S+ N    R       E  +FS+ELWKKAF+DA ER+CP+RA GHECGCL +L+
Sbjct  688   AAKSLCSKKNS--SRRYGLGDLEQGSFSVELWKKAFKDACERLCPIRACGHECGCLAVLA  745

Query  2571  KLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNA  2750
             KL+M+Q V RLDVAMFNAILRESA+++P DPVSDPIS+ +VLPIPA ++SF AG QLKNA
Sbjct  746   KLVMEQLVGRLDVAMFNAILRESAEEMPADPVSDPISDSKVLPIPASESSFGAGVQLKNA  805

Query  2751  IGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS---KPFYLLNAMSD  2921
             IGNWSRWL DLFGI           DD    ++SN        AC    K F LLNA+SD
Sbjct  806   IGNWSRWLTDLFGI-----------DDNESPEDSNEVGDSKNAACEGSFKSFCLLNALSD  854

Query  2922  LMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEV  3101
             L+MLP +ML  R+ RKEVCP F +SLI RVLN F+PDEF P+P+   V EAL  +D  E 
Sbjct  855   LLMLPSEMLADRSTRKEVCPRFSVSLIIRVLNNFVPDEFNPNPVSQAVFEALE-KDLSEG  913

Query  3102  EEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldel  3281
              EES+ NFPC A PIVY+PPSA +           S  + RS+S VL+KSYTSDDELDEL
Sbjct  914   GEESITNFPCMATPIVYSPPSATS-----LTDIIQSQVMERSKSLVLRKSYTSDDELDEL  968

Query  3282  dsPLNLIKMENSEVTKPg--ggsgngngngVRYQLLREVWMSSE  3407
             DSP+  I +EN   +       +G G    VRY+L+RE+W   E
Sbjct  969   DSPMTSIMIENPRGSPKTNWMRTGKGGRKVVRYELIREIWKDGE  1012


 Score =   175 bits (444),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 127/198 (64%), Gaps = 9/198 (5%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   S Q  Y++ + EI PW P QSL   +++++QWE+GDK+SGS      
Sbjct  1    MVLGLRTKNRKGNSYQVYYIVYVNEINPWTPLQSLPAAQSLLLQWENGDKSSGSLV----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S   NG+IEF ESFR+ +TL  E S KS N D FQKNC+EF LYEPR+D   KGQ
Sbjct  57   -----SSFRNGKIEFGESFRLQVTLSLESSRKSTNRDGFQKNCLEFYLYEPRKDKVAKGQ  111

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLG+AV++ A+YG+++E +++S PIN K+S RN  QP+L L IQ   KG   S  + ++ 
Sbjct  112  LLGSAVVNLADYGIIRETISISTPINLKKSSRNIEQPVLYLTIQPFNKGSSSSSSKGSLP  171

Query  705  RESSMDSSAGESVSALMN  758
            +E S++    ESVS  +N
Sbjct  172  KEVSLEKDGSESVSGSIN  189



>ref|XP_009761880.1| PREDICTED: uncharacterized protein LOC104213993 [Nicotiana sylvestris]
Length=1051

 Score =   504 bits (1299),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 292/536 (54%), Positives = 366/536 (68%), Gaps = 23/536 (4%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             E + +I+ LE ELREAAAVE+ L+SVVAEHGSS +KVHAPARRLSR Y HAC   S  ++
Sbjct  529   EWKARIETLEEELREAAAVEVSLYSVVAEHGSSAHKVHAPARRLSRFYAHACTAKSRAKQ  588

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
               AAR+ VSGL+LV+KACGNDVPRLTFWLSN V+LRA + + +  ++    S Y+++   
Sbjct  589   AGAARAAVSGLVLVSKACGNDVPRLTFWLSNSVMLRAIVSQAAGGRKEGDRS-YAESNRG  647

Query  2187  KNERKASPLKWQS-FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQ  2363
             K+      LK ++ F   K + N L     DWE+   F  ALE+VEAWIFSRI+ES+WWQ
Sbjct  648   KSSLNGRSLKKRTEFSSNKDLNNSLTDELGDWEDTETFMLALEQVEAWIFSRIVESVWWQ  707

Query  2364  TFTPHMQSGAATS--LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             T TPHMQ+ AA S    + + K Y R  S   +E  NFS+ELWKKAF+DA ER+CPVRAG
Sbjct  708   TLTPHMQNTAANSGGRSTSVKKTYGRRCSLGDQEQGNFSIELWKKAFKDACERLCPVRAG  767

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL LL++L+M+Q V+RLDVAMFNAILRESA+++PTDPVSDPI + +VLP+PAGK+
Sbjct  768   GHECGCLPLLARLVMEQLVSRLDVAMFNAILRESAEEMPTDPVSDPICDSKVLPVPAGKS  827

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKNAIG+WSRWL++LFGI+D+D   D  +    KA +            +KPF
Sbjct  828   SFGSGAQLKNAIGDWSRWLSNLFGIEDNDFSGDGEDLVHEKAPSP-----------AKPF  876

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLNA+SDLMMLP +ML     RKEVCP  G +LI RVLN F+PDEFCP P+P  VL AL
Sbjct  877   RLLNALSDLMMLPFEMLADPQTRKEVCPILGPTLIRRVLNGFVPDEFCPIPVPPDVLRAL  936

Query  3078  NSEDH-MEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSY  3254
             +S+D  ++  EE V   PC+A+P  Y PPS  +   I     + +  L RS SSVLKKSY
Sbjct  937   DSQDDAVDTPEEPVSTVPCTASPTSYLPPSVRS--IITFLGDTGNQSLQRSGSSVLKKSY  994

Query  3255  TsddeldeldsPLNLIKMENSEVTKPgggsgngngng-----VRYQLLREVWMSSE  3407
             TSDDELDELDSPL  I  +    +         +        VRYQLLR+VW   E
Sbjct  995   TSDDELDELDSPLTSIVADRFRGSPNLAKFNLVSKGKGDRNIVRYQLLRQVWRDQE  1050


 Score =   154 bits (388),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 111/164 (68%), Gaps = 13/164 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   + +   SVQ EY+I + EIKPWPPSQSLK++++V++ WE+  +NSGS      
Sbjct  1    MVLGLRSRHKKGASVQVEYVIQVDEIKPWPPSQSLKSVQSVLLLWENDGQNSGSIV----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 S VG+  IEF ESF +P+TL RE  +     D FQKN ++F LYE R+D T KGQ
Sbjct  57   -----SSVGDTNIEFKESFTLPLTLCREKKA----SDKFQKNFLDFYLYELRKDKTTKGQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            LLGT++I+ A++G+++E +++  P+NCK+S +N+ QP L + I 
Sbjct  108  LLGTSIINLADFGLLEEIVSIYTPLNCKKSSKNSEQPALFVNIH  151



>ref|XP_010682835.1| PREDICTED: uncharacterized protein LOC104897609 [Beta vulgaris 
subsp. vulgaris]
Length=870

 Score =   498 bits (1283),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 290/622 (47%), Positives = 390/622 (63%), Gaps = 38/622 (6%)
 Frame = +3

Query  1557  TTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGS-VRSNQFVLRDKR  1733
             T KQ     S +  G++ +      D +L H+ SV    +S RA+G  +  + F    + 
Sbjct  274   TRKQTSRSISTLKFGKKGLDLHGLGD-KLKHIKSVRLPTDSPRASGPPIPLHLFDKSKEE  332

Query  1734  NSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAE  1913
             +S++ +  +     K   K+  NV  + K  E E KI+MLE ELREAAA+EIG++SVVAE
Sbjct  333   SSVKEVQVDTKSQEKSDKKDKKNVKSDNKA-EFESKIKMLEEELREAAALEIGVYSVVAE  391

Query  1914  HGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWL  2093
             H +S  KVHAPARRLSR Y H C+  S   R S+AR++VSGL++V+KACGNDVPRLTFWL
Sbjct  392   HLNSKRKVHAPARRLSRFYRHVCRAESQANRASSARTIVSGLVMVSKACGNDVPRLTFWL  451

Query  2094  SNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFE  2273
             SN ++LRA +   +E  ++P  +E S     K+ RK S         KK+  ND   +  
Sbjct  452   SNAIILRAMVSHITE--EIPPPAEPSSTTETKSGRKKS--------EKKTPLNDSIDSLG  501

Query  2274  DWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCS  2453
             DWE+P  F  ALEKVEAWIF RI+E +WWQ+FTPHMQ            +  QR      
Sbjct  502   DWEDPRTFIMALEKVEAWIFFRIVEGLWWQSFTPHMQPTKKKKGKRLTTRKTQRWKYGLG  561

Query  2454  EEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
             ++ + +FS ELWKKAF+DA ER+CP+RAGGH+CGCL +LSK++M+Q V RLDVAMFNAIL
Sbjct  562   DQEQGSFSTELWKKAFQDACERLCPIRAGGHDCGCLPMLSKMVMEQLVDRLDVAMFNAIL  621

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             R+S +++PTDP+SDPIS  +VLPIPAGK+SF AGAQLKNA+G+WS+WL+D FGI      
Sbjct  622   RDSEEEMPTDPISDPISELKVLPIPAGKSSFGAGAQLKNAVGSWSKWLSDFFGI------  675

Query  2811  ddlveddeNKADNSNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTF  2987
                      + D    H+  + D  S K F+LLNA+ DLMMLP  ML   T RKEVCP F
Sbjct  676   ---------EEDEPAKHQDDSNDEASVKAFHLLNALGDLMMLPLGMLSDATTRKEVCPIF  726

Query  2988  GLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEE-SVVNFPCSAAPIVYAPPS  3164
             G SLI RV   F PD+F P+ I + VLE+L+SED  E  ++ +V +FP  A P+VY+P  
Sbjct  727   GGSLIKRVFTNFEPDDFSPNSITDEVLESLDSEDSRETSKDCTVKSFPYDAKPVVYSP--  784

Query  3165  AAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggs  3344
               A   +     SSS    ++ SS+L+KS+ SDD+LD+L  PL LI ++N+ +      +
Sbjct  785   LPATLFLGLLGDSSSQSQKKNGSSLLRKSHNSDDDLDKLSVPLALINVQNTCIEPASSKT  844

Query  3345  g-----ngngngVRYQLLREVW  3395
                    G  + VRY+LL+E W
Sbjct  845   DWTPKGKGGRDVVRYRLLQEAW  866


 Score =   143 bits (360),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 120/178 (67%), Gaps = 13/178 (7%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +G+ S+Q +Y+++I+EIKPWPPS +L +++ V+IQWE+GD+NSG      P
Sbjct  1    MVLG-KKKKKGI-SLQVDYIVSILEIKPWPPSVALCSVQTVLIQWENGDQNSGFLPPGVP  58

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   +G  +G+IEFNE F++P+TL  +      +  +FQKN +EF+LYEP++D  VKGQ
Sbjct  59   SL---NGFDDGKIEFNEFFKLPVTLTGK------HNQSFQKNSLEFHLYEPKKDKAVKGQ  109

Query  525  LLGTAVIDFANYGVVK--EGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVR  692
            LLGTAVI+ A YG+++  + +   + I  K S   + QPLL ++IQ      ++S++R
Sbjct  110  LLGTAVINLAEYGIIRDVQTIITPIIITKKVSKGTSSQPLLYVQIQPFDNEGIESVLR  167



>gb|KDP37358.1| hypothetical protein JCGZ_06812 [Jatropha curcas]
Length=804

 Score =   496 bits (1277),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 287/598 (48%), Positives = 381/598 (64%), Gaps = 32/598 (5%)
 Frame = +3

Query  1653  SSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQE  1829
             SSV + G  ++    V+  +  L +  N  + I S N+  D +      + + L ++ +E
Sbjct  218   SSVSSEGADDKPVEDVKDIE-ALDEASNGTQSIASDNETVDAEENGGHGNEIALNQRIEE  276

Query  1830  LEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRL  2009
             +E KI  LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK  +  +R 
Sbjct  277   MEMKIGKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKYWTQDKRA  336

Query  2010  SAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNA-  2180
             + A++ VSGL+L+AK+CGNDVPRLTFWLSN ++LR  I +   S +   PL+     N  
Sbjct  337   TIAKNTVSGLVLIAKSCGNDVPRLTFWLSNTIVLREIISQAFGSSRYSSPLTRFTGSNGD  396

Query  2181  VVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWW  2360
               K+E K+ PLKW+     K VG  +    +DW+    +T ALEKVE+WIFSRI+ES+WW
Sbjct  397   SKKSEGKSMPLKWKGNYGHKQVGGFME-LVDDWQETGTYTAALEKVESWIFSRIVESVWW  455

Query  2361  QTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRA  2534
             Q  TPHMQS +  SL S  NK + R        ++  +FS+ LWK AFRDA +R+CPVRA
Sbjct  456   QALTPHMQSPSG-SLSS--NKSFGRLLGPALGDQQQGSFSVNLWKNAFRDASQRLCPVRA  512

Query  2535  GGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGK  2714
             GGHECGCL ++++++M+QCVARLDVAMFNAILRESA ++PTDPVSDPI + +VLPIPAG 
Sbjct  513   GGHECGCLPIIARMVMEQCVARLDVAMFNAILRESAHEVPTDPVSDPIVDSKVLPIPAGD  572

Query  2715  ASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKP  2894
              SF +GAQLKN++G WSRWL+D+FG+D DD           K D  +    + +D   K 
Sbjct  573   LSFGSGAQLKNSVGTWSRWLSDMFGMDVDDSL---------KDDQHSSDNDEMRDGEPKV  623

Query  2895  FYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEA  3074
             F+LLN +SDL+MLPKDML+ R++RKEVCP+  L L+ R+L  F PDEFCPD +P  VLEA
Sbjct  624   FHLLNDLSDLLMLPKDMLIDRSIRKEVCPSISLPLVKRILCNFTPDEFCPDAVPGDVLEA  683

Query  3075  LNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKK  3248
             LN+E  +E  +  E+  NFP +AAP++Y   S +           + S L+R+ S V +K
Sbjct  684   LNAETIVERRLSGETARNFPYTAAPVMYTAAS-STDVAEKVAEIGAKSHLSRNVSVVQRK  742

Query  3249  SYTsddeldeldsPLNLI---------KMENSEVTKPgggsgngngngVRYQLLREVW  3395
              YTSD+EL+ELDS L  I          M N                 VRY+LLREVW
Sbjct  743   GYTSDEELEELDSHLTSIIEKLPPSPSIMANGNRNGKHTEHTGHVVKNVRYELLREVW  800



>gb|KHN30580.1| hypothetical protein glysoja_030017 [Glycine soja]
Length=1099

 Score =   504 bits (1299),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 303/657 (46%), Positives = 417/657 (63%), Gaps = 55/657 (8%)
 Frame = +3

Query  1446  LVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKT  1625
             ++ +++K ++  +G+E    + +  E E V++   D +TK+    ++  +  +++    T
Sbjct  495   VMDDKEKMKKGRKGQEQFTMRNELLENELVSNLSDDGSTKKGKFNSTTFLLNKKTHEHPT  554

Query  1626  TC--DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWK-DTKVRSKET  1796
             +   D++   V++V +  +S    G   SNQ  ++ +    E  T+ND    T       
Sbjct  555   SILIDDKTVDVTNVKSPPQSAENYGMFSSNQTHIQAE----EINTTNDVHVGTSCHEDVN  610

Query  1797  SNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFH  1976
              N        EL+ +++ML+ ELREAAA+E+ ++SV+AEHGSS+NKVHAPARRLSR YFH
Sbjct  611   VNGSFLNNETELKAEVEMLQEELREAAALEVSMYSVIAEHGSSSNKVHAPARRLSRFYFH  670

Query  1977  ACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPL  2156
             AC+  S     SAA+S VSG +LV+KACGNDVPRLTFW SN +LLRA + K  E+     
Sbjct  671   ACRVGSPDTMASAAQSAVSGFVLVSKACGNDVPRLTFWFSNLILLRAIVSKEVER-----  725

Query  2157  SSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
               + + N + K E+                       F  WE+P  F  ALEKVEAWIFS
Sbjct  726   --DGNGNTLHKEEK----------------------PFHSWEDPETFLVALEKVEAWIFS  761

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYER  2516
             RI+ES+WWQT TP+MQS AA S  S   K Y++      ++  NFS++LWK+AF+DA ER
Sbjct  762   RIVESVWWQTLTPYMQSAAAKS--SSSRKAYEKRYRVGDQDQGNFSIDLWKRAFKDACER  819

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             ICP+RAGGHECGCL ++++L+M+Q V+RLDVAMFNAILRESA+++P DP+SDPIS+ +VL
Sbjct  820   ICPLRAGGHECGCLPVIARLVMEQLVSRLDVAMFNAILRESAEEMPMDPISDPISDSKVL  879

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PIPAGK+ F AGAQLKNAIG+WSRWL+DLF IDD D  + + E++E K + S        
Sbjct  880   PIPAGKSGFGAGAQLKNAIGDWSRWLSDLFSIDDSDSREVINENNEPKCEPS--------  931

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
                 KPF  LNA+SDLMMLP DML   ++RKEVCP FG+SL+ RV+  F+PDEF P PIP
Sbjct  932   ---FKPFQFLNALSDLMMLPLDMLADGSMRKEVCPKFGISLMKRVVYNFVPDEFSPGPIP  988

Query  3057  NVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrss  3236
             + V EAL+ +  +E +E ++ +FPCSA    Y PP A++   +       +    RS S 
Sbjct  989   DAVFEALDED--IEDDEGAITSFPCSAGSTFYEPPPASS--VVGMLQEVGTKTSLRSGSF  1044

Query  3237  VLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWMSSE  3407
             VLKK YTSDDELDELDSPL+ + M++S +         G    VRY+LLRE W +SE
Sbjct  1045  VLKKLYTSDDELDELDSPLSALGMDDSSLL--SKELVKGGRKVVRYELLREAWKTSE  1099


 Score =   176 bits (445),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 117/164 (71%), Gaps = 13/164 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R   S+Q  Y+I+++EIKPWPPSQSL+++++V +QWE+GDKNSGS    A 
Sbjct  1    MVLGLRSKSRKRVSIQVHYIIHVLEIKPWPPSQSLRSVQSVFLQWENGDKNSGSLPSTA-  59

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                    GNG+IEFNESFR+ + + RE S K  + ++FQKNC+EF LY    D TVK Q
Sbjct  60   --------GNGKIEFNESFRLSVLMCREASKKGKHPESFQKNCLEFYLY----DKTVKSQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            LLG+A+++ A++G++KE   +S+  NCK+S+RN+ QP L + IQ
Sbjct  108  LLGSAIVNLADFGIIKETKALSIVFNCKKSFRNSSQPFLYVTIQ  151



>ref|XP_009391818.1| PREDICTED: uncharacterized protein LOC103977891 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391819.1| PREDICTED: uncharacterized protein LOC103977891 [Musa acuminata 
subsp. malaccensis]
Length=708

 Score =   492 bits (1266),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 274/545 (50%), Positives = 355/545 (65%), Gaps = 37/545 (7%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K +E+E +I+ LE ELRE AA+EI L+SV+ EHGSS +KVH PARRLSRLY HACK  +
Sbjct  181   QKMEEMESRIEKLEEELREVAALEISLYSVIPEHGSSAHKVHTPARRLSRLYIHACKYWT  240

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FS--EKQQLPLSSE  2165
               ++ + AR+ VSGL+L+AK+CGNDV RLTFWLSN V+LR  IC+ F         L + 
Sbjct  241   QDKKATVARNTVSGLVLIAKSCGNDVSRLTFWLSNTVVLREIICQTFGNLSNSNATLRTV  300

Query  2166  YSKNAVVKNERKASPLKWQ---SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
              S     K + K SPLK +        K+ G       +DW++   FT ALEK+E+WIFS
Sbjct  301   ESNGGARKTDEKQSPLKRKINSGIKQGKNFG--FMQLIDDWQDTSTFTSALEKIESWIFS  358

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTS-------SSCSEEPENFSLELWKKA  2495
             RI+ES+WWQT TP MQS         +  IY   S       +   ++  +FS+ LWK A
Sbjct  359   RIVESVWWQTLTPCMQS--------PLEDIYTPKSFGKLLGPALGDQQQGSFSINLWKSA  410

Query  2496  FRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDP  2675
             F DA+ R+CPVR+GGHECGCL +L+K +M+QCV+RLDVAMFNAILRESA +IPTDPVSDP
Sbjct  411   FHDAFSRLCPVRSGGHECGCLPVLAKKVMEQCVSRLDVAMFNAILRESAHEIPTDPVSDP  470

Query  2676  ISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN  2855
             I +P+VLPIPAG  SF +GAQLKN+IGNWSRWL DLFG+          ED      + +
Sbjct  471   IVDPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDLFGM--------DAEDSAKDDQDGD  522

Query  2856  GHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
               +RK + A SK F+LLN +SDL+MLPKDMLL+R VRKEVCP+ GL LI R+L  F PDE
Sbjct  523   ADDRKEEIAESKSFHLLNQLSDLLMLPKDMLLARAVRKEVCPSIGLPLIIRILCNFTPDE  582

Query  3036  FCPDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             FCPDP+P +VLE LN+E  +E    ++E +  FP +AAP++Y+PP   A           
Sbjct  583   FCPDPVPGIVLEELNTESILERRLSDKELIGGFPSAAAPVLYSPP-LPAEVAEKVADIGR  641

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngV--RYQL  3380
              ++L R  S V +K YTSD +LDELD+PL  I      V+       +   +    RY+L
Sbjct  642   QAELDRRASMVQRKGYTSDQDLDELDAPLASIVDRTPPVSPSPTSIPHQQSSPANSRYKL  701

Query  3381  LREVW  3395
             LR+VW
Sbjct  702   LRQVW  706



>ref|XP_004957173.1| PREDICTED: uncharacterized protein LOC101757500 [Setaria italica]
Length=825

 Score =   493 bits (1270),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 294/667 (44%), Positives = 406/667 (61%), Gaps = 65/667 (10%)
 Frame = +3

Query  1452  TERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTC  1631
             T+ DK  E G   ++ IE G+ ++       ++D  T  +       I GRE+ G     
Sbjct  201   TQDDKAVEDGTKNDMDIEDGKDAK------VIEDKVTDDN------AIEGRETDG-----  243

Query  1632  DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVL  1811
              + +     +  L E+ + + S  ++  +   + N +    S               V  
Sbjct  244   -KAVGEAKEIDILDEAPKCDQSTSTDDEIAETEENIVHNGHS---------------VSY  287

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             ER  +EL+ KI+ LE ELRE AA+E+ L+SVV EHG S++K+H PARRLSRLY HA K  
Sbjct  288   ERN-EELDSKIEKLEQELREVAALEVSLYSVVPEHGCSSHKLHTPARRLSRLYIHASKFW  346

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPLSSE  2165
             S  ++ S AR+ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +   + +Q  P+   
Sbjct  347   SSDKKASVARNSVSGLVLVAKSCGNDVSRLTFWLSNIVVLREIIAQTFGTSRQSGPVMKS  406

Query  2166  YSKNAVVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
             +S N   K  +   +P++W+S  + K    ++    +DW        ALEK+E+WIFSRI
Sbjct  407   FSTNGNAKKLDGNFAPMRWKSSSNAKHARPNIMQMPDDWRESGTLLSALEKIESWIFSRI  466

Query  2343  IESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERIC  2522
             +ES+WWQ  TPHMQ+        +I+++     S   ++  NFS++LWK AFRDA+ RIC
Sbjct  467   VESVWWQAMTPHMQTPVEDLSTPKISRLL--GPSLGDQQHGNFSIDLWKTAFRDAFSRIC  524

Query  2523  PVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPI  2702
             P+RA GHECGCL +L+KL+M+ CVARLDVAMFNAILRESA++IP+DP+SDPI +  VLPI
Sbjct  525   PLRASGHECGCLPVLAKLVMEHCVARLDVAMFNAILRESANEIPSDPISDPIVDSRVLPI  584

Query  2703  PAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK--AQ  2876
             PAG  SF +GAQLKN++GNWSRWL D FG+D  + + D  +         NG ER+  A+
Sbjct  585   PAGDLSFGSGAQLKNSVGNWSRWLTDTFGMDGAESEKDGQDA------EHNGDERRDAAE  638

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
               C   F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPDP+P
Sbjct  639   SNC---FKLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLPLVTRILCNFTPDEFCPDPVP  695

Query  3057  NVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsr  3230
              +VLE L+SE  ME  +E+E +  FP +AAP+VY PPS   +   + D    + +L R  
Sbjct  696   GMVLEELSSEGMMERFMEKEVISTFPVTAAPVVYCPPSLEDVAEKVADTGCGNPELDRRS  755

Query  3231  ssVLKKSYTsddeldeldsPLNLIKMENSEVTKP------------gggsgngngngVRY  3374
             S   ++ YTSDD+LD+LDSPL  +  + S    P            G G+G  +    RY
Sbjct  756   SMAQRRGYTSDDDLDDLDSPLASL-YDRSAPPSPCSNGAAHFSARQGAGAGAASMANARY  814

Query  3375  QLLREVW  3395
             +LLREVW
Sbjct  815   ELLREVW  821



>ref|XP_006490049.1| PREDICTED: uncharacterized protein LOC102611142 isoform X1 [Citrus 
sinensis]
 ref|XP_006490050.1| PREDICTED: uncharacterized protein LOC102611142 isoform X2 [Citrus 
sinensis]
 ref|XP_006490051.1| PREDICTED: uncharacterized protein LOC102611142 isoform X3 [Citrus 
sinensis]
 ref|XP_006490052.1| PREDICTED: uncharacterized protein LOC102611142 isoform X4 [Citrus 
sinensis]
Length=788

 Score =   491 bits (1263),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 280/581 (48%), Positives = 374/581 (64%), Gaps = 35/581 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +  N  + + S N+  DT+   +      L +K +E+E +I+ LE ELR+ AA+EI 
Sbjct  224   LLDETSNGAQSVASDNETVDTEESGEHIDEANLNQKIEEMELRIEKLEEELRDVAALEIS  283

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH+PARRLSR+Y HACK  +  +R + A++ VSGL+LVAK+CGNDV
Sbjct  284   LYSVVPEHGSSAHKVHSPARRLSRIYIHACKHWTQNKRATIAKNSVSGLVLVAKSCGNDV  343

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKS  2243
              RLTFWLSN ++LR  IC+   +     P++     N   K +E K+  LKW+     K 
Sbjct  344   SRLTFWLSNTIVLREIICQAFGNSHNSTPVTRISESNGFSKKSEGKSQSLKWKGGSGNKQ  403

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINK  2423
             +   L    EDW+    F  AL+KVE+WIFSRI+ES+WWQ  TPHMQS   ++    I K
Sbjct  404   LNGHLQFD-EDWQEMGTFIAALQKVESWIFSRIVESVWWQALTPHMQSPVGSTT-KPIGK  461

Query  2424  IYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARL  2603
             +     +   ++  +FS+ LWK AF+DA +++CPVRAGGHECGCL +L +++M+QCVARL
Sbjct  462   LL--GPALGDQQQGSFSINLWKNAFQDALQKLCPVRAGGHECGCLPVLGRMVMEQCVARL  519

Query  2604  DVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADL  2783
             DVAMFNAILRESA++IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSRWL D+
Sbjct  520   DVAMFNAILRESANEIPTDPVSDPILDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDM  579

Query  2784  FGIddddedddlveddeNKADNSNGHERKAQDACSKP--FYLLNAMSDLMMLPKDMLLSR  2957
             FG+D DD           K D     +   QD   +P  F LLN+ SDL+MLPKDML+ R
Sbjct  580   FGMDTDDSP---------KEDQDFTEDDDGQDGVGEPKSFILLNSFSDLLMLPKDMLMDR  630

Query  2958  TVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPC  3131
             ++R+EVCP   LSL+ R+L  F PDEFCPD +P  VLEALN+E  +E  +  +S  +FP 
Sbjct  631   SIRQEVCPLISLSLVKRILCNFTPDEFCPDAVPGAVLEALNAESIIERRLSGDSARSFPY  690

Query  3132  SAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL------  3293
             +AAP+ Y PPS ++        +   S L R+ SSV +K YTSDDEL+ELDSPL      
Sbjct  691   TAAPVEYNPPS-SSDVAEKVAEAGGKSHLLRNVSSVQRKGYTSDDELEELDSPLSSIIDK  749

Query  3294  -----NLIKMENSEVTKPgggsgngngngVRYQLLREVWMS  3401
                  ++I  EN              G+  RY+LLREVW S
Sbjct  750   LPPSPSIIATENG--NGKHKNHTYYTGSNARYELLREVWSS  788



>gb|KDO57226.1| hypothetical protein CISIN_1g003892mg [Citrus sinensis]
 gb|KDO57227.1| hypothetical protein CISIN_1g003892mg [Citrus sinensis]
 gb|KDO57228.1| hypothetical protein CISIN_1g003892mg [Citrus sinensis]
Length=788

 Score =   491 bits (1263),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 280/581 (48%), Positives = 374/581 (64%), Gaps = 35/581 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +  N  + + S N+  DT+   +      L +K +E+E +I+ LE ELR+ AA+EI 
Sbjct  224   LLDETSNGAQSVASDNETVDTEESGEHIDEANLNQKIEEMELRIEKLEEELRDVAALEIS  283

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH+PARRLSR+Y HACK  +  +R + A++ VSGL+LVAK+CGNDV
Sbjct  284   LYSVVPEHGSSAHKVHSPARRLSRIYIHACKHWTQNKRATIAKNSVSGLVLVAKSCGNDV  343

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKS  2243
              RLTFWLSN ++LR  IC+   +     P++     N   K +E K+  LKW+     K 
Sbjct  344   SRLTFWLSNTIVLREIICQAFGNSHNSTPVTRISESNGFSKKSEGKSQSLKWKGGSGNKQ  403

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINK  2423
             +   L    EDW+    F  AL+KVE+WIFSRI+ES+WWQ  TPHMQS   ++    I K
Sbjct  404   LNGHLQFD-EDWQEMGTFIAALQKVESWIFSRIVESVWWQALTPHMQSPVGSTT-KPIGK  461

Query  2424  IYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARL  2603
             +     +   ++  +FS+ LWK AF+DA +++CPVRAGGHECGCL +L +++M+QCVARL
Sbjct  462   LL--GPALGDQQQGSFSINLWKNAFQDALQKLCPVRAGGHECGCLPVLGRMVMEQCVARL  519

Query  2604  DVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADL  2783
             DVAMFNAILRESA++IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSRWL D+
Sbjct  520   DVAMFNAILRESANEIPTDPVSDPILDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDM  579

Query  2784  FGIddddedddlveddeNKADNSNGHERKAQDACSKP--FYLLNAMSDLMMLPKDMLLSR  2957
             FG+D DD           K D     +   QD   +P  F LLN+ SDL+MLPKDML+ R
Sbjct  580   FGMDTDDSP---------KEDQDFTEDDDGQDGVGEPKSFILLNSFSDLLMLPKDMLMDR  630

Query  2958  TVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPC  3131
             ++R+EVCP   LSL+ R+L  F PDEFCPD +P  VLEALN+E  +E  +  +S  +FP 
Sbjct  631   SIRQEVCPLISLSLVKRILCNFTPDEFCPDAVPGAVLEALNAESIIERRLSGDSARSFPY  690

Query  3132  SAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL------  3293
             +AAP+ Y PPS ++        +   S L R+ SSV +K YTSDDEL+ELDSPL      
Sbjct  691   TAAPVEYNPPS-SSDVAEKVAEAGGKSHLLRNVSSVQRKGYTSDDELEELDSPLSSIIDK  749

Query  3294  -----NLIKMENSEVTKPgggsgngngngVRYQLLREVWMS  3401
                  ++I  EN              G+  RY+LLREVW S
Sbjct  750   LPPSPSIIATENG--NGKHKNHTYYTGSNARYELLREVWSS  788



>ref|XP_009134581.1| PREDICTED: uncharacterized protein LOC103858888 [Brassica rapa]
Length=873

 Score =   492 bits (1266),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 298/563 (53%), Positives = 378/563 (67%), Gaps = 44/563 (8%)
 Frame = +3

Query  1731  RNSIEGITSN-DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVV  1907
             R+S+E   SN + K+ KV  +  SN  LE K ++LE +++ LEGEL EAAA+E  L+SVV
Sbjct  343   RSSLEISRSNSERKEAKVFPR--SNTTLESKVKDLESRVKKLEGELCEAAAIEAALYSVV  400

Query  1908  AEHGSSTNKVHAPARRLSRLYFHACK-ENSVL--RRLSAARSVVSGLILVAKACGNDVPR  2078
             AEH SS+ KVHAPARRL RLY HAC+ +N +L  RR +AA+SVVSGL+ VAKACGNDVPR
Sbjct  401   AEHASSSAKVHAPARRLLRLYLHACRGDNHLLSTRRANAAKSVVSGLVTVAKACGNDVPR  460

Query  2079  LTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQ-SFPHKKSVGND  2255
             LT+WLSN ++LRA I   +  ++LP+S+           + +S L W+ S   KK+ G  
Sbjct  461   LTYWLSNTIILRAIISD-NHSEELPVSAGPGPKTSKTQRQGSSSLTWKDSSLSKKNTGG-  518

Query  2256  LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINK-IYQ  2432
                    W++P  F  ALEKVEAWIFSR++ESIWWQT TP MQS AA    +   K  + 
Sbjct  519   -------WDDPGTFITALEKVEAWIFSRVVESIWWQTLTPRMQSSAANGSSASSKKNKFG  571

Query  2433  RTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVA  2612
             R+ SS ++E  +FSLELWKKAFR+A+ER+CP+RA GHECGCL L ++LIM+QCVARLDVA
Sbjct  572   RSPSSVNQEQGDFSLELWKKAFREAHERLCPLRASGHECGCLPLPARLIMEQCVARLDVA  631

Query  2613  MFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGI  2792
             MFNAILR+S ++ PTDP+SDPI++  VLPIP    SF +GA LKN+IGNWSRWL DLFGI
Sbjct  632   MFNAILRDSDENFPTDPLSDPIADSRVLPIPCSITSFGSGALLKNSIGNWSRWLTDLFGI  691

Query  2793  ddddedddlveddeNKADNSNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVRK  2969
                                 +  E  +    S K F LL A+SDLMMLPKDMLL+  VRK
Sbjct  692   -------------------DDDEENSSYVGTSFKTFILLKALSDLMMLPKDMLLNTRVRK  732

Query  2970  EVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIV  3149
             EVCP FG  LI RVLN F+PDEFCPDP+P  VLEAL SE     E+  + ++PC+A P V
Sbjct  733   EVCPMFGAPLIKRVLNHFVPDEFCPDPVPVAVLEALESE--EGEEKAMITSYPCTAPPPV  790

Query  3150  YAPPSAAAldgilgdisssssqlt-rsrssVLKKSYTsddeldeldsPLNLIKMENSEVT  3326
             Y+PPS  ++  I+GD     +    R RSSV +K+YTSDDELDEL SPL ++ ++  +  
Sbjct  791   YSPPSGTSISTIIGDFGQPQAPKLCRIRSSVTRKAYTSDDELDELSSPLAVV-LQQPDSN  849

Query  3327  KPgggsgngngngVRYQLLREVW  3395
             K    +       VRYQLLRE W
Sbjct  850   K---VNNGCADETVRYQLLRECW  869


 Score =   187 bits (476),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 137/206 (67%), Gaps = 21/206 (10%)
 Frame = +3

Query  165  MVLGPSGKTR-----GVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGST  329
            MVLG S K R        S+Q +YLI+I +IKPWPPSQSL++L++VVIQWE+G++NSG+T
Sbjct  1    MVLGLSSKNRRGSSSSSSSIQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGERNSGTT  60

Query  330  TQVAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGD---TFQKNCIEFNLYEPR  500
              VAP L   S +G G+IEFN SF++P+TLL++ S+ + N      F KN +E NLYE R
Sbjct  61   DAVAPSL--GSVIGEGKIEFNHSFKLPLTLLKDASASARNKGCDVVFFKNVLELNLYEAR  118

Query  501  RDTTVKGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMK  680
            R+ T   QLL TA +D A YG+VKE L+++ P+N KRSYRNT QP+L L IQ +      
Sbjct  119  REKT--HQLLATATVDLAEYGIVKESLSLTAPMNSKRSYRNTTQPVLHLSIQPIRAASSS  176

Query  681  SLVRNNVRRESSMDSSAGESVSALMN  758
            S       R  S D   GESVSALMN
Sbjct  177  S-------RNGSKD--GGESVSALMN  193



>ref|XP_007162261.1| hypothetical protein PHAVU_001G137700g [Phaseolus vulgaris]
 gb|ESW34255.1| hypothetical protein PHAVU_001G137700g [Phaseolus vulgaris]
Length=811

 Score =   490 bits (1261),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 278/543 (51%), Positives = 362/543 (67%), Gaps = 23/543 (4%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
             V +E K +E+E +I+ LE ELRE AA+E+ L+S+V EHGSS +KVH PARRLSRLY HAC
Sbjct  278   VAVELKIEEMESRIEKLEEELREVAALEVSLYSIVPEHGSSGHKVHTPARRLSRLYIHAC  337

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K  +  RR + A++ VSGLILVAK+CGNDV RLTFWLSN V+LR  I + F    Q  L 
Sbjct  338   KHWTQKRRATIAKNTVSGLILVAKSCGNDVSRLTFWLSNTVVLREIISQTFGNSCQASLL  397

Query  2160  SEY--SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
                  S  A   N+ K   LK +S  + K  G+ L    EDW+    FT ALE+VE+WIF
Sbjct  398   KRLAESNGAGKGNDGKYIALKRKSSSNGKP-GSGLMPLVEDWQETGTFTFALERVESWIF  456

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYE  2513
             SRI+ES+WWQ  TP+MQS    S +    K+        ++   NFS+ +W+ AF+DA++
Sbjct  457   SRIVESVWWQALTPYMQSSVGDSSNKPTGKLMGPALGDHNQG--NFSINIWRNAFQDAFQ  514

Query  2514  RICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEV  2693
             R+CPVRAGGH CGCL +L++++M+QC+ARLD+AMFNAILRESA +IPTDP+SDPI + +V
Sbjct  515   RLCPVRAGGHGCGCLPVLARMVMEQCIARLDIAMFNAILRESALEIPTDPISDPIVDSKV  574

Query  2694  LPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKA  2873
             LPIPAG  SF +GAQLKN++GNW+RWL D+FG+D +D   +         +NS   E++ 
Sbjct  575   LPIPAGDLSFGSGAQLKNSVGNWARWLTDMFGMDVEDCLQEDQ-------ENSENDEKQG  627

Query  2874  QDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
              +   K F LLN +SDL+MLPKDML+ R +R+EVCP+  LSL+ RVL  F PDEFCPD +
Sbjct  628   GNGEPKSFVLLNDLSDLLMLPKDMLIDRKIRQEVCPSISLSLVIRVLCNFTPDEFCPDFV  687

Query  3054  PNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
             P  VLEALN+E  +E  +  E V +FP  AAP+VY PPS +A        +   S L R+
Sbjct  688   PGTVLEALNAETIIERRLSSEPVRSFPYVAAPVVYMPPS-SANVAEKVAEAGGKSHLGRN  746

Query  3228  rssVLKKSYTsddeldeldsPLNLI--KMENS-EVTKPgggsgngn----gngVRYQLLR  3386
              S+V +  YTSD+ELDELDSPL  I  K+ +S  VT  G G+            RYQLLR
Sbjct  747   VSAVQRIGYTSDEELDELDSPLTSIIDKLPSSPSVTHTGKGNHKEQGDHPTTNARYQLLR  806

Query  3387  EVW  3395
             EVW
Sbjct  807   EVW  809



>emb|CDX74320.1| BnaA03g27270D [Brassica napus]
Length=874

 Score =   492 bits (1266),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 296/564 (52%), Positives = 376/564 (67%), Gaps = 44/564 (8%)
 Frame = +3

Query  1731  RNSIEGITSN-DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVV  1907
             R+S+E   SN + K+ KV  +  SN  LE K ++LE +++ LEGEL EAAA+E  L+SVV
Sbjct  342   RSSLEISRSNSERKEAKVFPR--SNTTLESKVKDLESRVKKLEGELCEAAAIEAALYSVV  399

Query  1908  AEHGSSTNKVHAPARRLSRLYFHACK-ENSVL--RRLSAARSVVSGLILVAKACGNDVPR  2078
             AEH SS+ KVHAPARRL RLY HAC+ +N +L  RR +AA+S VSGL+ VAKACGNDVPR
Sbjct  400   AEHASSSAKVHAPARRLLRLYLHACRGDNHLLSTRRANAAKSAVSGLVTVAKACGNDVPR  459

Query  2079  LTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQ--SFPHKKSVGN  2252
             LT+WLSN ++LRA I   +  ++LP+S+           + +S L W+  S   K + G 
Sbjct  460   LTYWLSNTIILRAIISD-NHSEELPVSAGPGPKTSKTQRQGSSSLTWKDSSLSKKNTTGG  518

Query  2253  DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKI-Y  2429
                     W++P  F  ALEKVEAWIFSR++ESIWWQT TP MQS AA    +   K  +
Sbjct  519   --------WDDPGTFITALEKVEAWIFSRVVESIWWQTLTPRMQSSAANGSSAASKKNNF  570

Query  2430  QRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDV  2609
              R+ SS ++E  +FSLELWKKAFRDA+ER+CP+RA GHECGCL L ++LIM+QCVARLDV
Sbjct  571   GRSPSSVNQEQGDFSLELWKKAFRDAHERLCPLRASGHECGCLPLPARLIMEQCVARLDV  630

Query  2610  AMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFG  2789
             AMFNAILR+S ++ PTDP+SDPI++  VLPIP    SF +GA LKN+IGNWSRWL DLFG
Sbjct  631   AMFNAILRDSDENFPTDPLSDPIADSRVLPIPCSVTSFGSGALLKNSIGNWSRWLTDLFG  690

Query  2790  IddddedddlveddeNKADNSNGHERKAQDACS-KPFYLLNAMSDLMMLPKDMLLSRTVR  2966
             I                    +  E  +    S K F LL A+SDLMMLPKDMLL+  VR
Sbjct  691   I-------------------DDDEENSSYVGTSFKTFILLKALSDLMMLPKDMLLNTCVR  731

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPI  3146
             KEVCP FG  LI RVLN F+PDEFCPDP+P  VLEAL SE     E+  + ++PC+A   
Sbjct  732   KEVCPMFGAPLIKRVLNHFVPDEFCPDPVPVAVLEALESE--EGEEKAMITSYPCTAPLP  789

Query  3147  VYAPPSAAAldgilgdisssssqlt-rsrssVLKKSYTsddeldeldsPLNLIKMENSEV  3323
             VY+PPS  ++  I+GD     +    R RSSV +K+YTSDDELDEL SPL ++ ++ ++ 
Sbjct  790   VYSPPSGTSISTIIGDFGQPQAPKLCRIRSSVTRKAYTSDDELDELSSPLAVVLLQQADS  849

Query  3324  TKPgggsgngngngVRYQLLREVW  3395
              K    +       VRYQLLRE W
Sbjct  850   NK---VNNGCADETVRYQLLRECW  870


 Score =   184 bits (466),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 129/187 (69%), Gaps = 16/187 (9%)
 Frame = +3

Query  207  VQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRIE  386
            +Q +YLI+I +IKPWPPSQSL++L++VVIQWE+G++NSG+T  VAP L   S +G G+IE
Sbjct  19   IQVDYLIHIHDIKPWPPSQSLRSLRSVVIQWENGERNSGTTDAVAPSL--GSVIGEGKIE  76

Query  387  FNESFRVPITLLREISSKSVNGD---TFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFAN  557
            FN SF++P+TLL++ S+ + N      F KN +E NLYE RR+ T   QLL TA +D A 
Sbjct  77   FNHSFKLPLTLLKDASASARNKGCDVVFFKNVLELNLYEARREKT--HQLLATATVDLAE  134

Query  558  YGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDSSAGE  737
            YG+VKE L+++ P+N KRSYRNT QP+L L IQ +      S       R  S D   GE
Sbjct  135  YGIVKESLSLTAPMNSKRSYRNTTQPVLHLSIQPIRAASSSS-------RNGSKD--GGE  185

Query  738  SVSALMN  758
            SVSALMN
Sbjct  186  SVSALMN  192



>ref|XP_002322696.2| hypothetical protein POPTR_0016s05200g [Populus trichocarpa]
 gb|EEF04457.2| hypothetical protein POPTR_0016s05200g [Populus trichocarpa]
Length=710

 Score =   486 bits (1251),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 279/551 (51%), Positives = 364/551 (66%), Gaps = 36/551 (7%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             L ++ +++E +I  LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK 
Sbjct  172   LNQRIEDMEMRIGKLEAELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKH  231

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPR-----LTFWLSNCVLLRAAICKF--SEKQQ  2147
              ++++R + AR+ VSGL+L++K+CGNDVPR     LTFWLSN ++LR  I +   S +  
Sbjct  232   WTLVKRATVARNTVSGLVLISKSCGNDVPRQVNITLTFWLSNTIVLREIISQAFGSSRHS  291

Query  2148  LPLSSEYSKNA-VVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEA  2324
              PL+     N    K+E K + LKW+     K V N      +DW+    FT ALE+VE+
Sbjct  292   SPLARLAESNGGSKKSEGKPTALKWKGGSGSKQV-NGFMQFADDWQETGTFTAALERVES  350

Query  2325  WIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAF  2498
             WIFSR++ES+WWQ  TPHMQS      D   NK   R        ++  +FS+ LWK AF
Sbjct  351   WIFSRVVESVWWQALTPHMQSPTG---DLSSNKTTGRLHGPALGDQQQGSFSINLWKNAF  407

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA +R+CPVRAGGHECGCL ++++++M+QCVARLDVAMFNAILRESA +IPTDPVSDPI
Sbjct  408   QDALQRLCPVRAGGHECGCLPIIARMVMEQCVARLDVAMFNAILRESAHEIPTDPVSDPI  467

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              + +VLPIPAG  SF +GAQLKN++GNWSR L D+FGI+ DD           K D    
Sbjct  468   LDSKVLPIPAGDLSFGSGAQLKNSVGNWSRRLTDMFGINADDCL---------KEDQHGS  518

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
              +   QD  +KPF LLN +SDL+MLPKDML+ R++RKEVCP+ GL L+ R+L  F PDEF
Sbjct  519   EDDDKQDGEAKPFLLLNDLSDLLMLPKDMLMDRSIRKEVCPSIGLPLVKRILCNFTPDEF  578

Query  3039  CPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssss  3212
             CPDP+P  VLEALNSE  +E  +  ++  NFP +AAP+VY PPS+A         + + S
Sbjct  579   CPDPVPGAVLEALNSEGTVEWRLLGDAARNFPYTAAPVVYTPPSSA-HVAEKVSEAGTES  637

Query  3213  qltrsrssVLKKSYTsddeldeldsPLN----------LIKMENSEVTKPgggsgngngn  3362
             QL+R+ S+V +K YTSD+EL+ELDSPL            I M N         +   +  
Sbjct  638   QLSRNVSAVQRKGYTSDEELEELDSPLTSIIERLPSSPAIIMANGNGKHKEYATAGDSMA  697

Query  3363  gVRYQLLREVW  3395
               RY+LLREVW
Sbjct  698   NARYELLREVW  708



>emb|CDP10087.1| unnamed protein product [Coffea canephora]
Length=794

 Score =   489 bits (1258),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 273/545 (50%), Positives = 359/545 (66%), Gaps = 38/545 (7%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             ++K Q++E +I+ LE ELRE AA+E+ L+SVV EHGSS +KVH PARRL RLY HACK  
Sbjct  274   DQKIQDMETRIEKLEEELREVAALEVALYSVVPEHGSSAHKVHTPARRLCRLYIHACKHW  333

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPLSSE  2165
             S  +R + +R+ VSGL+L+AK+CG+DV RLTFWLSN V+LR  I +   S  Q  P++  
Sbjct  334   SPAKRATVSRNTVSGLVLIAKSCGHDVSRLTFWLSNTVVLREIISQTFGSACQSSPVAKA  393

Query  2166  YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPG------TFEDWENPLGFTKALEKVEAW  2327
             +  N     E K S LKW+S     ++G+ LP         +DW+    FT ALEKVE+W
Sbjct  394   FESNGGKIGEAKFSSLKWKS-----NLGSKLPNKQSFMQVVDDWQETRTFTAALEKVESW  448

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSS--CSEEPENFSLELWKKAFR  2501
             +FSRI+ESIWWQT TP+MQS    + D   NK+  R        ++  +FS+ LWK AF+
Sbjct  449   MFSRIVESIWWQTLTPNMQS---PNDDHTKNKVLGRILGPPLGDQQQGSFSINLWKNAFQ  505

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++ +M+QC+ARLDVAMFNAILRES  +IPTDPVSDPI 
Sbjct  506   DAFGRLCPVRAGGHECGCLPVLARKVMEQCLARLDVAMFNAILRESEHEIPTDPVSDPIV  565

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +  VLPIPAG  SF +GAQLKN+IGNW+RWL DLFG+   D             D+ N  
Sbjct  566   DCRVLPIPAGDLSFGSGAQLKNSIGNWTRWLTDLFGMGAGDLIK----------DDQNIC  615

Query  2862  ERKAQDACSKP--FYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
             E   Q    +P  FYLL+A+SDL+MLPKDML+ RT+R EVCP   L L+ R+L  F PDE
Sbjct  616   EDDGQGGADEPKCFYLLSALSDLLMLPKDMLMDRTIRMEVCPQISLPLVKRILCNFTPDE  675

Query  3036  FCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdissss  3209
             FCPD +P  VLEALN+E  +E     ++   FP  AA +VY PPS ++        + S 
Sbjct  676   FCPDSVPGAVLEALNAECIIERRFSGDAASTFPYPAASVVYTPPS-SSDVAEKVAEAGSK  734

Query  3210  sqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLRE  3389
             SQL+R+ S++  K YTSD++L ELDSPL +I ++N +         +  G   RY+LLRE
Sbjct  735   SQLSRNASTIQSKGYTSDEDLVELDSPLAII-VDNQK----NEQDTSHVGVNARYELLRE  789

Query  3390  VWMSS  3404
             VW ++
Sbjct  790   VWQAT  794



>ref|XP_002462561.1| hypothetical protein SORBIDRAFT_02g028255 [Sorghum bicolor]
 gb|EER99082.1| hypothetical protein SORBIDRAFT_02g028255 [Sorghum bicolor]
Length=791

 Score =   488 bits (1257),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 362/561 (65%), Gaps = 25/561 (4%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T ++  DT+    +  N V     +EL  KI+ LE ELRE AA+EI L+SVV EHG S++
Sbjct  239   TDDEIADTEENIADNGNSVSYENNEELYTKIEKLEQELREVAALEISLYSVVPEHGCSSH  298

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             K+H PARRLSR+Y HA K  S  ++ S AR+ +SGL+LVAK+CGNDV RLTFWLSN V+L
Sbjct  299   KLHTPARRLSRMYIHASKFWSSDKKASVARNSISGLVLVAKSCGNDVSRLTFWLSNTVVL  358

Query  2112  RAAICKF--SEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWEN  2285
             R  I +   + +   P+    +     K +R  +P +W+S  + K    ++    +DW  
Sbjct  359   REIIAQTFGTSRHSSPVRGFSTNGNAKKPDRSFAPTRWKSNYNGKYAKPNIMQLPDDWRE  418

Query  2286  PLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPE  2465
                   ALEK+E+WIFSRI+ES+WWQ  TPHMQ+        +I K+     S   ++  
Sbjct  419   TSTLLDALEKIESWIFSRIVESVWWQAMTPHMQAPVEDLSTPKIGKLLGH--SLGDQQHG  476

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESAD  2645
             NFS++LWK AF DA+ RICP+RAGGHECGCL +L+KL+M+ C+ARLD+AMFNAILRES +
Sbjct  477   NFSIDLWKTAFHDAFSRICPLRAGGHECGCLPVLAKLVMEHCIARLDIAMFNAILRESEN  536

Query  2646  DIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlve  2825
             +IPTDP+SDPI +  VLPIPAG  SF +GAQLKN++GNWSRWL D FG+D  +   D  +
Sbjct  537   EIPTDPISDPIVDSRVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDTFGMDAAESGKDGQD  596

Query  2826  ddeNKADNSNGHERK--AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSL  2999
                     SNG +R+  A+  C   F LLN +SDL+MLPKDMLL +T+RKEVCP+ GL L
Sbjct  597   V------ESNGDDRRDAAESTC---FKLLNELSDLLMLPKDMLLEKTIRKEVCPSIGLPL  647

Query  3000  ITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAA  3173
             +TR+L  F PDEFCPDP+P +VLE LNSE  +E   E++ +  FP +AAP+VY+PP+   
Sbjct  648   VTRILCNFTPDEFCPDPVPGMVLEQLNSESLLERFTEKDMISTFPVTAAPVVYSPPTLED  707

Query  3174  ldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP-------  3332
             +   + D +  + +L R  S V ++ YTSDD+LD+L+ PL  +  + S    P       
Sbjct  708   VAEKVADTACGNPELDRRGSMVQRRGYTSDDDLDDLEFPLASL-YDKSNPPSPCNNGVAH  766

Query  3333  gggsgngngngVRYQLLREVW  3395
                    +    R++LLREVW
Sbjct  767   FSTRQGASIENARHELLREVW  787



>ref|XP_004495366.1| PREDICTED: uncharacterized protein LOC101504250 isoform X1 [Cicer 
arietinum]
 ref|XP_004495367.1| PREDICTED: uncharacterized protein LOC101504250 isoform X2 [Cicer 
arietinum]
 ref|XP_004495368.1| PREDICTED: uncharacterized protein LOC101504250 isoform X3 [Cicer 
arietinum]
Length=995

 Score =   494 bits (1272),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 280/543 (52%), Positives = 357/543 (66%), Gaps = 64/543 (12%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL+ +++ L  ELREAAA+E  ++SV+AEHGSS NKVHAPARRLSR YFHA +  S  + 
Sbjct  501   ELKAEVERLREELREAAALEASMYSVIAEHGSS-NKVHAPARRLSRFYFHAHRVGSPAKI  559

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              SAA+S +SG +LV+K CGNDVPRLTFW SN + LRA + K  E      S  +     +
Sbjct  560   ASAAQSTISGFVLVSKVCGNDVPRLTFWFSNLIFLRAILSKGVE------SIHFGDGPCI  613

Query  2187  KNERKASPLKWQSFPHKKSVGND----------LPGTFEDWENPLGFTKALEKVEAWIFS  2336
              NE                 GND                 W +P  F  ALEKVEAWIFS
Sbjct  614   NNE---------------CYGNDDTLHEEEKENTEECLRSWLDPETFLVALEKVEAWIFS  658

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYER  2516
             RI+ES+WWQT TP+MQS AA S  S   K Y +  +   ++  NFS++LWK+AF+DA ER
Sbjct  659   RIVESVWWQTLTPYMQSSAAKS--STSRKTYGKRYTIGDQDQGNFSIDLWKRAFKDACER  716

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             +CP+RAGG ECGCL ++S+++M+Q V RLDVAMFNAILRESAD++PTDP+SDPIS+ +VL
Sbjct  717   LCPLRAGGLECGCLPVISRMVMEQLVNRLDVAMFNAILRESADEMPTDPISDPISDSKVL  776

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PI AGK+ F AGAQLKNA+G+WSRWL+DLFGI                 D+ + HE K +
Sbjct  777   PIAAGKSGFGAGAQLKNAVGDWSRWLSDLFGI-----------------DDCDSHEDKNE  819

Query  2877  DACS------KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
             +  S      KPF LLNA+SDLMMLP DML   ++RKEVCP FG+SLI +V+  F+PDEF
Sbjct  820   NDDSKYESSFKPFLLLNALSDLMMLPFDMLADVSMRKEVCPRFGISLIKQVVYNFVPDEF  879

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
              P P+P+ VLEALN+ED ++ +E S+ +FPCSA    YAPP A++   ++G +    +  
Sbjct  880   SPGPVPDAVLEALNNED-IQDDEGSITSFPCSAGSTSYAPPPASS---VVGMLQEVGTPS  935

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
              RS S VLKK YTSDDELDELDSPL+ + M++    K       G    VRY+LLREVW 
Sbjct  936   LRSGSFVLKKLYTSDDELDELDSPLSALGMDD---PKKKFAVVKGGRKVVRYELLREVWK  992

Query  3399  SSE  3407
             SSE
Sbjct  993   SSE  995


 Score =   163 bits (412),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 115/166 (69%), Gaps = 15/166 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPS--VQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQV  338
            MVLG   K+R   S  +Q  Y I++ EIKPWPPSQSL+++++V++ WE+GD+ SGS    
Sbjct  1    MVLGIRTKSRKSVSNSIQVNYNIHVKEIKPWPPSQSLRSVQSVLLNWENGDRVSGSLA--  58

Query  339  APMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVK  518
                   S VGNG+IEFNE FR+ + + RE S K  N ++F+KN +EF+LY    D TVK
Sbjct  59   -------SNVGNGKIEFNEPFRLSVFMCREASKKGKNHESFKKNYLEFHLY----DRTVK  107

Query  519  GQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
             QLLG+AVI+FA +G++KE   +SV +NCK+S+RN+ QP L + IQ
Sbjct  108  SQLLGSAVINFAEFGIIKEAKAISVQLNCKKSFRNSAQPFLYVNIQ  153



>ref|XP_006421474.1| hypothetical protein CICLE_v10004356mg [Citrus clementina]
 ref|XP_006421475.1| hypothetical protein CICLE_v10004356mg [Citrus clementina]
 ref|XP_006421476.1| hypothetical protein CICLE_v10004356mg [Citrus clementina]
 gb|ESR34714.1| hypothetical protein CICLE_v10004356mg [Citrus clementina]
 gb|ESR34715.1| hypothetical protein CICLE_v10004356mg [Citrus clementina]
 gb|ESR34716.1| hypothetical protein CICLE_v10004356mg [Citrus clementina]
Length=788

 Score =   488 bits (1256),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 281/582 (48%), Positives = 374/582 (64%), Gaps = 37/582 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +  N  + + S N+  DT+   +      L +K +E+E +I+ LE ELR+ AA+EI 
Sbjct  224   LLDETSNGAQSVASDNETVDTEESGEHIDEANLNQKIEEMELRIEKLEEELRDVAALEIS  283

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH+PARRLSR+Y HACK  +  +R + A++ VSGL+LVAK+CGNDV
Sbjct  284   LYSVVPEHGSSAHKVHSPARRLSRIYIHACKHWTQNKRATIAKNSVSGLVLVAKSCGNDV  343

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKS  2243
              RLTFWLSN ++LR  IC+   +     P++     N   K +E K+  LKW+     K 
Sbjct  344   SRLTFWLSNTIVLREIICQAFGNSHNSTPVTRISESNGFSKKSEGKSQSLKWKGGSGNKQ  403

Query  2244  VGNDLPGTF-EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             +   L   F EDW+    F  AL+KVE+WIFSRI+ES+WWQ  TPHMQS   ++    I 
Sbjct  404   LNGHL--QFDEDWQEMGTFIAALQKVESWIFSRIVESVWWQALTPHMQSPVGSTT-KPIG  460

Query  2421  KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVAR  2600
             K+     +   ++  +FS+ LWK AF+DA +++CPVRAGGHECGCL +L +++M+QCVAR
Sbjct  461   KLL--GPALGDQQQGSFSINLWKNAFQDALQKLCPVRAGGHECGCLPVLGRMVMEQCVAR  518

Query  2601  LDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLAD  2780
             LDVAMFNAILRESA++IPTDPVSDPI + +VLPIPAG  SF +GAQLKN++GNWSRWL D
Sbjct  519   LDVAMFNAILRESANEIPTDPVSDPILDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLTD  578

Query  2781  LFGIddddedddlveddeNKADNSNGHERKAQDACSKP--FYLLNAMSDLMMLPKDMLLS  2954
             +FG+D DD           K D     +   QD   +P  F LLN+ SDL+MLPKDML+ 
Sbjct  579   MFGMDTDDSP---------KEDEDFTEDDDGQDGVGEPKSFILLNSFSDLLMLPKDMLMD  629

Query  2955  RTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFP  3128
             R++R+EVCP   LSL+ R+L  F PDEFCPD +P  VLEALN+E  +E  +  +S  +FP
Sbjct  630   RSIRQEVCPLISLSLVKRILCNFTPDEFCPDAVPGAVLEALNAESIIERRLSGDSARSFP  689

Query  3129  CSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL-----  3293
              +AAP+ Y PPS +         +   S L R+ SSV +K YTSDDEL+ELDSPL     
Sbjct  690   YTAAPVEYNPPS-STDVAEKVAEAGGKSHLLRNVSSVQRKGYTSDDELEELDSPLSSIID  748

Query  3294  ------NLIKMENSEVTKPgggsgngngngVRYQLLREVWMS  3401
                   ++I  EN              G+  RY+LLREVW S
Sbjct  749   KLPPSPSIIATENG--NGKHKNHTYYTGSNARYELLREVWSS  788



>ref|XP_007204273.1| hypothetical protein PRUPE_ppa001635mg [Prunus persica]
 gb|EMJ05472.1| hypothetical protein PRUPE_ppa001635mg [Prunus persica]
Length=789

 Score =   487 bits (1254),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 284/546 (52%), Positives = 370/546 (68%), Gaps = 29/546 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LERK +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARR+SRLY HAC
Sbjct  256   TALERKVEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRISRLYIHAC  315

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K  +  +R + A++ VSGL+L+AK+CGNDVPRLTFWLSN V+LR  I + F    Q   S
Sbjct  316   KLWTQDKRATIAKNTVSGLVLIAKSCGNDVPRLTFWLSNTVVLREIISQAFGISHQ---S  372

Query  2160  SEYSKNAVV-----KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEA  2324
             S  +K A +     +NE K+  LKW+     K + N      +DW+    FT ALEKVE+
Sbjct  373   SSLTKFADINGTSKRNEVKSPTLKWKGGSGGKQM-NGFMQFSDDWQETGTFTAALEKVES  431

Query  2325  WIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPE-NFSLELWKKAFR  2501
             WIFSRI+ES+WWQ  TP+MQS A  S  S  N I +    +  ++ + +FS+ LWK AF+
Sbjct  432   WIFSRIVESVWWQALTPNMQSPAEYS--SNNNTIVRLLGPALGDQKQGSFSVNLWKNAFQ  489

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA +R+CPVRAGGH+CGCL +L++++M+ CVARLDVAMFNAILRESA +IPTDPVSDPI 
Sbjct  490   DASQRLCPVRAGGHKCGCLPVLARMVMEHCVARLDVAMFNAILRESAHEIPTDPVSDPIV  549

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P VLPIPAG  SF +GAQLKN++GNWSRWL+D+F +D DD   +           S   
Sbjct  550   DPRVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDMFDMDADDSLQEDKP-------GSQDD  602

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             +R++ D  SK F LLNA+SDL+MLPKDML+ R++RKEVCP+  L L+ R+L  F PDEFC
Sbjct  603   DRQSGDGESKSFLLLNALSDLLMLPKDMLIDRSIRKEVCPSISLPLVKRILCNFTPDEFC  662

Query  3042  PDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             PD +P  VLEALN+E  +E  +  ES  +FP +AAP++Y+PPS+A         +   SQ
Sbjct  663   PDAVPGAVLEALNAESIVERRLSGESARSFPYTAAPVMYSPPSSA-DVAEKVSEAGGRSQ  721

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEVT----KPgggsgngngngVRYQ  3377
             L R+ S+V +K YTSD+EL+ELDSPL  I  K+ +S                    VRY+
Sbjct  722   LERNVSAVQRKGYTSDEELEELDSPLTSIIDKLPSSPTIVANGNGKHEHTGHACMNVRYE  781

Query  3378  LLREVW  3395
             LLREVW
Sbjct  782   LLREVW  787



>ref|XP_009418204.1| PREDICTED: uncharacterized protein LOC103998449 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418205.1| PREDICTED: uncharacterized protein LOC103998449 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=710

 Score =   484 bits (1245),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 275/562 (49%), Positives = 356/562 (63%), Gaps = 27/562 (5%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T ++  DT+    +     + +K +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +
Sbjct  160   TDDETVDTEENVLDDDRASVYQKIEEMESRIEKLEEELREVAALEISLYSVVPEHGSSAH  219

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             KVH PARRLSRLY HACK  +  ++ + AR++VSGL+L AK+CGNDV RLTFWLSN V+L
Sbjct  220   KVHTPARRLSRLYIHACKYWTQDKKATVARNIVSGLVLTAKSCGNDVSRLTFWLSNTVVL  279

Query  2112  RAAICKFSEKQQLPLSSEY----SKNAVVKNERKASPLKWQS---FPHKKSVGNDLPGTF  2270
             R  I  F     L  S+      S     K + K +PL+ ++       KS+G       
Sbjct  280   REII--FQTFGNLSNSTNMRAVESNGGARKTDEKHTPLRRKNNSVIRQGKSLG--FMQLL  335

Query  2271  EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC  2450
             +DW++   FT ALEK+E+WIFSRI+ES+WWQT TPHMQS     L +  N          
Sbjct  336   DDWQDTSTFTTALEKIESWIFSRIVESVWWQTLTPHMQS-PLEELYTPKNFGKLLGPVLG  394

Query  2451  SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
              ++  + S+ LW  AF DA+ R+CPVRAGGHECGCL +L++ +M+QCV+RLDVAMFNAIL
Sbjct  395   DQQQGSLSINLWISAFHDAFSRLCPVRAGGHECGCLPVLARKVMEQCVSRLDVAMFNAIL  454

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             RESA +IPTDPVSDPI +P+VLPIPAG  SF +GAQLKN+IGNWSRWL DLFG       
Sbjct  455   RESAHEIPTDPVSDPIVDPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDLFG-------  507

Query  2811  ddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFG  2990
              D  +  ++  D +     K  +A SK F+LLN + DL+MLPKDMLL RTVRKEV P+ G
Sbjct  508   KDAEDSTKDVQDANEEETLKEANAGSKYFHLLNELCDLLMLPKDMLLDRTVRKEVFPSIG  567

Query  2991  LSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIVYAPP  3161
             L LITR+L  F PDEFCPDP+P VVLE LN++  +E    ++E +  FPC+AAP+VY PP
Sbjct  568   LPLITRILCNFTPDEFCPDPVPGVVLEELNTKSILERRVTDKEVIGGFPCAAAPVVYLPP  627

Query  3162  SAAAldgilgdisssssqltrsrssVLKKSYTsdde-ldeldsPLNLIKMENSEVTKPgg  3338
             S A             + L R  S V +K YTSD++     D+PL  I  +   +  P  
Sbjct  628   S-ADDVAEKVGDVGGKAGLERRGSMVQRKGYTSDEDLDVLDDTPLAHIMDKTPPLVSPSP  686

Query  3339  gsgngngngV---RYQLLREVW  3395
               G    +     RY LLREVW
Sbjct  687   VVGGHKDSWTSNSRYNLLREVW  708



>ref|XP_009418203.1| PREDICTED: uncharacterized protein LOC103998449 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=715

 Score =   484 bits (1246),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 275/562 (49%), Positives = 356/562 (63%), Gaps = 27/562 (5%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T ++  DT+    +     + +K +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +
Sbjct  165   TDDETVDTEENVLDDDRASVYQKIEEMESRIEKLEEELREVAALEISLYSVVPEHGSSAH  224

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             KVH PARRLSRLY HACK  +  ++ + AR++VSGL+L AK+CGNDV RLTFWLSN V+L
Sbjct  225   KVHTPARRLSRLYIHACKYWTQDKKATVARNIVSGLVLTAKSCGNDVSRLTFWLSNTVVL  284

Query  2112  RAAICKFSEKQQLPLSSEY----SKNAVVKNERKASPLKWQS---FPHKKSVGNDLPGTF  2270
             R  I  F     L  S+      S     K + K +PL+ ++       KS+G       
Sbjct  285   REII--FQTFGNLSNSTNMRAVESNGGARKTDEKHTPLRRKNNSVIRQGKSLG--FMQLL  340

Query  2271  EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC  2450
             +DW++   FT ALEK+E+WIFSRI+ES+WWQT TPHMQS     L +  N          
Sbjct  341   DDWQDTSTFTTALEKIESWIFSRIVESVWWQTLTPHMQS-PLEELYTPKNFGKLLGPVLG  399

Query  2451  SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
              ++  + S+ LW  AF DA+ R+CPVRAGGHECGCL +L++ +M+QCV+RLDVAMFNAIL
Sbjct  400   DQQQGSLSINLWISAFHDAFSRLCPVRAGGHECGCLPVLARKVMEQCVSRLDVAMFNAIL  459

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             RESA +IPTDPVSDPI +P+VLPIPAG  SF +GAQLKN+IGNWSRWL DLFG       
Sbjct  460   RESAHEIPTDPVSDPIVDPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDLFG-------  512

Query  2811  ddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFG  2990
              D  +  ++  D +     K  +A SK F+LLN + DL+MLPKDMLL RTVRKEV P+ G
Sbjct  513   KDAEDSTKDVQDANEEETLKEANAGSKYFHLLNELCDLLMLPKDMLLDRTVRKEVFPSIG  572

Query  2991  LSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME---VEEESVVNFPCSAAPIVYAPP  3161
             L LITR+L  F PDEFCPDP+P VVLE LN++  +E    ++E +  FPC+AAP+VY PP
Sbjct  573   LPLITRILCNFTPDEFCPDPVPGVVLEELNTKSILERRVTDKEVIGGFPCAAAPVVYLPP  632

Query  3162  SAAAldgilgdisssssqltrsrssVLKKSYTsdde-ldeldsPLNLIKMENSEVTKPgg  3338
             S A             + L R  S V +K YTSD++     D+PL  I  +   +  P  
Sbjct  633   S-ADDVAEKVGDVGGKAGLERRGSMVQRKGYTSDEDLDVLDDTPLAHIMDKTPPLVSPSP  691

Query  3339  gsgngngngV---RYQLLREVW  3395
               G    +     RY LLREVW
Sbjct  692   VVGGHKDSWTSNSRYNLLREVW  713



>emb|CBI29891.3| unnamed protein product [Vitis vinifera]
Length=652

 Score =   482 bits (1240),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 273/546 (50%), Positives = 357/546 (65%), Gaps = 58/546 (11%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
             V L+++ +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HA 
Sbjct  152   VALDQRIEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHAS  211

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             K  +  +R + A++ VSGL+L+AK+CGNDVPRLTFW+SN V+LR  I            S
Sbjct  212   KHWAQHKRATIAKNTVSGLVLIAKSCGNDVPRLTFWMSNTVVLREII------------S  259

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
             +   N++ K       L +  F              +DW+    FT ALEKVE+WIFSRI
Sbjct  260   QAFGNSLNK-------LGFVQF-------------VDDWQETRTFTSALEKVESWIFSRI  299

Query  2343  IESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYER  2516
             +ES+WWQT TPHMQ       DS   K  +R        ++  +FS+ LWK AF+DA++R
Sbjct  300   VESVWWQTLTPHMQPPVK---DSYTKKTIERLLGPALGDQQQGSFSINLWKNAFQDAFQR  356

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             +CPVRAGGHECGCL ++++++M+QCV+RLDVAMFNAILRESA +IPTDP+SDPI + +VL
Sbjct  357   LCPVRAGGHECGCLPVIARMVMEQCVSRLDVAMFNAILRESAHEIPTDPISDPIVDSKVL  416

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PIPAG  SF +GAQLKN++G WSRWL DLFG+D DD   ++           NG + ++Q
Sbjct  417   PIPAGDLSFGSGAQLKNSVGTWSRWLTDLFGMDVDDSLGEVQI---------NGEDGESQ  467

Query  2877  DACSKP--FYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
                 +P  F+LLNA+SDL+MLPKDML+ R++RKEVCP+  L L+ R+L  F PDEFCPDP
Sbjct  468   GGHDEPKSFHLLNALSDLLMLPKDMLMDRSIRKEVCPSISLPLLKRILCNFTPDEFCPDP  527

Query  3051  IPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
             +P  VLEA+N+E  +E  +  +S  +FP  A P++YAPPS+A         +   SQL R
Sbjct  528   VPGAVLEAVNAESIVERRLSGDSASSFPYPATPVLYAPPSSA-DVAEKVAEAGGKSQLAR  586

Query  3225  srssVLKKSYTsddeldeldsPLNLI--KMENSEVT-----KPgggsgngngngVRYQLL  3383
             + S V KK YTSD+EL+ELDSPL  I  KM  S                 NG   RY+LL
Sbjct  587   NASMVQKKGYTSDEELEELDSPLTSIIEKMPPSPSVVRNGNGKHSEETGHNGLNARYELL  646

Query  3384  REVWMS  3401
             REVW S
Sbjct  647   REVWSS  652



>ref|XP_007028895.1| Nucleolar protein gar2-related isoform 2 [Theobroma cacao]
 gb|EOY09397.1| Nucleolar protein gar2-related isoform 2 [Theobroma cacao]
Length=697

 Score =   483 bits (1243),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 272/551 (49%), Positives = 355/551 (64%), Gaps = 37/551 (7%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               L  K +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HAC
Sbjct  162   TALNEKIEEMETRIEKLEAELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHAC  221

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAI-------CKFSEK  2141
             K  +  +R + A++ VSGLIL+AK+CGNDV RLTFWLSN ++LR  I       C  S  
Sbjct  222   KHWTQNKRATIAKNSVSGLILIAKSCGNDVSRLTFWLSNTIVLREIISLAFGNSCNSSPL  281

Query  2142  QQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
              +LP S+  +K    ++E K   LKW+     K + N      +DW+    FT ALEKVE
Sbjct  282   TRLPESNGSNK----RSEVKPPTLKWKGGAGSKHI-NGFVQLVDDWQETGTFTSALEKVE  336

Query  2322  AWIFSRIIESIWWQTFTPHMQS-GAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             +WIFSRI+ES+WWQ  TPHMQ+    +S    + K+     +   ++  + S+ LWK AF
Sbjct  337   SWIFSRIVESVWWQALTPHMQALHEGSSASRTVGKLL--GPALGDQQQGSLSINLWKNAF  394

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA++R+CPVRA  HECGCL ++++++M+ C+ARLDVAMFNAILRESA +IPTDPVSDPI
Sbjct  395   QDAFQRLCPVRAEAHECGCLPVIARMVMEHCIARLDVAMFNAILRESAHEIPTDPVSDPI  454

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              + +VLPIPAG  SF +GAQLKN++GNWSRWL D+FG+D DD           K D  N 
Sbjct  455   VDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMFGMDSDDAL---------KEDQPNS  505

Query  2859  HERKAQ--DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPD  3032
              +   Q  D  SK F  LNA+SDL+MLPKDML+ R++R EVCP+ GL L+ R+L  F PD
Sbjct  506   QDDFKQNGDGESKSFLFLNALSDLLMLPKDMLMDRSIRNEVCPSIGLPLVKRILCNFTPD  565

Query  3033  EFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             EFCPDP+P  VLEALN+E  +E  +  +S  +FP +AA +VY  PS +A        +  
Sbjct  566   EFCPDPVPGAVLEALNAESIVERRLSGDSARSFPYTAASVVYTSPS-SADVAEKVAKAGG  624

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLI--------KMENSEVTKPgggsgngngn  3362
              SQL+R+ S V +K YTSD+EL+ELDSPL  I         M  +               
Sbjct  625   KSQLSRNASVVQRKGYTSDEELEELDSPLASIIDKLPLSPTMVGNGRVNGKHEHEGCGAA  684

Query  3363  gVRYQLLREVW  3395
               RY+LLREVW
Sbjct  685   NARYELLREVW  695



>ref|XP_007028894.1| Nucleolar protein gar2-related isoform 1 [Theobroma cacao]
 gb|EOY09396.1| Nucleolar protein gar2-related isoform 1 [Theobroma cacao]
Length=808

 Score =   486 bits (1252),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 271/550 (49%), Positives = 355/550 (65%), Gaps = 36/550 (7%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               L  K +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HAC
Sbjct  274   TALNEKIEEMETRIEKLEAELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHAC  333

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAI-------CKFSEK  2141
             K  +  +R + A++ VSGLIL+AK+CGNDV RLTFWLSN ++LR  I       C  S  
Sbjct  334   KHWTQNKRATIAKNSVSGLILIAKSCGNDVSRLTFWLSNTIVLREIISLAFGNSCNSSPL  393

Query  2142  QQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
              +LP S+  +K    ++E K   LKW+     K + N      +DW+    FT ALEKVE
Sbjct  394   TRLPESNGSNK----RSEVKPPTLKWKGGAGSKHI-NGFVQLVDDWQETGTFTSALEKVE  448

Query  2322  AWIFSRIIESIWWQTFTPHMQS-GAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             +WIFSRI+ES+WWQ  TPHMQ+    +S    + K+     +   ++  + S+ LWK AF
Sbjct  449   SWIFSRIVESVWWQALTPHMQALHEGSSASRTVGKLL--GPALGDQQQGSLSINLWKNAF  506

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA++R+CPVRA  HECGCL ++++++M+ C+ARLDVAMFNAILRESA +IPTDPVSDPI
Sbjct  507   QDAFQRLCPVRAEAHECGCLPVIARMVMEHCIARLDVAMFNAILRESAHEIPTDPVSDPI  566

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              + +VLPIPAG  SF +GAQLKN++GNWSRWL D+FG+D DD           K D  N 
Sbjct  567   VDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMFGMDSDDAL---------KEDQPNS  617

Query  2859  HERKAQ--DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPD  3032
              +   Q  D  SK F  LNA+SDL+MLPKDML+ R++R EVCP+ GL L+ R+L  F PD
Sbjct  618   QDDFKQNGDGESKSFLFLNALSDLLMLPKDMLMDRSIRNEVCPSIGLPLVKRILCNFTPD  677

Query  3033  EFCPDPIPNVVLEALNSEDH-MEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdissss  3209
             EFCPDP+P  VLEALN+E+  + +  +S  +FP +AA +VY  PS +A        +   
Sbjct  678   EFCPDPVPGAVLEALNAEELILPLTGDSARSFPYTAASVVYTSPS-SADVAEKVAKAGGK  736

Query  3210  sqltrsrssVLKKSYTsddeldeldsPLNLI--------KMENSEVTKPgggsgngngng  3365
             SQL+R+ S V +K YTSD+EL+ELDSPL  I         M  +                
Sbjct  737   SQLSRNASVVQRKGYTSDEELEELDSPLASIIDKLPLSPTMVGNGRVNGKHEHEGCGAAN  796

Query  3366  VRYQLLREVW  3395
              RY+LLREVW
Sbjct  797   ARYELLREVW  806



>gb|ABA96901.1| expressed protein [Oryza sativa Japonica Group]
Length=906

 Score =   487 bits (1254),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 268/513 (52%), Positives = 345/513 (67%), Gaps = 29/513 (6%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA EIGL+SV+AEHGSS+NKVH PARRLSR + HA K  S  +  SAARS  SGL+L
Sbjct  415   RETAAAEIGLYSVIAEHGSSSNKVHTPARRLSRHFIHALKNWSRDKMGSAARSASSGLVL  474

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQS  2225
             VAKACG DV RL+FWLSNCV+LRA + + S++     +S    N      R+ S   W+S
Sbjct  475   VAKACGYDVARLSFWLSNCVVLRAIVSETSKQS----NSNAINNGSKTGPRRNSASMWES  530

Query  2226  FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-  2402
                KK  G  L   F++WE+   F  AL+K+E+WIFSRI+ESIWWQ FTPHMQS   +S 
Sbjct  531   LNRKK--GKLLSPEFDNWEDVDTFIAALKKIESWIFSRIVESIWWQAFTPHMQSANISSE  588

Query  2403  --LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKL  2576
                 S   K Y R +   +++    S+++WKKAF++A E++CPVRA GHECGCL LL+KL
Sbjct  589   PMPSSNAKKCYGRITVVGNQQQATLSIDIWKKAFKEASEKLCPVRAAGHECGCLPLLAKL  648

Query  2577  IMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIG  2756
             +M+QC+ARLDVAMFNAILRES D+IPTDP+SDPI++P+VLP+P+GK SF AG QLKNAIG
Sbjct  649   VMEQCIARLDVAMFNAILRESDDEIPTDPMSDPITDPKVLPVPSGKFSFGAGVQLKNAIG  708

Query  2757  NWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLP  2936
             +WSR L+D FG+      D     +    D  NG          KPFYLLNA+SDL+M+P
Sbjct  709   SWSRCLSDSFGM------DMDDYPEVESGDGDNGAAE-----LRKPFYLLNALSDLLMIP  757

Query  2937  KDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESV  3116
             KD+L+  + RKE+CPTF  S+I R+L+ F+PD+FCPDP+ + +LEAL SEDH+E   + +
Sbjct  758   KDVLMETSTRKELCPTFSSSIIKRILDGFVPDDFCPDPVQHSLLEALESEDHLEGNTKGI  817

Query  3117  VNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLN  3296
                PCSA+PI+Y  P++ A       I S      +S S++L+KS TSDDELDEL SPL 
Sbjct  818   RAVPCSASPILYPYPASGA-------ILSMIGDPRKSGSAILRKSNTSDDELDELSSPLT  870

Query  3297  LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
              I   +S           GN N  RY+LL EVW
Sbjct  871   FISKASSNPL--AKLKQIGNPNSARYRLLHEVW  901


 Score =   159 bits (401),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 6/194 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KTR   S   ++ I I EI PWPPS+SLK+LK+VV+ WE+G++NSG T  VAP
Sbjct  1    MVLGLRTKTRKDASFHVDFNIFIQEISPWPPSESLKSLKSVVLFWENGERNSGKTNAVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG   G++EFNE   +     +E SSKS     +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SI--GSGTTVGKVEFNEFINLQAVFQKEGSSKS---GKWQKNLLELNLYEPRRD-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LGTA +D A + +  E  +V VP+N KRS RN VQP++ L+IQ +         R+ + 
Sbjct  115  HLGTATLDLAEHAMFHEDTSVPVPLNSKRSLRNNVQPMVYLRIQPLDGDNSSVSSRDALS  174

Query  705  RESSMDSSAGESVS  746
            +E+S+D  + E +S
Sbjct  175  KEASVDRDSKELMS  188



>ref|XP_004960725.1| PREDICTED: uncharacterized protein LOC101785743 isoform X1 [Setaria 
italica]
 ref|XP_004960726.1| PREDICTED: uncharacterized protein LOC101785743 isoform X2 [Setaria 
italica]
Length=914

 Score =   487 bits (1254),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 267/518 (52%), Positives = 347/518 (67%), Gaps = 36/518 (7%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA EIGL+S++AEHGSS NKVH PARRLSR + HA K  S  +  SAARS  SGL+L
Sbjct  420   REVAAAEIGLYSIIAEHGSSVNKVHTPARRLSRHFVHALKNFSRDKMGSAARSATSGLVL  479

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPL----SSEYSKNAVVKNERKASPL  2213
             VAK+CG D+ RL+FWLSNCV+LR  + + S KQ   +    S+ YS        RK S  
Sbjct  480   VAKSCGYDIARLSFWLSNCVVLRGIVTETS-KQSGTINGINSASYSSKPAY---RKNSAS  535

Query  2214  KWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGA  2393
              W+S   KK  G  +   F++WE+   F  A++K+E+WIFSRI+E++WWQTFTPHMQS  
Sbjct  536   MWESLNRKK--GKLVSPEFDNWEDVDTFIAAIKKIESWIFSRIVETLWWQTFTPHMQSAY  593

Query  2394  ATS---LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHL  2564
              TS     S   + Y R +    ++    S+++WKKAF++A ER+CPVRA GHECGCL +
Sbjct  594   ITSDLKTSSNAKRSYGRITVVGDQQQATISMDIWKKAFKEASERLCPVRAAGHECGCLPM  653

Query  2565  LSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLK  2744
             L+KL+M+QC+ARLDVAMFNAILRES D+IPTDP+SDPI++P+VLPIP+GK SF AG QLK
Sbjct  654   LAKLVMEQCIARLDVAMFNAILRESDDEIPTDPMSDPITDPKVLPIPSGKFSFGAGVQLK  713

Query  2745  NAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDL  2924
             NAIG+WSR L DLFG+      D     +   AD  NG          KPFYLLNA+SDL
Sbjct  714   NAIGSWSRSLTDLFGM------DMDDYPEVENADGENGFAE-----SRKPFYLLNALSDL  762

Query  2925  MMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE  3104
             +MLPKD+L+  + RKE+CPTF  S+I  +L  F+PDEFCPDPI N +LEAL  EDH+E  
Sbjct  763   LMLPKDVLMDTSTRKELCPTFSSSIIKNILVGFVPDEFCPDPIQNSLLEALELEDHLEC-  821

Query  3105  EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeld  3284
              + + + PC A+PI+Y+PP++ A       I S      +S S++L+KS TSDDELDEL 
Sbjct  822   NKGIHSIPCGASPILYSPPASGA-------ILSVIGDPRKSGSAILRKSNTSDDELDELS  874

Query  3285  sPLNLIKMENSEVTKPgggsgngngngV-RYQLLREVW  3395
             SPL  I   ++ ++ P       + +   RY+LL EVW
Sbjct  875   SPLTFI---SNTLSNPLAKLKRISNSSTSRYRLLHEVW  909


 Score =   159 bits (403),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 126/198 (64%), Gaps = 6/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KTR   +   ++ I I EI PWPPS+SLK+L++VV+ WE+G++NSG T+ VAP
Sbjct  1    MVLGLRTKTRKDSAFHVDFNILIQEISPWPPSESLKSLRSVVLFWENGERNSGKTSTVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG  +G+IEFNE   +     +E SSKS     +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SI--GSGSASGKIEFNEFISLQAVFQKEGSSKS---GKWQKNLLELNLYEPRRD-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LGTA +D A + +  E  +V VP+N KRS+++  QP++ L+IQ +         R+ + 
Sbjct  115  HLGTATLDLAEHAMFHEDSSVPVPLNSKRSFKSNAQPMVYLRIQPLDGDNSSVSSRDALS  174

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D  + E  SA M+
Sbjct  175  KEASIDKDSKEFASATMS  192



>ref|XP_003590840.1| hypothetical protein MTR_1g075790 [Medicago truncatula]
 gb|AES61091.1| hypothetical protein MTR_1g075790 [Medicago truncatula]
Length=994

 Score =   489 bits (1259),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 301/656 (46%), Positives = 411/656 (63%), Gaps = 55/656 (8%)
 Frame = +3

Query  1482  EGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSV  1661
             E KE + E+ +  +   V++ + +N    +   + +  AG+      T    + +H    
Sbjct  380   EDKEKMDERRKVRKQSTVSNEVLENVLDNNFSDDESTWAGK--FNNDTLLRRKKSHEHPT  437

Query  1662  HTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQ-----  1826
               L  +N     VR+ +F L+   +S + I S +  D + + K  + V ++  C      
Sbjct  438   IIL--TNDKAEDVRNEKFPLQTTESSGQFIRSQNL-DREEKIKTLNGVHVDAACHKDVNV  494

Query  1827  ---------ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHA  1979
                      EL+ +++ L  EL+EAAA+E  ++SV+AEHGSS NKVHAPARRLSR YFHA
Sbjct  495   NGSLLNDNTELKAEVERLREELKEAAALEASMYSVIAEHGSS-NKVHAPARRLSRFYFHA  553

Query  1980  CKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS  2159
              K  S  +  SAA+S+VSG + V+KACGNDVPRLTFW SN +LLRA + K  E + L   
Sbjct  554   RKAGSPDKIASAAQSIVSGFVFVSKACGNDVPRLTFWFSNIILLRAIVSKGVEHKDL---  610

Query  2160  SEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSR  2339
                   A +  ER  + L      H++   N     F +W +P  F  ALEKVEAWIFSR
Sbjct  611   ---GDAACINGERYVNGLTL----HEQEKEN-TEEYFHNWLDPETFLVALEKVEAWIFSR  662

Query  2340  IIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             I+ES+WWQT TP+MQS AA S  S   K   +      ++  NFS++LWK+AF+D+ ER+
Sbjct  663   IVESVWWQTLTPYMQSAAAKS--SSSRKTNGKRYIIGDQDQGNFSIDLWKRAFKDSCERL  720

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+RAGG +CGCL ++S+++M+Q V RLDVAMFNAILRESAD++PTDP+SDPIS+ +VLP
Sbjct  721   CPLRAGGLDCGCLPVISRMVMEQLVNRLDVAMFNAILRESADEMPTDPISDPISDSKVLP  780

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IP+GK+ F AGAQLKNAIG+WSRWL+DLFGI           DD +  +++N ++    +
Sbjct  781   IPSGKSGFGAGAQLKNAIGDWSRWLSDLFGI-----------DDCDSHEDNNENDDSKYE  829

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
                KPF LLNA+SDLMMLP DML  R++RKE+CP FG+SLI +V++ F+PDEF P P+PN
Sbjct  830   PPFKPFPLLNALSDLMMLPFDMLADRSMRKELCPRFGISLIKQVVDNFVPDEFSPGPVPN  889

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssV  3239
              VLEAL +ED +E +E S+ +FPCS    +YAPP  ++       +    +   RS S V
Sbjct  890   AVLEALYNED-VEDDEGSINSFPCSVGSTLYAPPPTSS-------VKEVGTPSLRSGSFV  941

Query  3240  LKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWMSSE  3407
             LKK YTSDDELDELDSPL+ + M++    K       G    VRY+LLREVW SSE
Sbjct  942   LKKLYTSDDELDELDSPLSALGMDD---PKKKFSVVKGGRKVVRYELLREVWKSSE  994


 Score =   167 bits (422),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 131/196 (67%), Gaps = 15/196 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGV--PSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQV  338
            MVLG   K+R     S+Q  Y+I++ EIKPWPPSQSL+++++V++QWE+GDKNSGS    
Sbjct  1    MVLGIRTKSRKTVSDSIQVNYIIHVHEIKPWPPSQSLRSVQSVLLQWENGDKNSGSLA--  58

Query  339  APMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVK  518
                   S VGNG+IEFNE F++ + +LRE S K  N + F+KN +EF+LY    D TVK
Sbjct  59   -------SNVGNGKIEFNEPFKLSVFMLREASKKEKNRENFKKNYLEFHLY----DRTVK  107

Query  519  GQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNN  698
             QLLG+A I+FA++G++KE   +S  +NCK+++R++ QPL+ + IQ        S   +N
Sbjct  108  NQLLGSATINFADFGIIKEVKAISFQLNCKKTFRSSTQPLMYVSIQPFDMECSSSSPSSN  167

Query  699  VRRESSMDSSAGESVS  746
            + +E S++    ESVS
Sbjct  168  LSKELSVEKEERESVS  183



>gb|KCW53021.1| hypothetical protein EUGRSUZ_J02316 [Eucalyptus grandis]
Length=851

 Score =   484 bits (1247),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 257/448 (57%), Positives = 311/448 (69%), Gaps = 33/448 (7%)
 Frame = +3

Query  1761  DWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVH  1940
             D K  KV  K+T   +++ K Q LE KIQMLEGELRE AA+E+ L+SVVAEHG S +K H
Sbjct  392   DIKVDKVYPKDTKRTLMDAKLQRLENKIQMLEGELRETAAIEVALYSVVAEHGGSMSKFH  451

Query  1941  APARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAA  2120
             APARRLSR Y +A  E     R +A RS+V+GL +VA+ACG+DVPRLT+WLSN V+LRA 
Sbjct  452   APARRLSRFYRYAFGELPQASRANAGRSIVAGLFVVARACGSDVPRLTYWLSNSVVLRAI  511

Query  2121  ICKFSEKQQL--PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLG  2294
             I +      +  PLSS+                  +S+P KK  GN    T +D EN   
Sbjct  512   ISQMIPNGNIGVPLSSKSK----------------ESYPRKK--GNKNARTDDDSENVHE  553

Query  2295  FTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEP  2462
                 LEKVEAWIFSRI+ES+WWQ+ TP+MQS AA  L S       K  ++ + +  +E 
Sbjct  554   LISELEKVEAWIFSRIVESLWWQSLTPYMQSSAAKLLGSAKGSSSIKNNRKVTYAEDQEQ  613

Query  2463  ENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESA  2642
              N S++LWKKAF DA ER+CPVR GGHECGCL +L+KL+M+ CVARLDVAMFNAILRESA
Sbjct  614   GNISVDLWKKAFTDACERLCPVRGGGHECGCLPVLAKLLMEHCVARLDVAMFNAILRESA  673

Query  2643  DDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlv  2822
             ++IPTDPVSDPIS+P+VLPIPAG++SF AG QLKNAIGNWSRWL          +   L 
Sbjct  674   NEIPTDPVSDPISDPKVLPIPAGRSSFHAGVQLKNAIGNWSRWLT---------DLFGLD  724

Query  2823  eddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
             +DD +   N    E + +DA  K FYLLNA+SDLMMLPKDMLLSR+ RKEVCPTFG SLI
Sbjct  725   DDDLHGDKNKIVDEDETRDATFKSFYLLNALSDLMMLPKDMLLSRSTRKEVCPTFGASLI  784

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSE  3086
              RVL+ F PDEFCPDP+P  VLEAL SE
Sbjct  785   KRVLDNFSPDEFCPDPVPKAVLEALASE  812


 Score =   218 bits (554),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLGP    R   SVQ +Y+I++ EI PWPPS +L++L++V+IQW++G++ SG+T  V P
Sbjct  1    MVLGPGANARKSASVQLDYIIHVQEIAPWPPSPTLRSLRSVLIQWQNGERTSGATKPVVP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S VG G+IEFNESFR+  TLL+EI  K+ NG  FQKN +EFNLYEPRRD  +KGQ
Sbjct  61   FLG--SNVGEGKIEFNESFRLSATLLKEIKVKAGNGGAFQKNYLEFNLYEPRRDNIMKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVR-NNV  701
            L+GTA+I+ A+YGV+ E LN+S  +NCKR++RN  QP+L +KIQ V KGR  S++R +++
Sbjct  119  LIGTAMINLADYGVIDEPLNISAAMNCKRNFRNMAQPILYVKIQPVDKGRTGSMLRGSSL  178

Query  702  RRESSMDSSAGESV  743
             +E S+ ++  ESV
Sbjct  179  SKEVSLGTNDCESV  192



>ref|XP_008356497.1| PREDICTED: uncharacterized protein LOC103420212 isoform X1 [Malus 
domestica]
Length=697

 Score =   479 bits (1232),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 280/552 (51%), Positives = 368/552 (67%), Gaps = 42/552 (8%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             LERK +E+E +I+ LE ELRE AA+EI L++VV EHGSS +KVH PARR+SRLY HACK 
Sbjct  163   LERKIEEMEIRIEKLEEELREVAALEISLYAVVPEHGSSAHKVHTPARRISRLYIHACKH  222

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY  2168
              +  +R + A++ VSGL+L+AK+CGNDVPRLTFWLSN V+LR  I      Q   +SSE 
Sbjct  223   WTQGKRATIAKNTVSGLVLIAKSCGNDVPRLTFWLSNTVVLREIIS-----QAFGISSES  277

Query  2169  SKNAVV--------KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEA  2324
             S +           KNE K++ LKW+     K + N      +DW+    FT ALEKVE+
Sbjct  278   SPSVKFVXSNGTSKKNEVKSATLKWRGGSSSKQM-NGFMQYADDWQETGTFTAALEKVES  336

Query  2325  WIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAF  2498
             WIFSRI+ES+WWQ  TP+MQS A    +S INK+  R S      ++  +FS+ LWK AF
Sbjct  337   WIFSRIVESVWWQALTPNMQSPAE---NSSINKMSVRFSGPALGDQKQGSFSVNLWKNAF  393

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA +R+CPVRAGGH+CGCL +L++++MQ CVARLDVAMFNAILRESA +IPTDPVSDPI
Sbjct  394   QDASQRLCPVRAGGHKCGCLPVLARMVMQHCVARLDVAMFNAILRESAHEIPTDPVSDPI  453

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              +  VLPIPAG  SF +GAQLKN++GNWSRWL+D+F +D DD           + D+  G
Sbjct  454   LDSRVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDMFDMDADDYL---------QEDHPGG  504

Query  2859  HE--RKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPD  3032
              +  R+  D  S+ F LLNA+SDL+MLPKD+L+   +RKEVCP+  L L+ R+L  F PD
Sbjct  505   EDDDRQIGDGESESFLLLNALSDLLMLPKDLLIDTRIRKEVCPSISLPLVKRILCNFTPD  564

Query  3033  EFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             EFCPD +P  VLEALN+E  +E  +  ES  +FP +AAP+VY PPS+A +   + +   S
Sbjct  565   EFCPDAVPGAVLEALNAESIVERRLSGESARSFPYTAAPVVYTPPSSAXVAEKVSEAGGS  624

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIK---------MENSEVTKPgggsgngng  3359
             S    +  + V +K YTSD+EL+ELDSPL+ I          + N   +     +G+   
Sbjct  625   SQLERKVSA-VQRKGYTSDEELEELDSPLSSIIDKLPSTPTIIANGNGSGKHEHAGHHAC  683

Query  3360  ngVRYQLLREVW  3395
                RY+LLREVW
Sbjct  684   TNARYELLREVW  695



>ref|XP_008356498.1| PREDICTED: uncharacterized protein LOC103420212 isoform X2 [Malus 
domestica]
Length=725

 Score =   479 bits (1232),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 280/554 (51%), Positives = 368/554 (66%), Gaps = 42/554 (8%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LERK +E+E +I+ LE ELRE AA+EI L++VV EHGSS +KVH PARR+SRLY HAC
Sbjct  189   TALERKIEEMEIRIEKLEEELREVAALEISLYAVVPEHGSSAHKVHTPARRISRLYIHAC  248

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             K  +  +R + A++ VSGL+L+AK+CGNDVPRLTFWLSN V+LR  I      Q   +SS
Sbjct  249   KHWTQGKRATIAKNTVSGLVLIAKSCGNDVPRLTFWLSNTVVLREIIS-----QAFGISS  303

Query  2163  EYSKNAVV--------KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             E S +           KNE K++ LKW+     K + N      +DW+    FT ALEKV
Sbjct  304   ESSPSVKFVXSNGTSKKNEVKSATLKWRGGSSSKQM-NGFMQYADDWQETGTFTAALEKV  362

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKK  2492
             E+WIFSRI+ES+WWQ  TP+MQS A    +S INK+  R S      ++  +FS+ LWK 
Sbjct  363   ESWIFSRIVESVWWQALTPNMQSPAE---NSSINKMSVRFSGPALGDQKQGSFSVNLWKN  419

Query  2493  AFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSD  2672
             AF+DA +R+CPVRAGGH+CGCL +L++++MQ CVARLDVAMFNAILRESA +IPTDPVSD
Sbjct  420   AFQDASQRLCPVRAGGHKCGCLPVLARMVMQHCVARLDVAMFNAILRESAHEIPTDPVSD  479

Query  2673  PISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS  2852
             PI +  VLPIPAG  SF +GAQLKN++GNWSRWL+D+F +D DD           + D+ 
Sbjct  480   PILDSRVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDMFDMDADDYL---------QEDHP  530

Query  2853  NGHE--RKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
              G +  R+  D  S+ F LLNA+SDL+MLPKD+L+   +RKEVCP+  L L+ R+L  F 
Sbjct  531   GGEDDDRQIGDGESESFLLLNALSDLLMLPKDLLIDTRIRKEVCPSISLPLVKRILCNFT  590

Query  3027  PDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             PDEFCPD +P  VLEALN+E  +E  +  ES  +FP +AAP+VY PPS+A +   + +  
Sbjct  591   PDEFCPDAVPGAVLEALNAESIVERRLSGESARSFPYTAAPVVYTPPSSAXVAEKVSEAG  650

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsPLNLIK---------MENSEVTKPgggsgng  3353
              SS    +  + V +K YTSD+EL+ELDSPL+ I          + N   +     +G+ 
Sbjct  651   GSSQLERKVSA-VQRKGYTSDEELEELDSPLSSIIDKLPSTPTIIANGNGSGKHEHAGHH  709

Query  3354  ngngVRYQLLREVW  3395
                  RY+LLREVW
Sbjct  710   ACTNARYELLREVW  723



>ref|XP_003574740.1| PREDICTED: uncharacterized protein LOC100845006 [Brachypodium 
distachyon]
Length=710

 Score =   478 bits (1230),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 271/559 (48%), Positives = 363/559 (65%), Gaps = 21/559 (4%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T +D  D + +  +    VL ++ +EL+ K++ LE ELRE AA+E+ L+SV+ EHGSS +
Sbjct  158   TDDDIVDIEEKIIDDEKTVLHQRNEELQSKLEKLEQELREVAALEVSLYSVMPEHGSSAH  217

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             K+H PARRLSRLY HA K   + +  S A++ VSGL+LVAK+C ND  RLTFWLSN V+L
Sbjct  218   KLHTPARRLSRLYIHASKFWPIDKTASVAKNTVSGLVLVAKSCSNDASRLTFWLSNTVVL  277

Query  2112  RAAICK-FS-EKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKSVGNDLPGTFEDWE  2282
             R  I K F   +Q  P     + N   K  + K+ P+   +  + K          +DW+
Sbjct  278   REIIAKSFGISRQSTPTMKTKNINDSAKWFDGKSMPMLQNNNSNGKQTNLAAIQILDDWQ  337

Query  2283  NPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEP  2462
                    ALEK+E+WIFSRI+E++WWQ  TPHMQ+ A  S   +  K+     S   ++ 
Sbjct  338   ETSTLLAALEKIESWIFSRIVETVWWQALTPHMQTRAEGSSTPKAGKVL--GPSLGDQQQ  395

Query  2463  ENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESA  2642
               FS+ LWK AF DA+ RICP+RAGGHECGCL +L+KL+M+QCVARLDVAMFNAILRESA
Sbjct  396   GTFSVNLWKAAFHDAFSRICPLRAGGHECGCLPVLAKLVMEQCVARLDVAMFNAILRESA  455

Query  2643  DDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlv  2822
              +IPTDP+SDPI +P+VLPIPAG+ SF +GAQLKN+IGNWSRWL D  GIDDDD +D+ +
Sbjct  456   SEIPTDPISDPIVDPKVLPIPAGELSFGSGAQLKNSIGNWSRWLTDNLGIDDDDSEDECL  515

Query  2823  eddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLI  3002
                    D  NG++ ++  A  K F LLN +SDL+MLPKDMLL  ++RKE+CP+ GL L+
Sbjct  516   -------DIGNGNDERSGAAEGKSFRLLNELSDLLMLPKDMLLENSIRKEICPSVGLPLV  568

Query  3003  TRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAl  3176
             TR+L  F PDEFCPDP+P++VLE LNSE  +E  + +++   FPC AAP+ Y PPS    
Sbjct  569   TRILCNFTPDEFCPDPVPSIVLEELNSESLLERSIGKDAASAFPCIAAPVTYRPPS-QLD  627

Query  3177  dgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSE------VTKPgg  3338
                    +   ++L R  S V ++ YTSDD+LD+LDSPL  +  +++       VT    
Sbjct  628   VAEKVSDTGGGAKLDRRGSMVQRRGYTSDDDLDDLDSPLASLFDKSAPPSPSNGVTPFTA  687

Query  3339  gsgngngngVRYQLLREVW  3395
                  +    RY LLREVW
Sbjct  688   QLRGASMENARYTLLREVW  706



>ref|XP_011020299.1| PREDICTED: uncharacterized protein LOC105122726 [Populus euphratica]
 ref|XP_011020300.1| PREDICTED: uncharacterized protein LOC105122726 [Populus euphratica]
 ref|XP_011020301.1| PREDICTED: uncharacterized protein LOC105122726 [Populus euphratica]
Length=802

 Score =   481 bits (1238),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 278/577 (48%), Positives = 375/577 (65%), Gaps = 35/577 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSND-WKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             VL +  N  +   S+D   D +   K      L +K +++E +I  LE ELRE AA+EI 
Sbjct  242   VLDEASNGTQSFASDDETADAEENGKHEDEAELIQKIEDMEMRIGKLEAELREVAALEIS  301

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARRLSRLY HACK  +  +R + AR+ VSGL L++K+CGNDV
Sbjct  302   LYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWTQDKRATIARNTVSGLALISKSCGNDV  361

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNA-VVKNERKASPLKWQSFPHKKS  2243
             PRLTFWLSN ++LR  I +   S +   PL+     N    K+E K++ +KW+S    K 
Sbjct  362   PRLTFWLSNTIVLREIISQAFGSSRNSSPLARHAGSNGGSKKSEGKSTAVKWKSGSGSKQ  421

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINK  2423
             V N      +DW+    FT ALEKVE+WIFSRI+ES+WWQ  TPHMQS AA   +   NK
Sbjct  422   V-NGFMQFADDWQETGTFTAALEKVESWIFSRIVESVWWQALTPHMQSPAA---ELASNK  477

Query  2424  IYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVA  2597
                R        ++  ++S+ LWK AF+DA +R+CP RAGGHECGCLH++++++M+QC+A
Sbjct  478   TSGRLLGPALGDQQQGSYSINLWKNAFKDALQRLCPARAGGHECGCLHIIARMVMEQCIA  537

Query  2598  RLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLA  2777
             RLDVAMFNAILRES+ +IPTDP+SDPI + ++LPIPAG  SF +GAQLKN++G+WSRWL 
Sbjct  538   RLDVAMFNAILRESSHEIPTDPISDPIVDSKILPIPAGDLSFGSGAQLKNSVGDWSRWLT  597

Query  2778  DLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSR  2957
             D+FGID DD   +          +S G +R+  +  ++ F LLN +SDL+MLPKDML+ R
Sbjct  598   DMFGIDADDSLKEDQH-------DSEGDDRRYGE--TRSFLLLNDLSDLLMLPKDMLMDR  648

Query  2958  TVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPC  3131
             ++RKEVCP+ GL L+ R+L  F PDEF PDP+   VLEALN+E  +E  +  ++  NFP 
Sbjct  649   SIRKEVCPSIGLPLVKRILCNFTPDEFWPDPVSGAVLEALNAESILERRLLGDAARNFPY  708

Query  3132  SAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI---  3302
             +AAP+VY PPS++        ++ + S L+R+ S+V +K YTSD+EL+ELDSPL  I   
Sbjct  709   TAAPVVYTPPSSS-----DVAVAGTKSPLSRNASAVQRKGYTSDEELEELDSPLTSIIEK  763

Query  3303  ------KMENSEVTKPgggsgngngngVRYQLLREVW  3395
                    M N                  RY+LLREVW
Sbjct  764   LPSSPTIMANGNGNGKHKEHAGDLVANARYELLREVW  800



>ref|XP_006663923.1| PREDICTED: uncharacterized protein LOC102711391 [Oryza brachyantha]
Length=910

 Score =   484 bits (1246),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 269/514 (52%), Positives = 350/514 (68%), Gaps = 31/514 (6%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA EIGL+SV+AEHGSS NKVH PARRLSR + H  K  S  +  SAARS  SGL+L
Sbjct  419   RETAAAEIGLYSVIAEHGSSANKVHTPARRLSRHFLHGFKNWSKDKMGSAARSASSGLVL  478

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNE-RKASPLKWQ  2222
             VAKACG DV RL+FWLSNCV+LRA + + S++     S+  + N V K   R+ S   W+
Sbjct  479   VAKACGYDVARLSFWLSNCVVLRAIVSETSKQ-----SNGSAINYVGKTTPRRNSASMWE  533

Query  2223  SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS  2402
             S   KK  G  L   F++WE+   F  AL+K+E+WIFSRI+ESIWWQ FTPHMQS   +S
Sbjct  534   SLNRKK--GKLLSPEFDNWEDVDTFIAALKKIESWIFSRIVESIWWQAFTPHMQSANVSS  591

Query  2403  ---LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSK  2573
                  S   K Y R +   +++    S+++WK+AF++A E++CPVRA GHECGCL LL+K
Sbjct  592   EPLPSSNAKKCYGRITVVGNQQQATLSIDIWKRAFKEASEKLCPVRAAGHECGCLPLLAK  651

Query  2574  LIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAI  2753
             L+M+QC+ARLDVAMFNAILRES D+IPTDP+SDPI++P+VLPIP+GK SF AG QLKNAI
Sbjct  652   LVMEQCIARLDVAMFNAILRESDDEIPTDPMSDPITDPKVLPIPSGKFSFGAGVQLKNAI  711

Query  2754  GNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMML  2933
             G+WSR L DLFG+D D+           + +N NG    A+    KPFYLLNA+SDL+M+
Sbjct  712   GSWSRCLTDLFGMDMDEYP---------EVENGNGDNGAAE--IRKPFYLLNALSDLLMI  760

Query  2934  PKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEES  3113
             PKD+L+  + RKE+CPTF  S+I R+L+ F+PD+FCPDP+ + +LEAL SE+H+E   + 
Sbjct  761   PKDVLMDTSTRKELCPTFSSSIIKRILDGFVPDDFCPDPVQHSLLEALESEEHLEGNIKG  820

Query  3114  VVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPL  3293
             +   PCSA PI+Y  P++ A       I S      +S S++L+KS TSDDELDEL SPL
Sbjct  821   IRAVPCSALPILYPYPASGA-------ILSMIGDPRKSGSAILRKSNTSDDELDELSSPL  873

Query  3294  NLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
               I    + +         G+ N  RY+LL EVW
Sbjct  874   TFI--SKASLNPLAKLKQIGSPNTARYRLLHEVW  905


 Score =   159 bits (403),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 123/198 (62%), Gaps = 6/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KTR       ++ I I EI PWPPS+SLK+LK+VV+ WE+G++NSG T  VAP
Sbjct  1    MVLGLRSKTRKDVPFHVDFNIFIQEISPWPPSESLKSLKSVVLFWENGERNSGKTNAVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG   G+IEFNE   +     +E SSKS     +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SI--GSGTTLGKIEFNEFINLQAVFQKEGSSKS---GKWQKNLLELNLYEPRRD-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LGTA +D A + +  E  +V VP+N KRS RN  QP++ L+IQ +         R+ + 
Sbjct  115  HLGTATLDLAEHAMFHEDTSVPVPLNSKRSLRNNAQPMVYLRIQPLDGDNSSVSSRDALS  174

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D  + E +SA M+
Sbjct  175  KEASVDRDSKEVMSATMS  192



>ref|XP_008240833.1| PREDICTED: uncharacterized protein LOC103339339 [Prunus mume]
 ref|XP_008240834.1| PREDICTED: uncharacterized protein LOC103339339 [Prunus mume]
 ref|XP_008240835.1| PREDICTED: uncharacterized protein LOC103339339 [Prunus mume]
 ref|XP_008240836.1| PREDICTED: uncharacterized protein LOC103339339 [Prunus mume]
 ref|XP_008240837.1| PREDICTED: uncharacterized protein LOC103339339 [Prunus mume]
Length=804

 Score =   481 bits (1237),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 286/576 (50%), Positives = 379/576 (66%), Gaps = 30/576 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWKDTKVRSKETSNVV-LERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L    N  + + S+D       + E  +V  LERK +E+E +I+ LE ELRE AA+EI 
Sbjct  241   ILDGASNGAQSVESDDETVHAEENDEQEDVTALERKVEEMEMRIEKLEEELREVAALEIS  300

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARR+SRLY HACK  +  +R + A++ VSGL+L+AK+CGNDV
Sbjct  301   LYSVVPEHGSSAHKVHTPARRISRLYIHACKLWTQDKRATIAKNTVSGLVLIAKSCGNDV  360

Query  2073  PRLTFWLSNCVLLRAAICK-FSEKQQLPLSSEYSKNAVV-----KNERKASPLKWQSFPH  2234
             PRLTFWLSN V+LR  I + F    Q   SS  +K A +     +N  K+  LKW+    
Sbjct  361   PRLTFWLSNTVVLREIISQAFGISHQ---SSSLTKFADINGTSKRNGVKSPTLKWRGGSG  417

Query  2235  KKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSE  2414
              K + N      +DW+    FT ALEK+E+WIFSRI+ES+WWQ  TP+MQS A  S  S 
Sbjct  418   GKQM-NGFMQFADDWQETGNFTAALEKIESWIFSRIVESVWWQALTPNMQSPAEYS--SN  474

Query  2415  INKIYQRTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQC  2591
              N I +    +  ++ + +FS+ LWK AF+DA +R+CPVRAGGH+CGCL +L++++M+ C
Sbjct  475   NNTIVRLLGPALGDQKQGSFSVNLWKNAFQDASQRLCPVRAGGHKCGCLPVLARMVMEHC  534

Query  2592  VARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRW  2771
             VARLDVAMFNAILRESA +IPTDPVSDPI +P VLPIPAG  SF +GAQLKN++GNWSRW
Sbjct  535   VARLDVAMFNAILRESAHEIPTDPVSDPIVDPRVLPIPAGDLSFGSGAQLKNSVGNWSRW  594

Query  2772  LADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLL  2951
             L+D+F +D DD   +           S   +R++ D  SK F LLNA+SDL+MLPKDML+
Sbjct  595   LSDMFDMDADDSLQEDQP-------GSQDDDRQSGDGESKSFLLLNALSDLLMLPKDMLI  647

Query  2952  SRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNF  3125
              R++RKEVCP+  L L+ R+L  F PDEFCPD +P  VLEALN+E  ++  +  ES  +F
Sbjct  648   DRSIRKEVCPSISLPLVKRILCNFTPDEFCPDAVPGAVLEALNAESIVDRRLSGESARSF  707

Query  3126  PCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI-  3302
             P +AAP++Y PPS+A         +   SQL R+ S+V +K YTSD+EL+ELDSPL  I 
Sbjct  708   PYTAAPVMYRPPSSA-DVAEKVSEAGGRSQLERNVSAVQRKGYTSDEELEELDSPLTSII  766

Query  3303  -KMENSEVT----KPgggsgngngngVRYQLLREVW  3395
              K+ +S                     RY+LLREVW
Sbjct  767   DKLPSSPTIVANGNGKHEHTGHACMNARYELLREVW  802



>ref|XP_011029663.1| PREDICTED: uncharacterized protein LOC105129350 isoform X3 [Populus 
euphratica]
Length=1044

 Score =   487 bits (1253),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 344/512 (67%), Gaps = 39/512 (8%)
 Frame = +3

Query  1887  IGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGN  2066
             +GL+SVVAEHGSS NKV APARRLSR Y HACK  S ++  +AAR+++SGLILV+KACGN
Sbjct  567   VGLYSVVAEHGSSINKVLAPARRLSRFYLHACKARSRVKSANAARAIISGLILVSKACGN  626

Query  2067  DVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSV  2246
             DVPR            A + +  EK Q         N   K   ++SP + Q     K+ 
Sbjct  627   DVPR------------AIVTQAVEKLQFASVPSIINNGSPKGRHESSPSEVQ-----KTD  669

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKI  2426
             G +   + +DW  P  +  AL+K+EAWIFSRI+ S+WWQT TPHMQS A  S +S   K 
Sbjct  670   GTE---SSDDWAEPEPYIAALKKIEAWIFSRIVTSVWWQTLTPHMQSTAVKSSNSR--KT  724

Query  2427  YQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLD  2606
               R      +E  NF+++LWKKAFRDA ER+CPVRAGGHECGCL +LS+L+M+Q V RLD
Sbjct  725   NARRHGLGDQEQGNFAIDLWKKAFRDACERLCPVRAGGHECGCLPVLSRLVMEQLVGRLD  784

Query  2607  VAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLF  2786
             VAMFNAILRESA+++PTDPVSDPIS+P+VLPIPAG +SF AGAQLKNA+GNWSRWL DLF
Sbjct  785   VAMFNAILRESAEEMPTDPVSDPISDPKVLPIPAGNSSFGAGAQLKNAVGNWSRWLTDLF  844

Query  2787  GIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVR  2966
             GIDDDD  ++  E D N         R+  +   K F LLNA+SDLMMLP +ML  R+ R
Sbjct  845   GIDDDDSPEEKDELDRN---------RRECETSFKAFQLLNALSDLMMLPFEMLGDRSTR  895

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPI  3146
             KEVCPTFG+ +I RVL+ F+PDEF PDP+P  +LE+ NSED  +  EES+ NFPC AAP 
Sbjct  896   KEVCPTFGVPIIKRVLDNFVPDEFNPDPVPETILESFNSEDLADSGEESITNFPCIAAPA  955

Query  3147  VYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVT  3326
             +Y+PP AA               L RSRS++L+KSY SDDELDELDSP+  I +++S+V+
Sbjct  956   IYSPPPAA--LLTNIIGEVGGQTLHRSRSAMLRKSYASDDELDELDSPMTSI-IDSSKVS  1012

Query  3327  KPggg-----sgngngngVRYQLLREVWMSSE  3407
                        G      VRYQLLREVW   E
Sbjct  1013  PTATAWNWMQKGKAGRKVVRYQLLREVWKDGE  1044


 Score =   171 bits (434),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 133/201 (66%), Gaps = 18/201 (9%)
 Frame = +3

Query  165  MVLGPSGKTR---GVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQ  335
            MVLG   K R      SVQ +Y+I++ EIKPWPPSQSLK+++++++QWE+GD++SGS T 
Sbjct  1    MVLGLRSKNRKGTSDSSVQVDYIIHVQEIKPWPPSQSLKSVQSLLLQWENGDQSSGSFT-  59

Query  336  VAPMLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTV  515
                    S VG+G++EF ESFR+  TL +E+S K    D+F KN +EFN YE R+D  +
Sbjct  60   --------SNVGDGKVEFIESFRLSATLCKEVSRKGTARDSFLKNYLEFNFYESRKDKAM  111

Query  516  KGQLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRN  695
            KGQLLG+A+I+ A+YG++ + + ++ PIN K+S R+ V  +L L IQ   +       ++
Sbjct  112  KGQLLGSALINLADYGIIMDAVTINAPINFKKSSRSAVPAVLYLNIQPFDRD------KS  165

Query  696  NVRRESSMDSSAGESVSALMN  758
            ++ +E S+D    E+VS + N
Sbjct  166  SLSKEVSLDKDGSETVSEVAN  186



>ref|XP_009345114.1| PREDICTED: uncharacterized protein LOC103936952 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345115.1| PREDICTED: uncharacterized protein LOC103936952 isoform X1 [Pyrus 
x bretschneideri]
Length=784

 Score =   478 bits (1231),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 281/553 (51%), Positives = 362/553 (65%), Gaps = 42/553 (8%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
             + LERK +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARR+SRLY HAC
Sbjct  250   IALERKIEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRISRLYIHAC  309

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K  +  +R + A++ VSGLIL+AK+CGNDVPRLTFWLSN V+LR  I + F   +Q   S
Sbjct  310   KHWTQDKRATIAKNTVSGLILIAKSCGNDVPRLTFWLSNIVVLREIISQAFGISRQSSPS  369

Query  2160  SEY--SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
              ++  S     +NE K++ LKW+     K + N L    +DW+    FT ALEKVE+WIF
Sbjct  370   VKFAESNGTSKRNEVKSASLKWRGSSGSKQM-NSLMQFDDDWQETGTFTAALEKVESWIF  428

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDA  2507
             SRI+ES+WWQ  TP+MQS A +S     NK   R S      ++  +FS+ LWK AF+DA
Sbjct  429   SRIVESVWWQALTPNMQSPAESS---STNKTTVRLSGPALGDQKQGSFSVNLWKNAFQDA  485

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CPVRAGGH+CGCL +L++++M+ CVARLDVAMFNAILRESA +IPTDPVSDPI + 
Sbjct  486   SQRLCPVRAGGHKCGCLPVLARMVMEHCVARLDVAMFNAILRESAHEIPTDPVSDPILDS  545

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS-----  2852
              VLPIPAG  SF +GAQLKN++GNWSRWL+D F +                AD+S     
Sbjct  546   RVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDTFDM---------------DADDSLQEDH  590

Query  2853  --NGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
               N  +        K F LLNA+SDL+MLPKDML+ R +RKEVCP+  L L+ R+L  F 
Sbjct  591   PGNEDDDGQSGDGDKSFLLLNALSDLLMLPKDMLIDRRIRKEVCPSISLPLVKRILCNFT  650

Query  3027  PDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             PDEFCPD +P  VLEALN+   ME  +  E V +FP +AAP+VY PPS+A         +
Sbjct  651   PDEFCPDAVPGAVLEALNAASIMERRLSGELVRSFPYTAAPVVYTPPSSA-DVAEKVSEA  709

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsPLNLI--KMENSE------VTKPgggsgngn  3356
               SSQL R+ S V +K YTSD+EL+ELDSPL+ I  K+ ++       +           
Sbjct  710   GGSSQLERNVSVVQRKGYTSDEELEELDSPLSSIIDKLPSTPTIVANGIGNGKHEHTGHA  769

Query  3357  gngVRYQLLREVW  3395
                 RY+LLREVW
Sbjct  770   CMNARYELLREVW  782



>ref|XP_009345116.1| PREDICTED: uncharacterized protein LOC103936952 isoform X2 [Pyrus 
x bretschneideri]
Length=689

 Score =   475 bits (1222),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 281/553 (51%), Positives = 362/553 (65%), Gaps = 42/553 (8%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
             + LERK +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARR+SRLY HAC
Sbjct  155   IALERKIEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRISRLYIHAC  214

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K  +  +R + A++ VSGLIL+AK+CGNDVPRLTFWLSN V+LR  I + F   +Q   S
Sbjct  215   KHWTQDKRATIAKNTVSGLILIAKSCGNDVPRLTFWLSNIVVLREIISQAFGISRQSSPS  274

Query  2160  SEY--SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
              ++  S     +NE K++ LKW+     K + N L    +DW+    FT ALEKVE+WIF
Sbjct  275   VKFAESNGTSKRNEVKSASLKWRGSSGSKQM-NSLMQFDDDWQETGTFTAALEKVESWIF  333

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDA  2507
             SRI+ES+WWQ  TP+MQS A +S     NK   R S      ++  +FS+ LWK AF+DA
Sbjct  334   SRIVESVWWQALTPNMQSPAESS---STNKTTVRLSGPALGDQKQGSFSVNLWKNAFQDA  390

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CPVRAGGH+CGCL +L++++M+ CVARLDVAMFNAILRESA +IPTDPVSDPI + 
Sbjct  391   SQRLCPVRAGGHKCGCLPVLARMVMEHCVARLDVAMFNAILRESAHEIPTDPVSDPILDS  450

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS-----  2852
              VLPIPAG  SF +GAQLKN++GNWSRWL+D F +                AD+S     
Sbjct  451   RVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDTFDM---------------DADDSLQEDH  495

Query  2853  --NGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
               N  +        K F LLNA+SDL+MLPKDML+ R +RKEVCP+  L L+ R+L  F 
Sbjct  496   PGNEDDDGQSGDGDKSFLLLNALSDLLMLPKDMLIDRRIRKEVCPSISLPLVKRILCNFT  555

Query  3027  PDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdis  3200
             PDEFCPD +P  VLEALN+   ME  +  E V +FP +AAP+VY PPS+A         +
Sbjct  556   PDEFCPDAVPGAVLEALNAASIMERRLSGELVRSFPYTAAPVVYTPPSSA-DVAEKVSEA  614

Query  3201  ssssqltrsrssVLKKSYTsddeldeldsPLNLI--KMENSE------VTKPgggsgngn  3356
               SSQL R+ S V +K YTSD+EL+ELDSPL+ I  K+ ++       +           
Sbjct  615   GGSSQLERNVSVVQRKGYTSDEELEELDSPLSSIIDKLPSTPTIVANGIGNGKHEHTGHA  674

Query  3357  gngVRYQLLREVW  3395
                 RY+LLREVW
Sbjct  675   CMNARYELLREVW  687



>ref|NP_001062183.1| Os08g0505200 [Oryza sativa Japonica Group]
 dbj|BAD08832.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD10169.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24097.1| Os08g0505200 [Oryza sativa Japonica Group]
 gb|EEC83843.1| hypothetical protein OsI_29800 [Oryza sativa Indica Group]
 gb|EEE68964.1| hypothetical protein OsJ_27864 [Oryza sativa Japonica Group]
Length=687

 Score =   474 bits (1220),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 268/555 (48%), Positives = 350/555 (63%), Gaps = 52/555 (9%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             V+ ++ +EL+ KI  LE ELRE AA+E+ L+SV+ EHGSS +K+H PARRLSR+Y HA K
Sbjct  158   VVYQRNEELQSKIDKLEQELREVAALEVSLYSVLPEHGSSAHKLHTPARRLSRMYIHASK  217

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSE  2165
               S  +  S A+S VSGL+LVAK+C ND  RLTFWLSN V+LR  I      Q + +S +
Sbjct  218   FWSSDKIASVAKSTVSGLVLVAKSCSNDASRLTFWLSNTVVLREIIA-----QTIGISCQ  272

Query  2166  YSKNAVVKN--------ERKASPLKW---QSFPHKKSVGNDLPGTFEDWENPLGFTKALE  2312
              S      N        + ++ P+ W    S    K  G  +P   +DW        ALE
Sbjct  273   SSSTITAINMNGSAKSLDGRSMPMLWTNSSSGKQTKFTGMQVP---DDWHETSTLLAALE  329

Query  2313  KVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKK  2492
             K+E+WIFSRI+E++WWQ  TPHMQ+    S   +  ++     S   ++   FS+ LWK 
Sbjct  330   KIESWIFSRIVETVWWQALTPHMQTPVEGSSTPKTGRVL--GPSLGDQQQGTFSVNLWKA  387

Query  2493  AFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSD  2672
             AF DA+ RICP+RAGGHECGCL +L+KL+M+QCV RLDVAMFNAILRESA +IPTDP+SD
Sbjct  388   AFHDAFNRICPLRAGGHECGCLPVLAKLVMEQCVGRLDVAMFNAILRESASEIPTDPISD  447

Query  2673  PISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS  2852
             PI +P+VLPIPAG  SF +GAQLKN+IGNWSRWL D FGI                AD+S
Sbjct  448   PIVDPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDNFGI---------------DADDS  492

Query  2853  ------NGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVL  3014
                    G ER A  A SK F LLN +SDL+MLPKDML+ +++RKE+CP+ GL L+TR+L
Sbjct  493   EEDGTDTGSERSA--AESKSFQLLNELSDLLMLPKDMLIEKSIRKEICPSIGLPLVTRIL  550

Query  3015  NVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgil  3188
               F PDEFCPDP+P++VLE LNSE  +E   ++ +   FPC AAP+VY PPS        
Sbjct  551   CNFTPDEFCPDPVPSIVLEELNSESLLERCTDKSATSAFPCIAAPVVYRPPS-LLDVAEK  609

Query  3189  gdisssssqltrsrssVLKKSYTsddeldeldsPL-NLIKMEN----SEVTKPgggsgng  3353
                +  +++L R  S V ++ YTSDD+LD+LDSPL +LI        S+ +         
Sbjct  610   VADTGGNAKLDRRASMVQRRGYTSDDDLDDLDSPLASLIDKSAPPLLSKGSAHFTAQRGV  669

Query  3354  ngngVRYQLLREVWM  3398
             +    RY  LREVW+
Sbjct  670   SMENARYTFLREVWL  684



>gb|EMS60373.1| hypothetical protein TRIUR3_21199 [Triticum urartu]
Length=722

 Score =   475 bits (1222),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 267/564 (47%), Positives = 365/564 (65%), Gaps = 27/564 (5%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T ++  D + +  +    VL R+ +EL+ K++ +E ELRE AA+E+ L+SV+ EHGSS +
Sbjct  159   TDDEIADIEEKIVDDDKAVLHRRNEELQSKLEKMEQELREVAALEVSLYSVLPEHGSSAH  218

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             K+H PARRLSRLY HA K  S  RR SAA++ VSGL+LV K+C ND  RLT+WLSN V+L
Sbjct  219   KLHTPARRLSRLYTHASKFWSPDRRASAAKNTVSGLVLVVKSCSNDASRLTYWLSNTVVL  278

Query  2112  RAAICK-FS-EKQQLPLSSEYSKNAVV-----KNERKASPLKWQSFPHKKSVGNDLPGTF  2270
             R  I K F   +Q  P  +  + N        K+  ++ P+ W++  + K     +  T 
Sbjct  279   REIISKSFGISRQSTPTMTTKNLNGSAHWFDGKSTPRSMPVPWKNNSNGKQTELAIIQTA  338

Query  2271  EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC  2450
             ++W+       ALE++E+WIFSRI+E++WWQ  TPHMQ+    S   +  K+     S  
Sbjct  339   DNWQETSTLLAALERIESWIFSRIVETVWWQALTPHMQTPREGSSTPKARKVL--GPSLG  396

Query  2451  SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
              ++   FS+ LWK AF DAY R+CP+RAGGHECGCL +L+KL+M+QCVARLDVAMFNAIL
Sbjct  397   DQQQGTFSVNLWKAAFHDAYSRLCPLRAGGHECGCLPVLAKLVMEQCVARLDVAMFNAIL  456

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             RESA +IPTDP+SDPI +P+VLPIPAG+ SF +GAQLKN+IGNWSRWL D  GID DD +
Sbjct  457   RESASEIPTDPISDPIVDPKVLPIPAGELSFGSGAQLKNSIGNWSRWLTDNLGIDADDPE  516

Query  2811  ddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFG  2990
             D+         D  NG++ +   A +K F LLN +SDL+M PKDML+ +++RKE+CP+ G
Sbjct  517   DEGF-------DIGNGNDERIGAAEAKSFKLLNELSDLLMTPKDMLIEKSIRKEICPSVG  569

Query  2991  LSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPS  3164
             L L+TR+L  F PDEFCPDP+P++VLE LNSE  +E    + ++  FPC AAPI Y  PS
Sbjct  570   LPLVTRILCNFTPDEFCPDPVPSIVLEELNSESLLERHTAKHAISAFPCIAAPIAYRAPS  629

Query  3165  AAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP----  3332
                       ++  S++L R  S V ++ YTSDD+LD+LDSPL  +  + S    P    
Sbjct  630   -QLDVEEKVSVAGGSAKLDRRASMVQRRGYTSDDDLDDLDSPLASL-FDKSAPPSPSNGA  687

Query  3333  ---gggsgngngngVRYQLLREVW  3395
                       +    R++LLREVW
Sbjct  688   APFTAQQRGASMENARFELLREVW  711



>dbj|BAK07252.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=909

 Score =   480 bits (1235),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 272/539 (50%), Positives = 363/539 (67%), Gaps = 31/539 (6%)
 Frame = +3

Query  1797  SNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFH  1976
             SN   + K +ELE+K+++LE EL+EAAA EIGL+SV AEHGSS NKVH PARRLSR + H
Sbjct  390   SNNRSDNKVRELERKVELLETELQEAAASEIGLYSVAAEHGSSANKVHTPARRLSRHFVH  449

Query  1977  ACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPL  2156
             A K     +  SAARS  SGL+ VAKACG DV RL+FWLSNCV+LRA + + S++  +  
Sbjct  450   AFKNCPREKMGSAARSSSSGLVFVAKACGYDVARLSFWLSNCVVLRAIVTETSKQSDIGN  509

Query  2157  SSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
                 +  +     R+ S   W+S   KK  GN L   F++WE+   F  AL+K+E+WIFS
Sbjct  510   DINATDYSSKTAPRRNSASMWESLNRKK--GNFLSPEFDNWEDIDTFIAALKKIESWIFS  567

Query  2337  RIIESIWWQTFTPHMQSG-----AATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             RI+E IWWQ FTPHMQS      + T L+++  K Y + +   +++    S+++WKKAF+
Sbjct  568   RIVECIWWQAFTPHMQSAYISTESKTGLNAK--KCYGKITVVGNQQQATLSIDIWKKAFK  625

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
              A E+ICPVRA GHECGCL +L+KL+M++C+ARLD+AMFNAILRES D+IPTDP+SDPI+
Sbjct  626   QASEKICPVRAAGHECGCLPMLAKLLMEECIARLDIAMFNAILRESEDEIPTDPISDPIT  685

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIP+GK  F AG QLKNAIG+WSR L DLFG+D DD           + +N +G 
Sbjct  686   DPKVLPIPSGKFGFGAGVQLKNAIGSWSRCLTDLFGMDMDDYP---------EVENWDGE  736

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
                A+    KPFYLLNA+SDL+M+PKD+L+  + RKE+CPTF  S++  +L  F+PDEFC
Sbjct  737   NGIAE--THKPFYLLNALSDLLMIPKDVLMETSTRKEICPTFSSSIVRSILVGFVPDEFC  794

Query  3042  PDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqlt  3221
             PDPI + +L+AL  EDH+E  ++ +   PCSA+PIVY+ P+          I S      
Sbjct  795   PDPIQDSLLQALELEDHLESSDKGIRAIPCSASPIVYSYPAPGT-------ILSIIGDPR  847

Query  3222  rsrssVLKKSYTsddeldeldsPLNLI-KMENSEVTKPgggsgngngngVRYQLLREVW  3395
             +S S+VL+KS TSDDELDEL SPL+ I K  ++ + K             RY+LL EVW
Sbjct  848   KSGSAVLRKSNTSDDELDELSSPLSFISKAPSNPLAK---LKQISGSYTARYRLLHEVW  903


 Score =   153 bits (387),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 124/198 (63%), Gaps = 8/198 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KT+   ++  ++ I I EI PWPPS+SLK+L++VV+ WE+G++NSG T  VAP
Sbjct  1    MVLGLRTKTKKDAAIHVDFNIFIQEISPWPPSESLKSLRSVVLFWENGERNSGKTNTVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG  +G+IEFNE   + +   +E SS       +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SV--RSGSTSGKIEFNEFISIQVVFQKEDSSGK-----WQKNLLELNLYEPRRD-KLKGQ  112

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LGTA +D A + +  E   V VP+N KR++++   P++ L+IQ +   R     R+ + 
Sbjct  113  HLGTATLDLAEHAMFLEDTAVPVPLNSKRNFKSNAHPMVYLRIQPLDGDRSSLSSRDALP  172

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D  +   +SA M+
Sbjct  173  KEASVDKDSKAFMSATMS  190



>ref|XP_006659567.1| PREDICTED: uncharacterized protein LOC102707702 [Oryza brachyantha]
Length=687

 Score =   473 bits (1216),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 269/550 (49%), Positives = 355/550 (65%), Gaps = 32/550 (6%)
 Frame = +3

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             E  +VV  R  +EL  KI  LE ELRE AA+E+ L+SV+ EHGSS +K+H PARRLSR+Y
Sbjct  153   EEKSVVYHRN-EELRSKIDKLEQELREVAALEVSLYSVLPEHGSSAHKLHTPARRLSRMY  211

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FS-EKQ  2144
              HA K  S  +  S A++ VSGL+LVAK+C ND  RLTFWLSN V+LR  I + F    Q
Sbjct  212   IHASKFWSSDKIASVAKTTVSGLVLVAKSCSNDASRLTFWLSNTVVLREIIAQTFGISHQ  271

Query  2145  QLPLSSEYSKNAVVKN-ERKASPLKWQSFPHKKSV---GNDLPGTFEDWENPLGFTKALE  2312
               P ++  + N   K  + ++ P+ W++  + K     G  +P   +DW+        LE
Sbjct  272   SPPTTTTINMNGGAKRPDGRSMPMLWKNSSNGKQTKFTGMQIP---DDWQETSTLLATLE  328

Query  2313  KVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKK  2492
             K+E+WIFSRI+E++WWQ  TPHMQ+    S   +  ++     S   ++   FS+ LWK 
Sbjct  329   KIESWIFSRIVETVWWQALTPHMQTPVEGSSTPKAGRVL--GPSLGDQQQGTFSVNLWKA  386

Query  2493  AFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSD  2672
             AF DA+ RICP+RAGGHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SD
Sbjct  387   AFHDAFSRICPLRAGGHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISD  446

Query  2673  PISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNS  2852
             PI +P+VLPIPAG  SF +GAQLKN+IGNWSRWL D  GI          +D E +    
Sbjct  447   PIVDPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDNLGI--------DADDSEEEDGTD  498

Query  2853  NGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPD  3032
              G+E  A  A SK F LLN +SDL+MLPKDML+ +++RKEVCP+ GL L+TR+L  F PD
Sbjct  499   TGNETSA--AESKSFQLLNELSDLLMLPKDMLIEKSIRKEVCPSIGLPLVTRILCNFTPD  556

Query  3033  EFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             EFCPDP+P+VVLE LNSE  +E   ++ +   FPC AAP+VY PPS           +  
Sbjct  557   EFCPDPVPSVVLEELNSESLLERCTDKNATSAFPCIAAPVVYRPPS-LLDVAEKVADTGG  615

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngV  3368
             +++L R  S V ++ YTSDD+LD+LDSPL  + ++ S    P          G  +    
Sbjct  616   NAKLDRRASMVQRRGYTSDDDLDDLDSPLASL-IDKSAPHSPSNGIAHFTAQGGASMENA  674

Query  3369  RYQLLREVWM  3398
             R+ LLREVW+
Sbjct  675   RFTLLREVWL  684



>ref|XP_008651773.1| PREDICTED: uncharacterized protein LOC100384417 isoform X1 [Zea 
mays]
 ref|XP_008651774.1| PREDICTED: uncharacterized protein LOC100384417 isoform X1 [Zea 
mays]
 tpg|DAA62028.1| TPA: hypothetical protein ZEAMMB73_064427 [Zea mays]
Length=792

 Score =   475 bits (1223),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 282/682 (41%), Positives = 404/682 (59%), Gaps = 57/682 (8%)
 Frame = +3

Query  1383  VSDNGLAEGENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTT  1562
             + D+   EG  T     + +    + DK  E G   +  IE  + ++ +P++S + D+ T
Sbjct  153   IKDDSAVEGRATNDKAVDDK---AKNDKDIEDGMKDDNAIE-CEVTDDKPIDSKVTDDIT  208

Query  1563  KQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSI  1742
                       I GRE  G      + +     +  L E+ +++ S  ++  ++       
Sbjct  209   ----------IEGREIEG------KAIEEAKEIDILDEAPKSDQSTGTDDEIV-------  245

Query  1743  EGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGS  1922
                      DT+    +  N V  +  +EL  KI+ LE ELRE AA+E+ L+SVV EHG 
Sbjct  246   ---------DTEENIADNGNSVSYKINEELYSKIEKLEQELREVAALEVSLYSVVPEHGC  296

Query  1923  STNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNC  2102
             S++K+H PARRLSR+Y HA K  S  ++ S AR+ VSGL+LVAK+CGNDV RLTFWLSN 
Sbjct  297   SSHKLHTPARRLSRVYIHASKFWSSDKKASVARNSVSGLVLVAKSCGNDVSRLTFWLSNT  356

Query  2103  VLLRAAICK-FSEKQQLPLSSEYSKNAVV-KNERKASPLKWQSFPHKKSVGNDLPGTFED  2276
             V+LR  I + F   Q       +S N    K +R  +  +W+S  + K V  ++    +D
Sbjct  357   VVLREIIAQTFGTSQHSSPVKVFSSNGNANKPDRSFTSSQWKSNYNGKYVNPNIMQLPDD  416

Query  2277  WENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSE  2456
             W+       ALEK+E+WIFSRI+ES+WWQ  TPHMQ+        +I ++  +  S   +
Sbjct  417   WQKTSTLLDALEKIESWIFSRIVESVWWQAMTPHMQTPVEDLSTPKIGRLLGQ--SLGDQ  474

Query  2457  EPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRE  2636
             +  +FS++LW+ AF+DA+ RICP+RAGGHECGCL +L+KL+M+ C+ARLD+AMFNAILRE
Sbjct  475   QHGSFSIDLWRSAFQDAFSRICPLRAGGHECGCLPVLAKLVMEHCIARLDIAMFNAILRE  534

Query  2637  SADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddeddd  2816
             S ++IPTDP+SDPI +  VLPIPAG  SF +GAQLK+++GNWSRWL D FG+D  + +  
Sbjct  535   SENEIPTDPISDPIVDSRVLPIPAGNLSFGSGAQLKSSVGNWSRWLTDTFGMDAAESEKG  594

Query  2817  lveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLS  2996
               + + N  D  +     A+  C   F LLN +SDL+MLPKDMLL + +RKEVCP+ GL 
Sbjct  595   GQDVEVNGDDRRDA----AESTC---FKLLNELSDLLMLPKDMLLEKAIRKEVCPSIGLP  647

Query  2997  LITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAA  3170
             L+TR+L  F PDEFCPDP+P +VLE LNSE  ++   E + V  FP +AAP+VY  P+  
Sbjct  648   LVTRILCNFTPDEFCPDPVPGMVLEELNSESLLDRSTEIDMVSTFPVTAAPVVYWAPTLE  707

Query  3171  AldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP------  3332
              +   + D +  + +L R  S V ++ YTSDD+LD L+ PL  +  + S    P      
Sbjct  708   DVREKVADTACGNPELDRRGSMVQRRGYTSDDDLDALEFPLASL-YDKSNPPSPCNNGVA  766

Query  3333  -gggsgngngngVRYQLLREVW  3395
                     +   VR++LLREVW
Sbjct  767   HFSTRQVASMENVRHELLREVW  788



>ref|XP_011071208.1| PREDICTED: uncharacterized protein LOC105156693 isoform X1 [Sesamum 
indicum]
 ref|XP_011071209.1| PREDICTED: uncharacterized protein LOC105156693 isoform X1 [Sesamum 
indicum]
Length=915

 Score =   479 bits (1233),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 279/542 (51%), Positives = 355/542 (65%), Gaps = 37/542 (7%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             E + +IQMLE ELREAAA EIGL+S++AEH SS NKVHAPARRLSR Y +ACK  S ++R
Sbjct  396   EWKTRIQMLEEELREAAAAEIGLYSIIAEHASSVNKVHAPARRLSRFYSNACKAGSQVKR  455

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+ VSGL+LV+K+CGNDVPRLTFWLSN ++LRA + + + + Q     E   N   
Sbjct  456   ATAARAAVSGLVLVSKSCGNDVPRLTFWLSNVIMLRAIVSQIAAELQCSNRPESKMNGTG  515

Query  2187  KNERKASPLKWQSFPH---KKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
                    P K   F H    +S  N+ P   EDWE+   F  ALE VE+W+FSRI+ES+W
Sbjct  516   PELTGRLPHKRADFSHVEGDQSKSNEEP---EDWEDVWTFILALENVESWLFSRIVESVW  572

Query  2358  WQTFTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICP  2525
             WQTFTPHMQ   A S      S+  KI  R +S  + E  NFS+ELWKKAF+DA ER+CP
Sbjct  573   WQTFTPHMQCTVAKSNGLTSGSDTKKICGRRNSMSNHEQSNFSMELWKKAFKDACERLCP  632

Query  2526  VRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIP  2705
             +RAGGH+CGCL +L +L+M++ V RLDVAMFNA+LRESA+++PTDP+SDPIS+ +VLPI 
Sbjct  633   IRAGGHDCGCLSVLVRLVMEELVNRLDVAMFNAVLRESAEEMPTDPLSDPISDSKVLPIL  692

Query  2706  AGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDA-  2882
              GK+SF AG +LKNAIGNWSRWL DLFG+D                D+S  H     D  
Sbjct  693   PGKSSFGAGVELKNAIGNWSRWLTDLFGLD----------------DDSIEHSDILGDGK  736

Query  2883  ---CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
                  K F LL+++SDLMMLP  ML   + RKEVCP  G ++I RVL+ F+PDEFCPDP+
Sbjct  737   KPESFKAFRLLHSLSDLMMLPFGMLADASTRKEVCPMLGPTIIKRVLDSFVPDEFCPDPL  796

Query  3054  PNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrs  3233
             P  ++EAL+ E+ ++   + + +FPC+A+P  Y PP AA    +       S  L  SR 
Sbjct  797   PQDIIEALDIEEDLDSSGDLLTSFPCTASPTKYTPPPAA---LLTCAGEVGSQVLQSSRL  853

Query  3234  sVLKKSYTsddeldeldsPLNLI---KMENSEVTKPgggsgngngngV-RYQLLREVWMS  3401
             S L+KSYTSDDELDELDSP   I     ++S + K         G  V RYQLLRE+W  
Sbjct  854   STLRKSYTSDDELDELDSPFTAIIPDSFQSSALAKLSLIPKEKGGRNVLRYQLLREIWKD  913

Query  3402  SE  3407
              E
Sbjct  914   DE  915


 Score =   134 bits (338),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 114/186 (61%), Gaps = 14/186 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   + R   SV+  Y++N+ EI+PWPP +S K+ + V++QWE G++ SGS      
Sbjct  1    MVLGLRSRHRKGTSVKVNYIVNVQEIRPWPPLESPKSAQTVLLQWESGNQYSGS------  54

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
            +  T  G    +I FNESF++P+ L ++  +     + FQKN +EF+L+ PR+D   KGQ
Sbjct  55   LFSTAQG---SKIVFNESFKLPLILYQDKKAH----NRFQKNYLEFSLFVPRKDK-AKGQ  106

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA+I+ A+YGV++   ++S  +N K+S  N +QP L + ++ V K    S     + 
Sbjct  107  LLGTAIINLADYGVIEHITSISASVNLKKSSNNLLQPALIVTLEPVEKDSSSSSPNVGLS  166

Query  705  RESSMD  722
            +E+S D
Sbjct  167  KEASFD  172



>ref|XP_011071210.1| PREDICTED: uncharacterized protein LOC105156693 isoform X2 [Sesamum 
indicum]
Length=905

 Score =   478 bits (1231),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 279/542 (51%), Positives = 355/542 (65%), Gaps = 37/542 (7%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             E + +IQMLE ELREAAA EIGL+S++AEH SS NKVHAPARRLSR Y +ACK  S ++R
Sbjct  386   EWKTRIQMLEEELREAAAAEIGLYSIIAEHASSVNKVHAPARRLSRFYSNACKAGSQVKR  445

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+ VSGL+LV+K+CGNDVPRLTFWLSN ++LRA + + + + Q     E   N   
Sbjct  446   ATAARAAVSGLVLVSKSCGNDVPRLTFWLSNVIMLRAIVSQIAAELQCSNRPESKMNGTG  505

Query  2187  KNERKASPLKWQSFPH---KKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
                    P K   F H    +S  N+ P   EDWE+   F  ALE VE+W+FSRI+ES+W
Sbjct  506   PELTGRLPHKRADFSHVEGDQSKSNEEP---EDWEDVWTFILALENVESWLFSRIVESVW  562

Query  2358  WQTFTPHMQSGAATS----LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICP  2525
             WQTFTPHMQ   A S      S+  KI  R +S  + E  NFS+ELWKKAF+DA ER+CP
Sbjct  563   WQTFTPHMQCTVAKSNGLTSGSDTKKICGRRNSMSNHEQSNFSMELWKKAFKDACERLCP  622

Query  2526  VRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIP  2705
             +RAGGH+CGCL +L +L+M++ V RLDVAMFNA+LRESA+++PTDP+SDPIS+ +VLPI 
Sbjct  623   IRAGGHDCGCLSVLVRLVMEELVNRLDVAMFNAVLRESAEEMPTDPLSDPISDSKVLPIL  682

Query  2706  AGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDA-  2882
              GK+SF AG +LKNAIGNWSRWL DLFG+D                D+S  H     D  
Sbjct  683   PGKSSFGAGVELKNAIGNWSRWLTDLFGLD----------------DDSIEHSDILGDGK  726

Query  2883  ---CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
                  K F LL+++SDLMMLP  ML   + RKEVCP  G ++I RVL+ F+PDEFCPDP+
Sbjct  727   KPESFKAFRLLHSLSDLMMLPFGMLADASTRKEVCPMLGPTIIKRVLDSFVPDEFCPDPL  786

Query  3054  PNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrs  3233
             P  ++EAL+ E+ ++   + + +FPC+A+P  Y PP AA    +       S  L  SR 
Sbjct  787   PQDIIEALDIEEDLDSSGDLLTSFPCTASPTKYTPPPAA---LLTCAGEVGSQVLQSSRL  843

Query  3234  sVLKKSYTsddeldeldsPLNLI---KMENSEVTKPgggsgngngngV-RYQLLREVWMS  3401
             S L+KSYTSDDELDELDSP   I     ++S + K         G  V RYQLLRE+W  
Sbjct  844   STLRKSYTSDDELDELDSPFTAIIPDSFQSSALAKLSLIPKEKGGRNVLRYQLLREIWKD  903

Query  3402  SE  3407
              E
Sbjct  904   DE  905


 Score =   134 bits (337),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 114/186 (61%), Gaps = 14/186 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   + R   SV+  Y++N+ EI+PWPP +S K+ + V++QWE G++ SGS      
Sbjct  1    MVLGLRSRHRKGTSVKVNYIVNVQEIRPWPPLESPKSAQTVLLQWESGNQYSGS------  54

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
            +  T  G    +I FNESF++P+ L ++  +     + FQKN +EF+L+ PR+D   KGQ
Sbjct  55   LFSTAQG---SKIVFNESFKLPLILYQDKKAH----NRFQKNYLEFSLFVPRKDK-AKGQ  106

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA+I+ A+YGV++   ++S  +N K+S  N +QP L + ++ V K    S     + 
Sbjct  107  LLGTAIINLADYGVIEHITSISASVNLKKSSNNLLQPALIVTLEPVEKDSSSSSPNVGLS  166

Query  705  RESSMD  722
            +E+S D
Sbjct  167  KEASFD  172



>ref|XP_006381030.1| hypothetical protein POPTR_0006s05550g [Populus trichocarpa]
 gb|ERP58827.1| hypothetical protein POPTR_0006s05550g [Populus trichocarpa]
Length=692

 Score =   471 bits (1213),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 280/577 (49%), Positives = 377/577 (65%), Gaps = 35/577 (6%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             VL +  N  + + S N+  D +   +      L +K +++E +I  LE ELRE AA+EI 
Sbjct  132   VLDEASNGTQSVASDNETADAEENGEHEDEAELIQKIEDMEMRIGKLEAELREVAALEIS  191

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             ++SVV EHG+S +KVH PARRLSRLY HACK+ +  +R + AR+ VSGL L++K+CGNDV
Sbjct  192   IYSVVPEHGNSAHKVHTPARRLSRLYIHACKQWTQDKRATIARNTVSGLALISKSCGNDV  251

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNA-VVKNERKASPLKWQSFPHKKS  2243
             PRLTFWLSN ++LR  I +   S +   PL+     N    K+E K++ +KW+S    K 
Sbjct  252   PRLTFWLSNTIVLREIISQAFGSSRNSSPLARHAGSNGGSKKSEGKSTAVKWKSGSGSKQ  311

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINK  2423
             V N      +DW+    FT ALEKVE+WIFSRI+ES+WWQ  TPHMQS AA   D   NK
Sbjct  312   V-NGFMQFADDWQETGTFTAALEKVESWIFSRIVESVWWQALTPHMQSPAA---DLPSNK  367

Query  2424  IYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVA  2597
                R        ++  +FS+ LWK AF+DA +R+CPVRAGGHECGCL ++++++M+QCVA
Sbjct  368   TSGRLLGPALGDQQQGSFSINLWKNAFKDALQRLCPVRAGGHECGCLPIIARMVMEQCVA  427

Query  2598  RLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLA  2777
             RLDVAMFNAILRES+ +IPTDP+SDPI + ++LPIPAG  SF +GAQLKN++G+WSRWL 
Sbjct  428   RLDVAMFNAILRESSHEIPTDPISDPIVDSKILPIPAGDLSFGSGAQLKNSVGDWSRWLT  487

Query  2778  DLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSR  2957
             D+FGID DD   +          +S G +R+  +  +K F LLN +SDL+MLPKDML+ R
Sbjct  488   DMFGIDADDSLKEDQH-------DSEGDDRRYGE--TKSFLLLNDLSDLLMLPKDMLMDR  538

Query  2958  TVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPC  3131
             ++RKEVCP+ GL L+ R+L  F PDEF PDP+   VLEALN+E  +E  +  ++  NFP 
Sbjct  539   SIRKEVCPSIGLPLVKRILCNFTPDEFWPDPVSGAVLEALNAESIVERRLLGDAARNFPY  598

Query  3132  SAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI---  3302
             +AAP+VY  PS++        ++ + SQL+R+ SSV +K YTSD+EL+ELDSPL  I   
Sbjct  599   TAAPVVYTLPSSS-----DVAVAGTKSQLSRNASSVQRKGYTSDEELEELDSPLTTIIEK  653

Query  3303  ------KMENSEVTKPgggsgngngngVRYQLLREVW  3395
                    M N                  RY+LLREVW
Sbjct  654   LPSSPTIMANGNGNGKHKEHAGDLVANARYELLREVW  690



>ref|XP_009791126.1| PREDICTED: uncharacterized protein LOC104238468 isoform X2 [Nicotiana 
sylvestris]
Length=895

 Score =   478 bits (1229),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 293/638 (46%), Positives = 395/638 (62%), Gaps = 42/638 (7%)
 Frame = +3

Query  1545  LQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLR  1724
             L DN   + ++    + + R+++GA+ T   RL  V SV  + +S  AN  + + + + +
Sbjct  274   LSDNKIAKSMKRQGTMSSIRKALGAQITHG-RLKAVKSVQ-IRDSASANVFLGNTEIIKK  331

Query  1725  DKRNSIEGITSNDWKDTKVRSKETSNV-------------VLERKCQELEQKIQMLEGEL  1865
             + +      TS+  K T V  K+  N              V+ +   E E +IQMLE EL
Sbjct  332   EMKEHATIETSSIAKSTVVEDKKPKNTTSTSATEKRAPANVMSKSKPESESRIQMLEEEL  391

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             +EAAA+E+GL+SVVAEHGSS NKVH PARRL+R Y HA +  S  ++ SAAR+ VSGL L
Sbjct  392   KEAAAIEVGLYSVVAEHGSSMNKVHTPARRLARFYLHAWRTKSTAKQASAARAAVSGLAL  451

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLK---  2216
             V+KACG+DVPRLTFWLSN ++LRA I + +   Q    +E +      N  +++  K   
Sbjct  452   VSKACGSDVPRLTFWLSNSIMLRAIISQAAAGVQF---NEGAPTETTGNRGRSALEKIYM  508

Query  2217  WQSFPHKKSVGND--LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQ-S  2387
              QS     S GN   L   + +WE+   FT+ALEK+EAWIFS+I +S+WWQT TPHMQ S
Sbjct  509   QQSIKSIASQGNKSHLVKQYYNWEDIESFTQALEKLEAWIFSKITKSLWWQTLTPHMQFS  568

Query  2388  GAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLH  2561
              A TS    S + K Y+  +S   +E   FS++LWK+A +DA ER+CP+RAGGH+CGCL 
Sbjct  569   TAKTSKTRGSRVKKTYESRNSLGDQEQGKFSVKLWKRALKDACERLCPLRAGGHKCGCLP  628

Query  2562  LLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQL  2741
             +L KL+M+Q V+RLDVAMFNAILRES +++PTDP+ DPIS+ ++LPIPAGK+SF AGAQL
Sbjct  629   VLPKLVMKQLVSRLDVAMFNAILRESIEEMPTDPIFDPISDRKILPIPAGKSSFGAGAQL  688

Query  2742  KNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSD  2921
             KNA+G+WS WL DL G  D+            + +N  G+++K +    K F+LLNA+S+
Sbjct  689   KNAVGSWSGWLTDLIGFQDEVSP---------EYNNIFGNDKKQE--SFKAFHLLNALSN  737

Query  2922  LMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEV  3101
             LMMLP +ML+  + RKEVCP FG +LI RVL  F+PD+F PDPIP  V EAL+SED  + 
Sbjct  738   LMMLPFEMLIDASTRKEVCPIFGPALIKRVLTNFVPDDFRPDPIPMNVFEALDSEDVTDA  797

Query  3102  EEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldel  3281
               E + +FPC+    VY  P A +           +       SSVLKK+YTSD ELDEL
Sbjct  798   PGELLTSFPCTFTLPVYTSPPALS--LTTFIEKVGNQAPKIRGSSVLKKTYTSDVELDEL  855

Query  3282  dsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DSP      ++    K          N VRYQLLRE W
Sbjct  856   DSPFTSFLADS---FKDYPNLAKPARNIVRYQLLREAW  890


 Score =   146 bits (369),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 115/174 (66%), Gaps = 13/174 (7%)
 Frame = +3

Query  204  SVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRI  383
            S Q +Y+++I  I+PWPPS+SL+++++V++QWE+GD+NSG  T         S V +  +
Sbjct  12   SFQIDYIVHIQSIRPWPPSESLRSVQSVLLQWENGDRNSGFVT---------SSVEDDYL  62

Query  384  EFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFANYG  563
            E N++F + +TL RE  SK    D F KN +EF+LYE  ++   +GQLLGTA I+FA YG
Sbjct  63   EINKTFTLFLTLCREKKSK----DKFLKNNLEFSLYEYTKENAAQGQLLGTASINFAEYG  118

Query  564  VVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDS  725
            V+KE L +SVP+NCK+S ++ +QP L +K+Q     +   L+ ++   +S + S
Sbjct  119  VIKETLAISVPLNCKKSSKSLLQPSLYVKVQPAKDKQESDLMIDDAEDDSDVAS  172



>gb|EMT23332.1| hypothetical protein F775_06572 [Aegilops tauschii]
Length=721

 Score =   472 bits (1214),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 268/564 (48%), Positives = 361/564 (64%), Gaps = 26/564 (5%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T ++  D + +  +    VL R+ +EL+ K++ +E ELRE AA+E+ L+SV+ EHGSS +
Sbjct  159   TDDEIADIEEKMVDDDKAVLHRRNEELQSKLEKMEQELREVAALEVSLYSVLPEHGSSAH  218

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             K+H PARRLSRLY HA K  S  RR SAA++ VSGL+LV K+C ND  RLT+WLSN V+L
Sbjct  219   KLHTPARRLSRLYTHASKFWSPDRRASAAKNTVSGLVLVVKSCSNDASRLTYWLSNTVVL  278

Query  2112  RAAICK-FS-EKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTF----E  2273
             R  I K F   +Q  P  +  + N   +     S  +    P   S G      F    +
Sbjct  279   REIISKSFGISRQSTPTMTSKNLNGSAQWFDGKSTPRSMPVPWNHSNGKQTELAFIQIAD  338

Query  2274  DWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCS  2453
             +W+       ALE++E+WIFSRI+E++WWQ  TPHMQ+ A  S   +  K+     S   
Sbjct  339   NWQETSTLLAALERIESWIFSRIVETVWWQALTPHMQTPAEGSSTPKARKVL--GPSLGD  396

Query  2454  EEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILR  2633
             ++   FS+ LWK AF DAY R+CP+RAGGHECGCL +L+KL+M+QCVARLDVAMFNAILR
Sbjct  397   QQQGTFSVNLWKAAFHDAYSRLCPLRAGGHECGCLPVLAKLVMEQCVARLDVAMFNAILR  456

Query  2634  ESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedd  2813
             ESA +IPTDP+SDPI +P+VLPIPAG+ SF +GAQLKN+IGNWSRWL D  GID DD +D
Sbjct  457   ESASEIPTDPISDPIVDPKVLPIPAGELSFGSGAQLKNSIGNWSRWLTDNLGIDADDPED  516

Query  2814  dlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGL  2993
             +         D  NG++ +   A +K F LLN +SDL+M PKDML+ +++RKE+CP+ GL
Sbjct  517   EGF-------DIGNGNDERIGAAEAKSFKLLNELSDLLMTPKDMLIEKSIRKEICPSVGL  569

Query  2994  SLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSA  3167
              L+TR+L  F PDEFCPDP+P++VLE LNSE  +E    + ++  FPC AAPI Y  PS 
Sbjct  570   PLVTRILCNFTPDEFCPDPVPSIVLEELNSESLLERHTAKHAISAFPCIAAPIAYRAPS-  628

Query  3168  AAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP-----  3332
                      ++  S++L R  S V ++ YTSDD+LD+LDSPL  +  + S    P     
Sbjct  629   QLDVEEKVSVAGGSAKLDRRASMVQRRGYTSDDDLDDLDSPLASL-FDKSAPPSPSNGAT  687

Query  3333  --gggsgngngngVRYQLLREVWM  3398
                      +    R++LLREVW+
Sbjct  688   PFTAQQRGASMENARFELLREVWL  711



>ref|XP_009791125.1| PREDICTED: uncharacterized protein LOC104238468 isoform X1 [Nicotiana 
sylvestris]
Length=906

 Score =   478 bits (1229),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 293/641 (46%), Positives = 395/641 (62%), Gaps = 48/641 (7%)
 Frame = +3

Query  1545  LQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLR  1724
             L DN   + ++    + + R+++GA+ T   RL  V SV  + +S  AN  + + + + +
Sbjct  285   LSDNKIAKSMKRQGTMSSIRKALGAQITHG-RLKAVKSVQ-IRDSASANVFLGNTEIIKK  342

Query  1725  DKRNSIEGITSNDWKDTKVRSKETSNV-------------VLERKCQELEQKIQMLEGEL  1865
             + +      TS+  K T V  K+  N              V+ +   E E +IQMLE EL
Sbjct  343   EMKEHATIETSSIAKSTVVEDKKPKNTTSTSATEKRAPANVMSKSKPESESRIQMLEEEL  402

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             +EAAA+E+GL+SVVAEHGSS NKVH PARRL+R Y HA +  S  ++ SAAR+ VSGL L
Sbjct  403   KEAAAIEVGLYSVVAEHGSSMNKVHTPARRLARFYLHAWRTKSTAKQASAARAAVSGLAL  462

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAI------CKFSEKQQLPLSSEYSKNAVVKNERKAS  2207
             V+KACG+DVPRLTFWLSN ++LRA I       +F+E      +    ++A+ K   +  
Sbjct  463   VSKACGSDVPRLTFWLSNSIMLRAIISQAAAGVQFNEGAPTETTGNRGRSALEKIYMQ--  520

Query  2208  PLKWQSFPHKKSVGND--LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHM  2381
                 QS     S GN   L   + +WE+   FT+ALEK+EAWIFS+I +S+WWQT TPHM
Sbjct  521   ----QSIKSIASQGNKSHLVKQYYNWEDIESFTQALEKLEAWIFSKITKSLWWQTLTPHM  576

Query  2382  Q-SGAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECG  2552
             Q S A TS    S + K Y+  +S   +E   FS++LWK+A +DA ER+CP+RAGGH+CG
Sbjct  577   QFSTAKTSKTRGSRVKKTYESRNSLGDQEQGKFSVKLWKRALKDACERLCPLRAGGHKCG  636

Query  2553  CLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAG  2732
             CL +L KL+M+Q V+RLDVAMFNAILRES +++PTDP+ DPIS+ ++LPIPAGK+SF AG
Sbjct  637   CLPVLPKLVMKQLVSRLDVAMFNAILRESIEEMPTDPIFDPISDRKILPIPAGKSSFGAG  696

Query  2733  AQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNA  2912
             AQLKNA+G+WS WL DL G  D+            + +N  G+++K +    K F+LLNA
Sbjct  697   AQLKNAVGSWSGWLTDLIGFQDEVSP---------EYNNIFGNDKKQE--SFKAFHLLNA  745

Query  2913  MSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDH  3092
             +S+LMMLP +ML+  + RKEVCP FG +LI RVL  F+PD+F PDPIP  V EAL+SED 
Sbjct  746   LSNLMMLPFEMLIDASTRKEVCPIFGPALIKRVLTNFVPDDFRPDPIPMNVFEALDSEDV  805

Query  3093  MEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddel  3272
              +   E + +FPC+    VY  P A +           +       SSVLKK+YTSD EL
Sbjct  806   TDAPGELLTSFPCTFTLPVYTSPPALS--LTTFIEKVGNQAPKIRGSSVLKKTYTSDVEL  863

Query  3273  deldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DELDSP      ++    K          N VRYQLLRE W
Sbjct  864   DELDSPFTSFLADS---FKDYPNLAKPARNIVRYQLLREAW  901


 Score =   146 bits (369),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 115/174 (66%), Gaps = 13/174 (7%)
 Frame = +3

Query  204  SVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRI  383
            S Q +Y+++I  I+PWPPS+SL+++++V++QWE+GD+NSG  T         S V +  +
Sbjct  12   SFQIDYIVHIQSIRPWPPSESLRSVQSVLLQWENGDRNSGFVT---------SSVEDDYL  62

Query  384  EFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFANYG  563
            E N++F + +TL RE  SK    D F KN +EF+LYE  ++   +GQLLGTA I+FA YG
Sbjct  63   EINKTFTLFLTLCREKKSK----DKFLKNNLEFSLYEYTKENAAQGQLLGTASINFAEYG  118

Query  564  VVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVRRESSMDS  725
            V+KE L +SVP+NCK+S ++ +QP L +K+Q     +   L+ ++   +S + S
Sbjct  119  VIKETLAISVPLNCKKSSKSLLQPSLYVKVQPAKDKQESDLMIDDAEDDSDVAS  172



>ref|XP_010238583.1| PREDICTED: uncharacterized protein LOC100821761 [Brachypodium 
distachyon]
Length=916

 Score =   478 bits (1229),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 263/514 (51%), Positives = 341/514 (66%), Gaps = 27/514 (5%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             REAAA EIGL+SVVAEHGSS NKVH PARRLSR + HA K     +  SAA+S  SGL+L
Sbjct  421   REAAASEIGLYSVVAEHGSSANKVHTPARRLSRHFIHAFKNWPREKMGSAAKSASSGLVL  480

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQS  2225
             VAKACG DV RL+FWLSNCV+LRA + + S++  +      +        RK S   W+S
Sbjct  481   VAKACGYDVARLSFWLSNCVVLRAIVTENSKQSGVGNGINAADYNSKTTPRKNSASMWES  540

Query  2226  FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-  2402
                KK  G  L   F++WE+   F  AL+K+E+WIFSRI+E IWWQ FTPHMQS   +S 
Sbjct  541   LNRKK--GKLLAPEFDNWEDSDTFIAALKKIESWIFSRIVECIWWQAFTPHMQSAYTSSE  598

Query  2403  --LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKL  2576
                 S   K Y R +   +++    S+++WKKAF+ A E+ICPVRA GHECGCL +L+KL
Sbjct  599   SKTASSAKKCYGRITVVGNQQQATLSIDIWKKAFKQASEKICPVRAAGHECGCLPMLAKL  658

Query  2577  IMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIG  2756
             +M+QC+ARLD+AMFNAILRES D+IPTDP+SDPI++P+VLPI  GK SF AG QLKNAIG
Sbjct  659   VMEQCIARLDIAMFNAILRESEDEIPTDPMSDPITDPKVLPISIGKFSFGAGVQLKNAIG  718

Query  2757  NWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLP  2936
             +WSR L DLFG+           D ++  +  NG  +       KPFYLLNA+SDL+M+P
Sbjct  719   SWSRCLTDLFGM-----------DMDDYPEVDNGDGKSGIPETHKPFYLLNALSDLLMIP  767

Query  2937  KDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESV  3116
             KD+L+    RKE+CPTF  S++  +L+ F+PDEFCPDP+ + +L+AL  EDH+E  ++ +
Sbjct  768   KDVLVETNTRKELCPTFSSSIVRSILDGFVPDEFCPDPVQDSLLQALELEDHLEDSDKGI  827

Query  3117  VNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLN  3296
                PCSA+PI+Y  P++ A       I S      +S S+VL+KS TSDDELDEL SPL 
Sbjct  828   RAVPCSASPILYGYPASGA-------ILSIIGDPRKSGSAVLRKSNTSDDELDELSSPLT  880

Query  3297  LI-KMENSEVTKPgggsgngngngVRYQLLREVW  3395
              + K   + +TK       G  N  RY+LL EVW
Sbjct  881   FVSKAPPNPLTK---LKQIGGVNPARYRLLHEVW  911


 Score =   156 bits (395),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 126/200 (63%), Gaps = 8/200 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KT+   S+  ++ I I EI PWPPS+SLK+L++ V+ WE+G++NSG T  VAP
Sbjct  1    MVLGLRTKTKKDASIHVDFNIFIQEISPWPPSESLKSLRSAVLFWENGERNSGKTNAVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG   G+IEFNE   + +   ++ SSKS     +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SI--GSGSTAGKIEFNEFISIQVVFQKDGSSKS---GKWQKNLLELNLYEPRRD-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTV--GKGRMKSLVRNN  698
             LGTA +D A + +  E   + VP+N KRS++N   P++ L++Q +      + S  R+ 
Sbjct  115  HLGTATLDLAEHAMFHEDTAIPVPLNSKRSFKNNAHPMVYLRVQPLDGDTSSVSSTSRDA  174

Query  699  VRRESSMDSSAGESVSALMN  758
            + +E+S+D  + E +SA M+
Sbjct  175  LSKEASVDKDSKEFMSATMS  194



>ref|XP_007028896.1| Nucleolar protein gar2-related isoform 3 [Theobroma cacao]
 gb|EOY09398.1| Nucleolar protein gar2-related isoform 3 [Theobroma cacao]
Length=787

 Score =   473 bits (1218),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 265/551 (48%), Positives = 346/551 (63%), Gaps = 59/551 (11%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               L  K +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HAC
Sbjct  274   TALNEKIEEMETRIEKLEAELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHAC  333

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAI-------CKFSEK  2141
             K  +  +R + A++ VSGLIL+AK+CGNDV RLTFWLSN ++LR  I       C  S  
Sbjct  334   KHWTQNKRATIAKNSVSGLILIAKSCGNDVSRLTFWLSNTIVLREIISLAFGNSCNSSPL  393

Query  2142  QQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
              +LP S+  +K + +                            +DW+    FT ALEKVE
Sbjct  394   TRLPESNGSNKRSEL---------------------------VDDWQETGTFTSALEKVE  426

Query  2322  AWIFSRIIESIWWQTFTPHMQS-GAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             +WIFSRI+ES+WWQ  TPHMQ+    +S    + K+     +   ++  + S+ LWK AF
Sbjct  427   SWIFSRIVESVWWQALTPHMQALHEGSSASRTVGKLL--GPALGDQQQGSLSINLWKNAF  484

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
             +DA++R+CPVRA  HECGCL ++++++M+ C+ARLDVAMFNAILRESA +IPTDPVSDPI
Sbjct  485   QDAFQRLCPVRAEAHECGCLPVIARMVMEHCIARLDVAMFNAILRESAHEIPTDPVSDPI  544

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              + +VLPIPAG  SF +GAQLKN++GNWSRWL D+FG+D DD           K D  N 
Sbjct  545   VDSKVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMFGMDSDDAL---------KEDQPNS  595

Query  2859  HERKAQ--DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPD  3032
              +   Q  D  SK F  LNA+SDL+MLPKDML+ R++R EVCP+ GL L+ R+L  F PD
Sbjct  596   QDDFKQNGDGESKSFLFLNALSDLLMLPKDMLMDRSIRNEVCPSIGLPLVKRILCNFTPD  655

Query  3033  EFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             EFCPDP+P  VLEALN+E  +E  +  +S  +FP +AA +VY  PS +A        +  
Sbjct  656   EFCPDPVPGAVLEALNAESIVERRLSGDSARSFPYTAASVVYTSPS-SADVAEKVAKAGG  714

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLI--------KMENSEVTKPgggsgngngn  3362
              SQL+R+ S V +K YTSD+EL+ELDSPL  I         M  +               
Sbjct  715   KSQLSRNASVVQRKGYTSDEELEELDSPLASIIDKLPLSPTMVGNGRVNGKHEHEGCGAA  774

Query  3363  gVRYQLLREVW  3395
               RY+LLREVW
Sbjct  775   NARYELLREVW  785



>ref|XP_010057656.1| PREDICTED: uncharacterized protein LOC104445437 [Eucalyptus grandis]
 gb|KCW90259.1| hypothetical protein EUGRSUZ_A02411 [Eucalyptus grandis]
 gb|KCW90260.1| hypothetical protein EUGRSUZ_A02411 [Eucalyptus grandis]
Length=800

 Score =   473 bits (1218),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 280/549 (51%), Positives = 366/549 (67%), Gaps = 32/549 (6%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LE+K +E+E +I+ LE ELREAAA+EI L+SV  EHGSS +KVH PARRLSRLY HAC
Sbjct  264   AALEQKIEEMEMRIEKLEEELREAAALEISLYSVAPEHGSSAHKVHTPARRLSRLYIHAC  323

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPL  2156
             K  +  +R + A+++VSGL+L+AK+C NDVPRLTFWLSN V+LR  + +   S     P 
Sbjct  324   KHWTQDKRATIAKNIVSGLVLIAKSCSNDVPRLTFWLSNAVVLREIVSQAFGSSHNSSPF  383

Query  2157  SSEYSKNAV-VKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
             +     N    K+E K+  LKW+   + K     +    EDW+    FT ALEKVE WIF
Sbjct  384   TRFAESNGSDKKSEAKSMTLKWKGNSNFKQTTGSM-QFLEDWQETGTFTGALEKVEMWIF  442

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSE-INKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             SRI+ESIWWQ FTPHMQ+    S  S+   K+     +   ++  NFS+ LW  AF+DA+
Sbjct  443   SRIVESIWWQAFTPHMQTPVQDSFSSKSAGKLL--GPALGDQQQGNFSINLWTNAFQDAF  500

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
              ++CPVRA  HECGCL +L+K++M+QCVARLDVAMFNAILRESA +IPTDPVSDPI +  
Sbjct  501   RQMCPVRAARHECGCLPVLAKMVMEQCVARLDVAMFNAILRESAFEIPTDPVSDPIVDSR  560

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSRWL+D+FG+D+D+           + D  N  E  
Sbjct  561   VLPIPAGHLSFGSGAQLKNSVGNWSRWLSDMFGMDNDNPA---------EEDQHNNKEEF  611

Query  2871  AQ--DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCP  3044
              Q  D+  K F LLN +S+L+MLPKD++L R++RKEVCPT  L+L+ RVL  F PDEFCP
Sbjct  612   QQGGDSELKSFLLLNELSELLMLPKDLILDRSIRKEVCPTISLALVKRVLCNFTPDEFCP  671

Query  3045  DPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             D +P  VLEALN+E  +E  +  E+V NFP +AAP+ Y PPS +         +    QL
Sbjct  672   DSVPGAVLEALNAESIVERRISGETVRNFPYTAAPVTYCPPS-SLDVAEKVAEAGVRFQL  730

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngV----------  3368
             +R+ S+V +K YTSD+EL++L+SPL  I M+N   +     +GNGNG  V          
Sbjct  731   SRNVSAVQRKGYTSDEELEDLESPLVSI-MDNMYSSPTTVSNGNGNGKLVERPGYSLMNA  789

Query  3369  RYQLLREVW  3395
             RY+LLREVW
Sbjct  790   RYELLREVW  798



>gb|KHG14195.1| myoH [Gossypium arboreum]
Length=807

 Score =   474 bits (1219),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 276/576 (48%), Positives = 370/576 (64%), Gaps = 28/576 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             VL +  N  +   S N+  D + + +  +   L  K  E+E +I+ L+ ELRE AA+EI 
Sbjct  242   VLDETSNGYKSFASGNEPVDAEDKFQVENEAALNEKINEMETRIEKLKAELREVAALEIS  301

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV+EHGSS +K+H PARRLSRLY HACK     +R + A++ VSGLIL AK+C NDV
Sbjct  302   LYSVVSEHGSSAHKLHTPARRLSRLYIHACKHWEQNKRATIAKNTVSGLILTAKSCSNDV  361

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKS  2243
              RLTFWLSN ++LR  I +   + +   PL+     N   K +E K S LKW+     K 
Sbjct  362   SRLTFWLSNTIVLREIISQAFGNSRNSSPLAWLPELNGSNKRSEVKPSTLKWKGGVGSKQ  421

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-LDSEIN  2420
             V + +P   +DW+    FT ALEKVE+WIFSRI+ES+WWQ  TP+MQ     S +   I 
Sbjct  422   VNSFMP-LVDDWQETGTFTNALEKVESWIFSRIVESVWWQALTPYMQIPLEGSPVSKTIG  480

Query  2421  KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVAR  2600
             K+     +   ++  +FS+ LW  AF+DA++R+CPVRAGGHECGCL ++++L+M+QCVAR
Sbjct  481   KLL--GPALGDQQQGSFSINLWINAFQDAFQRLCPVRAGGHECGCLPVIARLVMEQCVAR  538

Query  2601  LDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLAD  2780
             LDVAMFNAILRESA +IPTDP+SDPI +  VLPIPAG  SF +GAQLKNA+GNW RWL D
Sbjct  539   LDVAMFNAILRESAHEIPTDPISDPIVDSRVLPIPAGDLSFGSGAQLKNAVGNWCRWLTD  598

Query  2781  LFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRT  2960
             +FG+D D   ++          +S    RK  D  SK F  LN++SDL+MLPKDML+ R+
Sbjct  599   MFGMDGDYNLNEDQR-------SSQDDFRKNGDGESKSFLFLNSLSDLLMLPKDMLMDRS  651

Query  2961  VRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCS  3134
             +R+E+CP+ GL L+ R+L  F PDEFCPDP+P  VLEALN+E  +E  +      +FP +
Sbjct  652   IREELCPSIGLPLVKRILCNFTPDEFCPDPVPGAVLEALNAETIVERRLSGGPARSFPYT  711

Query  3135  AAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLN-LIK--  3305
             AA +VY P S+A         +   S L+R+ S V +K YTSD+EL+EL+SPL+ LI+  
Sbjct  712   AALVVYTPLSSA-DVAEKVAGAGGKSPLSRNASVVQRKGYTSDEELEELNSPLSSLIEKL  770

Query  3306  ------MENSEVTKPgggsgngngngVRYQLLREVW  3395
                   + N EV           G   RY+LLREVW
Sbjct  771   PLSPTIVTNGEVNG-NHEHAGYCGINARYELLREVW  805



>ref|XP_008662663.1| PREDICTED: uncharacterized protein LOC103641028 [Zea mays]
 ref|XP_008662664.1| PREDICTED: uncharacterized protein LOC103641028 [Zea mays]
 ref|XP_008662665.1| PREDICTED: uncharacterized protein LOC103641028 [Zea mays]
 ref|XP_008662666.1| PREDICTED: uncharacterized protein LOC103641028 [Zea mays]
 ref|XP_008662667.1| PREDICTED: uncharacterized protein LOC103641028 [Zea mays]
 gb|AFW56727.1| hypothetical protein ZEAMMB73_979442 [Zea mays]
 gb|AFW56728.1| hypothetical protein ZEAMMB73_979442 [Zea mays]
Length=903

 Score =   476 bits (1226),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 336/506 (66%), Gaps = 26/506 (5%)
 Frame = +3

Query  1887  IGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGN  2066
             IGL+S++AEHGSS NKVH PARRLSR + HA K  S  +  SAAR+  SGL+LVAKACG 
Sbjct  416   IGLYSIIAEHGSSVNKVHTPARRLSRHFVHALKNCSRDKMGSAARNTTSGLVLVAKACGY  475

Query  2067  DVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSV  2246
             D+ RL+FWLSNCV+LRA + + S +     SS Y         RK S   W+S   KK  
Sbjct  476   DIARLSFWLSNCVVLRAIVTETSRQSGTVNSSNYGDYNSKTTYRKNSASMWESLNRKK--  533

Query  2247  GNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-LDSEIN-  2420
             G  L   F++WE+   F  AL+K+E+WIFSRI+E++WWQTFTPHMQS   T  L S  N 
Sbjct  534   GKLLSPEFDNWEDVDTFIAALKKIESWIFSRIVETLWWQTFTPHMQSADITGGLRSTPNP  593

Query  2421  -KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVA  2597
              K Y +     +++    S+++WKKAF++A ER+CPVRA GHECGCL +L+KL+M+QC+A
Sbjct  594   KKGYGKIPVVGNQQQATISMDIWKKAFKEASERLCPVRAAGHECGCLPMLTKLVMEQCIA  653

Query  2598  RLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLA  2777
             RLDVAMFNAILRES D+IPTDP+SDPI++P+VLPIP+GK SF AG QLKNAIG+WSR L 
Sbjct  654   RLDVAMFNAILRESDDEIPTDPLSDPITDPKVLPIPSGKFSFGAGVQLKNAIGSWSRCLT  713

Query  2778  DLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSR  2957
             DLFG+           DD  + DN  G     +    KPFY LNA+SDL+MLPKD+L+  
Sbjct  714   DLFGM---------DMDDYQELDNEGGENGFGESV--KPFYHLNALSDLLMLPKDVLMDT  762

Query  2958  TVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSA  3137
             + RKE+CPTF  S+I  +L+VF+PDEFCPDPI   +L+AL  EDH+EV  + + + PCSA
Sbjct  763   SSRKELCPTFSSSIIKNILDVFLPDEFCPDPIQGSLLQALELEDHLEV-NKGIRSIPCSA  821

Query  3138  APIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENS  3317
             +PI+Y  P + A       I S      +S S++L KS TSDDELDEL SPL  I   N+
Sbjct  822   SPILYNAPVSGA-------ILSVIGDPRKSGSAILHKSNTSDDELDELSSPLTFI--SNT  872

Query  3318  EVTKPgggsgngngngVRYQLLREVW  3395
                         N    RY+LL EVW
Sbjct  873   SSDPLAKLKRISNSTTARYRLLHEVW  898


 Score =   153 bits (386),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 124/195 (64%), Gaps = 6/195 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KTR   +   ++ I I EI PWPPS+SLK+L++VV+ WE+G++NSG T+ VAP
Sbjct  1    MVLGLRTKTRKDSAFHVDFNILIQEISPWPPSESLKSLRSVVLFWENGERNSGKTSTVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG   G+IEFNE   +     +E SSKS     +QKN +E NLYEPRR+  +KGQ
Sbjct  61   SI--GSGSTAGKIEFNEFINLQAIFQKEGSSKS---GKWQKNLLELNLYEPRRE-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LG+A +D A + +  E  +V VP++ KRS++N  QP++ L+IQ +         R+ + 
Sbjct  115  HLGSATLDLAEHAMFHEDTSVPVPLSSKRSFKNNAQPMVYLRIQPLDGDNSSVSSRDALS  174

Query  705  RESSMDSSAGESVSA  749
            +E+S+D  + E VSA
Sbjct  175  QEASVDKDSKEFVSA  189



>gb|KHG14194.1| myoH [Gossypium arboreum]
Length=825

 Score =   474 bits (1219),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 276/576 (48%), Positives = 370/576 (64%), Gaps = 28/576 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITS-NDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             VL +  N  +   S N+  D + + +  +   L  K  E+E +I+ L+ ELRE AA+EI 
Sbjct  260   VLDETSNGYKSFASGNEPVDAEDKFQVENEAALNEKINEMETRIEKLKAELREVAALEIS  319

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV+EHGSS +K+H PARRLSRLY HACK     +R + A++ VSGLIL AK+C NDV
Sbjct  320   LYSVVSEHGSSAHKLHTPARRLSRLYIHACKHWEQNKRATIAKNTVSGLILTAKSCSNDV  379

Query  2073  PRLTFWLSNCVLLRAAICKF--SEKQQLPLSSEYSKNAVVK-NERKASPLKWQSFPHKKS  2243
              RLTFWLSN ++LR  I +   + +   PL+     N   K +E K S LKW+     K 
Sbjct  380   SRLTFWLSNTIVLREIISQAFGNSRNSSPLAWLPELNGSNKRSEVKPSTLKWKGGVGSKQ  439

Query  2244  VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-LDSEIN  2420
             V + +P   +DW+    FT ALEKVE+WIFSRI+ES+WWQ  TP+MQ     S +   I 
Sbjct  440   VNSFMP-LVDDWQETGTFTNALEKVESWIFSRIVESVWWQALTPYMQIPLEGSPVSKTIG  498

Query  2421  KIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVAR  2600
             K+     +   ++  +FS+ LW  AF+DA++R+CPVRAGGHECGCL ++++L+M+QCVAR
Sbjct  499   KLL--GPALGDQQQGSFSINLWINAFQDAFQRLCPVRAGGHECGCLPVIARLVMEQCVAR  556

Query  2601  LDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLAD  2780
             LDVAMFNAILRESA +IPTDP+SDPI +  VLPIPAG  SF +GAQLKNA+GNW RWL D
Sbjct  557   LDVAMFNAILRESAHEIPTDPISDPIVDSRVLPIPAGDLSFGSGAQLKNAVGNWCRWLTD  616

Query  2781  LFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRT  2960
             +FG+D D   ++          +S    RK  D  SK F  LN++SDL+MLPKDML+ R+
Sbjct  617   MFGMDGDYNLNEDQR-------SSQDDFRKNGDGESKSFLFLNSLSDLLMLPKDMLMDRS  669

Query  2961  VRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCS  3134
             +R+E+CP+ GL L+ R+L  F PDEFCPDP+P  VLEALN+E  +E  +      +FP +
Sbjct  670   IREELCPSIGLPLVKRILCNFTPDEFCPDPVPGAVLEALNAETIVERRLSGGPARSFPYT  729

Query  3135  AAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLN-LIK--  3305
             AA +VY P S+A         +   S L+R+ S V +K YTSD+EL+EL+SPL+ LI+  
Sbjct  730   AALVVYTPLSSA-DVAEKVAGAGGKSPLSRNASVVQRKGYTSDEELEELNSPLSSLIEKL  788

Query  3306  ------MENSEVTKPgggsgngngngVRYQLLREVW  3395
                   + N EV           G   RY+LLREVW
Sbjct  789   PLSPTIVTNGEVNG-NHEHAGYCGINARYELLREVW  823



>ref|XP_006363839.1| PREDICTED: uncharacterized protein LOC102597710 isoform X1 [Solanum 
tuberosum]
 ref|XP_006363840.1| PREDICTED: uncharacterized protein LOC102597710 isoform X2 [Solanum 
tuberosum]
Length=810

 Score =   473 bits (1216),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 273/549 (50%), Positives = 360/549 (66%), Gaps = 26/549 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
              VLE+K  E+E +++ LE ELRE AA+EI L+SVV+EHGSS +K+H PARRLSRLY HAC
Sbjct  273   AVLEQKIGEMESRLEKLEEELREVAALEIALYSVVSEHGSSAHKLHTPARRLSRLYLHAC  332

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK---FSEKQQLP  2153
             K  S  +R + A++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +    S      
Sbjct  333   KYWSQDKRATVAKNTVSGLVLVAKSCGNDVARLTFWLSNAVVLRVIISQAFGSSCSSSSL  392

Query  2154  LSSEYSKNAVVKNERKASPLKWQSFP-HKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
             ++         K E K S LKW++ P  K+S  NDL   F+DW+    FT ALE+VE+WI
Sbjct  393   VTITVPNGRGNKTESKVSSLKWKAHPGSKQSSKNDLLKFFDDWQETRTFTAALERVESWI  452

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSE-INKIYQRTSSSCSEEPENFSLELWKKAFRDA  2507
             FSRI+ESIWWQT TP+MQS     + S+ + ++     +   ++  NFS+ LWK AF++A
Sbjct  453   FSRIVESIWWQTLTPNMQSPTDDPMTSKSVGRLL--GPALGDQQQGNFSINLWKHAFQEA  510

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CPVRA  HECGCL +L++ +++ CVARLD+AMFNAILRESA +IPTDP+SDPI + 
Sbjct  511   LKRLCPVRAESHECGCLPVLARRVIEHCVARLDIAMFNAILRESAHEIPTDPISDPIVDS  570

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHER  2867
             +VLPIPAG  SF +GAQLKN++GNWSR L DLFG+       D  +  +N  D+S    R
Sbjct  571   KVLPIPAGDLSFGSGAQLKNSVGNWSRCLTDLFGM-------DAEDSGKNDEDSSGDDHR  623

Query  2868  KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPD  3047
             K  +     FYLLNA+SDL+MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCPD
Sbjct  624   KGGNQLEH-FYLLNALSDLLMLPKDMLMDRTIRMEVCPSISLPLVKRILCNFSPDEFCPD  682

Query  3048  PIPNVVLEALNSEDHMEVE---EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             P+P  VLEALN+E  +       +S  +FP  AAP+VY PP  A             S L
Sbjct  683   PVPGAVLEALNAESIIARRLSGGDSSNSFPYPAAPVVYTPP-VAVDVAEKVAEIEGKSHL  741

Query  3219  trsrssVLKKSYTsddeldeldsPLNLI--KMENSEVT-----KPgggsgngngngVRYQ  3377
             + S S++ +K YTSD+EL+E++SPL  I  KM +S  +               G+  RY 
Sbjct  742   SWSASAIQRKGYTSDEELEEINSPLACIIDKMASSPASAENGKDKQKEETGSIGSNTRYG  801

Query  3378  LLREVWMSS  3404
             LLREVW ++
Sbjct  802   LLREVWKAA  810



>ref|XP_006363841.1| PREDICTED: uncharacterized protein LOC102597710 isoform X3 [Solanum 
tuberosum]
Length=715

 Score =   469 bits (1207),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 273/548 (50%), Positives = 360/548 (66%), Gaps = 26/548 (5%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             VLE+K  E+E +++ LE ELRE AA+EI L+SVV+EHGSS +K+H PARRLSRLY HACK
Sbjct  179   VLEQKIGEMESRLEKLEEELREVAALEIALYSVVSEHGSSAHKLHTPARRLSRLYLHACK  238

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK---FSEKQQLPL  2156
               S  +R + A++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +    S      +
Sbjct  239   YWSQDKRATVAKNTVSGLVLVAKSCGNDVARLTFWLSNAVVLRVIISQAFGSSCSSSSLV  298

Query  2157  SSEYSKNAVVKNERKASPLKWQSFP-HKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
             +         K E K S LKW++ P  K+S  NDL   F+DW+    FT ALE+VE+WIF
Sbjct  299   TITVPNGRGNKTESKVSSLKWKAHPGSKQSSKNDLLKFFDDWQETRTFTAALERVESWIF  358

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSE-INKIYQRTSSSCSEEPENFSLELWKKAFRDAY  2510
             SRI+ESIWWQT TP+MQS     + S+ + ++     +   ++  NFS+ LWK AF++A 
Sbjct  359   SRIVESIWWQTLTPNMQSPTDDPMTSKSVGRLL--GPALGDQQQGNFSINLWKHAFQEAL  416

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRA  HECGCL +L++ +++ CVARLD+AMFNAILRESA +IPTDP+SDPI + +
Sbjct  417   KRLCPVRAESHECGCLPVLARRVIEHCVARLDIAMFNAILRESAHEIPTDPISDPIVDSK  476

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSR L DLFG+       D  +  +N  D+S    RK
Sbjct  477   VLPIPAGDLSFGSGAQLKNSVGNWSRCLTDLFGM-------DAEDSGKNDEDSSGDDHRK  529

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
               +     FYLLNA+SDL+MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCPDP
Sbjct  530   GGNQLEH-FYLLNALSDLLMLPKDMLMDRTIRMEVCPSISLPLVKRILCNFSPDEFCPDP  588

Query  3051  IPNVVLEALNSEDHMEVE---EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqlt  3221
             +P  VLEALN+E  +       +S  +FP  AAP+VY PP  A             S L+
Sbjct  589   VPGAVLEALNAESIIARRLSGGDSSNSFPYPAAPVVYTPP-VAVDVAEKVAEIEGKSHLS  647

Query  3222  rsrssVLKKSYTsddeldeldsPLNLI--KMENSEVT-----KPgggsgngngngVRYQL  3380
              S S++ +K YTSD+EL+E++SPL  I  KM +S  +               G+  RY L
Sbjct  648   WSASAIQRKGYTSDEELEEINSPLACIIDKMASSPASAENGKDKQKEETGSIGSNTRYGL  707

Query  3381  LREVWMSS  3404
             LREVW ++
Sbjct  708   LREVWKAA  715



>ref|XP_009630632.1| PREDICTED: uncharacterized protein LOC104120545 isoform X2 [Nicotiana 
tomentosiformis]
Length=895

 Score =   474 bits (1221),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 295/638 (46%), Positives = 393/638 (62%), Gaps = 42/638 (7%)
 Frame = +3

Query  1545  LQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLR  1724
             L DN   + ++    + + R+++GA+ T   RL  V SV  + +S  AN  + + + + +
Sbjct  274   LSDNKIAKSMKRQGTMSSIRKALGAQITHG-RLKPVKSVQ-IRDSASANVFLGNTEIIKK  331

Query  1725  DKRNSIEGITSNDWKDTKVRSKETSNV-------------VLERKCQELEQKIQMLEGEL  1865
             + +      TS+  K T V  KE  N              V+ +   E E +IQMLE EL
Sbjct  332   EIKEHTPIETSSIAKSTVVEKKEPKNTTSTSATEKRDPANVMSKSKPESESRIQMLEEEL  391

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             +EAAA+E+GL+SVVAEHGSS NKVH PARRL+R Y HA +  S  ++ SAAR+ VSGL L
Sbjct  392   KEAAAIEVGLYSVVAEHGSSMNKVHTPARRLARFYLHAWRTKSTAKQASAARAAVSGLAL  451

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLK---  2216
             V+KACG+DVPRLTFWLSN ++LRA I + +   Q    +E +      N+ +++  K   
Sbjct  452   VSKACGSDVPRLTFWLSNSIMLRAIISQAAAGVQF---NEGAPTETTGNKGRSALEKIYM  508

Query  2217  WQSFPHKKSVGND--LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQ-S  2387
              QS     S GN   L   + +WE+   FT+ALEK+E WIFS+I +S+WWQT TPHMQ S
Sbjct  509   QQSIKSIASQGNKSHLVKQYYNWEDIESFTQALEKLEGWIFSKITKSLWWQTLTPHMQFS  568

Query  2388  GAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLH  2561
              A TS    S + K Y    S   +E   FS++LWK+A +DA ER+CP+RAGGH+CGCL 
Sbjct  569   TAKTSKTKGSRVKKTYGSRHSLGDQEQGKFSVKLWKRALKDACERLCPLRAGGHKCGCLP  628

Query  2562  LLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQL  2741
             +L KL+M+Q V+RLDVAMFNAILRES +++PTDPV DPIS+ +VLPIPAGK+SF AGAQL
Sbjct  629   VLPKLVMKQLVSRLDVAMFNAILRESTEEMPTDPVFDPISDRKVLPIPAGKSSFGAGAQL  688

Query  2742  KNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSD  2921
             KNA+G+WS WL DL G  D+            + +N  G+++K +    K F  LNA+S+
Sbjct  689   KNAVGSWSGWLTDLIGFQDEVSP---------EYNNIFGNDKKPESF--KAFRFLNALSN  737

Query  2922  LMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEV  3101
             LMMLP +ML+  + RKEVCP  G +LI RVL  F+PD+F PDPIP  VLEAL+SED  + 
Sbjct  738   LMMLPFEMLIDASTRKEVCPILGPALIKRVLANFVPDDFRPDPIPMNVLEALDSEDVKDA  797

Query  3102  EEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldel  3281
               E + +FPC+    VY PP A +    +      +       SSVLKK+YTSD ELDEL
Sbjct  798   PGELLTSFPCTFTLPVYTPPPALS--LTIFIEKVGNQAPKIRGSSVLKKTYTSDVELDEL  855

Query  3282  dsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DSP      ++    K          N VRYQLLRE W
Sbjct  856   DSPFTSFLADS---FKDYPNLAKPARNIVRYQLLREAW  890


 Score =   144 bits (363),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 106/151 (70%), Gaps = 13/151 (9%)
 Frame = +3

Query  204  SVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRI  383
            S Q +Y+++I  I+PWPPS+SL+++++V++QWE+GD+NSG  T         S V +  +
Sbjct  12   SFQIDYIVHIQLIRPWPPSESLRSVQSVLLQWENGDRNSGFVT---------SSVEDDYL  62

Query  384  EFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFANYG  563
            E N++F + +TL RE  SK    D F KN +EF+LYE  ++   +GQLLGTA I+FA YG
Sbjct  63   EINKTFTLFLTLCREKKSK----DKFLKNNLEFSLYEYTKENAAQGQLLGTASINFAEYG  118

Query  564  VVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            V+KE L +SVP+NCK+S ++ +QP L +K+Q
Sbjct  119  VIKETLAISVPLNCKKSSKSLLQPSLYVKVQ  149



>ref|XP_011086757.1| PREDICTED: uncharacterized protein LOC105168391 [Sesamum indicum]
 ref|XP_011086758.1| PREDICTED: uncharacterized protein LOC105168391 [Sesamum indicum]
Length=992

 Score =   477 bits (1228),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 304/672 (45%), Positives = 404/672 (60%), Gaps = 55/672 (8%)
 Frame = +3

Query  1455  ERDKHQETGEGKELIIE-KGQCSEGEPVNSCLQDNTTKQH-LEGNSAIIAGRE--SVGAK  1622
             E+ + Q+ GE  E I+E      E   +   L +N TK H +  N  ++  R+  ++   
Sbjct  355   EKRREQKDGERDEHIMEGTNHVPEKSLLGKFLSENDTKSHDIMRNDMLVPNRQGAAIPPS  414

Query  1623  TTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSN  1802
             ++   RL HV SV         +GS++ N F L D     +    +  + ++ + K   +
Sbjct  415   SSNKARLKHVKSVQI-------HGSIKGNGF-LADIYGGGKPPDLDIPRGSQKKGKPKGD  466

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               L     E   +++MLE ELREAAA+E+GL+S+VAEH SS NKVH PARRLSR Y +AC
Sbjct  467   --LSDSKNEWRNRVEMLEEELREAAAIEVGLYSIVAEHSSSGNKVHTPARRLSRFYNNAC  524

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             +  S  +R  AAR+ +SGL+LV+KACGNDV RLTFWLSN ++LRA + + +   +LP SS
Sbjct  525   RTGSQAKRACAARAALSGLVLVSKACGNDVTRLTFWLSNSIMLRAIVSQTA--AELPHSS  582

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDLP--------GTFEDWENPLGFTKALEKV  2318
                  A       A P      P+++ V + L         G  +DWE+ L F  A+EKV
Sbjct  583   -----APTIKSNGAGPELTSKHPNRR-VDSSLVEGQKSSSIGESDDWEDVLTFIIAVEKV  636

Query  2319  EAWIFSRIIESIWWQTFTPHMQSG----AATSLDSEINKIYQRTSSSCSEEPENFSLELW  2486
             EAW+FSRI+ES+WWQTFTPHMQ      +  S  S   K   + ++  + E  N+S+ELW
Sbjct  637   EAWLFSRIVESVWWQTFTPHMQPTITERSYRSKGSGKKKTSGKRNTLGNHEQVNYSIELW  696

Query  2487  KKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPV  2666
             KKAF+DA ER+CP+RAGG ECGCL  L   +M+Q V RLDVAMFNAILRESA D+PTDPV
Sbjct  697   KKAFKDACERLCPIRAGGRECGCLSALVIRVMEQLVNRLDVAMFNAILRESAKDMPTDPV  756

Query  2667  SDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKAD  2846
             SDPI +  VLP+PAGK+SF AGAQLKN IGNWSRWL DLFG++DD  +           D
Sbjct  757   SDPICDSNVLPVPAGKSSFGAGAQLKNVIGNWSRWLTDLFGLEDDSTE-----------D  805

Query  2847  NSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
             N  G+ ++++    K F LL+A+SDLMMLP  ML   + RKEVCPTFG ++I RVLN F+
Sbjct  806   NVLGNSKRSKSF--KAFRLLHALSDLMMLPFGMLADASTRKEVCPTFGPAIIKRVLNNFV  863

Query  3027  PDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisss  3206
             PDEFCP PIP  ++ AL+SE+  +   + +  FPC A+   Y+PP AA    +       
Sbjct  864   PDEFCPYPIPRNIINALDSEEISDSLGDVITTFPCRASLTKYSPPPAA---LLTCVGEVG  920

Query  3207  ssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngng-----VR  3371
                L  SR S LKKSYTSDDELDELDSPL  I  ++ + +                  +R
Sbjct  921   RQVLKSSRLSTLKKSYTSDDELDELDSPLISIIPDSCQSSSALAKLSLMPKEKGGRNVLR  980

Query  3372  YQLLREVWMSSE  3407
             YQLLRE+W   E
Sbjct  981   YQLLREIWRGDE  992


 Score =   146 bits (368),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 115/168 (68%), Gaps = 15/168 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +    ++ +Y++++ EI+PWPPS+SLK+++ V++QWE+GD+NSGS   VA 
Sbjct  1    MVLGLKSKHKKGAVIKVDYIVHVQEIRPWPPSESLKSVQTVLLQWENGDQNSGSFLTVA-  59

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                    G+  I FNESF +P+TL ++ +S     D F+KN +EF+L+EPR+D   KGQ
Sbjct  60   --------GDSNIVFNESFMLPLTLYQKKAS-----DKFRKNYLEFSLFEPRKD-KAKGQ  105

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK  668
            LLGTA+ + A+Y ++++ L+++ P+N K++  N VQP L + ++ V +
Sbjct  106  LLGTALFNLADYALIEDVLSINAPLNLKKNGNNLVQPALVISLELVAR  153



>ref|XP_009630631.1| PREDICTED: uncharacterized protein LOC104120545 isoform X1 [Nicotiana 
tomentosiformis]
Length=906

 Score =   474 bits (1221),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 295/638 (46%), Positives = 393/638 (62%), Gaps = 42/638 (7%)
 Frame = +3

Query  1545  LQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLR  1724
             L DN   + ++    + + R+++GA+ T   RL  V SV  + +S  AN  + + + + +
Sbjct  285   LSDNKIAKSMKRQGTMSSIRKALGAQITHG-RLKPVKSVQ-IRDSASANVFLGNTEIIKK  342

Query  1725  DKRNSIEGITSNDWKDTKVRSKETSNV-------------VLERKCQELEQKIQMLEGEL  1865
             + +      TS+  K T V  KE  N              V+ +   E E +IQMLE EL
Sbjct  343   EIKEHTPIETSSIAKSTVVEKKEPKNTTSTSATEKRDPANVMSKSKPESESRIQMLEEEL  402

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             +EAAA+E+GL+SVVAEHGSS NKVH PARRL+R Y HA +  S  ++ SAAR+ VSGL L
Sbjct  403   KEAAAIEVGLYSVVAEHGSSMNKVHTPARRLARFYLHAWRTKSTAKQASAARAAVSGLAL  462

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLK---  2216
             V+KACG+DVPRLTFWLSN ++LRA I + +   Q    +E +      N+ +++  K   
Sbjct  463   VSKACGSDVPRLTFWLSNSIMLRAIISQAAAGVQF---NEGAPTETTGNKGRSALEKIYM  519

Query  2217  WQSFPHKKSVGND--LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQ-S  2387
              QS     S GN   L   + +WE+   FT+ALEK+E WIFS+I +S+WWQT TPHMQ S
Sbjct  520   QQSIKSIASQGNKSHLVKQYYNWEDIESFTQALEKLEGWIFSKITKSLWWQTLTPHMQFS  579

Query  2388  GAATSLD--SEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLH  2561
              A TS    S + K Y    S   +E   FS++LWK+A +DA ER+CP+RAGGH+CGCL 
Sbjct  580   TAKTSKTKGSRVKKTYGSRHSLGDQEQGKFSVKLWKRALKDACERLCPLRAGGHKCGCLP  639

Query  2562  LLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQL  2741
             +L KL+M+Q V+RLDVAMFNAILRES +++PTDPV DPIS+ +VLPIPAGK+SF AGAQL
Sbjct  640   VLPKLVMKQLVSRLDVAMFNAILRESTEEMPTDPVFDPISDRKVLPIPAGKSSFGAGAQL  699

Query  2742  KNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSD  2921
             KNA+G+WS WL DL G  D+            + +N  G+++K +    K F  LNA+S+
Sbjct  700   KNAVGSWSGWLTDLIGFQDEVSP---------EYNNIFGNDKKPESF--KAFRFLNALSN  748

Query  2922  LMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEV  3101
             LMMLP +ML+  + RKEVCP  G +LI RVL  F+PD+F PDPIP  VLEAL+SED  + 
Sbjct  749   LMMLPFEMLIDASTRKEVCPILGPALIKRVLANFVPDDFRPDPIPMNVLEALDSEDVKDA  808

Query  3102  EEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldel  3281
               E + +FPC+    VY PP A +    +      +       SSVLKK+YTSD ELDEL
Sbjct  809   PGELLTSFPCTFTLPVYTPPPALS--LTIFIEKVGNQAPKIRGSSVLKKTYTSDVELDEL  866

Query  3282  dsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DSP      ++    K          N VRYQLLRE W
Sbjct  867   DSPFTSFLADS---FKDYPNLAKPARNIVRYQLLREAW  901


 Score =   144 bits (363),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 106/151 (70%), Gaps = 13/151 (9%)
 Frame = +3

Query  204  SVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAPMLETESGVGNGRI  383
            S Q +Y+++I  I+PWPPS+SL+++++V++QWE+GD+NSG  T         S V +  +
Sbjct  12   SFQIDYIVHIQLIRPWPPSESLRSVQSVLLQWENGDRNSGFVT---------SSVEDDYL  62

Query  384  EFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQLLGTAVIDFANYG  563
            E N++F + +TL RE  SK    D F KN +EF+LYE  ++   +GQLLGTA I+FA YG
Sbjct  63   EINKTFTLFLTLCREKKSK----DKFLKNNLEFSLYEYTKENAAQGQLLGTASINFAEYG  118

Query  564  VVKEGLNVSVPINCKRSYRNTVQPLLCLKIQ  656
            V+KE L +SVP+NCK+S ++ +QP L +K+Q
Sbjct  119  VIKETLAISVPLNCKKSSKSLLQPSLYVKVQ  149



>ref|XP_004234749.1| PREDICTED: uncharacterized protein LOC101260514 [Solanum lycopersicum]
 ref|XP_010317856.1| PREDICTED: uncharacterized protein LOC101260514 [Solanum lycopersicum]
 ref|XP_010317857.1| PREDICTED: uncharacterized protein LOC101260514 [Solanum lycopersicum]
Length=810

 Score =   471 bits (1212),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 275/549 (50%), Positives = 364/549 (66%), Gaps = 28/549 (5%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             VLE+K  E+E +++ LE ELRE AA+EI L+SVV+EHGSS +K+H PARRLSRLY HACK
Sbjct  274   VLEQKIGEMESRLEKLEEELREVAALEIALYSVVSEHGSSAHKLHTPARRLSRLYLHACK  333

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK----FSEKQQLP  2153
               S  +R + A++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +          L 
Sbjct  334   YWSQDKRATVAKNTVSGLVLVAKSCGNDVARLTFWLSNAVVLRVIISQAFGSSCSSSSLV  393

Query  2154  LSSEYSKNAVVKNERKASPLKWQSFP-HKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
              + E ++    K E K S LKW++ P  K+S  NDL   F+DW+    FT ALE+VE+WI
Sbjct  394   TTIEPNRRGN-KTESKVSSLKWKTHPGSKQSNKNDLLKLFDDWQETRTFTVALERVESWI  452

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSE-INKIYQRTSSSCSEEPENFSLELWKKAFRDA  2507
             FSRI+ESIWWQTFTP+MQS     + S+ + ++     +   ++  NFS+ LWK AF++A
Sbjct  453   FSRIVESIWWQTFTPNMQSPTDDPMTSKSVGRLL--GPALGDQQQGNFSINLWKHAFQEA  510

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CPVRAG HECGCL +L++ +++ CVARLD+A+FNAILRESA +IPTDP+SDPI + 
Sbjct  511   LKRLCPVRAGIHECGCLPVLARRVIEHCVARLDIAIFNAILRESAHEIPTDPISDPIVDS  570

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHER  2867
             +VLPIPAG+ SF +GAQLKN++GNWSR L DLFG+       D  +  +N  D S    R
Sbjct  571   KVLPIPAGELSFGSGAQLKNSVGNWSRCLTDLFGM-------DAEDSGKNDEDGSGDDHR  623

Query  2868  KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPD  3047
             K  +     FYLLN++SDL+MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCPD
Sbjct  624   KGGNQLEH-FYLLNSLSDLLMLPKDMLMDRTIRMEVCPSISLPLVKRILCNFSPDEFCPD  682

Query  3048  PIPNVVLEALNSEDHMEVEEE---SVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             P+P  VLEALN+E  +        S  +FP  AAP+VY PP  A             S L
Sbjct  683   PVPGAVLEALNAECIIARRLSGGYSSSSFPYPAAPVVYTPP-VAVDVAEKVAEIEGKSHL  741

Query  3219  trsrssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngng-----ngVRYQ  3377
             +RS S++ +K YTSD+EL+E++SPL  I  KM +S  +   G            +  RY 
Sbjct  742   SRSASAIQRKGYTSDEELEEINSPLACIIDKMASSPASTENGKDKEKEERGSIGSNTRYG  801

Query  3378  LLREVWMSS  3404
             LLREVW ++
Sbjct  802   LLREVWKAA  810



>ref|XP_009769977.1| PREDICTED: uncharacterized protein LOC104220744 isoform X2 [Nicotiana 
sylvestris]
Length=717

 Score =   468 bits (1204),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 282/582 (48%), Positives = 375/582 (64%), Gaps = 31/582 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +   S + + S+D   +T+   ++     LE+K  ++E +++ LE ELRE AA+EI 
Sbjct  148   ILDETSVSAQSVGSDDETVNTEESCEQEDKTALEQKIGQMESRLEKLEEELREVAALEIA  207

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV+EHGSS +K+H PARRLSRLY HACK  S  +R + A++ VSGL+LVAK+CGNDV
Sbjct  208   LYSVVSEHGSSAHKLHTPARRLSRLYLHACKYWSQDKRATVAKNTVSGLVLVAKSCGNDV  267

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLS---SEYSKNAVVKNERKASPLKWQSFP-HKK  2240
              RLTFWLSN V+LR  I +       P S      S     K E K S  KW++ P +K+
Sbjct  268   ARLTFWLSNAVVLRVIISQAFGSSCSPSSLVKITESNGGGKKTESKISSFKWKTHPGNKQ  327

Query  2241  SVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             S  +DL   F+DW+    FT ALE+VE+WIFSRI+ESIWWQT TP+MQS A    D    
Sbjct  328   SSKHDLLQFFDDWQETRTFTAALERVESWIFSRIVESIWWQTLTPNMQSPAD---DPMAR  384

Query  2421  KIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             K   R        ++  NFS+ LWK AF++A +R+CPVRAG HECGCL +L++ +++QCV
Sbjct  385   KSVGRLLGPALGDQQQGNFSINLWKHAFQEALKRLCPVRAGSHECGCLPVLARRVIEQCV  444

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             ARLDVAMFNAILRESA +IPTDP+SDPI + +VLPIPAG  SF +GAQLKN++GNWSR L
Sbjct  445   ARLDVAMFNAILRESAHEIPTDPISDPIVDSKVLPIPAGDLSFGSGAQLKNSVGNWSRCL  504

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLS  2954
              DLFG+D +D   +         + S G + +      + F+LLNA+SDL+MLPKDML+ 
Sbjct  505   TDLFGMDAEDSGQND--------EGSFGDDHRKGGNQPEHFHLLNALSDLLMLPKDMLMD  556

Query  2955  RTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE---EESVVNF  3125
             RT+R EVCP+  L L+ R+L  F PDEFCPDP+P  VLEALN+E  +       +S  +F
Sbjct  557   RTIRMEVCPSISLPLVKRILCNFSPDEFCPDPVPGTVLEALNAECIIARRLSGGDSSGSF  616

Query  3126  PCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI-  3302
             P  AAP+VY PP  AA            S L+RS S++ +K YTSD+EL+E+DSPL  I 
Sbjct  617   PYPAAPVVYKPP-VAADVAEKVAEVDGKSLLSRSASAIQRKGYTSDEELEEIDSPLACII  675

Query  3303  -KMENSEVTKPgggsgngng-------ngVRYQLLREVWMSS  3404
              KM +S  +   G              +  RY LLREVW+++
Sbjct  676   DKMPSSPASAQNGSRKAKQKEETGSIGSNTRYDLLREVWLTT  717



>dbj|BAC53933.1| hypothetical protein [Nicotiana tabacum]
Length=717

 Score =   468 bits (1203),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 282/582 (48%), Positives = 374/582 (64%), Gaps = 31/582 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +   S + + S+D   +T+   ++     LE+K  ++E +++ LE ELRE AA+EI 
Sbjct  148   ILDETSVSAQSVGSDDETVNTEESCEQEDKTALEQKIGQMESRLEKLEEELREVAALEIA  207

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV+EHGSS +K+H PARRLSRLY HACK  S  +R + A++ VSGL+LVAK+CGNDV
Sbjct  208   LYSVVSEHGSSAHKLHTPARRLSRLYLHACKYWSQDKRATVAKNTVSGLVLVAKSCGNDV  267

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLS---SEYSKNAVVKNERKASPLKWQSFP-HKK  2240
              RLTFWLSN V+LR  I +       P S      S     K E K S  KW++ P +K+
Sbjct  268   ARLTFWLSNAVVLRVIISQAFGSSCSPSSLVKITESNGGGKKTESKISSFKWKTHPGNKQ  327

Query  2241  SVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             S  +DL   F+DW+    FT ALE+VE+WIFSRI+ESIWWQT TP+MQS A    D    
Sbjct  328   SSKHDLLQFFDDWQETRTFTAALERVESWIFSRIVESIWWQTLTPNMQSPAD---DPMAR  384

Query  2421  KIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             K   R        ++  NFS+ LWK AF++A +R+CPVRAG HECGCL +L++ +++QCV
Sbjct  385   KSVGRLLGPALGDQQQGNFSINLWKHAFQEALKRLCPVRAGSHECGCLPVLARRVIEQCV  444

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             ARLDVAMFNAILRESA +IPTDP+SDPI + +VLPIPAG  SF +GAQLKN++GNWSR L
Sbjct  445   ARLDVAMFNAILRESAHEIPTDPISDPIVDSKVLPIPAGDLSFGSGAQLKNSVGNWSRCL  504

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLS  2954
              DLFG+D +D   +         + S G + +      + F+LLNA+SDL+MLPKDML+ 
Sbjct  505   TDLFGMDAEDSGQND--------EGSFGDDHRKGGNQPEHFHLLNALSDLLMLPKDMLMD  556

Query  2955  RTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVE---EESVVNF  3125
             RT+R EVCP+  L L+ R+L  F PDEFCPDP+P  VLEALN+E  +       +S  +F
Sbjct  557   RTIRMEVCPSISLPLVKRILCNFSPDEFCPDPVPGTVLEALNAECIIARRLSGGDSSGSF  616

Query  3126  PCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI-  3302
             P  AAP+VY PP  AA            S L+RS S++ +K YTSD+EL+E+DSPL  I 
Sbjct  617   PYPAAPVVYKPP-VAADVAEKVAEVDGKSLLSRSASAIQRKGYTSDEELEEIDSPLACII  675

Query  3303  -KMENSEVTKPgggsgngngngV-------RYQLLREVWMSS  3404
              KM +S  +   G                 RY LLREVW+++
Sbjct  676   DKMPSSPASAQNGSRKAKQKEETGSIGSNKRYDLLREVWLTT  717



>ref|XP_010506045.1| PREDICTED: uncharacterized protein LOC104782733 [Camelina sativa]
Length=658

 Score =   464 bits (1195),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 256/536 (48%), Positives = 345/536 (64%), Gaps = 41/536 (8%)
 Frame = +3

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             E S    E K + LE +I+ LE ELRE AA+EI L+SVV +H SS +K+H PARR+SR+Y
Sbjct  159   ENSGGNFEDKIEHLETRIEKLEEELREVAALEISLYSVVPDHCSSAHKLHTPARRISRIY  218

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL  2150
              HACK  +  +R + AR+ VSGL+LVAK+CGNDV RLTFWLSN + LR  I +     ++
Sbjct  219   VHACKHFTQGKRATIARNSVSGLVLVAKSCGNDVSRLTFWLSNIIALRQIISQAFGTSRI  278

Query  2151  PLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
                SE + ++      K + L+W+         N      EDW+    FT ALEK+E W+
Sbjct  279   TRISESNGDS-----GKKTNLRWK---------NGFQQLLEDWQETETFTTALEKIEFWV  324

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPE-NFSLELWKKAFRDA  2507
             FSRI+ES+WWQ FTPHMQS    S  S+ N   + T  S  ++ +  FS+ LWK AFRDA
Sbjct  325   FSRIVESVWWQVFTPHMQSPENDSSASKSNG--KMTGPSLGDQNQGTFSISLWKNAFRDA  382

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CP+R  GHECGCL +L++++M +C+ R DVAMFNAILRES   IPTDPVSDPI + 
Sbjct  383   LQRLCPMRGAGHECGCLPVLARMVMDKCIGRFDVAMFNAILRESEHQIPTDPVSDPILDS  442

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHER  2867
             +VLPIPAG  SF +GAQLKNAIGNWSR L ++FG+                +D+S+  E 
Sbjct  443   KVLPIPAGDLSFGSGAQLKNAIGNWSRCLTEMFGM---------------NSDDSSAKES  487

Query  2868  KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPD  3047
             +   A SKPF LLN +SDL+MLPKDML+ R++R+E+CP+  L LI R+L  F PDEFCPD
Sbjct  488   EDDHAESKPFVLLNELSDLLMLPKDMLMERSIREEMCPSISLPLIKRILCNFTPDEFCPD  547

Query  3048  PIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
              +P  VLE LN+ + +   + S  +FP  A+ I Y PPS      I   ++ ++ +L+R+
Sbjct  548   HVPGAVLEELNAAESIGDGKLSETSFPYGASSISYMPPST---MDIAEKVAEAAGKLSRN  604

Query  3228  rssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
              S + +K YTSD+EL+ELDSPL+ I  + S+ T           +  RY+LLREVW
Sbjct  605   VSMIQRKGYTSDEELEELDSPLSSIVDKGSDFT------AGSTTSNARYKLLREVW  654



>ref|XP_010508591.1| PREDICTED: uncharacterized protein LOC104785140 [Camelina sativa]
Length=648

 Score =   464 bits (1194),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 261/570 (46%), Positives = 355/570 (62%), Gaps = 51/570 (9%)
 Frame = +3

Query  1722  RDKRNSIEGITSNDWKDTK--VRSKETSNVV----------LERKCQELEQKIQMLEGEL  1865
             +D +++ EGI ++ W+D      S E+ N             E K + LE +I+ LE EL
Sbjct  114   QDCKDAREGINADVWEDASNGALSAESENEAADVTENKGGNFEDKIEHLETRIEKLEEEL  173

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA+EI L+SVV +H SS +K+H PARR+SR+Y HACK  +  +R + AR+ VSGL+L
Sbjct  174   REVAALEISLYSVVPDHCSSAHKLHTPARRISRIYIHACKHFTQGKRATIARNSVSGLVL  233

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQS  2225
             VAK+CGNDV RLTFWLSN + LR  I +     ++   SE + ++      K + L+W+ 
Sbjct  234   VAKSCGNDVSRLTFWLSNIIALRQIISQAFGTSRITRISESNGDS-----GKKTNLRWK-  287

Query  2226  FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSL  2405
                     N      EDW+    FT ALEK+E W+FSRI+ES+WWQ FTPHMQS    S 
Sbjct  288   --------NGFQQLLEDWQETETFTTALEKIEFWVFSRIVESVWWQVFTPHMQSPENDSS  339

Query  2406  DSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQ  2585
              S+ N      S    +    FS+ LWK AFRDA +R+CP+R  GHECGCL +L++++M 
Sbjct  340   ASKSNGKLMGPSLG-DQNQGTFSISLWKNAFRDALQRLCPMRGAGHECGCLPVLARMVMD  398

Query  2586  QCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWS  2765
             +C+ R DVAMFNAILRES   IPTDPVSDPI + +VLPIPAG  SF +GAQLKNAIGNWS
Sbjct  399   KCIGRFDVAMFNAILRESEHQIPTDPVSDPILDSKVLPIPAGDLSFGSGAQLKNAIGNWS  458

Query  2766  RWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDM  2945
             R L ++FG+                +D+S+  E +     SKPF LLN +SDL+MLPKDM
Sbjct  459   RCLTEMFGM---------------NSDDSSAKESEDDQVESKPFVLLNELSDLLMLPKDM  503

Query  2946  LLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNF  3125
             L+ R++R+E+CP+  L LI R+L  F PDEFCPD +P  VLE LN+ + +   + S  +F
Sbjct  504   LMERSIREEMCPSISLPLIKRILCNFTPDEFCPDHVPGAVLEELNAAESIGDGKLSETSF  563

Query  3126  PCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIK  3305
             P  A+ I Y PPS      I   ++ ++ +L+R+ S + +K YTSD+EL+ELDSPL+ I 
Sbjct  564   PYGASSISYMPPST---MDIAEKVAEATGKLSRNVSMIQRKGYTSDEELEELDSPLSSIV  620

Query  3306  MENSEVTKPgggsgngngngVRYQLLREVW  3395
              + S+ T           +  RY+LLREVW
Sbjct  621   DKGSDFT------AGSTTSNARYKLLREVW  644



>gb|EEE52991.1| hypothetical protein OsJ_35667 [Oryza sativa Japonica Group]
Length=929

 Score =   473 bits (1216),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 268/536 (50%), Positives = 345/536 (64%), Gaps = 52/536 (10%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA EIGL+SV+AEHGSS+NKVH PARRLSR + HA K  S  +  SAARS  SGL+L
Sbjct  415   RETAAAEIGLYSVIAEHGSSSNKVHTPARRLSRHFIHALKNWSRDKMGSAARSASSGLVL  474

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQS  2225
             VAKACG DV RL+FWLSNCV+LRA + + S++     +S    N      R+ S   W+S
Sbjct  475   VAKACGYDVARLSFWLSNCVVLRAIVSETSKQS----NSNAINNGSKTGPRRNSASMWES  530

Query  2226  FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-  2402
                KK  G  L   F++WE+   F  AL+K+E+WIFSRI+ESIWWQ FTPHMQS   +S 
Sbjct  531   LNRKK--GKLLSPEFDNWEDVDTFIAALKKIESWIFSRIVESIWWQAFTPHMQSANISSE  588

Query  2403  --LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKL  2576
                 S   K Y R +   +++    S+++WKKAF++A E++CPVRA GHECGCL LL+KL
Sbjct  589   PMPSSNAKKCYGRITVVGNQQQATLSIDIWKKAFKEASEKLCPVRAAGHECGCLPLLAKL  648

Query  2577  IMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIG  2756
             +M+QC+ARLDVAMFNAILRES D+IPTDP+SDPI++P+VLP+P+GK SF AG QLKNAIG
Sbjct  649   VMEQCIARLDVAMFNAILRESDDEIPTDPMSDPITDPKVLPVPSGKFSFGAGVQLKNAIG  708

Query  2757  NWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLP  2936
             +WSR L+D FG+      D     +    D  NG          KPFYLLNA+SDL+M+P
Sbjct  709   SWSRCLSDSFGM------DMDDYPEVESGDGDNGAAE-----LRKPFYLLNALSDLLMIP  757

Query  2937  KDMLLSRTVRKE-----------------------VCPTFGLSLITRVLNVFIPDEFCPD  3047
             KD+L+  + RKE                       +CPTF  S+I R+L+ F+PD+FCPD
Sbjct  758   KDVLMETSTRKEACTLILFNKCTLFPSELVKFSFLLCPTFSSSIIKRILDGFVPDDFCPD  817

Query  3048  PIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
             P+ + +LEAL SEDH+E   + +   PCSA+PI+Y  P++ A       I S      +S
Sbjct  818   PVQHSLLEALESEDHLEGNTKGIRAVPCSASPILYPYPASGA-------ILSMIGDPRKS  870

Query  3228  rssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
              S++L+KS TSDDELDEL SPL  I   +S           GN N  RY+LL EVW
Sbjct  871   GSAILRKSNTSDDELDELSSPLTFISKASSNPL--AKLKQIGNPNSARYRLLHEVW  924


 Score =   159 bits (401),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 6/194 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KTR   S   ++ I I EI PWPPS+SLK+LK+VV+ WE+G++NSG T  VAP
Sbjct  1    MVLGLRTKTRKDASFHVDFNIFIQEISPWPPSESLKSLKSVVLFWENGERNSGKTNAVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG   G++EFNE   +     +E SSKS     +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SI--GSGTTVGKVEFNEFINLQAVFQKEGSSKS---GKWQKNLLELNLYEPRRD-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LGTA +D A + +  E  +V VP+N KRS RN VQP++ L+IQ +         R+ + 
Sbjct  115  HLGTATLDLAEHAMFHEDTSVPVPLNSKRSLRNNVQPMVYLRIQPLDGDNSSVSSRDALS  174

Query  705  RESSMDSSAGESVS  746
            +E+S+D  + E +S
Sbjct  175  KEASVDRDSKELMS  188



>ref|XP_009769974.1| PREDICTED: uncharacterized protein LOC104220744 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769975.1| PREDICTED: uncharacterized protein LOC104220744 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769976.1| PREDICTED: uncharacterized protein LOC104220744 isoform X1 [Nicotiana 
sylvestris]
Length=811

 Score =   469 bits (1206),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 277/552 (50%), Positives = 361/552 (65%), Gaps = 30/552 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LE+K  ++E +++ LE ELRE AA+EI L+SVV+EHGSS +K+H PARRLSRLY HAC
Sbjct  272   TALEQKIGQMESRLEKLEEELREVAALEIALYSVVSEHGSSAHKLHTPARRLSRLYLHAC  331

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS-  2159
             K  S  +R + A++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +       P S 
Sbjct  332   KYWSQDKRATVAKNTVSGLVLVAKSCGNDVARLTFWLSNAVVLRVIISQAFGSSCSPSSL  391

Query  2160  --SEYSKNAVVKNERKASPLKWQSFP-HKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
                  S     K E K S  KW++ P +K+S  +DL   F+DW+    FT ALE+VE+WI
Sbjct  392   VKITESNGGGKKTESKISSFKWKTHPGNKQSSKHDLLQFFDDWQETRTFTAALERVESWI  451

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRD  2504
             FSRI+ESIWWQT TP+MQS A    D    K   R        ++  NFS+ LWK AF++
Sbjct  452   FSRIVESIWWQTLTPNMQSPAD---DPMARKSVGRLLGPALGDQQQGNFSINLWKHAFQE  508

Query  2505  AYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISN  2684
             A +R+CPVRAG HECGCL +L++ +++QCVARLDVAMFNAILRESA +IPTDP+SDPI +
Sbjct  509   ALKRLCPVRAGSHECGCLPVLARRVIEQCVARLDVAMFNAILRESAHEIPTDPISDPIVD  568

Query  2685  PEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE  2864
              +VLPIPAG  SF +GAQLKN++GNWSR L DLFG+D +D   +         + S G +
Sbjct  569   SKVLPIPAGDLSFGSGAQLKNSVGNWSRCLTDLFGMDAEDSGQND--------EGSFGDD  620

Query  2865  RKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCP  3044
              +      + F+LLNA+SDL+MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCP
Sbjct  621   HRKGGNQPEHFHLLNALSDLLMLPKDMLMDRTIRMEVCPSISLPLVKRILCNFSPDEFCP  680

Query  3045  DPIPNVVLEALNSEDHMEVE---EESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             DP+P  VLEALN+E  +       +S  +FP  AAP+VY PP  AA            S 
Sbjct  681   DPVPGTVLEALNAECIIARRLSGGDSSGSFPYPAAPVVYKPP-VAADVAEKVAEVDGKSL  739

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngng-------ngV  3368
             L+RS S++ +K YTSD+EL+E+DSPL  I  KM +S  +   G              +  
Sbjct  740   LSRSASAIQRKGYTSDEELEEIDSPLACIIDKMPSSPASAQNGSRKAKQKEETGSIGSNT  799

Query  3369  RYQLLREVWMSS  3404
             RY LLREVW+++
Sbjct  800   RYDLLREVWLTT  811



>gb|EYU39889.1| hypothetical protein MIMGU_mgv1a002696mg [Erythranthe guttata]
Length=646

 Score =   463 bits (1191),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 272/576 (47%), Positives = 363/576 (63%), Gaps = 39/576 (7%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +  N+   + S+D   +T+   K+     L+R+ +E+E +I+ LE ELRE AA+EI 
Sbjct  97    LLDEVPNATHSVCSDDEAVNTEENDKKEEQAALDRRIEEMETRIKSLESELREVAALEIA  156

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV EHGSS +KVH PARRLSRLY HACK     +R + AR+ VSG++LV+K+CGNDV
Sbjct  157   LYSVVPEHGSSAHKVHTPARRLSRLYIHACKYWLQDKRATVARNTVSGIVLVSKSCGNDV  216

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKN---ERKASPLKWQSFPHKKS  2243
              RLTFWLSN V+LR  + +          S  +   V ++   E+K+SP K ++    K 
Sbjct  217   SRLTFWLSNIVVLREILSQ-------AFGSSCNSAKVFESYGSEKKSSPPKRRNSSASKQ  269

Query  2244  VGNDLPGTF-EDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             +       F +DW+    FT ALEKVE+WIFSRI+ESIWWQT TP+MQS      DS  N
Sbjct  270   LNKQGFLQFIDDWQETRTFTSALEKVESWIFSRIVESIWWQTLTPNMQSPDG---DSVTN  326

Query  2421  KIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             K   R         +  NFS+ LWK AF DA +R+CPVRAGGH CGCL +L++ +M+QC 
Sbjct  327   KGADRLLGPALGDHKQGNFSINLWKNAFHDALKRLCPVRAGGHGCGCLPVLARKVMEQCT  386

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
              RLDVAMFNAILRESA +IPTDPVSDPI + +VLPIPAG   F +GAQLKN++GNW+RWL
Sbjct  387   DRLDVAMFNAILRESAHEIPTDPVSDPIVDSKVLPIPAGDLCFGSGAQLKNSVGNWTRWL  446

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKP--FYLLNAMSDLMMLPKDML  2948
             ++  G                 A++S   E ++ +   +P  F LLNA+SDL+MLPKDML
Sbjct  447   SEFLGA---------------DANSSAKDENRSLEGTEEPKSFTLLNALSDLLMLPKDML  491

Query  2949  LSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVN  3122
             + R +R EVCP+  L L+ RVL  F PDEFCPDP+   VLEA+N+E  +E  V      +
Sbjct  492   MDRNIRMEVCPSISLPLVKRVLCNFSPDEFCPDPVAGAVLEAINAECIIERRVLGNPSSS  551

Query  3123  FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI  3302
             FP SAAPIVY PPS+A         + +++ L++S S V +K YTSD+ELDEL+  LN +
Sbjct  552   FPYSAAPIVYTPPSSA-DVAEKVAEADANAVLSKSASCVQRKGYTSDEELDELEGCLNKL  610

Query  3303  KME--NSEVTKPgggsgngngngVRYQLLREVWMSS  3404
              +    + V          +G   RY LLREVW ++
Sbjct  611   PLSPTAAAVGSGDRKEAGYDGANARYDLLREVWQAT  646



>ref|XP_004166567.1| PREDICTED: uncharacterized LOC101213868 [Cucumis sativus]
Length=795

 Score =   468 bits (1203),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 265/542 (49%), Positives = 356/542 (66%), Gaps = 26/542 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
              V E+K +E+E +I  LE ELR  AA+E+ L+SVV EHGSS +KVH PARRLSR+Y +AC
Sbjct  267   TVSEQKIEEMENRIDKLEEELRVVAALEMSLYSVVPEHGSSAHKVHTPARRLSRIYIYAC  326

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PL  2156
             K  S  +R + A+++VSGL+L+AK+CG+DVPRLTFWLSN +++R    + FS      PL
Sbjct  327   KHWSQDKRATVAKNIVSGLVLIAKSCGSDVPRLTFWLSNTIVMREITSQTFSSLHSSNPL  386

Query  2157  SSEY-SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
              +   S N+  KN  K + ++W++    K V N    + EDW+    F  ALEKVE WIF
Sbjct  387   KNFVDSNNSSQKNGWKPTAVQWRNSYGSKQV-NSYMQSVEDWQETGTFMAALEKVEFWIF  445

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSS--CSEEPENFSLELWKKAFRDA  2507
             SRI+ES+WWQ+ TP+MQ       D   NKI +R        ++  N+S+ LW+  F+DA
Sbjct  446   SRIVESVWWQSLTPNMQHR-----DPSKNKIRERLMGPPLGDQQQGNYSVNLWRSTFQDA  500

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
             ++R+CPVRA GHECGCL +L++++M+QCV+RLDVAMFNAILRESA +IPTDPVSDPI + 
Sbjct  501   FQRLCPVRASGHECGCLPVLARMVMEQCVSRLDVAMFNAILRESAHEIPTDPVSDPIVDA  560

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHER  2867
             +VLPIPAG  SF +GAQLKN++GNWSRWL D+ GID DD   D           S+   +
Sbjct  561   KVLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMVGIDADDSSVDQH--------GSDYDIK  612

Query  2868  KAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPD  3047
               +D   + F LLN++SDL+MLPKDML  R++RKEVCP   L LITR+L  F PDEFCPD
Sbjct  613   SDKDGRPQSFPLLNSLSDLLMLPKDMLTDRSIRKEVCPLISLPLITRILCNFTPDEFCPD  672

Query  3048  PIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqlt  3221
             P+P  VLE+LN+E   E  V   S  NFP +AAP+ Y  PS  +        +   S L 
Sbjct  673   PVPGTVLESLNAESIGEQRVSGYSGRNFPYTAAPVFYISPS-TSDVAEKVAEAGGKSHLE  731

Query  3222  rsrssVLKKSYTsddeldeldsP-LNLIKMENSEVTKPgg---gsgngngngVRYQLLRE  3389
             R+ S++ +K YTSD+EL+EL+SP L+++      +T          +G    +RY+LLRE
Sbjct  732   RNISTIQRKGYTSDEELEELNSPLLSIVDKSTLSLTYNALGNGEHEDGTTFNMRYKLLRE  791

Query  3390  VW  3395
              W
Sbjct  792   AW  793



>ref|XP_004151009.1| PREDICTED: uncharacterized protein LOC101213868 [Cucumis sativus]
 gb|KGN54892.1| hypothetical protein Csa_4G572860 [Cucumis sativus]
Length=795

 Score =   467 bits (1202),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 264/541 (49%), Positives = 355/541 (66%), Gaps = 26/541 (5%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             V E+K +E+E +I  LE ELR  AA+E+ L+SVV EHGSS +KVH PARRLSR+Y +ACK
Sbjct  268   VSEQKIEEMENRIDKLEEELRVVAALEMSLYSVVPEHGSSAHKVHTPARRLSRIYIYACK  327

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLS  2159
               S  +R + A+++VSGL+L+AK+CG+DVPRLTFWLSN +++R    + FS      PL 
Sbjct  328   HWSQDKRATVAKNIVSGLVLIAKSCGSDVPRLTFWLSNTIVMREITSQTFSSLHSSNPLK  387

Query  2160  SEY-SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
             +   S N+  KN  K + ++W++    K V N    + EDW+    F  ALEKVE WIFS
Sbjct  388   NFVDSNNSSQKNGWKPTAVQWRNSYGSKQV-NSYMQSVEDWQETGTFMAALEKVEFWIFS  446

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSS--CSEEPENFSLELWKKAFRDAY  2510
             RI+ES+WWQ+ TP+MQ       D   NKI +R        ++  N+S+ LW+  F+DA+
Sbjct  447   RIVESVWWQSLTPNMQHR-----DPSKNKIRERLMGPPLGDQQQGNYSVNLWRSTFQDAF  501

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRA GHECGCL +L++++M+QCV+RLDVAMFNAILRESA +IPTDPVSDPI + +
Sbjct  502   QRLCPVRASGHECGCLPVLARMVMEQCVSRLDVAMFNAILRESAHEIPTDPVSDPIVDAK  561

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSRWL D+ GID DD   D           S+   + 
Sbjct  562   VLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMVGIDADDSSVDQH--------GSDYDIKS  613

Query  2871  AQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDP  3050
              +D   + F LLN++SDL+MLPKDML  R++RKEVCP   L LITR+L  F PDEFCPDP
Sbjct  614   DKDGRPQSFPLLNSLSDLLMLPKDMLTDRSIRKEVCPLISLPLITRILCNFTPDEFCPDP  673

Query  3051  IPNVVLEALNSED--HMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltr  3224
             +P  VLE+LN+E      V   S  NFP +AAP+ Y  PS  +        +   S L R
Sbjct  674   VPGTVLESLNAESIGEQRVSGYSGRNFPYTAAPVFYISPS-TSDVAEKVAEAGGKSHLER  732

Query  3225  srssVLKKSYTsddeldeldsP-LNLIKMENSEVTKPgg---gsgngngngVRYQLLREV  3392
             + S++ +K YTSD+EL+EL+SP L+++      +T          +G    +RY+LLRE 
Sbjct  733   NISTIQRKGYTSDEELEELNSPLLSIVDKSTLSLTYNALGNGEHEDGTTFNMRYKLLREA  792

Query  3393  W  3395
             W
Sbjct  793   W  793



>ref|XP_008442265.1| PREDICTED: uncharacterized protein LOC103486172 [Cucumis melo]
Length=793

 Score =   467 bits (1202),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 262/541 (48%), Positives = 354/541 (65%), Gaps = 28/541 (5%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             V E+K +E+E +I  LE ELR  AA+E+ L+SVV EHGSS +KVH PARRLSR+Y +ACK
Sbjct  268   VSEQKIEEMENRIDKLEEELRVVAALEMSLYSVVPEHGSSVHKVHTPARRLSRIYIYACK  327

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPLS  2159
               S  +R + A+++VSGL+L+AK+CG+DVPRLTFWLSN +++R    +   S +   PL 
Sbjct  328   HWSQDKRATVAKNIVSGLVLIAKSCGSDVPRLTFWLSNTIVMREITSQTFGSLRSSNPLK  387

Query  2160  SEY-SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
                 + N+  KN  K + ++W++    K V N    + EDW+    F  ALEKVE WIFS
Sbjct  388   IFVDANNSSQKNGWKPTAVQWRNSYGNKQV-NSYMQSVEDWQETGTFMAALEKVEFWIFS  446

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDAY  2510
             RI+ES+WWQ+ TP+MQ       D   NKI +R        ++  N+S+ LW+  F+DA+
Sbjct  447   RIVESVWWQSLTPNMQPR-----DPSRNKIRERLMGPALGDQQQGNYSVNLWRSTFQDAF  501

Query  2511  ERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPE  2690
             +R+CPVRA GHECGCL +L++++M+QCV+RLDVAMFNAILRES+ +IPTDPVSDPI + +
Sbjct  502   QRLCPVRASGHECGCLPVLARMVMEQCVSRLDVAMFNAILRESSHEIPTDPVSDPIVDAK  561

Query  2691  VLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERK  2870
             VLPIPAG  SF +GAQLKN++GNWSRWL D+ GI          + D++  D     +  
Sbjct  562   VLPIPAGDLSFGSGAQLKNSVGNWSRWLTDMVGI----------DADDSSVDQHGSDDDI  611

Query  2871  AQDACSKP--FYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCP  3044
               D   +P  F LLN++SDL+MLPKDML  R++RKEVCP   L LITR+L  F PDEFCP
Sbjct  612   KPDGDGRPHSFPLLNSLSDLLMLPKDMLTDRSIRKEVCPLISLPLITRILCNFTPDEFCP  671

Query  3045  DPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             DP+P  VLE+LN+E   E  V   S  NFP  AAP+ Y  PS  +        +   S L
Sbjct  672   DPVPGTVLESLNAESIGEQRVSGYSGRNFPYIAAPVFYISPS-TSDVAEKVAEAGGKSHL  730

Query  3219  trsrssVLKKSYTsddeldeldsP-LNLIKMENSEVTKPgggs-gngngngVRYQLLREV  3392
              R+ S++ +K YTSD+EL+ELDSP L+++    S ++         G    +RY+LLREV
Sbjct  731   ERNISTIQRKGYTSDEELEELDSPLLSIVDKSTSTLSLTYNSLGNGGTTLNMRYKLLREV  790

Query  3393  W  3395
             W
Sbjct  791   W  791



>ref|XP_010111442.1| hypothetical protein L484_028102 [Morus notabilis]
 gb|EXC30920.1| hypothetical protein L484_028102 [Morus notabilis]
Length=804

 Score =   467 bits (1202),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 250/517 (48%), Positives = 331/517 (64%), Gaps = 33/517 (6%)
 Frame = +3

Query  1632  DERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVL  1811
             D+ +  V  +HTL E+     S+ SN                ND  DT+   +  +   L
Sbjct  228   DKVVAEVEGIHTLNETPNGAKSIGSN----------------NDTVDTEENGEHENEAAL  271

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             E+K +E+E +I+ LE ELRE A++EI L+SVV EHGSS +KVH PARRLSR+Y HACK  
Sbjct  272   EKKIEEMETRIEKLEEELREVASLEISLYSVVPEHGSSAHKVHTPARRLSRIYIHACKYW  331

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPLSSE  2165
             + ++R + AR+ VSGL+L+AK+CGNDVPRLTFWLSN V+LR  I +     +   P    
Sbjct  332   TQVKRATIARNTVSGLLLIAKSCGNDVPRLTFWLSNTVVLREIISQAFGGSRHSSPAMRL  391

Query  2166  YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRII  2345
                N   K     S +KW+     K + N      EDW+    FT ALEKVE+WIFSR++
Sbjct  392   TESNGNGKRSEMKSTMKWKGISGSKQI-NAFTPLLEDWQETGTFTAALEKVESWIFSRVV  450

Query  2346  ESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYERI  2519
             ES+WWQ  TP+MQS      D   NK   R        ++  +FS+ LWK AF+DA +R+
Sbjct  451   ESVWWQALTPYMQSPVE---DLSNNKSIGRLLGPALGDQKQGSFSINLWKNAFQDAAQRL  507

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CPVRAGGHECGCL +L++++M+Q +ARLDVAMFNAILRESA DIPTDPVSDPI + +VLP
Sbjct  508   CPVRAGGHECGCLPVLARMVMEQSIARLDVAMFNAILRESAHDIPTDPVSDPIVDSKVLP  567

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IPAG  SF +GAQLKN++GNWSRWL D+FGID DD   +  + ++         E K+  
Sbjct  568   IPAGDLSFGSGAQLKNSVGNWSRWLTDMFGIDADDVPQEDQDCNDGDDRQGGDGEPKSFL  627

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
               +       ++SDL+MLPKDML+ R++RKEVCP+  L LI R+L  F PDEF PDP+P 
Sbjct  628   LLN-------SLSDLLMLPKDMLMDRSIRKEVCPSISLPLIKRILCNFTPDEFYPDPVPG  680

Query  3060  VVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPS  3164
              VLEALN+E  +E  +  +S+ +FP +  P+VY PPS
Sbjct  681   AVLEALNAESIVERRLSGDSMKSFPYTVDPVVYTPPS  717



>ref|XP_004304320.1| PREDICTED: uncharacterized protein LOC101299504 [Fragaria vesca 
subsp. vesca]
Length=803

 Score =   466 bits (1200),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 266/547 (49%), Positives = 360/547 (66%), Gaps = 28/547 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LE+K  E+E +IQ LE ELRE AA+EI L+SVV EHGSS +KVH PARR+SRL+ HAC
Sbjct  271   TALEQKVDEMEMRIQKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRISRLFIHAC  330

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKF--SEKQQLPL  2156
             K  +  +R + A++ VSGL+L+AK+CG+DV RLTFWLSN V+LR  I +   S +   P 
Sbjct  331   KHWTQDKRATIAKNTVSGLVLIAKSCGSDVARLTFWLSNTVVLREIISQAFGSSRHSSPF  390

Query  2157  SSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
             S   +     +N+ K++ L+W+  P  K + N      +DW+    FT ALE+VE+WIFS
Sbjct  391   SKFETNGTSKRNDVKSAALRWRGSPGSKQM-NGFMQFADDWQETGTFTAALERVESWIFS  449

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPE-NFSLELWKKAFRDAYE  2513
             R++ES+WWQ   PHMQS    S +   NK  +    +  ++ + +FS+ LW  AF+DA +
Sbjct  450   RLVESVWWQALAPHMQSPVEYSSN---NKTPRLLGPALGDQNQGSFSVNLWTNAFQDASQ  506

Query  2514  RICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEV  2693
             R+CPVRAGGH+CGCL +L++++M QCVARLDVAMFNAILRES  ++PTDPVSDPI +  V
Sbjct  507   RLCPVRAGGHQCGCLPVLARMVMGQCVARLDVAMFNAILRESVHEVPTDPVSDPILDSLV  566

Query  2694  LPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKA  2873
             LPIPAG  SF +GAQLKN++GNWSR L+D+FG+D DD   +           S   ++++
Sbjct  567   LPIPAGDLSFGSGAQLKNSVGNWSRCLSDMFGMDADDSLQETQL-------GSGDDDKQS  619

Query  2874  QDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
              D   K F LLNA+SDL+MLPKDML+ R++RKEVCP+  L L+ R+L  F PDEFCPD +
Sbjct  620   GDGEPKSFLLLNALSDLLMLPKDMLMDRSIRKEVCPSISLPLVKRILCNFTPDEFCPDAV  679

Query  3054  PNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
             P  VLEALN+E  +E  +  ES  +FP +AAP+VY PPS+     +    S + S L R+
Sbjct  680   PGAVLEALNAESIVERRLSGESARSFPYTAAPVVYNPPSSV---DVSEKDSEAGSPLERN  736

Query  3228  rssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPg-------ggsgngngngVRYQL  3380
              S++ +K YTSD+EL+ELDSPL  I  K+ +S               +        RY L
Sbjct  737   VSALQRKGYTSDEELEELDSPLTAIVDKLPSSPSLTANGNGHGKLEETTGHACMNARYDL  796

Query  3381  LREVWMS  3401
             LREVW +
Sbjct  797   LREVWFA  803



>ref|XP_008339316.1| PREDICTED: uncharacterized protein LOC103402348 [Malus domestica]
Length=645

 Score =   460 bits (1184),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 308/443 (70%), Gaps = 31/443 (7%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
             + LERK +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARR+SRLY HAC
Sbjct  165   IALERKIEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRISRLYIHAC  224

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K  +  +R++ A++ VSGL+L+AK+CGNDVPRL FWLSN V+LR  I + F   +Q   S
Sbjct  225   KHWTQDKRVTIAKNTVSGLVLIAKSCGNDVPRLIFWLSNTVVLREIISQAFGISRQSSPS  284

Query  2160  SEY--SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
              ++  S     +NE K++ LKW+  P  K + N L  + +DW+    FT ALEKVE+WIF
Sbjct  285   VKFAESNGTSKRNEVKSATLKWKGSPGSKQM-NGLVQSADDWQETGTFTAALEKVESWIF  343

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDA  2507
             SRI+ES+WWQ  TP+MQS A +S     NK   R S      ++  +FS++LWK AF+DA
Sbjct  344   SRIVESVWWQALTPNMQSPAESS---STNKTTVRLSGPALGDQKQGSFSVDLWKNAFQDA  400

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CPVRAGGH+CGCL +L++++MQ CVARLDVAMFNAILRESA +IPTDPVSDPI + 
Sbjct  401   SQRLCPVRAGGHKCGCLPVLARMVMQHCVARLDVAMFNAILRESAHEIPTDPVSDPILDS  460

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHER  2867
              VLPIPAG  SF +GAQLKN++GNWSRWL+D+F +                AD+S   + 
Sbjct  461   RVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDMFDM---------------DADDSLQEDH  505

Query  2868  KAQD-------ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFI  3026
                +          K F LLNA+SDL+MLPKD+L+ R +RKEVCP+  L L+ R+L  F 
Sbjct  506   PGSEDDDGQSGDGDKSFLLLNALSDLLMLPKDLLIDRRIRKEVCPSISLPLVKRILCNFT  565

Query  3027  PDEFCPDPIPNVVLEALNSEDHM  3095
             PDEFCPD +P  VLEALN+E HM
Sbjct  566   PDEFCPDAVPGAVLEALNAEPHM  588



>gb|EAZ09559.1| hypothetical protein OsI_31838 [Oryza sativa Indica Group]
Length=780

 Score =   464 bits (1193),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 237/457 (52%), Positives = 313/457 (68%), Gaps = 21/457 (5%)
 Frame = +3

Query  1818  KCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV  1997
             K +ELE K + LE ELRE AA+EI L+SVV EHG S++K+H PARRLSRLY HA K  S 
Sbjct  250   KSEELESKCERLEQELREVAALEISLYSVVPEHGCSSHKLHTPARRLSRLYVHASKFWSS  309

Query  1998  LRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLSSE-YS  2171
              ++ S  ++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I + F   +Q  L+ + +S
Sbjct  310   DKKASVTKNFVSGLVLVAKSCGNDVSRLTFWLSNTVVLREIIAQTFGISRQPSLAMKAFS  369

Query  2172  KNAVVKNERK-ASPLKWQ---SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSR  2339
              N   K   K +SP + +   S  H +     LP   +DW        ALEK+E+WIFSR
Sbjct  370   TNVNAKMLGKNSSPTRRKNNYSGKHARPAIWPLP---DDWRETGTLVAALEKIESWIFSR  426

Query  2340  IIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             I+ES+WWQ  TPHMQ+        +   +     +   ++  NFS+ LWK AF+DA+ RI
Sbjct  427   IVESVWWQALTPHMQTLVKDISSPKAGSLL--GPALGDQQQGNFSIHLWKTAFQDAFSRI  484

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+RAGGHECGCL +L+KL+M+ CVARLDVAMFNA+LRESA+++P+DP+SDPI +  VLP
Sbjct  485   CPLRAGGHECGCLPVLAKLVMEHCVARLDVAMFNAVLRESANEVPSDPISDPIVDSRVLP  544

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IPAG  SF +GAQLKN+IGNWSRWL D FG+       +      +++D+ +G    A D
Sbjct  545   IPAGDFSFGSGAQLKNSIGNWSRWLQDKFGM--VAAAPEKHGQAGDESDDRSG----AAD  598

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
               S  F LLN +SDL+MLPKDMLL +++RKEVCP+ G+ L+TR+L  F PDEFCP+P+P 
Sbjct  599   FYS--FKLLNELSDLLMLPKDMLLEKSIRKEVCPSIGIPLVTRILCNFTPDEFCPEPVPG  656

Query  3060  VVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPS  3164
             +VLE LN+E  +E   E++ +  FPC AAP+VY PPS
Sbjct  657   MVLEELNAESLLERFTEKDVITTFPCVAAPVVYCPPS  693



>ref|NP_001063524.1| Os09g0487200 [Oryza sativa Japonica Group]
 dbj|BAF25438.1| Os09g0487200 [Oryza sativa Japonica Group]
 gb|EAZ45180.1| hypothetical protein OsJ_29823 [Oryza sativa Japonica Group]
Length=780

 Score =   463 bits (1192),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 237/457 (52%), Positives = 313/457 (68%), Gaps = 21/457 (5%)
 Frame = +3

Query  1818  KCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV  1997
             K +ELE K + LE ELRE AA+EI L+SVV EHG S++K+H PARRLSRLY HA K  S 
Sbjct  250   KSEELESKCERLEQELREVAALEISLYSVVPEHGCSSHKLHTPARRLSRLYVHASKFWSS  309

Query  1998  LRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLSSE-YS  2171
              ++ S  ++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I + F   +Q  L+ + +S
Sbjct  310   DKKASVTKNFVSGLVLVAKSCGNDVSRLTFWLSNTVVLREIIAQTFGITRQPSLAMKAFS  369

Query  2172  KNAVVKNERK-ASPLKWQ---SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSR  2339
              N   K   K +SP + +   S  H +     LP   +DW        ALEK+E+WIFSR
Sbjct  370   TNVNAKMLGKNSSPTRRKNNYSGKHARPAIWPLP---DDWRETGTLVAALEKIESWIFSR  426

Query  2340  IIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             I+ES+WWQ  TPHMQ+        +   +     +   ++  NFS+ LWK AF+DA+ RI
Sbjct  427   IVESVWWQALTPHMQTLVKDISSPKAGSLL--GPALGDQQQGNFSIHLWKTAFQDAFSRI  484

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+RAGGHECGCL +L+KL+M+ CVARLDVAMFNA+LRESA+++P+DP+SDPI +  VLP
Sbjct  485   CPLRAGGHECGCLPVLAKLVMEHCVARLDVAMFNAVLRESANEVPSDPISDPIVDSRVLP  544

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             IPAG  SF +GAQLKN+IGNWSRWL D FG+       +      +++D+ +G    A D
Sbjct  545   IPAGDFSFGSGAQLKNSIGNWSRWLQDKFGM--VAAAPEKHGQAGDESDDRSG----AAD  598

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
               S  F LLN +SDL+MLPKDMLL +++RKEVCP+ G+ L+TR+L  F PDEFCP+P+P 
Sbjct  599   FYS--FKLLNELSDLLMLPKDMLLEKSIRKEVCPSIGIPLVTRILCNFTPDEFCPEPVPG  656

Query  3060  VVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPS  3164
             +VLE LN+E  +E   E++ +  FPC AAP+VY PPS
Sbjct  657   MVLEELNAESLLERFTEKDVITTFPCVAAPVVYCPPS  693



>gb|EYU42105.1| hypothetical protein MIMGU_mgv1a001198mg [Erythranthe guttata]
Length=868

 Score =   465 bits (1196),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 244/467 (52%), Positives = 318/467 (68%), Gaps = 56/467 (12%)
 Frame = +3

Query  1806  VLERK-----CQ-ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRL  1967
             V ERK     C+ E + +I+MLE ELREAAA EIGL+SVVAEH SS NKVHAPARRLSR 
Sbjct  368   VTERKESIHECRNECKSRIEMLEEELREAAASEIGLYSVVAEHASSGNKVHAPARRLSRF  427

Query  1968  YFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEK--  2141
             Y ++CKE S  +R SAAR+ VSGL+LV+K+CG+DVPRLTFWLSN ++LRA + K + +  
Sbjct  428   YSNSCKEGSQGKRASAARAAVSGLVLVSKSCGHDVPRLTFWLSNSIMLRAVVSKTAAELP  487

Query  2142  QQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
              ++P   E  K+  +                            +D E+   F  ALEKVE
Sbjct  488   GKIPHDLEEQKSKSIDET-------------------------DDMEDVSTFIIALEKVE  522

Query  2322  AWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELWK  2489
             +W+FSRI+ES+WWQTFTPHMQ   A S D   N    K   R +S  + E  NFS+ELWK
Sbjct  523   SWLFSRIVESLWWQTFTPHMQPTFAKSSDVTFNSGTKKTIGRRNSIGNYEQGNFSMELWK  582

Query  2490  KAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVS  2669
             KAF+DA+ER+CPVRAGGHECGCL +L +L+M+Q V RLD+AMFNAILRESA+++PTDP+S
Sbjct  583   KAFKDAFERLCPVRAGGHECGCLSVLVRLVMEQLVNRLDMAMFNAILRESAEEMPTDPLS  642

Query  2670  DPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADN  2849
             DPIS+ +VLPIPAGK+SF AG +LKN IGNWSR L DLFG++                ++
Sbjct  643   DPISDSKVLPIPAGKSSFGAGVELKNCIGNWSRGLTDLFGLE----------------ED  686

Query  2850  SNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIP  3029
             S   E +      K F LL+A+SDLMMLP +ML   ++RKE+CP FG +++ RVLN + P
Sbjct  687   SIDLENEKSPKSFKAFRLLHALSDLMMLPPEMLADTSIRKEICPMFGPTIVKRVLNSYTP  746

Query  3030  DEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAA  3170
             DEFCPDP+P  +++AL++E   E  ++ +  FPC+A+P  Y+PPSAA
Sbjct  747   DEFCPDPVPQNIIDALDNE---EFSDDMLTTFPCNASPTKYSPPSAA  790


 Score =   142 bits (359),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 118/186 (63%), Gaps = 14/186 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R   +V+  Y+I++ E+ PWPPS+SL++++ V +QWE+G++ SGS    A 
Sbjct  1    MVLGIRSKLRRRSAVKVTYIIHVQELMPWPPSESLRSVQTVFLQWENGNQYSGSFHSTA-  59

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                     + +I FNESF++P+ L +E  +     D FQKN +EF+L+ PR+D + KGQ
Sbjct  60   --------QDSKIVFNESFKLPVILHQEKKAH----DKFQKNYLEFSLFAPRKDKS-KGQ  106

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTAV++ A+YGV++  L+ +V IN K+S   +VQP+L ++++ V      S     + 
Sbjct  107  LLGTAVLNLADYGVIEHALSTNVSINLKKSSNKSVQPVLVIRLEPVENESASSSPNVGLS  166

Query  705  RESSMD  722
            +E S+D
Sbjct  167  KEPSLD  172



>ref|XP_009600559.1| PREDICTED: uncharacterized protein LOC104095991 isoform X2 [Nicotiana 
tomentosiformis]
Length=716

 Score =   460 bits (1184),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 278/581 (48%), Positives = 374/581 (64%), Gaps = 30/581 (5%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +   S + + S+D   +T+   ++     LE+K  ++E +++ LE ELRE AA+EI 
Sbjct  148   ILDETSISAQSVGSDDETVNTEENCEQEDKAALEQKIGQMESRLEKLEEELREVAALEIS  207

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SVV+EHGSS +K+H PARRLSRLY HACK  S  +R + A++ VSGL+LVAK+CGNDV
Sbjct  208   LYSVVSEHGSSAHKLHTPARRLSRLYLHACKYWSQDKRATVAKNTVSGLVLVAKSCGNDV  267

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLS---SEYSKNAVVKNERKASPLKWQSFP-HKK  2240
              RLTFWLSN V+LR  I +       P S      S     K E K S  KW++ P +K+
Sbjct  268   ARLTFWLSNAVVLRVIISQAFGSSCSPSSLVKITESNGGGKKTESKISSFKWKTHPGNKQ  327

Query  2241  SVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN  2420
             S  +DL    +DW+    FT ALE+VE+WIF RI+ESIWWQT TP+MQS    + D E +
Sbjct  328   SSKHDLLQFLDDWQETRTFTAALERVESWIFLRIVESIWWQTLTPNMQS---PTDDPEAS  384

Query  2421  KIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCV  2594
             K   R        ++  NFS+ LWK AF++A +R+CPVRAG HECGCL +L++ +++QCV
Sbjct  385   KSVGRLLGPALGDQQQGNFSINLWKNAFQEALKRLCPVRAGSHECGCLPVLARRVIEQCV  444

Query  2595  ARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWL  2774
             ARLDVAMFNAILRESA +IPTDP+SDPI + +VLPIPAG  SF +GAQLKN++GNWSR L
Sbjct  445   ARLDVAMFNAILRESAHEIPTDPISDPIVDSKVLPIPAGDLSFGSGAQLKNSVGNWSRCL  504

Query  2775  ADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLS  2954
              DLFGID +D   +         + S G +++      + F+LLNA+SDL+MLPKDML+ 
Sbjct  505   TDLFGIDAEDSGQND--------EGSFGDDQRKGGNQPEHFHLLNALSDLLMLPKDMLMD  556

Query  2955  RTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHM--EVEEESVVNFP  3128
             RT+R EVCP+  L L+ R+L  F PDEFCPDP+P  +LEALN+E  +   +  +S  +FP
Sbjct  557   RTIRMEVCPSISLPLVKRILCNFSPDEFCPDPVPGALLEALNAECIIARRLSGDSSSSFP  616

Query  3129  CSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI--  3302
               AA + Y PP  AA            S L+RS S++ +K YTSD+EL+E+DSPL  I  
Sbjct  617   YPAASVAYKPP-VAAEVAEKVAEVDGKSHLSRSASAIQRKGYTSDEELEEIDSPLACIID  675

Query  3303  KMENSEVTKPgggsgngng-------ngVRYQLLREVWMSS  3404
             KM +S  +   G              +  RY LLREVW ++
Sbjct  676   KMPSSPASAQNGNGKAKLKEETGFIGSNTRYDLLREVWQTT  716



>emb|CAN81894.1| hypothetical protein VITISV_042522 [Vitis vinifera]
Length=1060

 Score =   471 bits (1211),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 319/683 (47%), Positives = 415/683 (61%), Gaps = 77/683 (11%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGR---ESV  1613
             +L  E  + QE G+G++ + +K   SE E V+   QD T KQ    ++ +   +   E  
Sbjct  427   DLDKEEKEQQENGQGEQNLEKKKHSSENELVSKFTQDVTRKQVASRSNTLAFNKRVPEMQ  486

Query  1614  GAKTTCDERLNHVSSVHTLGESNRANGSVRSNQFVLRDKRNSIEGITSNDWKDTKV-RSK  1790
             G+  T + +L HV SV    E  +  G +  +  + ++K   I+  +  D K       K
Sbjct  487   GSLAT-NHKLKHVKSVQLSYERAKPVGLLDHSPHMEKEKEIDIQEDSHKDAKGFAASERK  545

Query  1791  ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLY  1970
             E  N   + K  E+E +I+MLE ELREAAA+E+GL+SVVAEHGSSTNKVHAPARRLSR Y
Sbjct  546   ERINNFSDSKV-EVESRIKMLEEELREAAAIEVGLYSVVAEHGSSTNKVHAPARRLSRFY  604

Query  1971  FHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL  2150
              HACK  +  +R SAAR+  SGL+LV+KACGNDVPRLTFWLSN ++LRA + +     ++
Sbjct  605   LHACKARTQAKRASAARAAASGLVLVSKACGNDVPRLTFWLSNSIVLRATVSQ--AVVEM  662

Query  2151  PLSSEYS------KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALE  2312
             PLS+  S      +N   K E  A           +   ++L GT +             
Sbjct  663   PLSAGPSTRSGGGRNRYNKEENNA-----------RESSDELGGTHKH------------  699

Query  2313  KVEAWIFSRIIESIWWQ---TFTPHMQSGAATSLD----SEINKIYQRTSSSCSEEPENF  2471
                  +F      + W+   T TP+MQS AA   D    S   K Y R  S   +E  NF
Sbjct  700   -----LF------LCWKRLKTLTPYMQSTAAKISDGSRGSNSRKTYGRRHSLGDQEQGNF  748

Query  2472  SLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDI  2651
             S+ELWK+AF+DA ER+CP RAGGHECGCL +LS+L+M+Q V+RLDV MFNAILRESA+++
Sbjct  749   SIELWKRAFKDACERLCPTRAGGHECGCLPVLSRLVMEQLVSRLDVGMFNAILRESAEEM  808

Query  2652  PTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlvedd  2831
             PTDP+SDPI + +VLPI AGK+SF AGAQLKNA+GNWSRWL DLFGIDD+D   D     
Sbjct  809   PTDPLSDPICDSKVLPISAGKSSFGAGAQLKNAVGNWSRWLTDLFGIDDNDAPGDT----  864

Query  2832  eNKADNSNGHERKAQ-DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGL-----  2993
                  N  G +++ + +   K F+LLNA+SDLMMLP +ML  R+ RKEV   +       
Sbjct  865   -----NEFGDDKRLKCETSFKVFHLLNALSDLMMLPFEMLADRSTRKEVISWYAQLLAYP  919

Query  2994  SLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAA  3173
             S+I RVL+ F+PDEFCPDPIP V+ E L+SED +E  EES+ +FPC A P VY+PPSAA+
Sbjct  920   SIIRRVLDNFVPDEFCPDPIPEVIFETLDSEDSLEGAEESITSFPCIATPPVYSPPSAAS  979

Query  3174  ldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSE----VTKPg-g  3338
                        S  L RS SS+L+KSY SDDELDELDSP+  I  +NS      TKP   
Sbjct  980   --FASIIGEVGSQSLQRSGSSLLRKSYISDDELDELDSPITSIIGDNSRGTPTSTKPSWL  1037

Query  3339  gsgngngngVRYQLLREVWMSSE  3407
               G G  + VRY+LLREVW   E
Sbjct  1038  PKGKGGRDVVRYRLLREVWRDGE  1060


 Score =   202 bits (515),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 140/198 (71%), Gaps = 11/198 (6%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K R    V+ +Y++++ EIKPWPPSQS++++++VV QWE+GD+ SG  +    
Sbjct  1    MVLGLRTKNRKGVLVKVDYIVHVQEIKPWPPSQSVRSVQSVVFQWENGDQASGFLS----  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VGNGRIEF+ESFR+P+ L ++   KS   D+FQKNC+EFNLYEPR+D   KGQ
Sbjct  57   -----CSVGNGRIEFSESFRLPVALYKD--GKSRGRDSFQKNCLEFNLYEPRKDKAGKGQ  109

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            +LG+A+I+ A+YG+++E + +S P+NCK+S+RN VQP++ LKIQ   K    S    ++ 
Sbjct  110  VLGSAIINLADYGIIEEAITISTPLNCKKSHRNMVQPVIFLKIQPFAKDSTSSSPVVSLS  169

Query  705  RESSMDSSAGESVSALMN  758
            +E+S+D   GESVS LM+
Sbjct  170  KEASLDQDGGESVSELMS  187



>ref|XP_008643808.1| PREDICTED: uncharacterized protein LOC100382159 isoform X1 [Zea 
mays]
 tpg|DAA47939.1| TPA: hypothetical protein ZEAMMB73_672463 [Zea mays]
Length=695

 Score =   459 bits (1181),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 261/541 (48%), Positives = 339/541 (63%), Gaps = 26/541 (5%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             V+++  +EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K
Sbjct  165   VVDQGNEELVLKIDKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASK  224

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLS  2159
               S  +R S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q  P  
Sbjct  225   SWSEDKRASVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSM  284

Query  2160  SEYSKNAVVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
             +  S N   K    K+  + W++  +            +DW+       ALEK+E+WIFS
Sbjct  285   TNMSMNGGAKKLGGKSMTMLWRNNYNGTQANFAARLMPDDWQETSTLLAALEKIESWIFS  344

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYER  2516
             RI+E++WWQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF+DA+ R
Sbjct  345   RIVETVWWQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFQDAFSR  402

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             +CP+ AG HECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VL
Sbjct  403   MCPLSAGRHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVL  462

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PIPAG  SF +GAQLKN+IGNWSRWL D  GI           D ++  D  +  + +  
Sbjct  463   PIPAGDLSFGSGAQLKNSIGNWSRWLTDKLGI-----------DHDDSEDIGDVEDERRA  511

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
              A +K F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPDP+P
Sbjct  512   AAETKSFQLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDPVP  571

Query  3057  NVVLEALNSEDHMEVEEESVVN--FPCSAAPIVYAPPSAAAldgilgdisssssqltrsr  3230
             + VLE LNSE  +E      V   FPC+AAPIVY  PS               ++L R  
Sbjct  572   STVLEELNSESLLERHANKDVTSVFPCTAAPIVYRTPS-TLDAAERAADIGGGAKLDRKA  630

Query  3231  ssVLKKSYTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREV  3392
             S V ++ YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREV
Sbjct  631   SMVQRRGYTSDDDLDDLDSPLASL-IDRSAPPSPSNGLAHFSAGRGVSMENTRYTLLREV  689

Query  3393  W  3395
             W
Sbjct  690   W  690



>ref|NP_181761.1| nucleolar protein gar2-like protein [Arabidopsis thaliana]
 ref|NP_001031531.1| nucleolar protein gar2-like protein [Arabidopsis thaliana]
 gb|AAD23715.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10105.1| nucleolar protein gar2-like protein [Arabidopsis thaliana]
 gb|AEC10106.1| nucleolar protein gar2-like protein [Arabidopsis thaliana]
Length=669

 Score =   458 bits (1179),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 252/531 (47%), Positives = 343/531 (65%), Gaps = 37/531 (7%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             E K + LE +I+ LE ELRE AA+EI L+SVV +H SS +K+H PARR+SR+Y HACK  
Sbjct  174   EEKIERLETRIEKLEEELREVAALEISLYSVVPDHCSSAHKLHTPARRISRIYIHACKHF  233

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS  2171
             +  +R + AR+ VSGL+LVAK+CGNDV RLTFWLSN + LR  I +   + ++   SE +
Sbjct  234   TQGKRATIARNSVSGLVLVAKSCGNDVSRLTFWLSNIIALRQIISQAFGRSRITQISEPN  293

Query  2172  KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIES  2351
             ++    + +K + L+W+         N      EDW+    FT ALEK+E W+FSRI+ES
Sbjct  294   ESGNSDSGKKTN-LRWK---------NGFQQLLEDWQETETFTTALEKIEFWVFSRIVES  343

Query  2352  IWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVR  2531
             +WWQ FTPHMQS    S  S+ N      S    +    FS+ LWK AFRDA +RICP+R
Sbjct  344   VWWQVFTPHMQSPEDDSSASKSNGKLMGPSLG-DQNQGTFSISLWKNAFRDALQRICPMR  402

Query  2532  AGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAG  2711
               GHECGCL +L++++M +C+ R DVAMFNAILRES   IPTDPVSDPI + +VLPIPAG
Sbjct  403   GAGHECGCLPVLARMVMDKCIGRFDVAMFNAILRESEHQIPTDPVSDPILDSKVLPIPAG  462

Query  2712  KASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD--AC  2885
               SF +GAQLKNAIGNWSR L ++FG+              N  D+S   +R ++D    
Sbjct  463   DLSFGSGAQLKNAIGNWSRCLTEMFGM--------------NSDDSSAKEKRNSEDDHVE  508

Query  2886  SKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVV  3065
             SK F LLN +SDL+MLPKDML+  ++R+E+CP+  L LI R+L  F PDEFCPD +P  V
Sbjct  509   SKAFVLLNELSDLLMLPKDMLMEISIREEICPSISLPLIKRILCNFTPDEFCPDQVPGAV  568

Query  3066  LEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLK  3245
             LE LN+ + +   + S  +FP +A+ + Y PPS      I   ++ +S++L+R+ S + +
Sbjct  569   LEELNAAESIGDRKLSEASFPYAASSVSYMPPST---MDIAEKVAEASAKLSRNVSMIQR  625

Query  3246  KSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
             K YTSD+EL+ELDSPL  I  + S+ T           +  RY+LLR+VW+
Sbjct  626   KGYTSDEELEELDSPLTSIVDKASDFT-------GSATSNARYKLLRQVWV  669



>ref|XP_006293794.1| hypothetical protein CARUB_v10022776mg [Capsella rubella]
 gb|EOA26692.1| hypothetical protein CARUB_v10022776mg [Capsella rubella]
Length=676

 Score =   458 bits (1179),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 253/528 (48%), Positives = 338/528 (64%), Gaps = 39/528 (7%)
 Frame = +3

Query  1818  KCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV  1997
             K   LE +I+ LE ELRE AA+EI L+SVV +H SS +K+H PARR+SR+Y HACK  + 
Sbjct  182   KIGHLETRIEKLEEELREVAALEISLYSVVPDHCSSAHKLHTPARRISRIYIHACKHFTQ  241

Query  1998  LRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKN  2177
              +R + AR+ VSGL+LVAK+CGNDVPRLTFWLSN + LR  I +   K ++   ++ S  
Sbjct  242   GKRATIARNSVSGLVLVAKSCGNDVPRLTFWLSNIIALRQIISQAFGKSRI---TQISNG  298

Query  2178  AVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
             +   +  K + L+W+         N      EDW+    FT ALEK+E W+FSRI+ES+W
Sbjct  299   SDHGDSGKKTNLRWK---------NGFQQLLEDWQETETFTTALEKIEFWVFSRIVESVW  349

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ FTPHMQS    S  S+ N      S    +    FS+ LWK A+RDA +R+CP+R  
Sbjct  350   WQVFTPHMQSPENDSSVSKSNGKLMGPSLG-DQNQGTFSISLWKNAYRDALQRLCPMRGA  408

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L++++M +C+ R DVAMFNAILRES   IPTDPVSDPI + +VLPIPAG  
Sbjct  409   GHECGCLPVLARMVMDKCIGRFDVAMFNAILRESEHQIPTDPVSDPILDSKVLPIPAGDL  468

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD--ACSK  2891
             SF +GAQLKNAIGNWSR L ++FG+              N  D+S    R  +D    SK
Sbjct  469   SFGSGAQLKNAIGNWSRCLTEMFGM--------------NSDDSSAKETRDREDDHVESK  514

Query  2892  PFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLE  3071
             PF LLN +SDL+MLPKDML+ R++R+E+CP+  L LI R+L  F PDEFCPD +P  VLE
Sbjct  515   PFVLLNELSDLLMLPKDMLMERSIREEMCPSISLPLIKRILCNFTPDEFCPDHVPGAVLE  574

Query  3072  ALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
              LN+ + +   + S  +FP +A+ + Y PPS      I   ++ ++ +LTR+ S + +K 
Sbjct  575   ELNAAESIGDGKLSEASFPYAASSVSYMPPST---MDIAEKVAEAAGKLTRNVSMIQRKG  631

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             YTSD+EL+ELDSPL  I  + S+ T           +  RY+LLREVW
Sbjct  632   YTSDEELEELDSPLTSIVDKGSDFT-------GSTTSNARYKLLREVW  672



>ref|XP_009600555.1| PREDICTED: uncharacterized protein LOC104095991 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009600556.1| PREDICTED: uncharacterized protein LOC104095991 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009600557.1| PREDICTED: uncharacterized protein LOC104095991 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009600558.1| PREDICTED: uncharacterized protein LOC104095991 isoform X1 [Nicotiana 
tomentosiformis]
Length=810

 Score =   461 bits (1187),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 273/551 (50%), Positives = 360/551 (65%), Gaps = 29/551 (5%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LE+K  ++E +++ LE ELRE AA+EI L+SVV+EHGSS +K+H PARRLSRLY HAC
Sbjct  272   AALEQKIGQMESRLEKLEEELREVAALEISLYSVVSEHGSSAHKLHTPARRLSRLYLHAC  331

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS-  2159
             K  S  +R + A++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +       P S 
Sbjct  332   KYWSQDKRATVAKNTVSGLVLVAKSCGNDVARLTFWLSNAVVLRVIISQAFGSSCSPSSL  391

Query  2160  --SEYSKNAVVKNERKASPLKWQSFP-HKKSVGNDLPGTFEDWENPLGFTKALEKVEAWI  2330
                  S     K E K S  KW++ P +K+S  +DL    +DW+    FT ALE+VE+WI
Sbjct  392   VKITESNGGGKKTESKISSFKWKTHPGNKQSSKHDLLQFLDDWQETRTFTAALERVESWI  451

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRD  2504
             F RI+ESIWWQT TP+MQS    + D E +K   R        ++  NFS+ LWK AF++
Sbjct  452   FLRIVESIWWQTLTPNMQS---PTDDPEASKSVGRLLGPALGDQQQGNFSINLWKNAFQE  508

Query  2505  AYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISN  2684
             A +R+CPVRAG HECGCL +L++ +++QCVARLDVAMFNAILRESA +IPTDP+SDPI +
Sbjct  509   ALKRLCPVRAGSHECGCLPVLARRVIEQCVARLDVAMFNAILRESAHEIPTDPISDPIVD  568

Query  2685  PEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE  2864
              +VLPIPAG  SF +GAQLKN++GNWSR L DLFGID +D   +         + S G +
Sbjct  569   SKVLPIPAGDLSFGSGAQLKNSVGNWSRCLTDLFGIDAEDSGQND--------EGSFGDD  620

Query  2865  RKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCP  3044
             ++      + F+LLNA+SDL+MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCP
Sbjct  621   QRKGGNQPEHFHLLNALSDLLMLPKDMLMDRTIRMEVCPSISLPLVKRILCNFSPDEFCP  680

Query  3045  DPIPNVVLEALNSEDHM--EVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             DP+P  +LEALN+E  +   +  +S  +FP  AA + Y PP  AA            S L
Sbjct  681   DPVPGALLEALNAECIIARRLSGDSSSSFPYPAASVAYKPP-VAAEVAEKVAEVDGKSHL  739

Query  3219  trsrssVLKKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngng-------ngVR  3371
             +RS S++ +K YTSD+EL+E+DSPL  I  KM +S  +   G              +  R
Sbjct  740   SRSASAIQRKGYTSDEELEEIDSPLACIIDKMPSSPASAQNGNGKAKLKEETGFIGSNTR  799

Query  3372  YQLLREVWMSS  3404
             Y LLREVW ++
Sbjct  800   YDLLREVWQTT  810



>ref|XP_009418206.1| PREDICTED: uncharacterized protein LOC103998449 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score =   455 bits (1170),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 297/431 (69%), Gaps = 19/431 (4%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK  +
Sbjct  186   QKIEEMESRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKYWT  245

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY--  2168
               ++ + AR++VSGL+L AK+CGNDV RLTFWLSN V+LR  I  F     L  S+    
Sbjct  246   QDKKATVARNIVSGLVLTAKSCGNDVSRLTFWLSNTVVLREII--FQTFGNLSNSTNMRA  303

Query  2169  --SKNAVVKNERKASPLKWQS---FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
               S     K + K +PL+ ++       KS+G       +DW++   FT ALEK+E+WIF
Sbjct  304   VESNGGARKTDEKHTPLRRKNNSVIRQGKSLG--FMQLLDDWQDTSTFTTALEKIESWIF  361

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYE  2513
             SRI+ES+WWQT TPHMQS     L +  N           ++  + S+ LW  AF DA+ 
Sbjct  362   SRIVESVWWQTLTPHMQS-PLEELYTPKNFGKLLGPVLGDQQQGSLSINLWISAFHDAFS  420

Query  2514  RICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEV  2693
             R+CPVRAGGHECGCL +L++ +M+QCV+RLDVAMFNAILRESA +IPTDPVSDPI +P+V
Sbjct  421   RLCPVRAGGHECGCLPVLARKVMEQCVSRLDVAMFNAILRESAHEIPTDPVSDPIVDPKV  480

Query  2694  LPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKA  2873
             LPIPAG  SF +GAQLKN+IGNWSRWL DLFG        D  +  ++  D +     K 
Sbjct  481   LPIPAGDLSFGSGAQLKNSIGNWSRWLTDLFG-------KDAEDSTKDVQDANEEETLKE  533

Query  2874  QDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
              +A SK F+LLN + DL+MLPKDMLL RTVRKEV P+ GL LITR+L  F PDEFCPDP+
Sbjct  534   ANAGSKYFHLLNELCDLLMLPKDMLLDRTVRKEVFPSIGLPLITRILCNFTPDEFCPDPV  593

Query  3054  PNVVLEALNSE  3086
             P VVLE LN++
Sbjct  594   PGVVLEELNTK  604



>emb|CDP13321.1| unnamed protein product [Coffea canephora]
Length=1029

 Score =   466 bits (1199),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 279/537 (52%), Positives = 362/537 (67%), Gaps = 32/537 (6%)
 Frame = +3

Query  1839  KIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAA  2018
             +IQMLE ELREAA +EIGL+SVVAEHGSS +KVHAPARRLSR Y HACKE S  ++ SAA
Sbjct  510   RIQMLEEELREAATLEIGLYSVVAEHGSSVSKVHAPARRLSRFYLHACKEKSRAKQASAA  569

Query  2019  RSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNER  2198
             R+ +SGL+LV+KACGNDVPRLTFWLSN ++LR  + + + +    +S+  +K+A  K++R
Sbjct  570   RAAISGLVLVSKACGNDVPRLTFWLSNAIMLRVIVIQTAAE----ISNLEAKHAG-KSDR  624

Query  2199  KAS------PLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWW  2360
               S      P +  SF + +   +D     +DWE+   F  ALEK E+W+FSRI+ESIWW
Sbjct  625   SVSHLDSCFPKRQDSFSYVEERNSDSVEESDDWEDIETFIFALEKAESWVFSRIVESIWW  684

Query  2361  QTFTPHMQSGAATSLDSEINKIYQRTSSSC----SEEPENFSLELWKKAFRDAYERICPV  2528
             QT TPHMQ   A +         ++ ++S      +   NFS+ELWKKAF+DA ER+CP+
Sbjct  685   QTITPHMQPTVAKTGGRTRGLGTKKNNASGYGLGDQVQGNFSIELWKKAFKDACERLCPI  744

Query  2529  RAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPA  2708
             RAGGHECGCL ++ +L+M+Q V+RLDVAMFNAILRESA+++P+DPVSDPIS+  VLPIPA
Sbjct  745   RAGGHECGCLPVMPRLVMEQLVSRLDVAMFNAILRESAEEMPSDPVSDPISDSRVLPIPA  804

Query  2709  GKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS  2888
             GK SF AG QLKNAIGNWSRWL+DLFGI+D +  DD     ++K   S            
Sbjct  805   GKLSFGAGVQLKNAIGNWSRWLSDLFGIEDSESLDDSDTAGDDKGSES-----------F  853

Query  2889  KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVL  3068
             K F  LNA+SDLMMLP +ML+    RKEVCP  G ++I +VL+ F+PDEFCP+PIP  V+
Sbjct  854   KAFRFLNALSDLMMLPLEMLMDIPTRKEVCPLLGPTMIKKVLSNFVPDEFCPNPIPQSVI  913

Query  3069  EALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKK  3248
              AL+ ED   V  ES+ + PC+A P +Y+PP A +   +       ++ + RS SS+LKK
Sbjct  914   HALDHEDASGVSTESITSHPCTAPPTIYSPPPAPS--LLRSIKEVGNNNIQRSGSSLLKK  971

Query  3249  SYTsddeldeldsPLNLI---KMENSEVTKPgggsgngngngV-RYQLLREVWMSSE  3407
             SYTSDDELDELD+ L  I     ++S   K            V RYQLLRE+W   E
Sbjct  972   SYTSDDELDELDTRLTSIIADSFQSSAARKLNWIPRGNGKGKVSRYQLLRELWKGYE  1028


 Score =   161 bits (408),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 127/198 (64%), Gaps = 15/198 (8%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +   SVQ +YLIN+VEIKPWPPSQSL+++++V++QW++GD+NSGS   VA 
Sbjct  1    MVLGLRSKKKRGASVQIDYLINVVEIKPWPPSQSLRSVQSVLLQWQNGDQNSGSFLTVA-  59

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                    G+  I FNESF +P+TL  +  ++    D FQKN +EF+LYEPR++   K Q
Sbjct  60   --------GDANIAFNESFTLPVTLHPDKKAR----DRFQKNYLEFSLYEPRKEKATKEQ  107

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA+I+ + +GV+++ L +  P+N K++ +++ QP L  +++ + KG  KS    NVR
Sbjct  108  LLGTAIINLSEFGVIEDILPIIAPLNFKKTSKSSPQPALYFQVEPLDKGSSKS--SPNVR  165

Query  705  RESSMDSSAGESVSALMN  758
               +     G+   A  N
Sbjct  166  SSRTSLDQDGQEAHAEFN  183



>ref|XP_006411492.1| hypothetical protein EUTSA_v10016357mg [Eutrema salsugineum]
 gb|ESQ52945.1| hypothetical protein EUTSA_v10016357mg [Eutrema salsugineum]
Length=671

 Score =   455 bits (1171),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 254/528 (48%), Positives = 346/528 (66%), Gaps = 32/528 (6%)
 Frame = +3

Query  1818  KCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV  1997
             K + LE +I+ LE ELRE AA+EI L+SVV +H SS++K+H PARR+SR+Y HACK  + 
Sbjct  175   KIENLETRIEKLEEELREVAALEISLYSVVPDHCSSSHKLHTPARRISRIYIHACKHFTR  234

Query  1998  LRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKN  2177
              +R + AR+ VSGL+LVA++CGNDV RLTFWLSN + LR  + +   K ++  SSE S  
Sbjct  235   GKRATIARNSVSGLVLVARSCGNDVSRLTFWLSNIIALREIVSQAFGKSRITQSSE-SNG  293

Query  2178  AVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
             +   +  K + L+W+         N L    EDW+    FT ALEK+E W+FSRI+ES+W
Sbjct  294   SENGDSGKKTNLRWK---------NGLQQLLEDWQETETFTAALEKIELWVFSRIVESVW  344

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ FTP MQS      DS  N+     SS   ++   FS+ LWK AFRDA +R+C +R G
Sbjct  345   WQVFTPRMQSPEN---DSSANEKLM-GSSLGDQKQGTFSISLWKNAFRDALQRLCTMRGG  400

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL LL++++M++C+ R DVAMFNAILRES   IPTDPVSDPI +  VLPIPAG+ 
Sbjct  401   GHECGCLSLLARMVMEKCIGRFDVAMFNAILRESEHQIPTDPVSDPILDSRVLPIPAGEL  460

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKNAIG+WSR L ++FG++ DD       + E+    S G +RKA       F
Sbjct  461   SFGSGAQLKNAIGSWSRCLTEMFGMNSDDTLAKEKRNSEDGHLESEGSDRKA-------F  513

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDML+ R++R+E+CP+  L LI R+L  F PDEFCPD +P  VLE L
Sbjct  514   VLLNELSDLLMLPKDMLMERSIREEICPSISLPLIKRILCNFTPDEFCPDHVPGAVLEEL  573

Query  3078  N-SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSY  3254
             N +E + +  + S  +FP +A+ + Y PPS      +   +  S+ +L+R+ S + +K Y
Sbjct  574   NAAERNGDDGQLSEASFPYAASSVSYMPPSTT---DVAEKVVESAGKLSRNLSMIQRKGY  630

Query  3255  TsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
             TSD+EL+ELDSPL  I  + S+ T           +  RY+LLR+VW+
Sbjct  631   TSDEELEELDSPLTSIVDKLSDFT-------GSATSNARYELLRQVWV  671



>ref|XP_004973859.1| PREDICTED: uncharacterized protein LOC101774238 isoform X3 [Setaria 
italica]
Length=692

 Score =   456 bits (1172),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 260/558 (47%), Positives = 348/558 (62%), Gaps = 26/558 (5%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T +D  D + +       V+ +  +E E +I  LE ELRE AA+E+ L+SVV EHGSS +
Sbjct  147   TDDDIPDIEEKIVHHDKSVVGQGNEESESRIDKLEQELREVAALEVSLYSVVPEHGSSAH  206

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             K+H PARRLSRLY HA K  S  +R S A+++ SGL+LVAK+  ND  RLTFWLSN V+L
Sbjct  207   KLHTPARRLSRLYIHASKFWSADKRASVAKNIASGLVLVAKSSSNDASRLTFWLSNTVVL  266

Query  2112  RAAICK-FSEKQQLPLSSEYSKNAVVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWEN  2285
             R  I + F      P ++  S +   K  + K   + W++  + K          +DW+ 
Sbjct  267   REIIAQTFGISCVTPTTATMSMDGGAKKLDGKPMTMLWRNSSNGKQAKLAAMQMPDDWQE  326

Query  2286  PLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPE  2465
                   +LEK+E+WIFSRI++++WWQ  TPHMQ+ A  S      ++     +   +   
Sbjct  327   TSTLLASLEKIESWIFSRIVDTVWWQALTPHMQTPAEGSSTPRAGRVL--GPALGDQRQG  384

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESAD  2645
              FS+ LWK AF DA+ R+CP+R+GGHECGCL +L+KL+M+QCVARLDVAMFNAILRESA 
Sbjct  385   TFSVNLWKAAFHDAFSRMCPLRSGGHECGCLPVLAKLVMEQCVARLDVAMFNAILRESAS  444

Query  2646  DIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlve  2825
             +IPTDP+SDPI +P+VLPIPAG  SF +GAQLKN+IGNWSRWL D F             
Sbjct  445   EIPTDPISDPIVDPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTDKF-----------GI  493

Query  2826  ddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLIT  3005
             DD++    ++  ER+   A SK F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+T
Sbjct  494   DDDDSDIGNDDDERRGA-AESKSFQLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVT  552

Query  3006  RVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAld  3179
             R+L  F PDEFCPDP+P+ VLE LNSE  +E   +++ +  FPC AAP+VY  PS     
Sbjct  553   RILCNFTPDEFCPDPVPSTVLEELNSESLLERCTDKDVISAFPCIAAPVVYCAPS-TLDA  611

Query  3180  gilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPg------gg  3341
                       ++L R  S V ++ YTSDD+LD+LDSPL  + ++ S    P         
Sbjct  612   AEKVADIGGGAKLDRKASLVQRRGYTSDDDLDDLDSPLASL-IDRSAPPSPSNGIAHFSA  670

Query  3342  sgngngngVRYQLLREVW  3395
                 +    RY LLREVW
Sbjct  671   QRGASMENARYTLLREVW  688



>ref|XP_006660764.1| PREDICTED: uncharacterized protein LOC102709200 [Oryza brachyantha]
Length=812

 Score =   459 bits (1180),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 257/541 (48%), Positives = 342/541 (63%), Gaps = 35/541 (6%)
 Frame = +3

Query  1824  QELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLR  2003
             +EL+ K + LE ELRE AA+EI L+SVV EHG S++K+H PARRLSRLY HA K  S  +
Sbjct  283   KELKSKCERLEQELREVAALEISLYSVVPEHGCSSHKLHTPARRLSRLYIHASKFWSSDK  342

Query  2004  RLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPL-----SSE  2165
             + S  ++ VSGL++VAK+CGNDV RLTFWLSN V+LR  I + F    Q  L     S+ 
Sbjct  343   KASVTKNFVSGLVIVAKSCGNDVSRLTFWLSNTVVLREIIAQTFGISCQPSLAMKAFSTN  402

Query  2166  YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRII  2345
              + N + KN       +  +  H +     LP   +DW        ALEK+E+WIFSRI+
Sbjct  403   GNANMLGKNSSAMRRKRNYNGKHARPAVWPLP---DDWRETDTLVLALEKIESWIFSRIV  459

Query  2346  ESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCS---EEPENFSLELWKKAFRDAYER  2516
             ES+WWQ  TPHMQ+     L  +I+     + S  +   ++  NFS+ LWK AF DA+ R
Sbjct  460   ESVWWQALTPHMQT-----LREDISSPKAGSLSGPALGDQQQGNFSIHLWKTAFHDAFSR  514

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             ICP+RAGGHECGCL +L+KL+M+QCVARLDVAMFNA+LRESA++IP+DP+SDPI    VL
Sbjct  515   ICPLRAGGHECGCLPVLAKLVMEQCVARLDVAMFNAVLRESANEIPSDPISDPIVESRVL  574

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PIPAG  SF +GAQLKN+IGNWSRWL D FG+           + + +A + +   R + 
Sbjct  575   PIPAGDFSFGSGAQLKNSIGNWSRWLQDKFGM------VAAASEKDGQAGDDSDDRRHSV  628

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
             D  S  F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCP+P+ 
Sbjct  629   DVSS--FKLLNQLSDLLMLPKDMLLEKSIRKEVCPSIGLPLVTRILCNFTPDEFCPEPVS  686

Query  3057  NVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsr  3230
              +VLE LN E  +E   E++ +  FPC+AAP+ Y PP            + ++ +     
Sbjct  687   GMVLEELNDESLLERFTEKDMITTFPCTAAPVGYCPP-PPDDVADKVADAGANVETDLRA  745

Query  3231  ssVLKKSYTsddeldeldsPLNLIKMENSEVTKP------gggsgngngngVRYQLLREV  3392
             S V ++ YTSDD+LD+LD+PL  +  + S    P             +    RYQLLREV
Sbjct  746   SMVQRRGYTSDDDLDDLDNPLASL-YDRSAPPSPCNGVSHSTTGQGFSMVNARYQLLREV  804

Query  3393  W  3395
             W
Sbjct  805   W  805



>ref|XP_002879979.1| hypothetical protein ARALYDRAFT_483324 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56238.1| hypothetical protein ARALYDRAFT_483324 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   453 bits (1166),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 250/531 (47%), Positives = 340/531 (64%), Gaps = 37/531 (7%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             E K + LE +I+ LE ELRE AA+EI L+SVV +H SS +K+H PARR+SR+Y HACK  
Sbjct  167   EEKIERLETRIEKLEEELREVAALEISLYSVVPDHCSSAHKLHTPARRISRIYIHACKHF  226

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS  2171
             +  +R + AR+ VSGL+LVAK+CGNDV RLTFWLSN + LR  I +   + ++   SE +
Sbjct  227   TQGKRATIARNSVSGLVLVAKSCGNDVSRLTFWLSNIIALRQIISQAFGRSRITQISEPN  286

Query  2172  KNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIES  2351
             +     + +K + L+W+         N      EDW+    FT ALEK+E W+FSRI+ES
Sbjct  287   ERGNGDSGKKTN-LRWK---------NGFQQLLEDWQETETFTTALEKIEFWVFSRIVES  336

Query  2352  IWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVR  2531
             +WWQ FTPHMQS    S  S+ N      S    +    FS+ LWK AFRDA +R+CP+R
Sbjct  337   VWWQVFTPHMQSPENDSSASKTNGKLMGPSLG-DQNQGTFSISLWKNAFRDALQRLCPMR  395

Query  2532  AGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAG  2711
               GHECGCL +L++++M +C+ R DVAMFNAILRES   IPTDPVSDPI + +VLPIPAG
Sbjct  396   GAGHECGCLPVLARMVMDKCIGRFDVAMFNAILRESEHQIPTDPVSDPILDSKVLPIPAG  455

Query  2712  KASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD--AC  2885
               SF +GAQLKNAIGNWSR L ++FG+              N  D+S   +R ++D    
Sbjct  456   DLSFGSGAQLKNAIGNWSRCLTEMFGM--------------NSDDSSAKEKRNSEDDHVE  501

Query  2886  SKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVV  3065
             SK F LLN +SDL+MLPKDML+   +R+E+CP+  L LI R+L  F PDEFCPD +P  V
Sbjct  502   SKAFVLLNELSDLLMLPKDMLMEIYIREEICPSITLPLIKRILCNFTPDEFCPDHVPGAV  561

Query  3066  LEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLK  3245
             LE LN+ + +   + S  +FP +A+ + Y PPS      I   ++ ++ +L+R+ S + +
Sbjct  562   LEELNASESIGDRKLSEASFPYAASSVSYMPPST---MDIAEKVAEAAGKLSRNVSMIQR  618

Query  3246  KSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
             K YTSD+EL+ELDSPL  I  + S+ T           +  RY+LLR+VW+
Sbjct  619   KGYTSDEELEELDSPLTSIVDKASDFT-------GSETSNARYKLLRQVWV  662



>gb|AFV66585.1| LSG [Saccharum hybrid cultivar]
 gb|AFV66587.1| LSG [Saccharum hybrid cultivar]
Length=690

 Score =   454 bits (1168),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 265/535 (50%), Positives = 341/535 (64%), Gaps = 30/535 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA  2180
             +S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q  P  +  + N 
Sbjct  232   VSVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSITTMNMNG  291

Query  2181  VVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
               K  + K+  + W++       G    G  +DW+       ALEK+E+WIFSRI+E++W
Sbjct  292   ATKKLDGKSMTMLWRNNSSHAKTG----GMPDDWQETSTLLAALEKIESWIFSRIVETVW  347

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+RAG
Sbjct  348   WQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFNDAFNRMCPLRAG  405

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  
Sbjct  406   GHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDL  465

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKN+IGNWSRWL D  GIDDDD +D    +           ER+   A +K F
Sbjct  466   SFGSGAQLKNSIGNWSRWLTDKLGIDDDDSEDIGDVE----------DERRGA-AETKSF  514

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VLE L
Sbjct  515   QLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVLEEL  574

Query  3078  NSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             NSE  +E    ++ +  FPC AAP VY  PS               ++L R  S V ++ 
Sbjct  575   NSESLLERHTNKDMINVFPCIAAPTVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQRRG  633

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  634   YTSDDDLDDLDSPLASL-IDRSAPPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  687



>gb|AFV66581.1| LSG [Saccharum hybrid cultivar]
Length=690

 Score =   453 bits (1166),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 263/535 (49%), Positives = 341/535 (64%), Gaps = 30/535 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+S+V EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSLVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLP--LSSEYSKN  2177
              S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q    +++     
Sbjct  232   ASVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSITTMNMNG  291

Query  2178  AVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
             A  K + K+  + W++       G    G  +DW+       ALEK+E+WIFSRI+E++W
Sbjct  292   ATRKLDGKSMTMLWRNNSSHAKTG----GMPDDWQETSTLLAALEKIESWIFSRIVETVW  347

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+RAG
Sbjct  348   WQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFNDAFNRMCPLRAG  405

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  
Sbjct  406   GHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDL  465

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKN+IGNWSRWL D  GIDDDD +D    +           ER+   A +K F
Sbjct  466   SFGSGAQLKNSIGNWSRWLTDKLGIDDDDSEDIGDVE----------DERRGA-AETKSF  514

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VLE L
Sbjct  515   QLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVLEEL  574

Query  3078  NSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             NSE  +E    ++++  FPC AAP VY  PS               ++L R  S V ++ 
Sbjct  575   NSESLLERYTNKDTINVFPCIAAPTVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQRRG  633

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  634   YTSDDDLDDLDSPLASL-IDRSAPPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  687



>gb|AFV66586.1| LSG [Saccharum hybrid cultivar]
Length=690

 Score =   453 bits (1165),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 264/535 (49%), Positives = 341/535 (64%), Gaps = 30/535 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA  2180
             +S A+++ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q  P  +  + N 
Sbjct  232   VSVAKNIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSITTMNMNG  291

Query  2181  VVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
               K  + K+  + W++       G    G  +DW+       ALEK+E+WIFSRI+E++W
Sbjct  292   ATKKLDGKSMTMLWRNNSSHAKTG----GMPDDWQETSTLLAALEKIESWIFSRIVETVW  347

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+RAG
Sbjct  348   WQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFNDAFNRMCPLRAG  405

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  
Sbjct  406   GHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDL  465

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKN+IGNWSRWL D  GIDDDD +D    +           ER+   A +K F
Sbjct  466   SFGSGAQLKNSIGNWSRWLTDKLGIDDDDSEDIGDVE----------DERRGA-AETKSF  514

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VLE L
Sbjct  515   QLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVLEEL  574

Query  3078  NSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             NSE  +E    ++ +  FPC AAP VY  PS               ++L R  S V ++ 
Sbjct  575   NSESLLERHTNKDMINVFPCIAAPTVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQRRG  633

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  634   YTSDDDLDDLDSPLASL-IDRSAPPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  687



>gb|AFV66580.1| LSG [Saccharum hybrid cultivar]
Length=690

 Score =   453 bits (1165),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 264/535 (49%), Positives = 341/535 (64%), Gaps = 30/535 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA  2180
              S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q  P  +  + N 
Sbjct  232   ASVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSITTMNMNG  291

Query  2181  VVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
               K  + K+  + W++       G    G  +DW+       ALEK+E+WIFSRI+E++W
Sbjct  292   ATKKLDGKSMKMLWRNNSSHAKTG----GMPDDWQETSTLLAALEKIESWIFSRIVETVW  347

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+RAG
Sbjct  348   WQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFNDAFNRMCPLRAG  405

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  
Sbjct  406   GHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDL  465

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQ+KN+IGNWSRWL D  GIDDDD +D    +           ER+   A +K F
Sbjct  466   SFGSGAQMKNSIGNWSRWLTDKLGIDDDDSEDIGDVE----------DERRGA-AETKSF  514

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P++VLE L
Sbjct  515   QLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSMVLEEL  574

Query  3078  NSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             NSE  +E    ++ +  FPC AAP VY  PS               ++L R  S V ++ 
Sbjct  575   NSESLLERHTNKDMINVFPCIAAPTVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQRRG  633

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  634   YTSDDDLDDLDSPLASL-IDRSAPPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  687



>ref|XP_008392120.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103454291 
[Malus domestica]
Length=789

 Score =   456 bits (1172),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 277/548 (51%), Positives = 354/548 (65%), Gaps = 32/548 (6%)
 Frame = +3

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
               LERK +E+E +I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARR+SRLY HAC
Sbjct  255   JALERKIEEMEMRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRISRLYIHAC  314

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLS  2159
             K  +  +R + A++ VSGL L+AK+CGNDVPRL FWLSN V+LR  I + F    Q   S
Sbjct  315   KHWTQDKRXTIAKNTVSGLXLIAKSCGNDVPRLXFWLSNXVVLREIISQAFGISXQSSPS  374

Query  2160  SEY--SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
              ++  S     +NE K++ LKW      K + N L    +DW+    FT ALEKVE+WIF
Sbjct  375   VKFAESNGTSKRNEXKSAXLKWXGSXGSKQM-NGLXQXADDWQETGTFTAALEKVESWIF  433

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFRDA  2507
             SRI+ES+WWQ  TP+MQS A +S     NK   R S      ++  +FS++LWK A +DA
Sbjct  434   SRIVESVWWQALTPNMQSPAESS---STNKTTVRLSGPALGDQKQGSFSVBLWKNAXQDA  490

Query  2508  YERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNP  2687
              +R+CPVRAGGH+CGCL +L++++M+ CVARLDVAMFNAILRESA +IPTDPVSDPI + 
Sbjct  491   SQRLCPVRAGGHKCGCLPVLARMVMZHCVARLDVAMFNAILRESAHEIPTDPVSDPILDS  550

Query  2688  EVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHE-  2864
              VLPIPAG  SF +GAQLKN++GNWSRWL+D+F +D DD             ++  G E 
Sbjct  551   RVLPIPAGDLSFGSGAQLKNSVGNWSRWLSDMFDMDADDXLQ----------EDHPGSED  600

Query  2865  -RKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
                      K F LLNA+SDL+MLPKD L+ R +RKEVCP+  L L+ R+L  F PDEFC
Sbjct  601   DDGQSGDGDKSFLLLNALSDLLMLPKDXLIDRRIRKEVCPSISLPLVKRILCNFTPDEFC  660

Query  3042  PDPIPNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             PD +P  VLEALN+E  ME  +  E   +FP +AAP+VY PPS +         +  SSQ
Sbjct  661   PDAVPGAVLEALNAESIMERRLSGELARSFPYTAAPVVYTPPS-SXDVAEKVSEAGGSSQ  719

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLI--KMENSEVTKP------gggsgngngngVR  3371
             L R  S V +K YTSD+EL+ELDSPL+ I  K+ +                        R
Sbjct  720   LERXVSVVQRKGYTSDEELEELDSPLSSIIDKLPSXPTIXANGNGNGKHEHTGHACTNAR  779

Query  3372  YQLLREVW  3395
             Y+LLREVW
Sbjct  780   YELLREVW  787



>ref|XP_010524226.1| PREDICTED: uncharacterized protein LOC104802359 [Tarenaya hassleriana]
Length=694

 Score =   452 bits (1162),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 258/538 (48%), Positives = 339/538 (63%), Gaps = 28/538 (5%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             L++K + LE +++ LE ELRE AA+EI L+SVV +H SS +K+H PARRLSRLY H+CK 
Sbjct  174   LKQKIEALETRMEKLEEELREVAALEISLYSVVPDHSSSAHKLHTPARRLSRLYIHSCKH  233

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY  2168
              +   R + AR+ VSGLILVAK+CGNDVPRLTFWLSN + LR  I +   +  +      
Sbjct  234   LTQRNRATIARNTVSGLILVAKSCGNDVPRLTFWLSNAIALREIIAQAFGRSLISTKISD  293

Query  2169  SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIE  2348
             S         K +  KW+     K + N     FEDW++   F  ALEKVE+W+FSRI+E
Sbjct  294   SNGKNSNGSGKPTSQKWRKSSGTK-LSNGFSQLFEDWQDTETFIAALEKVESWVFSRIVE  352

Query  2349  SIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPV  2528
             S+WWQ FTPHMQS        ++N      S    E+  NFS+ LWK AF+DA  R+CP+
Sbjct  353   SVWWQVFTPHMQSPETDVSTGKMNGKLMGPSLG-DEQQGNFSISLWKNAFQDALRRLCPI  411

Query  2529  RAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPA  2708
             R  GHECGCL +L++L+M+QC+AR D+AMFNAILRES   IPTDPVSDPI + +VLPIPA
Sbjct  412   RGSGHECGCLPVLARLVMEQCIARFDIAMFNAILRESEHQIPTDPVSDPILDSKVLPIPA  471

Query  2709  GKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS  2888
             G  SF +GAQLKNA+GNWSR L +LFG+              N  D+     R ++    
Sbjct  472   GDLSFGSGAQLKNAVGNWSRCLTELFGL--------------NSDDSVEDENRNSEHV--  515

Query  2889  KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVL  3068
             K F LLN +SDL+MLPKDML+ R++R+EVCP+ GL LI R+L  F PDEFCPD +P  VL
Sbjct  516   KSFLLLNELSDLLMLPKDMLMDRSIREEVCPSIGLPLIKRILCNFTPDEFCPDHVPGAVL  575

Query  3069  EALNSEDH--MEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVL  3242
             E LN+E     ++  ES  +FP +A+P+ Y PPS +         +   S+L+R+ S + 
Sbjct  576   EELNAESFPGRKLSGESSRSFPYAASPVFYIPPS-SVDVAEKVAEAGDVSKLSRNVSMIQ  634

Query  3243  KKSYTsddeldeldsPLNLI--KMENSEVTKPgggsgngn-----gngVRYQLLREVW  3395
             +K YTSD+EL+E++SPL  I  K+  S    P G               RY+LLREVW
Sbjct  635   RKGYTSDEELEEMNSPLTSIIDKVSLSPNATPKGNVKKDENVGPVATNARYELLREVW  692



>ref|XP_010238293.1| PREDICTED: uncharacterized protein LOC100822798 [Brachypodium 
distachyon]
Length=799

 Score =   455 bits (1171),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 255/542 (47%), Positives = 343/542 (63%), Gaps = 28/542 (5%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             + K +ELE KI+ LE ELRE AA+E+ L+S+V EHG S++K+H PARRLSRLY HA K  
Sbjct  267   DEKFEELESKIEKLEQELREVAALEVSLYSIVPEHGCSSHKLHTPARRLSRLYIHASKFW  326

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK---FSEKQQLPLSS  2162
             S  ++ S  ++ VSGL+LVAK+CGNDV RLTFWLSN V+LR  I +    S +    + +
Sbjct  327   SPEKKASVGKNSVSGLVLVAKSCGNDVSRLTFWLSNTVVLREIIAQTFGISNQSTTVMKA  386

Query  2163  EYSKNAVVKNERKASPLKWQ---SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
                K++  K  + + P++W+   S  H +      P   EDW+       ALEK+E+WIF
Sbjct  387   FTPKSSANKLYKNSPPMRWKTNSSVKHARPTIMQFP---EDWQETSTILGALEKIESWIF  443

Query  2334  SRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYE  2513
             SRI+ES+WWQ  TP M +    S  S  N       S   +    FS+ LWK AF D + 
Sbjct  444   SRIVESVWWQALTPRMHTPVEDS--STPNTGGLLGHSLGDQHQGTFSINLWKTAFCDVFN  501

Query  2514  RICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEV  2693
             RICP+RAGGHECGCL +L++L+M+QC+ARLDVA+FNAILRES ++IP+DP+SDPI +  V
Sbjct  502   RICPLRAGGHECGCLPVLAELVMEQCIARLDVALFNAILRESENEIPSDPISDPILDSRV  561

Query  2694  LPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKA  2873
             LPIPAG  SF +GAQLK +IG+WSR L D+FG+       D     ++  D    H+ + 
Sbjct  562   LPIPAGDLSFGSGAQLKTSIGSWSRLLMDMFGM-------DGDGSHKDGQDAGADHDGRR  614

Query  2874  QDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
               A S  F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +
Sbjct  615   DGAESISFKLLNELSDLLMLPKDMLLEKSIRKEVCPSMGLPLVTRILCNFTPDEFCPDHV  674

Query  3054  PNVVLEALNSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrs  3227
             P +VLE LNSE  +E   E++ +  FPC AAP+VY  P            +S ++++ R 
Sbjct  675   PGLVLEELNSESLVERFTEKDVISTFPCIAAPVVYHAPR-LEDVAKKVSDTSGNAEVDRR  733

Query  3228  rssVLKKSYTsddeldeldsPLNLIKMENSEVTKP------gggsgngngngVRYQLLRE  3389
              S V ++ YTSDD+LD+L SPL +   + S    P            G+   VRY+LLRE
Sbjct  734   ASIVQRRGYTSDDDLDDLGSPL-MSLYDRSTPPSPCDGVACFSTRRAGSMANVRYELLRE  792

Query  3390  VW  3395
             VW
Sbjct  793   VW  794



>gb|AFV66584.1| LSG [Saccharum hybrid cultivar]
Length=690

 Score =   451 bits (1161),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 264/535 (49%), Positives = 339/535 (63%), Gaps = 30/535 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA  2180
              S A+S+ SGL+LVA +  ND  RLTFWLSN V+LR  I + F    Q  P  +  + N 
Sbjct  232   ASVAKSIASGLVLVATSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSITTMNMNG  291

Query  2181  VVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
               K  + K+  + W++       G    G  +DW+       ALEK+E+WIFSRI+E++W
Sbjct  292   ATKKLDGKSMTMLWRNNSSHAKTG----GMPDDWQETSTLLAALEKIESWIFSRIVETVW  347

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+RAG
Sbjct  348   WQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFNDAFNRMCPLRAG  405

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  
Sbjct  406   GHECGCLLVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDL  465

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKN+IGNWSRWL D  GIDDDD +D    +           ER+   A +K F
Sbjct  466   SFGSGAQLKNSIGNWSRWLTDKLGIDDDDSEDIGDVE----------DERRGA-AETKSF  514

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VLE L
Sbjct  515   QLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVLEEL  574

Query  3078  NSEDHME--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             NSE  +E    ++ +  FPC AAP VY  PS               ++L R  S V ++ 
Sbjct  575   NSESLLERHTNKDMINVFPCIAAPTVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQRRG  633

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  634   YTSDDDLDDLDSPLASL-IDRSAPPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  687



>ref|XP_006402842.1| hypothetical protein EUTSA_v10005822mg [Eutrema salsugineum]
 gb|ESQ44295.1| hypothetical protein EUTSA_v10005822mg [Eutrema salsugineum]
Length=664

 Score =   451 bits (1159),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 252/539 (47%), Positives = 340/539 (63%), Gaps = 41/539 (8%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             L+++ ++LE +I+ LE ELRE AA+EI L+S+V +H  S +KVH PARR+SRLY HACK 
Sbjct  155   LKQQVEDLETRIEKLEEELREVAALEISLYSIVPDHSGSAHKVHTPARRISRLYIHACKH  214

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY  2168
              S  +R + AR+ VSGLILVAK+CGNDV RLTFWLSN + LR  I     K  +P  S  
Sbjct  215   WSRGKRTTIARNTVSGLILVAKSCGNDVSRLTFWLSNIIALREIISHEFGKYHVP--SHL  272

Query  2169  SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIE  2348
             ++ +V     ++      +   KK+       +F+DW+    FT  LEKVE WIFSRIIE
Sbjct  273   TQTSVSNGSEQSGS---GNLRRKKNQCTQESNSFQDWQESETFTAVLEKVEFWIFSRIIE  329

Query  2349  SIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPV  2528
             S+WWQ FTPHMQS   +S  +E   +         EE  +FS+ LW+ A R A  R+CP+
Sbjct  330   SVWWQVFTPHMQSPENSSKTNEKPVLGD-------EEQGSFSISLWQNALRVALSRLCPM  382

Query  2529  RAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPA  2708
             R  GHECGCL +L+K++M++C+AR+D+AMFNAILRES   IPTDPVSDPI + +VLPIPA
Sbjct  383   RGSGHECGCLPILAKMVMEKCIARVDIAMFNAILRESEHQIPTDPVSDPILDSKVLPIPA  442

Query  2709  GKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS  2888
             G  SF +GAQLKNAIGNWSR LA++F I                 +  +  E        
Sbjct  443   GHLSFGSGAQLKNAIGNWSRCLAEMFDI-----------------NTRDSVEETDLIESE  485

Query  2889  KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVL  3068
             K F LLN +SDL+MLPKDML+  ++R+EVCP+  L LITR+L  F PDEFCPD +P  VL
Sbjct  486   KSFSLLNELSDLLMLPKDMLMDLSIREEVCPSISLPLITRILCNFTPDEFCPDHVPGTVL  545

Query  3069  EALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKK  3248
             E L +E  +  ++ S V+FP +A+P+ Y PPS+  +   + ++    S+++RS S + +K
Sbjct  546   EELKTES-ISDQKFSGVSFPYAASPVSYTPPSSVNVAEKVAEVGGDISRMSRSASVIQRK  604

Query  3249  SYTsddeldeldsPLNLIKMENSEVTKPgg----------gsgngngngVRYQLLREVW  3395
              YTSD+EL+ELDSPL  + ++   V+ P                     VRY+LLREVW
Sbjct  605   GYTSDEELEELDSPLTFV-IDKVLVSSPISREIGKVKQEDEQIGAVVTNVRYELLREVW  662



>gb|EMT23515.1| hypothetical protein F775_02218 [Aegilops tauschii]
Length=831

 Score =   456 bits (1172),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 261/562 (46%), Positives = 351/562 (62%), Gaps = 45/562 (8%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             + K +ELE KI+ LE ELRE AA+E+ L+S++ EHG S++K+H PARRLSRLY HA K  
Sbjct  276   DEKIEELESKIEKLEQELREVAALEVSLYSIMPEHGCSSHKLHTPARRLSRLYIHASKFW  335

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLP-LSSE  2165
             S  ++ S A++ VSGL+LVAK+CGNDV RLTFWLSN ++LR  I + F    Q P + + 
Sbjct  336   SPDKKASVAKNSVSGLVLVAKSCGNDVSRLTFWLSNTIVLREIIAQTFGISSQSPAVMNA  395

Query  2166  YSKNA---VVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFS  2336
             +++N      K  + + P++W+     K     +    +DW+       ALEK+E+WIFS
Sbjct  396   FTRNRNSNAKKLYKNSPPMRWKMNSGGKHARPTIMQFPDDWQETGTVLAALEKIESWIFS  455

Query  2337  RIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYER  2516
             RI+ES+WWQ  TP MQ+    S    I K      SS  +    FS++LWK AF DA+ R
Sbjct  456   RIVESVWWQALTPRMQTPVEDSSTPSIGKPLGH--SSADQHQSTFSIDLWKTAFCDAFSR  513

Query  2517  ICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVL  2696
             ICP+RAGGHECGCL +L+KL+M+QCVARLDVA+FNAILRES ++IP+DP+SDPI +  VL
Sbjct  514   ICPLRAGGHECGCLPVLAKLVMEQCVARLDVALFNAILRESENEIPSDPISDPILDSRVL  573

Query  2697  PIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQ  2876
             PI AG  SF +GAQLKNA+G+WSR L D+FG+D DD   D       +    +G+ R+  
Sbjct  574   PILAGNLSFGSGAQLKNAVGSWSRLLTDMFGMDGDDSHKD------GQGAGGDGNSRR-D  626

Query  2877  DACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
              A S  F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPDP+P
Sbjct  627   GAESNSFKLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLPLVTRILCNFTPDEFCPDPVP  686

Query  3057  NVVLEALNSE-----------------DHME------VEEESVVNFPCSAAPIVYAPPSA  3167
              +VLE LNSE                 + M+       E+  +  FPC+AAP+ Y  PS 
Sbjct  687   GIVLEELNSEVCALLLKLNESIALCTQNVMKSLLERFTEKNLISTFPCAAAPVAYRAPS-  745

Query  3168  AAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP-----  3332
                       +S S+++ +    V ++ YTSDD+LD+L SPL +   + S    P     
Sbjct  746   LEDVAEKVADTSGSAEVEQRALMVQRRGYTSDDDLDDLGSPL-MSLYDRSSPPSPCDGVA  804

Query  3333  -gggsgngngngVRYQLLREVW  3395
                    G    VRY+LLREVW
Sbjct  805   HFSTRQEGAVANVRYELLREVW  826



>gb|AFV66582.1| LSG [Saccharum hybrid cultivar]
Length=689

 Score =   451 bits (1160),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 265/534 (50%), Positives = 342/534 (64%), Gaps = 29/534 (5%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EH SS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSVVPEHRSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLP--LSSEYSKN  2177
              S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q    +++     
Sbjct  232   ASVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSITTMNMNG  291

Query  2178  AVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
             A  K + K+  + W++       G    G  +DW+       ALEK+E+WIFSRI+E++W
Sbjct  292   ATRKLDGKSMTMLWRNNSSHAKTG----GMPDDWQETSTLLAALEKIESWIFSRIVETVW  347

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+RAG
Sbjct  348   WQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFNDAFNRMCPLRAG  405

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  
Sbjct  406   GHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDL  465

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKN+IGNWSRWL D   IDDDD +D    +           ER+   A +K F
Sbjct  466   SFGSGAQLKNSIGNWSRWLTDKLAIDDDDSEDIRDVE----------DERRGA-AETKSF  514

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VLE L
Sbjct  515   QLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVLEEL  574

Query  3078  NSEDHME-VEEESVVN-FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKS  3251
             NSE  +E    + ++N FPC AAP VY  PS               ++L R  S V ++ 
Sbjct  575   NSESLLERYTNKDMINVFPCIAAPTVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQRRG  633

Query  3252  YTsddeldeldsPLNLIKMENSEVTKPgggsgngngngV-----RYQLLREVWM  3398
             YTSDD+LD+LDSPL  + ++ S  +   G +      GV     RY LLREVW+
Sbjct  634   YTSDDDLDDLDSPLASL-IDRSAPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  686



>ref|XP_006339938.1| PREDICTED: uncharacterized protein LOC102578258 [Solanum tuberosum]
Length=929

 Score =   458 bits (1178),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 270/540 (50%), Positives = 351/540 (65%), Gaps = 34/540 (6%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             VL +   E E +IQMLE EL+EAAA+E+GL+SVVAEHGSS NKVH PARRL+R Y HA +
Sbjct  409   VLSKSKPEPESRIQMLEEELKEAAAIEVGLYSVVAEHGSSMNKVHTPARRLARFYLHAWR  468

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSE  2165
               S  ++ SAAR+ VSGL LV+KACG+DVPRLTFWLSN ++LRA I + +   Q    +E
Sbjct  469   TKSPAKQASAARAAVSGLALVSKACGSDVPRLTFWLSNSIMLRAIISQAAAGLQF---NE  525

Query  2166  YSKNAVVKNERKASPLK---WQSFPHKKSVGND--LPGTFEDWENPLGFTKALEKVEAWI  2330
              +      N  K++  K    QS  +  + GN   L   + +WE+   FT+ALEK+E WI
Sbjct  526   GAPTETTVNRGKSALEKIYMQQSIKYIANQGNKNYLVKQYYNWEDIESFTQALEKLEGWI  585

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLD---SEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             FS+I +S+WWQT TPHMQ G A +     S + K Y    S   +E   FS++LWK+A +
Sbjct  586   FSKITKSLWWQTLTPHMQFGTAKTSKTRASRVKKTYGSRHSLGDQEQGKFSVKLWKRALK  645

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA ER+CP+RA GH+CGCL +L KL+M+Q V+RLDVAMFNAILRES +++PTDP+ DPIS
Sbjct  646   DACERLCPLRALGHKCGCLPVLPKLVMKQLVSRLDVAMFNAILRESTEEMPTDPMFDPIS  705

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSN--  2855
             + +VLPIP GK+SF AGAQLKNA+G+WSRWL DL G            +DE+  ++SN  
Sbjct  706   DRKVLPIPPGKSSFGAGAQLKNAVGSWSRWLTDLIGF-----------EDEDSPEHSNIF  754

Query  2856  GHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDE  3035
             G+++K +    K F LLNA+S+LMMLP ++L+  + RKEVCP F  +LI RVL  F+PDE
Sbjct  755   GNDKKTESF--KAFRLLNALSNLMMLPFEVLIDASTRKEVCPIFSPALIKRVLANFVPDE  812

Query  3036  FCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssq  3215
             F P+PIP  V+E L+SED   V  E   +FPC+A    Y PP A +           +  
Sbjct  813   FRPNPIPKNVVETLDSED---VPGEHHTSFPCTATWTAYTPPPALS--LTTFIEKVGNQV  867

Query  3216  ltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
                + SSVLKK+YTSD ELDELDSP      ++    K          N VRYQLLRE W
Sbjct  868   PKSTGSSVLKKTYTSDVELDELDSPFTSFLADS---FKDYPNLAKPARNVVRYQLLREAW  924


 Score =   147 bits (371),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 119/187 (64%), Gaps = 14/187 (7%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +G  S Q +Y++NI  I+PWPPS+SL+++++V++QWE+GD+NSG  T    
Sbjct  1    MVLGQKKKKKGA-SFQIDYIVNIQLIRPWPPSESLRSVQSVLLQWENGDRNSGFVT----  55

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 + V +  +E N++F + +TL RE  SK    D F KN ++F+LYE  +D   +G 
Sbjct  56   -----ASVEDDYLEINKTFTLFLTLCREKKSK----DKFLKNNLDFSLYEYTKDNAAQGP  106

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA I+F  YG+++E L +SVP+NCK+S ++ +QP L +K+Q     +   ++ ++  
Sbjct  107  LLGTASINFGEYGIIRETLAISVPLNCKKSSKSLLQPSLYVKVQPTKDKQESDMMIDDAE  166

Query  705  RESSMDS  725
             +S   S
Sbjct  167  YDSDFAS  173



>gb|ABG21937.1| expressed protein [Oryza sativa Japonica Group]
Length=816

 Score =   454 bits (1169),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 225/410 (55%), Positives = 289/410 (70%), Gaps = 20/410 (5%)
 Frame = +3

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA EIGL+SV+AEHGSS+NKVH PARRLSR + HA K  S  +  SAARS  SGL+L
Sbjct  415   RETAAAEIGLYSVIAEHGSSSNKVHTPARRLSRHFIHALKNWSRDKMGSAARSASSGLVL  474

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQS  2225
             VAKACG DV RL+FWLSNCV+LRA + + S++     +S    N      R+ S   W+S
Sbjct  475   VAKACGYDVARLSFWLSNCVVLRAIVSETSKQS----NSNAINNGSKTGPRRNSASMWES  530

Query  2226  FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATS-  2402
                KK  G  L   F++WE+   F  AL+K+E+WIFSRI+ESIWWQ FTPHMQS   +S 
Sbjct  531   LNRKK--GKLLSPEFDNWEDVDTFIAALKKIESWIFSRIVESIWWQAFTPHMQSANISSE  588

Query  2403  --LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKL  2576
                 S   K Y R +   +++    S+++WKKAF++A E++CPVRA GHECGCL LL+KL
Sbjct  589   PMPSSNAKKCYGRITVVGNQQQATLSIDIWKKAFKEASEKLCPVRAAGHECGCLPLLAKL  648

Query  2577  IMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIG  2756
             +M+QC+ARLDVAMFNAILRES D+IPTDP+SDPI++P+VLP+P+GK SF AG QLKNAIG
Sbjct  649   VMEQCIARLDVAMFNAILRESDDEIPTDPMSDPITDPKVLPVPSGKFSFGAGVQLKNAIG  708

Query  2757  NWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLP  2936
             +WSR L+D FG+      D     +    D  NG          KPFYLLNA+SDL+M+P
Sbjct  709   SWSRCLSDSFGM------DMDDYPEVESGDGDNGAAE-----LRKPFYLLNALSDLLMIP  757

Query  2937  KDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSE  3086
             KD+L+  + RKE+CPTF  S+I R+L+ F+PD+FCPDP+ + +LEAL SE
Sbjct  758   KDVLMETSTRKELCPTFSSSIIKRILDGFVPDDFCPDPVQHSLLEALESE  807


 Score =   159 bits (402),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 6/194 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   KTR   S   ++ I I EI PWPPS+SLK+LK+VV+ WE+G++NSG T  VAP
Sbjct  1    MVLGLRTKTRKDASFHVDFNIFIQEISPWPPSESLKSLKSVVLFWENGERNSGKTNAVAP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   SG   G++EFNE   +     +E SSKS     +QKN +E NLYEPRRD  +KGQ
Sbjct  61   SI--GSGTTVGKVEFNEFINLQAVFQKEGSSKS---GKWQKNLLELNLYEPRRD-KLKGQ  114

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
             LGTA +D A + +  E  +V VP+N KRS RN VQP++ L+IQ +         R+ + 
Sbjct  115  HLGTATLDLAEHAMFHEDTSVPVPLNSKRSLRNNVQPMVYLRIQPLDGDNSSVSSRDALS  174

Query  705  RESSMDSSAGESVS  746
            +E+S+D  + E +S
Sbjct  175  KEASVDRDSKELMS  188



>gb|AFV66579.1| LSG [Saccharum hybrid cultivar]
Length=694

 Score =   448 bits (1153),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 267/538 (50%), Positives = 343/538 (64%), Gaps = 32/538 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  172   ELVSKIGKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  231

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA  2180
              S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q  P  +  + N 
Sbjct  232   ASVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSMTTMNMNG  291

Query  2181  VVKN-ERKASPLKWQSFPHKKS---VGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIE  2348
               K  + K+  + W++  + K        +P   +DW+       ALEK+E+WIFSRI+E
Sbjct  292   GAKKLDGKSMTMLWRNNSNGKQDKLAAMQMP---DDWQETSTLLAALEKIESWIFSRIVE  348

Query  2349  SIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPV  2528
             ++WWQ  TPHMQ  A  S   +  ++     +   ++   FS+ LWK AF DA+ R+CP+
Sbjct  349   TVWWQALTPHMQKRAEGSSTPKAGRVL--GPALGDQQQGTFSVNLWKAAFHDAFSRMCPL  406

Query  2529  RAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPA  2708
             RAGGHECGCL +L+KL+M+QCVARLDVAMFNAIL ESA +IPTDP+SDPI +P+VLPIPA
Sbjct  407   RAGGHECGCLPVLAKLVMEQCVARLDVAMFNAILCESASEIPTDPISDPIVDPKVLPIPA  466

Query  2709  GKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS  2888
             G  SF +GAQLKN+IGNWSRWL D  GIDDDD +D    +           ER+   A +
Sbjct  467   GDLSFGSGAQLKNSIGNWSRWLTDKLGIDDDDSEDIGDVE----------DERRGT-AET  515

Query  2889  KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVL  3068
             K F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VL
Sbjct  516   KLFQLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVL  575

Query  3069  EALNSEDHMEVE-EESVVN-FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVL  3242
             E LNSE  +E    + V+N FPC AAPIVY  PS               ++L R  S V 
Sbjct  576   EVLNSESLLERHTNKDVINVFPCIAAPIVYRAPS-TLDAAEKVADIGGGAKLDRKASMVQ  634

Query  3243  KKSYTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             ++ YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  635   RRGYTSDDDLDDLDSPLASL-IDRSAPPSPSNGFAHFSAQRGVSMENTRYTLLREVWL  691



>ref|XP_002444781.1| hypothetical protein SORBIDRAFT_07g027880 [Sorghum bicolor]
 gb|EES14276.1| hypothetical protein SORBIDRAFT_07g027880 [Sorghum bicolor]
Length=695

 Score =   447 bits (1150),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 265/538 (49%), Positives = 343/538 (64%), Gaps = 32/538 (6%)
 Frame = +3

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
             EL  KI  LE ELRE AA+E+ L+SVV EHGSS +K+H PARRLSRLY HA K  S  +R
Sbjct  173   ELVLKIDKLEQELREVAALEVSLYSVVPEHGSSAHKLHTPARRLSRLYIHASKFWSEDKR  232

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQL-PLSSEYSKNA  2180
              S A+S+ SGL+LVAK+  ND  RLTFWLSN V+LR  I + F    Q  P  +  + N 
Sbjct  233   ASVAKSIASGLVLVAKSSSNDASRLTFWLSNTVVLREIIVQTFGISHQFTPSMTTMNMNG  292

Query  2181  VVKN-ERKASPLKWQS---FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIE  2348
               K  + K+  + W++       K     +P   +DW+       AL+K+E+WIFSRI+E
Sbjct  293   GAKKLDGKSMTMLWRNNFNGMQTKLAAMQMP---DDWQETSTLLAALDKIESWIFSRIVE  349

Query  2349  SIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPV  2528
             ++WWQ  TPHMQ     +   +  ++     +   ++   FS+ LWK AF DA+ R+CP+
Sbjct  350   TVWWQALTPHMQKRTEGASTPKAGRVL--GPALGDQQQGTFSVNLWKAAFHDAFNRMCPL  407

Query  2529  RAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPA  2708
             RAGGHECGCL +L+KL+M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPA
Sbjct  408   RAGGHECGCLPVLAKLVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPA  467

Query  2709  GKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS  2888
             G  SF +GAQLKN+IGNWSRWL D  GIDDDD D+    +           ER+ + A +
Sbjct  468   GDLSFGSGAQLKNSIGNWSRWLTDKLGIDDDDSDEIGDVE----------DERRGR-AET  516

Query  2889  KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVL  3068
             K F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPD +P+ VL
Sbjct  517   KSFQLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDAVPSTVL  576

Query  3069  EALNSEDHMEVE-EESVVN-FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVL  3242
             E LNSE  +E    + V+N FPC AAPIVY  PS               ++L R  S V 
Sbjct  577   EELNSESLLERHTNKDVINVFPCIAAPIVYRAPS-TLDAAEKVADIGVGAKLDRKASMVQ  635

Query  3243  KKSYTsddeldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVWM  3398
             ++ YTSDD+LD+LDSPL  + ++ S    P             +    RY LLREVW+
Sbjct  636   RRGYTSDDDLDDLDSPLASL-IDRSAPPSPSNGFTHFSSQRGVSMENTRYTLLREVWL  692



>ref|XP_011075189.1| PREDICTED: uncharacterized protein LOC105159716 isoform X1 [Sesamum 
indicum]
Length=806

 Score =   451 bits (1159),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 241/502 (48%), Positives = 318/502 (63%), Gaps = 49/502 (10%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +  N    + S+D + +T+  + +      ++K +ELE +IQ LE ELRE AA+EI 
Sbjct  245   ILDEASNGAHSVCSDDEEVNTEQNNNQGDKAATDQKIEELETRIQNLESELREVAALEIA  304

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SV  EHGSS++KVH PARRLSRLY +ACK  S  +R + A++ VSGL+LV+K+CG+DV
Sbjct  305   LYSVAPEHGSSSHKVHTPARRLSRLYIYACKHWSQDKRATVAKNTVSGLVLVSKSCGSDV  364

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKN------ERKASPLKWQSFPH  2234
              RLTFWLSN V+LR  I +          S  + NA+ K       E K+ P+K ++   
Sbjct  365   SRLTFWLSNTVVLREIITQ-------AFGSSCNSNALAKVFESNGCETKSPPVKLKNSSG  417

Query  2235  KKSVGND-LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDS  2411
              + +    L    +DW+    FT AL KVEAWIFSRI+ESIWWQT TP+MQS      DS
Sbjct  418   SRQLNKQGLLQFIDDWQETRTFTAALGKVEAWIFSRIVESIWWQTLTPNMQSPIG---DS  474

Query  2412  EINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQ  2585
               NK  +R            NFS+ LWK AF DA++R+CPVRAGGHECGCL +L++ +M+
Sbjct  475   TTNKGAERLLGPALGDHRQGNFSINLWKNAFHDAFKRLCPVRAGGHECGCLPVLARKVME  534

Query  2586  QCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWS  2765
             QC+ RLDVAMFNAILRESA +IPTDPVSDPI +           SF +GAQLKN++GNW+
Sbjct  535   QCIGRLDVAMFNAILRESAHEIPTDPVSDPIVDXXX------XLSFGSGAQLKNSVGNWA  588

Query  2766  RWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS------KPFYLLNAMSDLM  2927
             RWL+D  G+                AD S   E+K+QD         K F LLNA+SDL+
Sbjct  589   RWLSDFLGM---------------DADASAEDEKKSQDDDDKSTEEPKSFPLLNALSDLL  633

Query  2928  MLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--V  3101
             MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCPD +P  VLEALN+E  +E  +
Sbjct  634   MLPKDMLMDRTIRLEVCPSISLPLVKRILCNFSPDEFCPDAVPGAVLEALNAECIVERRL  693

Query  3102  EEESVVNFPCSAAPIVYAPPSA  3167
               +S  +FP +A+P  Y PPS+
Sbjct  694   SGDSASSFPYTASPTTYIPPSS  715



>emb|CDY47964.1| BnaA04g24420D [Brassica napus]
Length=611

 Score =   444 bits (1142),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 360/571 (63%), Gaps = 65/571 (11%)
 Frame = +3

Query  1725  DKRNSIEGITSNDWKD------TKVRSKETSNVV-------LERKCQELEQKIQMLEGEL  1865
             D++  ++G+ ++ W+D      +     E  +V        L+ K + LE +I+ LE EL
Sbjct  91    DEQEEVKGVNADVWEDASNGALSAGSENEAPDVTESIEDGSLKEKIEHLETRIERLEEEL  150

Query  1866  REAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLIL  2045
             RE AA+E+ L+SVV +H SS +K+H PARR+SR+Y HACK  +  +R + AR+ VSGL+L
Sbjct  151   REVAALEVSLYSVVPDHSSSAHKLHTPARRISRIYIHACKHFARGKRATIARNSVSGLVL  210

Query  2046  VAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQS  2225
             VA++CGNDV RLTFWLSN + LR  I K   K ++  SSE + +    +  K + L+W+ 
Sbjct  211   VARSCGNDVSRLTFWLSNIITLREIISKAFGKSRVTESSEGNGSENGGDSGKKTNLRWK-  269

Query  2226  FPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSL  2405
                     N L    EDW+    FT ALEKVE W+FSRI+ES+WWQ FTPHMQS      
Sbjct  270   --------NGLQELLEDWQETETFTAALEKVELWVFSRIVESVWWQVFTPHMQS------  315

Query  2406  DSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQ  2585
               E NK    ++S  +E+   FS+ LWK AF DA +R+CP+R GGHECGCL +L++++M+
Sbjct  316   -PENNK---SSASKSNEKQGAFSITLWKNAFGDALQRLCPMRGGGHECGCLPVLARMVME  371

Query  2586  QCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWS  2765
             +CV R DVAMFNAILRES   IPTDPVSDPI + +VLP+PAG  SF +GAQLKNAIGNWS
Sbjct  372   KCVGRFDVAMFNAILRESEHQIPTDPVSDPILDTKVLPVPAGDLSFGSGAQLKNAIGNWS  431

Query  2766  RWLADLFGIddddedddlveddeNKADNSNGHERKAQDA-CSKPFYLLNAMSDLMMLPKD  2942
             R L ++FG+                  NS+  + +++ +  SK F LLN +SDL+MLPKD
Sbjct  432   RSLTEMFGM------------------NSDDDQVESEGSDSSKAFVLLNELSDLLMLPKD  473

Query  2943  MLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVN  3122
             ML+  ++R+E+CP+  LSLI R+L  F PDEFCP+ +P  VLE LN+    EV+ E   +
Sbjct  474   MLMESSIREEICPSITLSLIKRILCNFTPDEFCPEDVPGAVLEELNA---AEVQSEE-AS  529

Query  3123  FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI  3302
             FP +A+ + Y PPS      +   ++ ++ +L+R+ S + +K YTSD+EL+ELDSPL  I
Sbjct  530   FPYAASSVTYKPPST---MDVAEKVAEAAGKLSRNVSMIQRKGYTSDEELEELDSPLTSI  586

Query  3303  KMENSEVTKPgggsgngngngVRYQLLREVW  3395
               + SE             +  RY LLR+VW
Sbjct  587   VDKTSEFND-------SATSNARYNLLRQVW  610



>ref|XP_011075190.1| PREDICTED: uncharacterized protein LOC105159716 isoform X2 [Sesamum 
indicum]
 ref|XP_011075191.1| PREDICTED: uncharacterized protein LOC105159716 isoform X2 [Sesamum 
indicum]
Length=798

 Score =   450 bits (1158),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 241/502 (48%), Positives = 318/502 (63%), Gaps = 49/502 (10%)
 Frame = +3

Query  1716  VLRDKRNSIEGITSNDWK-DTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIG  1892
             +L +  N    + S+D + +T+  + +      ++K +ELE +IQ LE ELRE AA+EI 
Sbjct  237   ILDEASNGAHSVCSDDEEVNTEQNNNQGDKAATDQKIEELETRIQNLESELREVAALEIA  296

Query  1893  LFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDV  2072
             L+SV  EHGSS++KVH PARRLSRLY +ACK  S  +R + A++ VSGL+LV+K+CG+DV
Sbjct  297   LYSVAPEHGSSSHKVHTPARRLSRLYIYACKHWSQDKRATVAKNTVSGLVLVSKSCGSDV  356

Query  2073  PRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKN------ERKASPLKWQSFPH  2234
              RLTFWLSN V+LR  I +          S  + NA+ K       E K+ P+K ++   
Sbjct  357   SRLTFWLSNTVVLREIITQ-------AFGSSCNSNALAKVFESNGCETKSPPVKLKNSSG  409

Query  2235  KKSVGND-LPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDS  2411
              + +    L    +DW+    FT AL KVEAWIFSRI+ESIWWQT TP+MQS      DS
Sbjct  410   SRQLNKQGLLQFIDDWQETRTFTAALGKVEAWIFSRIVESIWWQTLTPNMQSPIG---DS  466

Query  2412  EINKIYQRTSSSC--SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQ  2585
               NK  +R            NFS+ LWK AF DA++R+CPVRAGGHECGCL +L++ +M+
Sbjct  467   TTNKGAERLLGPALGDHRQGNFSINLWKNAFHDAFKRLCPVRAGGHECGCLPVLARKVME  526

Query  2586  QCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWS  2765
             QC+ RLDVAMFNAILRESA +IPTDPVSDPI +           SF +GAQLKN++GNW+
Sbjct  527   QCIGRLDVAMFNAILRESAHEIPTDPVSDPIVD------XXXXLSFGSGAQLKNSVGNWA  580

Query  2766  RWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS------KPFYLLNAMSDLM  2927
             RWL+D  G+                AD S   E+K+QD         K F LLNA+SDL+
Sbjct  581   RWLSDFLGM---------------DADASAEDEKKSQDDDDKSTEEPKSFPLLNALSDLL  625

Query  2928  MLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--V  3101
             MLPKDML+ RT+R EVCP+  L L+ R+L  F PDEFCPD +P  VLEALN+E  +E  +
Sbjct  626   MLPKDMLMDRTIRLEVCPSISLPLVKRILCNFSPDEFCPDAVPGAVLEALNAECIVERRL  685

Query  3102  EEESVVNFPCSAAPIVYAPPSA  3167
               +S  +FP +A+P  Y PPS+
Sbjct  686   SGDSASSFPYTASPTTYIPPSS  707



>ref|XP_010672738.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672739.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672740.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672741.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672742.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672743.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672744.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672745.1| PREDICTED: uncharacterized protein LOC104889256 [Beta vulgaris 
subsp. vulgaris]
Length=775

 Score =   448 bits (1153),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 263/578 (46%), Positives = 360/578 (62%), Gaps = 28/578 (5%)
 Frame = +3

Query  1707  NQFVLRDKRNSIEGITSNDWKDTKVRSKETSNV-----VLERKCQELEQKIQMLEGELRE  1871
             NQ  L +  N I+  +SN   D  + +++   +      L++K + +E +I+ LE ELR 
Sbjct  209   NQDTLDEASNDIK--SSNSGDDHTIGAEDDGKLKQERAALKQKAEIMEDRIEKLEDELRV  266

Query  1872  AAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVA  2051
              AA+EI L+SV+ EHGSS +KVH PARRLSRLY HACK  +  +R + A++ VSGLILV+
Sbjct  267   VAALEISLYSVIPEHGSSAHKVHTPARRLSRLYIHACKHWTRSKRATIAKNTVSGLILVS  326

Query  2052  KACGNDVPRLTFWLSNCVLLRAAICK-FSEKQQLPLSSEYSKNAVVKNERKASPLKWQSF  2228
             + CGNDV RLTFWLSN V+LR  I + F    Q   +  +      K+E  A     +  
Sbjct  327   RTCGNDVARLTFWLSNTVVLREIISQTFGTSGQTSPARFHVSKGSTKSEGNAFSRNLKGN  386

Query  2229  PHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLD  2408
                K V N +   FEDWE    FT ALEK+E+WIFSR++ES+WWQ  TP+M S     ++
Sbjct  387   FGGKQV-NKITTLFEDWEETSTFTFALEKIESWIFSRVVESVWWQALTPNMLSPIEELIN  445

Query  2409  SEINKIYQRTSSSCSEEPE-NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQ  2585
              +  +I +    S  +  +   S+ELW  AF+ A+ R+CPVRA GHECGCL ++++++M+
Sbjct  446   QK--RIGKLLGPSLGDHQQGTLSIELWNNAFQSAFVRLCPVRAAGHECGCLPVVARMVME  503

Query  2586  QCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWS  2765
             QC+ RLDVAMFNAILRESA  +PTDPVSDPI +  VLPIPAG+ SF +GAQLKN++GNWS
Sbjct  504   QCIGRLDVAMFNAILRESAHQMPTDPVSDPIVDSRVLPIPAGEFSFGSGAQLKNSVGNWS  563

Query  2766  RWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDM  2945
             RW +D  G++ D    D           +N H  +   A +K F L+N +S+L+MLPKDM
Sbjct  564   RWFSDHLGMEMDSLPTDDP--------ETNDHNDQIIHAKTKCFCLINELSELLMLPKDM  615

Query  2946  LLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHME--VEEESVV  3119
             L  R++RKEVCP+  L +I R+L  F PDEFCPDP+P  VLEALN+E  +E     ES  
Sbjct  616   LTDRSIRKEVCPSINLGVIKRILCYFTPDEFCPDPVPGEVLEALNAESFVERKFAGESSG  675

Query  3120  NFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNL  3299
             +FP +A  + Y PPS+  +   + +   +  Q+ R+ S V KK Y SDDELD+LDSPL  
Sbjct  676   SFPYAAPIVSYFPPSSNDVSEKVAEAGGNKPQVERNVSMVQKKGYMSDDELDDLDSPLES  735

Query  3300  IKMENSEVTKPgggsgngngngV------RYQLLREVW  3395
                ++S  T  GG +   +   +      RY LLREVW
Sbjct  736   FIEQSSPRTLQGGNACLKSKEQISCGESTRYDLLREVW  773



>ref|XP_006290682.1| hypothetical protein CARUB_v10016776mg [Capsella rubella]
 gb|EOA23580.1| hypothetical protein CARUB_v10016776mg [Capsella rubella]
Length=679

 Score =   445 bits (1145),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 258/543 (48%), Positives = 344/543 (63%), Gaps = 41/543 (8%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             VL++K + LE +I+ LE ELRE A++EI L+SV  EH SS +K+H PARR+SRLY HACK
Sbjct  163   VLKQKVESLETRIEKLEEELREVASLEISLYSVAPEHSSSAHKLHTPARRISRLYIHACK  222

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLS-S  2162
               S  +R + AR+ VSGLIL AK+CGNDV RLTFWLSN + LR  I +   K  +P   +
Sbjct  223   HWSQGKRATVARNSVSGLILAAKSCGNDVSRLTFWLSNIITLREIILQAFGKASVPSHFT  282

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
             E SK+   +      P + ++  +K+S  N     FEDW+    FT ALEKVE WIFSRI
Sbjct  283   ETSKSNASEQIALGKPRRKKNQWNKQS--NGFKQVFEDWKEMETFTSALEKVEFWIFSRI  340

Query  2343  IESIWWQTFTPHMQS---GAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYE  2513
             IES+WWQ FTPHMQS   G  T     I K+         +   ++S+ LWK AF+ +  
Sbjct  341   IESVWWQVFTPHMQSPEIGGKT-----IEKLMGPVLGDHVQG--SYSINLWKNAFKVSLS  393

Query  2514  RICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEV  2693
              +CP+R  GHECGCL +L+K++M++C+AR+DVAMFNAILRES   IPTDPVSDPI + +V
Sbjct  394   WLCPMRGAGHECGCLPILAKMVMEKCIARIDVAMFNAILRESEHQIPTDPVSDPILDSQV  453

Query  2694  LPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKA  2873
             LPI AG  SF +GAQLKN+IGNWSR LA++F I              N  D+   ++   
Sbjct  454   LPILAGDLSFGSGAQLKNSIGNWSRCLAEMFSI--------------NTGDSVEENDPID  499

Query  2874  QDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPI  3053
              + C   F LLN +SDL+MLPKDML+ +++R+EVCP+  L LI R+L  F PDEFCPD +
Sbjct  500   SEKC---FSLLNELSDLLMLPKDMLMEQSIREEVCPSISLPLIKRILCNFTPDEFCPDGV  556

Query  3054  PNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrs  3233
             P  VLE LN+E  M  ++ S V+FP +A P+ Y PPS+  +   + ++    S+++R+ S
Sbjct  557   PGAVLEELNAEG-MSKQKLSGVSFPYAAPPVSYIPPSSINVAEKVEEVEGDISRMSRNAS  615

Query  3234  sVLKKSYTsddeldeldsPLNL---------IKMENSEVTKPgggsgngngngVRYQLLR  3386
              + +K YTSD+EL+ELDSPL           I  +NS V K             RY+LLR
Sbjct  616   MIQRKGYTSDEELEELDSPLTSIIENVSLPPILTQNSNV-KQQVEQIGAVVTNARYELLR  674

Query  3387  EVW  3395
             EVW
Sbjct  675   EVW  677



>ref|XP_004233605.1| PREDICTED: uncharacterized protein LOC101268546 [Solanum lycopersicum]
Length=929

 Score =   452 bits (1164),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 269/538 (50%), Positives = 346/538 (64%), Gaps = 30/538 (6%)
 Frame = +3

Query  1806  VLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACK  1985
             VL +   E E +IQMLE EL+EAAA+EI L+SVVAEHGSS NKVH PARRL+R Y HA +
Sbjct  409   VLSKSKPEPESRIQMLEEELKEAAAIEISLYSVVAEHGSSMNKVHTPARRLARFYLHAWR  468

Query  1986  ENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSE  2165
               S  ++ SAAR+ VSGL LV+KACG+DVPRLTFWLSN ++LRA I + +   Q    +E
Sbjct  469   TKSPAKQASAARAAVSGLALVSKACGSDVPRLTFWLSNSIMLRAIISQAAAGLQF---NE  525

Query  2166  YSKNAVVKNERKASPLK---WQSFPHKKSVGND--LPGTFEDWENPLGFTKALEKVEAWI  2330
              +      N  K++  K    QS  +  + GN   L   + +WE+   FT+ALEK+E WI
Sbjct  526   GAPTETTVNRGKSALEKIYMQQSIKYIANQGNKNYLVKQYYNWEDIESFTQALEKLEGWI  585

Query  2331  FSRIIESIWWQTFTPHMQSGAATSLD---SEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             FS+I +S+WWQT TPHMQ G A +     S + K Y    S   +E    S++LWK+A +
Sbjct  586   FSKITKSLWWQTLTPHMQFGTAKTSKTRASRVKKTYGSRHSLGDQEQGKLSVKLWKRALK  645

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA ER+CP+RA GH+CGCL +L KL+M+Q V+RLDVAMFNAILRES +++PTDP+ DPIS
Sbjct  646   DACERLCPLRALGHKCGCLPVLPKLVMKQLVSRLDVAMFNAILRESTEEMPTDPMFDPIS  705

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             + +VLPIP GK+SF AGAQLKNA+G+WSRWL DL G +D+D           +  N  G+
Sbjct  706   DRKVLPIPPGKSSFGAGAQLKNAVGSWSRWLTDLIGFEDEDSP---------EYSNIFGN  756

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
             ++K +    K F LLNA+S+LMMLP ++L+  + RKEVCP F   LI RVL  F+PDEF 
Sbjct  757   DKKTESF--KAFRLLNALSNLMMLPFEVLIDASTRKEVCPIFSPVLIKRVLANFVPDEFR  814

Query  3042  PDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqlt  3221
             P+PIP  V+E L+SED   V  E   +FPC+A    Y PP A +           +    
Sbjct  815   PNPIPKNVVETLDSED---VPGEHYTSFPCTATWTAYTPPPALS--LTTFIEKVGNQVPK  869

Query  3222  rsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
              S SSVLKK+YTSD ELDELDSP      ++    K          N VRYQLLRE W
Sbjct  870   SSGSSVLKKTYTSDVELDELDSPFTSFLADS---FKDFPNLAKPARNVVRYQLLREAW  924


 Score =   146 bits (368),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 119/187 (64%), Gaps = 14/187 (7%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K +G  S Q +Y++NI  I+PWPPS+SL+++++V++QWE+GD+NSG  T    
Sbjct  1    MVLGQKKKKKGA-SFQIDYIVNIQLIRPWPPSESLRSVQSVLLQWENGDRNSGFVT----  55

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                 + V +  +E N++F + +TL RE  +K    D F KN ++F+LYE  +D   +G 
Sbjct  56   -----ASVEDDYLEINKTFTLFLTLCREKKTK----DKFLKNNLDFSLYEYTKDNAAQGP  106

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LLGTA I+F  YG+++E L +SVP+NCK+S ++ +QP L +K+Q     +   ++ ++  
Sbjct  107  LLGTASINFGEYGIIRETLAISVPLNCKKSSKSLLQPSLYVKVQPTKDKQESDMMIDDAE  166

Query  705  RESSMDS  725
             +S   S
Sbjct  167  YDSDFAS  173



>ref|XP_008450082.1| PREDICTED: uncharacterized protein LOC103491774 isoform X2 [Cucumis 
melo]
Length=791

 Score =   446 bits (1148),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 280/388 (72%), Gaps = 14/388 (4%)
 Frame = +3

Query  1632  DERLNHVSSVHTLGESNRANGSVRSNQFVLRD------KRNSIEGITSNDWKDTKVRSKE  1793
             ++RL HV SV +  ES + NG        + +        NS+E +  ND +D+K  +K+
Sbjct  392   NDRLKHVKSVRSPLESAKCNGFSSKQPTGVEEGGAPVYPDNSLESVRRNDKRDSKPCAKD  451

Query  1794  TSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYF  1973
             T N V + K Q+L+ KI+MLEGELREAAA+E  L+S+VAEHGSS NKVHAPARRLSRLY 
Sbjct  452   TKNSVSDSKVQQLQHKIKMLEGELREAAAIEAALYSIVAEHGSSMNKVHAPARRLSRLYL  511

Query  1974  HACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICK--FSEKQQ  2147
             H+CKE+S  R+  AARSVVSG +L+AKACGNDVPRLTFWLSN ++LR  I +   S K Q
Sbjct  512   HSCKESSQSRKAHAARSVVSGFVLIAKACGNDVPRLTFWLSNSIVLRTIISQNAVSLKMQ  571

Query  2148  LPLSSEYSKNAVVKNERK-ASPLKWQ-SFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
             +   S  SKN   K   K AS LKW+ S P+K+  G+   G+  DWEN   FT ALEKVE
Sbjct  572   VISGSHSSKNGANKESSKAASALKWKVSSPNKRENGSTKHGSSGDWENVQTFTSALEKVE  631

Query  2322  AWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFSLELWK  2489
             AWIFSRIIESIWWQT TPHMQS  A +++   N    K Y+R SSS   +  NFSL+LWK
Sbjct  632   AWIFSRIIESIWWQTLTPHMQSATAKTINQVSNSTSGKSYKRNSSSVDHDQGNFSLDLWK  691

Query  2490  KAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVS  2669
             KAF+DA ERICPVRAGGHECGCL LLSKLIM+QCV RLD AMFNAILR+SAD++PTDPVS
Sbjct  692   KAFKDACERICPVRAGGHECGCLPLLSKLIMEQCVTRLDTAMFNAILRDSADEMPTDPVS  751

Query  2670  DPISNPEVLPIPAGKASFAAGAQLKNAI  2753
             DPIS  +VLPI  GK+SF AGA LKNA+
Sbjct  752   DPISESKVLPILVGKSSFGAGALLKNAV  779


 Score =   213 bits (543),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG  GK R    VQ +Y I++ +IKPWPPSQSL +L++V IQWE+GD++SGS+  V P
Sbjct  1    MVLGLKGKHRRGDIVQVDYRIHVQDIKPWPPSQSLMSLRSVFIQWENGDRHSGSSNLVIP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             +   S VG G+IEFNESF++P+ L+R++  +  + DTFQ+N +EFNL+E RR+   KGQ
Sbjct  61   TIG--SIVGEGKIEFNESFKLPVGLVRDMPVRGKDADTFQRNILEFNLFESRREKAGKGQ  118

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA ID A +GVVKE  +V+VPI+C+R+++NT+QP+L +KIQ + KGR  + ++  + 
Sbjct  119  LLATATIDLAEFGVVKETTSVTVPIHCQRNFKNTLQPILSIKIQPIDKGRSNNSLKETLS  178

Query  705  RESSMDSSAGESVSALMN  758
            R  S+DS  GES +A M+
Sbjct  179  RRMSLDSFDGESAAASMH  196



>ref|XP_009142054.1| PREDICTED: uncharacterized protein LOC103865941 [Brassica rapa]
 ref|XP_009142055.1| PREDICTED: uncharacterized protein LOC103865941 [Brassica rapa]
Length=613

 Score =   439 bits (1128),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 252/533 (47%), Positives = 345/533 (65%), Gaps = 57/533 (11%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             L+ K + LE +I+ LE ELRE AA+E+ L+SVV +H SS +K+H PARR+SR+Y HACK 
Sbjct  133   LKEKIEHLETRIERLEEELREVAALEVSLYSVVPDHSSSAHKLHTPARRISRIYIHACKH  192

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY  2168
              +  +R + AR+ VSGL+LVA++CGNDV RLTFWLSN + LR  I +   K ++  SSE 
Sbjct  193   FARGKRATIARNSVSGLVLVARSCGNDVSRLTFWLSNIITLREIISQAFGKSRVTESSEA  252

Query  2169  ---SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSR  2339
                S+N    +  K + L+W+         N L    EDW+    FT ALEKVE W+FSR
Sbjct  253   NNGSENG--GDSGKKTNLRWK---------NGLQELLEDWQETETFTAALEKVELWVFSR  301

Query  2340  IIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERI  2519
             I+ES+WWQ FTPHMQS           +    ++S  +E+   FS+ LWK AF DA +R+
Sbjct  302   IVESVWWQVFTPHMQSP----------ENNNSSASKSNEKQGAFSITLWKNAFGDALQRL  351

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+R GGHECGCL +L++++M++CV R DVAMFNAILRES   IPTDPVSDPI + +VLP
Sbjct  352   CPMRGGGHECGCLPVLARMVMEKCVGRFDVAMFNAILRESEHQIPTDPVSDPILDTKVLP  411

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             +PAG  SF +GAQLKNAIGNWSR L ++FG+                  NS+  + +++ 
Sbjct  412   VPAGDLSFGSGAQLKNAIGNWSRSLTEMFGM------------------NSDDDQVESEG  453

Query  2880  A-CSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIP  3056
             +  SK F LLN +SDL+MLPKDML+  ++R+E+CP+  LSLI R+L  F PDEFCPD +P
Sbjct  454   SDSSKAFVLLNELSDLLMLPKDMLMESSIREEICPSITLSLIKRILCNFTPDEFCPDDVP  513

Query  3057  NVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrss  3236
               VLE LN+ + ++ EEES   FP +A+ + Y PPS      +   ++ ++ +L+R+ S 
Sbjct  514   GAVLEELNAAE-VQSEEES---FPYAASSVTYKPPST---MDVAEKVAEAAGKLSRNVSM  566

Query  3237  VLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             + +K YTSD+EL+ELDSPL  I  + SE             +  RY LLR+VW
Sbjct  567   IQRKGYTSDEELEELDSPLTSIVDKTSEFND-------SATSNARYNLLRQVW  612



>emb|CAB41177.1| putative protein [Arabidopsis thaliana]
Length=670

 Score =   440 bits (1132),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 259/572 (45%), Positives = 344/572 (60%), Gaps = 62/572 (11%)
 Frame = +3

Query  1740  IEGITSNDWKDTKVRSK--ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAE  1913
             + G + N+  D K +++  E    +L++  + LE +++ LE ELRE AA+EI L+SVV +
Sbjct  139   LSGGSENEAGDVKEKNENFEEDEEMLKQMVETLETRVEKLEEELREVAALEISLYSVVPD  198

Query  1914  HGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWL  2093
             H SS +K+H PARR+SR+Y HACK  S  +R + AR+ VSGLIL AK+CGNDV RLTFWL
Sbjct  199   HSSSAHKLHTPARRISRIYIHACKHWSQGKRATVARNSVSGLILAAKSCGNDVSRLTFWL  258

Query  2094  SNCVLLRAAICKFSEKQQLP-------LSSEYSKNAVVKNERKASPLKWQSFPHKKSVGN  2252
             SN + LR  I +   K  +P        S+    N + K  RK +    QS        N
Sbjct  259   SNIISLREIILQAFGKTSVPSHFTETSASNGSEHNVLGKVRRKKNQWTKQS--------N  310

Query  2253  DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQS--GAATSLDSEINKI  2426
                  FEDW+    FT ALEKVE WIFSRI+ES+WWQ FTPHMQS      + +  +  I
Sbjct  311   GFKQVFEDWQESQTFTAALEKVEFWIFSRIVESVWWQVFTPHMQSPENGGKTKEHILGDI  370

Query  2427  YQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLD  2606
              Q +          FS+ LWK AF+    R+CP+R   HECGCL +L+K++M++C+AR+D
Sbjct  371   EQGS----------FSISLWKNAFKVTLSRLCPMRGARHECGCLPILAKMVMEKCIARID  420

Query  2607  VAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLF  2786
             VAMFNAILRES   IPTDPVSDPI + +VLPI +G  SF +GAQLKNAIGNWSR LA++F
Sbjct  421   VAMFNAILRESEHQIPTDPVSDPILDSKVLPILSGNLSFGSGAQLKNAIGNWSRCLAEMF  480

Query  2787  GIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVR  2966
              I                 +  +  E        K F LLN +SDL+MLPKDML+ R+ R
Sbjct  481   SI-----------------NTRDSVEENDPIESEKSFSLLNELSDLLMLPKDMLMDRSTR  523

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPI  3146
             +EVCP+  L+LI R+L  F PDEFCPD +P  VLE LN+E   E ++ S V+FP +A+P+
Sbjct  524   EEVCPSISLALIKRILCNFTPDEFCPDDVPGAVLEELNNESISE-QKLSGVSFPYAASPV  582

Query  3147  VYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVT  3326
              Y PPS+              S+++R+ S + +K YTSDDEL+ELDSPL  I +EN  ++
Sbjct  583   SYTPPSST-----NVAEVGDISRMSRNVSMIQRKGYTSDDELEELDSPLTSI-IENVSLS  636

Query  3327  ---------KPgggsgngngngVRYQLLREVW  3395
                      K             RY+LLREVW
Sbjct  637   PISAQGRNVKQEAEKIGPGVTISRYELLREVW  668



>ref|NP_191337.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE79699.1| uncharacterized protein AT3G57780 [Arabidopsis thaliana]
Length=671

 Score =   440 bits (1132),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 259/572 (45%), Positives = 344/572 (60%), Gaps = 62/572 (11%)
 Frame = +3

Query  1740  IEGITSNDWKDTKVRSK--ETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAE  1913
             + G + N+  D K +++  E    +L++  + LE +++ LE ELRE AA+EI L+SVV +
Sbjct  140   LSGGSENEAGDVKEKNENFEEDEEMLKQMVETLETRVEKLEEELREVAALEISLYSVVPD  199

Query  1914  HGSSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWL  2093
             H SS +K+H PARR+SR+Y HACK  S  +R + AR+ VSGLIL AK+CGNDV RLTFWL
Sbjct  200   HSSSAHKLHTPARRISRIYIHACKHWSQGKRATVARNSVSGLILAAKSCGNDVSRLTFWL  259

Query  2094  SNCVLLRAAICKFSEKQQLP-------LSSEYSKNAVVKNERKASPLKWQSFPHKKSVGN  2252
             SN + LR  I +   K  +P        S+    N + K  RK +    QS        N
Sbjct  260   SNIISLREIILQAFGKTSVPSHFTETSASNGSEHNVLGKVRRKKNQWTKQS--------N  311

Query  2253  DLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQS--GAATSLDSEINKI  2426
                  FEDW+    FT ALEKVE WIFSRI+ES+WWQ FTPHMQS      + +  +  I
Sbjct  312   GFKQVFEDWQESQTFTAALEKVEFWIFSRIVESVWWQVFTPHMQSPENGGKTKEHILGDI  371

Query  2427  YQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLD  2606
              Q +          FS+ LWK AF+    R+CP+R   HECGCL +L+K++M++C+AR+D
Sbjct  372   EQGS----------FSISLWKNAFKVTLSRLCPMRGARHECGCLPILAKMVMEKCIARID  421

Query  2607  VAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLF  2786
             VAMFNAILRES   IPTDPVSDPI + +VLPI +G  SF +GAQLKNAIGNWSR LA++F
Sbjct  422   VAMFNAILRESEHQIPTDPVSDPILDSKVLPILSGNLSFGSGAQLKNAIGNWSRCLAEMF  481

Query  2787  GIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVR  2966
              I                 +  +  E        K F LLN +SDL+MLPKDML+ R+ R
Sbjct  482   SI-----------------NTRDSVEENDPIESEKSFSLLNELSDLLMLPKDMLMDRSTR  524

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPI  3146
             +EVCP+  L+LI R+L  F PDEFCPD +P  VLE LN+E   E ++ S V+FP +A+P+
Sbjct  525   EEVCPSISLALIKRILCNFTPDEFCPDDVPGAVLEELNNESISE-QKLSGVSFPYAASPV  583

Query  3147  VYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVT  3326
              Y PPS+              S+++R+ S + +K YTSDDEL+ELDSPL  I +EN  ++
Sbjct  584   SYTPPSST-----NVAEVGDISRMSRNVSMIQRKGYTSDDELEELDSPLTSI-IENVSLS  637

Query  3327  ---------KPgggsgngngngVRYQLLREVW  3395
                      K             RY+LLREVW
Sbjct  638   PISAQGRNVKQEAEKIGPGVTISRYELLREVW  669



>gb|KDO55631.1| hypothetical protein CISIN_1g001323mg [Citrus sinensis]
Length=933

 Score =   445 bits (1145),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 256/461 (56%), Positives = 319/461 (69%), Gaps = 19/461 (4%)
 Frame = +3

Query  1443  ELVTERDKHQETGEGKELIIEKGQCSEG-EPVNSCLQDNTTKQHLEGNSAIIAGRE---S  1610
             + V  R + ++ G  +E I EKG+ S G EP+N C ++ T  Q   G+ +    RE   +
Sbjct  435   DFVKYRMEQEDNGLERE-IFEKGRHSAGDEPLNFCSRNATRNQVSLGSDSPSPIREDPVN  493

Query  1611  VGAKTTC--DERLNHVSSVHTLGESNRANGSVRSNQ--FVLRDKRNSIEGITSNDWKDTK  1778
              G K      +RL +V SV +  +  R+NG+ +  +   VL D  N      S + KD K
Sbjct  494   FGTKRNLLKSDRLKNVRSVRSSSDIARSNGNQKEAKENGVLGDAPNRAGSFGSPERKDYK  553

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
             V  ++T + V E K Q+LE KI MLE ELREAAA+E  L+SVVAEHGSS +KVHAPARRL
Sbjct  554   VYPRDTRSAVAESKIQQLEHKINMLETELREAAAIEASLYSVVAEHGSSMSKVHAPARRL  613

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSE  2138
             SRLY HACKE+   RR SAARS VSGL+LVAKACGNDVPRLTFWLSN ++LRA I + + 
Sbjct  614   SRLYLHACKEDFQSRRASAARSAVSGLVLVAKACGNDVPRLTFWLSNSIVLRAIISQATG  673

Query  2139  KQQLPLSSEYS--KNAVVK-NERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKA  2306
             + + P ++  S  +N+  + N    SPLKW +S   KK   N + G+F+DWE+P     A
Sbjct  674   RLEQPFAAGQSLERNSSQRGNNNITSPLKWKESASRKKDNRNVMRGSFDDWEDPHTLPSA  733

Query  2307  LEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEIN----KIYQRTSSSCSEEPENFS  2474
             LEKVEAWIFSRI+ESIWWQT TPHMQS A   +D +I     K  +RTSSS  +E  NFS
Sbjct  734   LEKVEAWIFSRIVESIWWQTLTPHMQSAAERVMDRDIGSCSRKNLERTSSSGDQEQINFS  793

Query  2475  LELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIP  2654
             L+ WKKAF+DA ER+CPVRA GHECGCL LL++LIM+QCVARLDVAMFNAILRESAD+IP
Sbjct  794   LDHWKKAFKDACERLCPVRARGHECGCLPLLARLIMEQCVARLDVAMFNAILRESADEIP  853

Query  2655  TDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIG--NWSRW  2771
             TDPVSDPIS+ +VLPIPAGK+SF AGAQLKNA+   N+  W
Sbjct  854   TDPVSDPISDSKVLPIPAGKSSFGAGAQLKNAVSDTNFRFW  894


 Score =   230 bits (587),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R   S+  +Y I+I +IKPWPPSQSL++L++V+IQW++GD+NSGST  V P
Sbjct  1    MVLGLSAKNRKEASIHVDYQIHIQDIKPWPPSQSLRSLRSVMIQWQNGDRNSGSTKTVGP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S +G G+IEFNESFR+ +TLLR+++ K+ + DTF KNC+EFNLYEPRRD T   Q
Sbjct  61   SL--GSVIGEGKIEFNESFRLRVTLLRDMNVKNKDADTFLKNCLEFNLYEPRRDKT---Q  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK--GRMKSLVRNN  698
            LL TA ID A+YG+VKE L+V+ P+N KRS+RNT QP+L +KIQ   K   R  S +R  
Sbjct  116  LLATATIDLADYGIVKETLSVNAPMNSKRSFRNTAQPVLFIKIQPAEKSVSRTSSSLREG  175

Query  699  VRRESSMDSSAGESVSALMN  758
              RE+S+D + GESVSALMN
Sbjct  176  FSREASLDKNGGESVSALMN  195



>ref|XP_010516407.1| PREDICTED: uncharacterized protein LOC104792073 isoform X1 [Camelina 
sativa]
 ref|XP_010516408.1| PREDICTED: uncharacterized protein LOC104792073 isoform X2 [Camelina 
sativa]
 ref|XP_010516409.1| PREDICTED: uncharacterized protein LOC104792073 isoform X2 [Camelina 
sativa]
 ref|XP_010516410.1| PREDICTED: uncharacterized protein LOC104792073 isoform X2 [Camelina 
sativa]
Length=676

 Score =   437 bits (1123),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 260/564 (46%), Positives = 337/564 (60%), Gaps = 40/564 (7%)
 Frame = +3

Query  1746  GITSNDWKDTKVRSKETSN--VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHG  1919
             GI+     +  V  KE S    VL++K + LE +I+ LE ELRE AA+EI L+SVV EH 
Sbjct  137   GISGGSENEAGVDVKENSEDEEVLKQKIENLETRIEKLEEELREVAALEISLYSVVPEHS  196

Query  1920  SSTNKVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSN  2099
             SS +K+H PARR+SRLY HACK  S  +R + +R+ VSGLIL AK+CGNDV RLT WLSN
Sbjct  197   SSAHKLHTPARRISRLYIHACKHWSQGKRATVSRNSVSGLILAAKSCGNDVSRLTLWLSN  256

Query  2100  CVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSV-GNDLPGTFED  2276
              + LR  I +      +P  S ++  +           K +   +K S   N      ED
Sbjct  257   IIALREIILQAFGNTSVP--SHFTDTSESNGSEHIGLGKLRRKNNKWSKQSNSFKQVLED  314

Query  2277  WENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSE--INKIYQRTSSSC  2450
             W+    FT ALEKVE WIFSRIIES+WWQ FTPHMQS    S  +E  I  +        
Sbjct  315   WQESETFTAALEKVEFWIFSRIIESVWWQVFTPHMQSPEIGSKTNEKLIGPVLGDHIQG-  373

Query  2451  SEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAIL  2630
                  ++S+ LWK AF+ +  R+CP+R  GHECGCL +L K++M++C+ARLDVAMFNAIL
Sbjct  374   -----SYSISLWKNAFKVSLSRLCPMRGAGHECGCLPILGKMVMEKCIARLDVAMFNAIL  428

Query  2631  RESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIdddded  2810
             RES   IPTDPVSDPI + +VLPI AG  SF +GAQLKNAIGNWSR LA++F I      
Sbjct  429   RESEHQIPTDPVSDPILDAKVLPILAGDLSFGSGAQLKNAIGNWSRCLAEMFSI------  482

Query  2811  ddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFG  2990
                        +  +  E        K F LLN +SDL+MLPKD+L+ +++R+EVCP+  
Sbjct  483   -----------NTRDSVEENDPIDSEKSFSLLNELSDLLMLPKDLLMEQSIREEVCPSIS  531

Query  2991  LSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAA  3170
             L LI R+L  F PDEFCPD +P  VLE LN+E  ++  + S V+FP +AAP+ Y PPS+ 
Sbjct  532   LLLIKRILCNFTPDEFCPDDVPGAVLEELNAESMLK-HKLSGVSFPYAAAPVSYIPPSSI  590

Query  3171  Aldgilgdiss-sssqltrsrssVLKKSYTsddeldeldsPLNLI--------KMENSEV  3323
                           S+++R+ S V +K YTSD+EL+ELDSPL  I          +N  V
Sbjct  591   NNVAERVAEVEGDISRMSRNASMVQRKGYTSDEELEELDSPLTSIIKNVSLSPSSQNRNV  650

Query  3324  TKPgggsgngngngVRYQLLREVW  3395
                    G       RY+LLREVW
Sbjct  651   KNQVEQIGAVVVTNARYELLREVW  674



>ref|XP_010928483.1| PREDICTED: uncharacterized protein LOC105050237 isoform X2 [Elaeis 
guineensis]
Length=670

 Score =   437 bits (1123),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 253/541 (47%), Positives = 326/541 (60%), Gaps = 69/541 (13%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K  E+EQ+I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK  S
Sbjct  181   QKISEMEQRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWS  240

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL---PLSSE  2165
               +R + A++ VSGL L+AK+CGNDVPRLTFWLSN V+LR  I +      L    + S 
Sbjct  241   QDKRATVAKNTVSGLALIAKSCGNDVPRLTFWLSNTVVLREIISQTFGNMSLLNPTMRSF  300

Query  2166  YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTF------EDWENPLGFTKALEKVEAW  2327
              S     K E K +PLKW     + + GN L   F      +DW+     T ALEK+E+W
Sbjct  301   ESNGGAKKTEGKLTPLKW-----RNNAGNRLAKVFGFMQQIDDWQETSTLTAALEKIESW  355

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFR  2501
             IF+RI+ES+WWQT TPHMQS       +   K Y R        ++  +FS  LWK AF 
Sbjct  356   IFARIVESVWWQTLTPHMQSPVEEMYTA---KGYGRLLGPALGDQQQGSFSSNLWKSAFH  412

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++++++QCV+RLDVAMFNAILRESA++IPTDPVSDPI 
Sbjct  413   DAFTRLCPVRAGGHECGCLPVLARMVIEQCVSRLDVAMFNAILRESANEIPTDPVSDPIV  472

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIPAG  SF +GAQLKN+IGNWSRWL  LFGI               +  + +G 
Sbjct  473   DPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTGLFGI------YADDSIKYGQLADEDGD  526

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
              R+     SK F LLN +SDL+MLPKDMLL R++RKE       SL+ R L+        
Sbjct  527   RREGAPE-SKSFCLLNELSDLLMLPKDMLLERSIRKE-------SLLERQLS--------  570

Query  3042  PDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqlt  3221
                                 +E+ + +FPC+AAP+VY+PPS A    +      +     
Sbjct  571   --------------------DEDLISSFPCTAAPVVYSPPSPADAAEVGDAGGKAKLDQR  610

Query  3222  rsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP---gggsgngngngVRYQLLREV  3392
              S    + + YTSD++LD+LDSPL  I M+ +    P               RY+LLREV
Sbjct  611   AS----MVQGYTSDEDLDDLDSPLTSI-MDKTPPVSPILRDVNQKESKHANARYKLLREV  665

Query  3393  W  3395
             W
Sbjct  666   W  666



>ref|XP_004973857.1| PREDICTED: uncharacterized protein LOC101774238 isoform X1 [Setaria 
italica]
 ref|XP_004973858.1| PREDICTED: uncharacterized protein LOC101774238 isoform X2 [Setaria 
italica]
Length=722

 Score =   438 bits (1126),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 260/588 (44%), Positives = 348/588 (59%), Gaps = 56/588 (10%)
 Frame = +3

Query  1752  TSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTN  1931
             T +D  D + +       V+ +  +E E +I  LE ELRE AA+E+ L+SVV EHGSS +
Sbjct  147   TDDDIPDIEEKIVHHDKSVVGQGNEESESRIDKLEQELREVAALEVSLYSVVPEHGSSAH  206

Query  1932  KVHAPARRLSRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLL  2111
             K+H PARRLSRLY HA K  S  +R S A+++ SGL+LVAK+  ND  RLTFWLSN V+L
Sbjct  207   KLHTPARRLSRLYIHASKFWSADKRASVAKNIASGLVLVAKSSSNDASRLTFWLSNTVVL  266

Query  2112  RAAICK-FSEKQQLPLSSEYSKNAVVKN-ERKASPLKWQSFPHKKSVGNDLPGTFEDWEN  2285
             R  I + F      P ++  S +   K  + K   + W++  + K          +DW+ 
Sbjct  267   REIIAQTFGISCVTPTTATMSMDGGAKKLDGKPMTMLWRNSSNGKQAKLAAMQMPDDWQE  326

Query  2286  PLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPE  2465
                   +LEK+E+WIFSRI++++WWQ  TPHMQ+ A  S      ++     +   +   
Sbjct  327   TSTLLASLEKIESWIFSRIVDTVWWQALTPHMQTPAEGSSTPRAGRVL--GPALGDQRQG  384

Query  2466  NFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLI----------------------  2579
              FS+ LWK AF DA+ R+CP+R+GGHECGCL +L+KL+                      
Sbjct  385   TFSVNLWKAAFHDAFSRMCPLRSGGHECGCLPVLAKLVFFNILNFKRIRIFHYCKYICRS  444

Query  2580  --------MQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGA  2735
                     M+QCVARLDVAMFNAILRESA +IPTDP+SDPI +P+VLPIPAG  SF +GA
Sbjct  445   HEFSHYQVMEQCVARLDVAMFNAILRESASEIPTDPISDPIVDPKVLPIPAGDLSFGSGA  504

Query  2736  QLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAM  2915
             QLKN+IGNWSRWL D F             DD++    ++  ER+   A SK F LLN +
Sbjct  505   QLKNSIGNWSRWLTDKF-----------GIDDDDSDIGNDDDERRGA-AESKSFQLLNEL  552

Query  2916  SDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHM  3095
             SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFCPDP+P+ VLE LNSE  +
Sbjct  553   SDLLMLPKDMLLEKSIRKEVCPSIGLQLVTRILCNFTPDEFCPDPVPSTVLEELNSESLL  612

Query  3096  E--VEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsdde  3269
             E   +++ +  FPC AAP+VY  PS               ++L R  S V ++ YTSDD+
Sbjct  613   ERCTDKDVISAFPCIAAPVVYCAPS-TLDAAEKVADIGGGAKLDRKASLVQRRGYTSDDD  671

Query  3270  ldeldsPLNLIKMENSEVTKPg------ggsgngngngVRYQLLREVW  3395
             LD+LDSPL  + ++ S    P             +    RY LLREVW
Sbjct  672   LDDLDSPLASL-IDRSAPPSPSNGIAHFSAQRGASMENARYTLLREVW  718



>ref|XP_002878171.1| hypothetical protein ARALYDRAFT_486231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54430.1| hypothetical protein ARALYDRAFT_486231 [Arabidopsis lyrata subsp. 
lyrata]
Length=689

 Score =   435 bits (1118),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 253/541 (47%), Positives = 331/541 (61%), Gaps = 50/541 (9%)
 Frame = +3

Query  1824  QELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLR  2003
             ++LE +++ LE ELRE AA+EI L+SVV +H SS +K+H PARR+SRLY HACK  S  +
Sbjct  180   EDLETRVEKLEEELREVAALEISLYSVVPDHSSSEHKLHTPARRISRLYIHACKHWSQRK  239

Query  2004  RLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPL-------SS  2162
             + + AR+ VSGLIL +K+CGNDV RLTFWLSN + LR  I +   K  +P        S+
Sbjct  240   QATVARNSVSGLILASKSCGNDVSRLTFWLSNIIALREIILQAFGKTSVPSHVRETSESN  299

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
                 N + K +RK +    QS        N      EDW+ P  FT ALEKVE WIFSRI
Sbjct  300   GSENNGLGKLKRKKNQWNKQS--------NGFKQVLEDWQEPETFTAALEKVEFWIFSRI  351

Query  2343  IESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSE-EPENFSLELWKKAFRDAYERI  2519
             +ES+WWQ FTPHMQS     L++  N   +       + E  +FS+ LWK AF+ A  R+
Sbjct  352   VESVWWQVFTPHMQS-----LENGGNTNEKLMGPVLGDNEQGSFSISLWKNAFKVALTRL  406

Query  2520  CPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLP  2699
             CP+R  GHECGCL  L+K++M++C++R+D+AMFNAILRES   IPTDPVSDPI + +VLP
Sbjct  407   CPMRGAGHECGCLPTLAKMVMEKCISRIDLAMFNAILRESEHQIPTDPVSDPILDSKVLP  466

Query  2700  IPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQD  2879
             I AG  SF +GAQLKNAIGNWSR LA++F I                 +  +  E     
Sbjct  467   ILAGNLSFGSGAQLKNAIGNWSRCLAEMFSI-----------------NTRDSVEENDSI  509

Query  2880  ACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
                K F LLN +SDL+MLPKDML+ R+ R+EVCP+  L LI R+L  F PDEFCPD +P 
Sbjct  510   ESEKSFSLLNELSDLLMLPKDMLMDRSTREEVCPSISLPLIKRILCNFTPDEFCPDDVPG  569

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssV  3239
              VLE LN+E   E ++ S V+FP +A+P+ Y PPS +             S+++R+ S +
Sbjct  570   AVLEELNNESISE-QKVSGVSFPYAASPVSYNPPS-SLNVAEKVPEVGDISRISRNVSMI  627

Query  3240  LKKSYTsddeldeldsPLNLIKMEN---------SEVTKPgggsgngngngVRYQLLREV  3392
              +K YTSD+EL+ELDSPL  I +EN         S   K             RY+LLRE 
Sbjct  628   QRKGYTSDEELEELDSPLTSI-IENVSLSPISVQSRNVKQETEHIGAVVANARYELLREA  686

Query  3393  W  3395
             W
Sbjct  687   W  687



>emb|CDY53495.1| BnaC04g02610D [Brassica napus]
Length=605

 Score =   430 bits (1105),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 253/590 (43%), Positives = 350/590 (59%), Gaps = 93/590 (16%)
 Frame = +3

Query  1686  ANGSVRSNQFVLRDKRNSIEGITSNDWKD------TKVRSKETSNVVLE--------RKC  1823
              NGS   +     + +++ EG+ ++ W+D      +     E+ +VV E         K 
Sbjct  90    VNGSKDDDDDEEEEVKDAREGVNADVWEDASNGALSTGSENESPDVVTENSGEHFEEEKI  149

Query  1824  QELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLR  2003
               LE +I  LE ELRE A++EI L+SVV +H SS +K+H PARRLSR+Y HACK  +  +
Sbjct  150   NHLETRIGRLEEELREVASLEISLYSVVPDHSSSAHKLHTPARRLSRIYIHACKHLTREK  209

Query  2004  RLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAV  2183
             R   A + VSGL+LVA++CGNDV RLTFWLSN + LR  I      Q    S E + +A 
Sbjct  210   RARIATNSVSGLVLVARSCGNDVSRLTFWLSNIISLREIIS-----QAFGKSHESNGDA-  263

Query  2184  VKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQ  2363
                E+K                  L    EDW+    FT +LEK+E W+F+RI+ES+WWQ
Sbjct  264   ---EKKG-----------------LQKLLEDWQETETFTTSLEKIEHWVFTRIVESVWWQ  303

Query  2364  TFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGH  2543
              FTP+MQS  + S                SE+   FS+ LW  AFR+A +R+CPVR  GH
Sbjct  304   VFTPYMQSPESNS----------------SEKQGAFSISLWNSAFREALQRLCPVRGAGH  347

Query  2544  ECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASF  2723
             ECGCL +L++++M++C++R DVAMFNAILRES   IPTDPVSDPI +  V+PIPAG+ SF
Sbjct  348   ECGCLPVLARMVMEKCISRFDVAMFNAILRESEHQIPTDPVSDPILDSNVVPIPAGELSF  407

Query  2724  AAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYL  2903
              +GAQLKNAIGNWSR L  +FG+                 +N +  E +  D+ SK F L
Sbjct  408   GSGAQLKNAIGNWSRCLTKMFGM-----------------NNKDDDESEGSDS-SKAFVL  449

Query  2904  LNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNS  3083
             LN +SDL+MLPKDML+  ++R+E+CP+  L LI R+L  F PDEFCPD +P  VLE LNS
Sbjct  450   LNEISDLLMLPKDMLMESSIREEICPSINLLLIKRILCNFTPDEFCPDHVPGAVLEELNS  509

Query  3084  ED-----HMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKK  3248
              D      + +EE    +FP +A+ + Y PPS      +   +S+ + +++R+ S + +K
Sbjct  510   ADSDGDGKLLLEE----SFPYAASSVSYTPPSTM---DVGEKVSNLTGKMSRNVSMIQRK  562

Query  3249  SYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
              YTSD+EL+ELDSPL  I  ++S+ T     +        RY+LLR+VW 
Sbjct  563   GYTSDEELEELDSPLTSIVDDSSDFTDSATSNE-------RYKLLRQVWF  605



>dbj|BAB10586.1| unnamed protein product [Arabidopsis thaliana]
Length=628

 Score =   428 bits (1101),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 254/530 (48%), Positives = 327/530 (62%), Gaps = 61/530 (12%)
 Frame = +3

Query  1833  EQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV--LRR  2006
             + K + LE EL+EAA +E  ++SVVAEH SS +KVHAPARRL+R Y HACK N     +R
Sbjct  145   DSKTETLEDELKEAAVLEAAIYSVVAEHTSSMSKVHAPARRLARFYLHACKGNGSDHSKR  204

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+ VSGLILV+KACGNDVPRLTFWLSN ++LRA + +  EK ++            
Sbjct  205   ATAARAAVSGLILVSKACGNDVPRLTFWLSNSIVLRAILSRGMEKMKI------------  252

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                           P K   G+D      +WE+P  F  ALEK E+WIFSR+++S+WWQ+
Sbjct  253   -------------VPEK--AGSD------EWEDPRAFLAALEKFESWIFSRVVKSVWWQS  291

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPEN---FSLELWKKAFRDAYERICPVRAG  2537
              TPHMQS A          I ++ S        N   +++ELWK AFR A ER+CP+R  
Sbjct  292   MTPHMQSPAVK------GSIARKVSGKRRLGHRNQGLYAIELWKNAFRAACERLCPLRGS  345

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
               ECGCL +L+KL+M+Q ++RLDVAMFNAILRESA ++PTDPVSDPIS+  VLPIPAGKA
Sbjct  346   RQECGCLPMLAKLVMEQLISRLDVAMFNAILRESAGEMPTDPVSDPISDINVLPIPAGKA  405

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF AGAQLKNAIG WSRWL D F       +    +   NK +++N  E K +    + F
Sbjct  406   SFGAGAQLKNAIGTWSRWLEDQF-------EQKEDKSGRNKDEDNNDKE-KPECEHFRLF  457

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
             +LLN++ DLMMLP  ML  ++ RKEVCPT G  +I RVL  F+PDEF P  IP  + + L
Sbjct  458   HLLNSLGDLMMLPFKMLADKSTRKEVCPTLGPPIIKRVLRNFVPDEFNPHRIPRRLFDVL  517

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
             NSE   E +   +  FP +A+P VY  PS  +          ++  ++ + SSV KK YT
Sbjct  518   NSEGLTEEDNGCITVFPSAASPTVYLMPSTDS--IKRFIGELNNPSISETGSSVFKKQYT  575

Query  3258  sddeldeldsPLNLI----KMENSEVTKPgggsgngngngVRYQLLREVW  3395
             SDDELD+LD+ +N I       NS    P    G G    VRYQLLRE+W
Sbjct  576   SDDELDDLDTSINSIFSAPGTTNSSEWMP---KGYGRRKTVRYQLLREIW  622



>ref|XP_010540405.1| PREDICTED: uncharacterized protein LOC104814192 isoform X3 [Tarenaya 
hassleriana]
Length=859

 Score =   435 bits (1118),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 257/586 (44%), Positives = 345/586 (59%), Gaps = 55/586 (9%)
 Frame = +3

Query  1674  ESNRANGSVRSNQFVLRDKRNSIEGI--------TSNDWKDTKVRSKETSNVVLERKCQE  1829
             E+ R    +R+N   L  K   +EG+            +   ++R K T     ++    
Sbjct  312   EAVRKQMKLRTNTLALGRKTLGMEGVPRLKQLKSIQLHFDTDEIRKKMTMKGSSDKVSVA  371

Query  1830  LEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRL  2009
              E K ++LE ELRE AA+E  ++S+  EH  S +KVHAPARRLSR Y HACK +S  +R 
Sbjct  372   KESKTEILEEELRETAALEAAIYSINPEHSRSQSKVHAPARRLSRFYLHACKASSNSKRA  431

Query  2010  SAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVK  2189
             SAAR+VVSGL+LV+KACGNDVPRLTFWLSN ++LR  + +  +K  L    +        
Sbjct  432   SAARAVVSGLVLVSKACGNDVPRLTFWLSNAIMLRTIVGQGVQKMNLSSGDD--------  483

Query  2190  NERKASPL---KWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWW  2360
                  +PL   K + F  K           ++W +P  F  ALE+ EAWIF RI++S+WW
Sbjct  484   -----APLGEKKLEYFLEK-----------DEWADPRAFLAALERFEAWIFPRIVKSVWW  527

Query  2361  QTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGG  2540
             Q+FTPHMQS   T     I++       S  +    +S+ELWK AFR A ER+CP+R   
Sbjct  528   QSFTPHMQSACTTR--GSISRKSSGKRRSGHKNHGRYSIELWKNAFRAACERLCPLRGTR  585

Query  2541  HECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKAS  2720
              ECGCL +L+KL+M+Q ++RLDVAMFNAILRES +++PTDPVSDPIS+  VLP+PAGKAS
Sbjct  586   QECGCLPMLAKLVMEQLISRLDVAMFNAILRESPEEMPTDPVSDPISDINVLPVPAGKAS  645

Query  2721  FAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFY  2900
             F AGAQLKN+ G WSRWLAD F                 K D+++  +   +    + F+
Sbjct  646   FGAGAQLKNSTGTWSRWLADQFD---------------RKDDSASRKDENPECESFRLFH  690

Query  2901  LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALN  3080
             LLNA+ DLMMLP  ML  ++ R+EVCP+ G  +I RVL  F+PDEF P  IP  + + LN
Sbjct  691   LLNALGDLMMLPFKMLADKSTRREVCPSLGPLIIKRVLRNFVPDEFNPHRIPRRLFDILN  750

Query  3081  SEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTs  3260
             SED  E     + +FPC+A+P  Y+ P+             S   L+R+ SSV KK YTS
Sbjct  751   SEDSAEAGNGCITSFPCAASPTFYSTPT--EDLIKSFIGEFSKPSLSRNGSSVFKKQYTS  808

Query  3261  ddeldeldsPLN-LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DDELD+LD+ +N +I    +         G G+   +RYQLLRE W
Sbjct  809   DDELDDLDTAINSIISAAATNNASEWLPKGYGHKKAIRYQLLREAW  854


 Score =   100 bits (248),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 96/170 (56%), Gaps = 18/170 (11%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R    +  EYLI+I E+KPWP   +L   + V+++W + + ++GS   V  
Sbjct  1    MVLGLRSKSRKDNGIFVEYLISIKELKPWP--NNLVPAQCVLLKWANAETSNGSFIAV--  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRD-TTVKG  521
                   VGN  I FNESF + + L ++        D F KN +EFN+++ R+D  T K 
Sbjct  57   -------VGNETIMFNESFTLTLVLDQK------GQDKFHKNLLEFNVFDARKDKNTDKN  103

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKG  671
            + LG+AV++ A +G+V+  + V VP + K++ RN    +L L I+ V  G
Sbjct  104  KFLGSAVVNLAEHGIVRGCVPVGVPFSFKKNSRNDSNSVLYLTIEPVVNG  153



>ref|XP_007031809.1| F28J7.14 protein, putative isoform 4 [Theobroma cacao]
 gb|EOY02735.1| F28J7.14 protein, putative isoform 4 [Theobroma cacao]
Length=919

 Score =   436 bits (1121),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 296/443 (67%), Gaps = 27/443 (6%)
 Frame = +3

Query  1473  ETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGRESVGAKTTCDERLNHV  1652
             E G   +   +K   +E EP+N    DN+  Q   GN   I     +       +RL HV
Sbjct  444   ENGHEGQYGEDKRYSTEDEPLNIHSPDNSLSQ---GNLGTIGNVLKI-------DRLKHV  493

Query  1653  SSVHTLGESNRANGSVRSNQF-------VLRDKRN---SIEGITSNDWKDTKVRSKETSN  1802
              SV +  +S R+NG   +NQ        VL D  +   +    + N+ KD KV  K+T +
Sbjct  494   KSVRSSSDSVRSNGLSTNNQHAELKEVGVLGDAPHGGGTFRSKSGNERKDAKVYPKDTRS  553

Query  1803  VVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHAC  1982
              +L+ K Q+LE KI+MLEGELREAAAVE  L+SVVAEHGSS  KVHAPARRLSRLY HA 
Sbjct  554   AILDNKVQQLELKIKMLEGELREAAAVEAALYSVVAEHGSSMCKVHAPARRLSRLYLHAF  613

Query  1983  KENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSS  2162
             KE    R  SAARS VSGL LVAKACGNDVPRLTFWLSN V+LRA I +     +LP+S+
Sbjct  614   KEGIQSRGASAARSAVSGLALVAKACGNDVPRLTFWLSNSVVLRAIISESIGDSELPISA  673

Query  2163  EYSK--NAVVKNERKASPLKW-QSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIF  2333
                +     +  ++ +SPLKW +S   +K     L G+  DW+NP  FT ALE+VEAWIF
Sbjct  674   GPMERIGGGMGKKQVSSPLKWKESSSRRKENKLILYGSSSDWDNPHAFTSALERVEAWIF  733

Query  2334  SRIIESIWWQTFTPHMQSGAATSLD----SEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             SRIIES+WWQT TPHMQS     +D    S  +K Y R SSS  E+  NFSL+ WKKAF+
Sbjct  734   SRIIESVWWQTLTPHMQSADRKEIDRGMGSGSSKSYGRVSSSSDEDQMNFSLDHWKKAFK  793

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA ER+CPVRA GHECGCL LLS+LIM+QCVARLDVAMFNAILR+S D+IPTDPVSDPIS
Sbjct  794   DACERLCPVRAAGHECGCLRLLSRLIMEQCVARLDVAMFNAILRDSGDEIPTDPVSDPIS  853

Query  2682  NPEVLPIPAGKASFAAGAQLKNA  2750
             NP VLPIP+GK SF AGAQLKNA
Sbjct  854   NPLVLPIPSGKTSFGAGAQLKNA  876


 Score =   217 bits (552),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 147/198 (74%), Gaps = 5/198 (3%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG S K R  P+V  +YLI+I EIKPWPPSQSL++L++V+IQWE+G+++SGST  V+P
Sbjct  1    MVLGLSAKNRRGPTVHVDYLIHIQEIKPWPPSQSLRSLRSVLIQWENGERSSGSTNTVSP  60

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
             L   S VG G+IEFNESF++P+ L+R++S K  + D FQKN +EFNLYEPRRD   K Q
Sbjct  61   TLG--SIVGEGKIEFNESFKLPVNLVRDLSVKGRDADVFQKNSLEFNLYEPRRD---KIQ  115

Query  525  LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGKGRMKSLVRNNVR  704
            LL TA++D A YG +KE L+++VP+N KRS+ NT QP+L +KI  + KGR  S  R+ + 
Sbjct  116  LLATAIVDLAEYGAIKETLDITVPMNSKRSFSNTAQPILFIKIDRIYKGRNSSSSRSGLS  175

Query  705  RESSMDSSAGESVSALMN  758
             E S+D    ESVSALM+
Sbjct  176  EEQSLDRKGSESVSALMD  193


 Score = 72.0 bits (175),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  2967  KEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSE  3086
             K  CPTFG SLI RVL+ ++PDEFCPDP+P+VVLEAL SE
Sbjct  874   KNACPTFGASLIKRVLDNYVPDEFCPDPVPDVVLEALESE  913



>ref|XP_010442054.1| PREDICTED: uncharacterized protein LOC104725146 [Camelina sativa]
Length=780

 Score =   428 bits (1101),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 265/587 (45%), Positives = 350/587 (60%), Gaps = 62/587 (11%)
 Frame = +3

Query  1674  ESNRANGSVRSNQFVLRDKRNSIEGI--------TSNDWKDTKVRS-KETSNVVLERKCQ  1826
             ++ R    +R+N   L  K   +EGI            +  TK  S K+ S V  +    
Sbjct  237   DAARKQMKLRTNTLALGRKTLGMEGIPRLKQLKSIQLHFDGTKDESHKKASGVSNKVGLT  296

Query  1827  ELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRR  2006
               E + + LE EL+E+AA+E  ++SVVAEH SS +KVHAPARRL+R Y HAC+     +R
Sbjct  297   SQEPRTETLEDELKESAALEAAVYSVVAEHSSSMSKVHAPARRLARFYLHACRGTDHSKR  356

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              SAAR+ VSG+ILV+KACGNDVPRLTFWLSN ++LRA + +  EK ++            
Sbjct  357   ASAARAAVSGMILVSKACGNDVPRLTFWLSNSIVLRAMLSRGMEKMKI------------  404

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                           P K S         ++WE+P  F  ALEK E+WIFSR+++S+WWQ+
Sbjct  405   -------------VPEKSSS--------DEWEDPRAFLAALEKFESWIFSRVVKSVWWQS  443

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPEN---FSLELWKKAFRDAYERICPVRAG  2537
              TPHMQS A          I ++ S        N   +++ELWK AFR A ER+CP+R  
Sbjct  444   MTPHMQSAAVK------GSISRKVSGKRRLGHRNQGLYAIELWKNAFRAACERLCPLRGS  497

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
               ECGCL +L+KL+M+Q ++RLDVAMFNAILRESA ++PTDPVSDPIS+  VLPIPAGKA
Sbjct  498   RQECGCLPMLAKLVMEQLISRLDVAMFNAILRESAAEMPTDPVSDPISDINVLPIPAGKA  557

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF AGAQLKNAIG WSRWL D F       +    +   NK ++SN +E K +    + F
Sbjct  558   SFGAGAQLKNAIGTWSRWLEDQF-------EPREDKSGRNKDEDSNNNE-KPESENFRLF  609

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
             +LLN++ DLMMLP  ML  ++ RKEVCPT G  +I RVL  F+PDEF P  IP  + + L
Sbjct  610   HLLNSLGDLMMLPFKMLADKSTRKEVCPTLGPPIIKRVLRNFVPDEFNPHRIPRRLFDVL  669

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
             NSE   E +   +  FPC+A+P VY  PS  +          ++  L+ S SSV KK YT
Sbjct  670   NSEASTEEDNGCITIFPCAASPTVYLMPSTDS--IKRFIGELNNPSLSESGSSVFKKQYT  727

Query  3258  sddeldeldsPLN-LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             SDDELD+LD+ +N ++    +  +      G G    VRYQLLRE+W
Sbjct  728   SDDELDDLDTSINSILSAPGTTNSSEWMPKGYGRRKTVRYQLLREIW  774



>ref|NP_199137.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED94926.1| uncharacterized protein AT5G43230 [Arabidopsis thaliana]
Length=848

 Score =   429 bits (1103),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 254/530 (48%), Positives = 327/530 (62%), Gaps = 61/530 (12%)
 Frame = +3

Query  1833  EQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV--LRR  2006
             + K + LE EL+EAA +E  ++SVVAEH SS +KVHAPARRL+R Y HACK N     +R
Sbjct  365   DSKTETLEDELKEAAVLEAAIYSVVAEHTSSMSKVHAPARRLARFYLHACKGNGSDHSKR  424

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              +AAR+ VSGLILV+KACGNDVPRLTFWLSN ++LRA + +  EK ++            
Sbjct  425   ATAARAAVSGLILVSKACGNDVPRLTFWLSNSIVLRAILSRGMEKMKI------------  472

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                           P K   G+D      +WE+P  F  ALEK E+WIFSR+++S+WWQ+
Sbjct  473   -------------VPEK--AGSD------EWEDPRAFLAALEKFESWIFSRVVKSVWWQS  511

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPEN---FSLELWKKAFRDAYERICPVRAG  2537
              TPHMQS A          I ++ S        N   +++ELWK AFR A ER+CP+R  
Sbjct  512   MTPHMQSPAVK------GSIARKVSGKRRLGHRNQGLYAIELWKNAFRAACERLCPLRGS  565

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
               ECGCL +L+KL+M+Q ++RLDVAMFNAILRESA ++PTDPVSDPIS+  VLPIPAGKA
Sbjct  566   RQECGCLPMLAKLVMEQLISRLDVAMFNAILRESAGEMPTDPVSDPISDINVLPIPAGKA  625

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF AGAQLKNAIG WSRWL D F       +    +   NK +++N  E K +    + F
Sbjct  626   SFGAGAQLKNAIGTWSRWLEDQF-------EQKEDKSGRNKDEDNNDKE-KPECEHFRLF  677

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
             +LLN++ DLMMLP  ML  ++ RKEVCPT G  +I RVL  F+PDEF P  IP  + + L
Sbjct  678   HLLNSLGDLMMLPFKMLADKSTRKEVCPTLGPPIIKRVLRNFVPDEFNPHRIPRRLFDVL  737

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
             NSE   E +   +  FP +A+P VY  PS  +          ++  ++ + SSV KK YT
Sbjct  738   NSEGLTEEDNGCITVFPSAASPTVYLMPSTDS--IKRFIGELNNPSISETGSSVFKKQYT  795

Query  3258  sddeldeldsPLNLI----KMENSEVTKPgggsgngngngVRYQLLREVW  3395
             SDDELD+LD+ +N I       NS    P    G G    VRYQLLRE+W
Sbjct  796   SDDELDDLDTSINSIFSAPGTTNSSEWMP---KGYGRRKTVRYQLLREIW  842


 Score = 96.3 bits (238),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 96/169 (57%), Gaps = 16/169 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R    V  EYLI+I E+KPWP SQ     + V+++WE+G+ NSGS   V  
Sbjct  1    MVLGLRTKSRRDNGVFVEYLISIKELKPWPTSQV--PAQCVLLKWENGENNSGSFIAV--  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEP-RRDTTVKG  521
                   VG   I FNESFR+ +TL  ++ S     + F KN +E ++Y+  ++D  VK 
Sbjct  57   -------VGKDTIMFNESFRLTLTLEPKVGSD----NKFHKNLLELHVYDAKKKDKGVKN  105

Query  522  QLLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK  668
            +LLGTA ++ A++G++   + V  P   K+S RN     + L ++  G+
Sbjct  106  KLLGTASVNLADFGLLTNSVPVGAPFTFKKSSRNDASSEIYLTVEPAGE  154



>gb|EMS58521.1| hypothetical protein TRIUR3_09895 [Triticum urartu]
Length=770

 Score =   426 bits (1096),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 244/550 (44%), Positives = 327/550 (59%), Gaps = 82/550 (15%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             + K +ELE KI+ L+ ELRE AA+E+ ++S+V EH  S++K+H PARRLSRLY HA K  
Sbjct  276   DEKSEELESKIEKLKQELREVAALEVSVYSIVPEHVCSSHKLHTPARRLSRLYIHASKFW  335

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYS  2171
             S  ++ S A++ VSGL+LVAK+CGNDVPRLTFWLSN ++LR  I      Q   +SS+ +
Sbjct  336   SPDKKASVAKNSVSGLVLVAKSCGNDVPRLTFWLSNTIVLREIIA-----QTFGISSQST  390

Query  2172  K--NAVVKNERKAS--------PLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVE  2321
                NA   N +  +        P++W+     K     +      W+       ALEK+E
Sbjct  391   AVMNAFTTNSKSNARNLYKNSLPMRWKMNSSGKQARPTITQFPNHWQETGTVLAALEKIE  450

Query  2322  AWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFR  2501
             +WIFSRI+ES+WWQ                                           AF 
Sbjct  451   SWIFSRIVESVWWQA------------------------------------------AFC  468

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ RICP+RAGGHECGCL +L+KL+M+QCVARLDVA+FNAILRES ++IP+DP+SDPI 
Sbjct  469   DAFSRICPLRAGGHECGCLPVLAKLVMEQCVARLDVALFNAILRESENEIPSDPISDPIL  528

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +  VLPIPAG  SF +GAQLKNA+G+WSR L D+FG+      D      + +    +G+
Sbjct  529   DSTVLPIPAGNLSFGSGAQLKNAVGSWSRLLTDMFGM------DGDDSRKDGQGAEGDGN  582

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFC  3041
              R+   A S  F LLN +SDL+MLPKDMLL +++RKEVCP+ GL L+TR+L  F PDEFC
Sbjct  583   SRR-DGAESNSFKLLNELSDLLMLPKDMLLEKSIRKEVCPSIGLPLVTRILCNFTPDEFC  641

Query  3042  PDPIPNVVLEALNSEDHME------VEEESVVNFPCSAAPIVYAPPSAAAldgilgdiss  3203
             PDP+P +VLE LNSE+ M+       E+  +  FPC+AAP+ Y  PS            S
Sbjct  642   PDPVPGIVLEELNSENVMKSLLERFTEKNLISTFPCTAAPVAYRAPSLEG-----VAEKS  696

Query  3204  sssqltrsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKP------gggsgngngng  3365
              S+++ +    V ++ YTSDD+LD+L SPL +   + S    P            G    
Sbjct  697   GSAEVEQRALMVQRRGYTSDDDLDDLGSPL-MSLYDRSSPPSPCNGVAHFSARQEGAVAN  755

Query  3366  VRYQLLREVW  3395
             VRY+LLREVW
Sbjct  756   VRYELLREVW  765



>ref|XP_010494294.1| PREDICTED: uncharacterized protein LOC104771465 [Camelina sativa]
Length=844

 Score =   426 bits (1094),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 253/527 (48%), Positives = 328/527 (62%), Gaps = 55/527 (10%)
 Frame = +3

Query  1833  EQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV--LRR  2006
             E + + LE EL+E+ AVE  ++SVVAEH SS +KVHAPARRL+R Y HACK N     +R
Sbjct  361   EPRTETLEDELKESVAVEAAVYSVVAEHSSSMSKVHAPARRLARFYLHACKGNGSDHSKR  420

Query  2007  LSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVV  2186
              SAAR+ VSG+ILV+KACGNDVPRLTFWLSN ++LRA + +  EK ++            
Sbjct  421   ASAARAAVSGMILVSKACGNDVPRLTFWLSNSIVLRAMLSRGMEKMKI------------  468

Query  2187  KNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQT  2366
                           P K S         ++WE+P  F  ALEK E+WIFSR+++S+WWQ+
Sbjct  469   -------------VPEKSSS--------DEWEDPRAFLAALEKFESWIFSRVVKSVWWQS  507

Query  2367  FTPHMQSGAATSLDSEINKIYQRTSSSCSEEPEN---FSLELWKKAFRDAYERICPVRAG  2537
              TPHMQS A          I ++ S        N   +++ELWK AFR A ER+CP+R  
Sbjct  508   MTPHMQSAAVK------GSISRKVSGKRRLGHRNQGLYAIELWKNAFRAACERLCPLRGS  561

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
               ECGCL +L+KL+M+Q ++RLDVAMFNAILRESA ++PTDPVSDPIS+  VLPIPAGKA
Sbjct  562   RQECGCLPMLAKLVMEQLISRLDVAMFNAILRESAAEMPTDPVSDPISDINVLPIPAGKA  621

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF AGAQLKNAIG WSRWL D F       +    +   NK ++SN +E K +    + F
Sbjct  622   SFGAGAQLKNAIGTWSRWLEDQF-------EPREDKSGRNKDEDSNNNE-KPESENFRLF  673

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
             +LLN++ DLMMLP  ML  ++ RKEVCPT G  +I RVL  F+PDEF P  IP  + + L
Sbjct  674   HLLNSLGDLMMLPFKMLADKSTRKEVCPTLGPPIIKRVLRNFVPDEFNPHRIPRRLFDVL  733

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
             NSE   E +   +  FPC+A+P VY  PS  +          ++  L+ S SSV KK YT
Sbjct  734   NSEASTEEDNGCITIFPCAASPTVYLMPSTDS--IKRFIGELNNPSLSESGSSVFKKQYT  791

Query  3258  sddeldeldsPLN-LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             SDDELD+LD+ +N ++    +  +      G G    VRYQLLRE+W
Sbjct  792   SDDELDDLDTSINSILSAPGTTNSSEWMPKGYGRRKTVRYQLLREIW  838


 Score = 94.4 bits (233),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 91/169 (54%), Gaps = 16/169 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R    V  EY+++I E+KPWP SQ     + V+++WE+G+ NSGS   V  
Sbjct  1    MVLGLRTKSRKDNGVFVEYVVSIKELKPWPTSQV--PAQCVLLKWENGENNSGSFIAV--  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG   I FNESFR+ +TL  ++ +     + F KN +E  +Y+ ++       
Sbjct  57   -------VGKDTIMFNESFRLTLTLEPKVGAD----NKFHKNLLELQVYDAKKKDKGVKN  105

Query  525  -LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK  668
             LLGTA ++ A++GV+   + V  P   K+S RN     + L ++  G+
Sbjct  106  KLLGTASVNLADFGVLTNSVPVGAPFTFKKSSRNDASSEIYLTVEPAGE  154



>emb|CDX88965.1| BnaA04g02210D [Brassica napus]
Length=590

 Score =   417 bits (1073),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 248/538 (46%), Positives = 316/538 (59%), Gaps = 91/538 (17%)
 Frame = +3

Query  1809  LERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKE  1988
             L++K + LE +I+ LE ELRE AA+EI L+SVV +H SS +K+H PARR+SRLY HACK 
Sbjct  133   LKQKVESLETRIEKLEDELREVAALEISLYSVVPDHSSSAHKLHTPARRVSRLYIHACKH  192

Query  1989  NSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEY  2168
              S  +R + AR+ VSGLIL AK+CGNDV RLTFWLSN V LR       E       SE+
Sbjct  193   WSQEKRAAVARNTVSGLILAAKSCGNDVSRLTFWLSNIVTLR-------EITSHAFGSEH  245

Query  2169  SKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIE  2348
             + +  +K  ++                            P GFT ALEKVE WIFSRI+E
Sbjct  246   NGSEKLKRTKQ----------------------------PNGFTAALEKVEFWIFSRIVE  277

Query  2349  SIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPV  2528
             S+WWQ FTPHMQS       +E  K  Q   S        FS+ LW+ AF+ A  R+CP 
Sbjct  278   SVWWQVFTPHMQSPENVGKTNEKLKGDQEQGS--------FSISLWQNAFKAALSRLCPT  329

Query  2529  RAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPA  2708
             R  GHECGCL +LSK++M++C+AR+DVAMFNAILRES   IPTDPVSDPI + +VLPI A
Sbjct  330   RGEGHECGCLPILSKMVMEKCIARVDVAMFNAILRESEHQIPTDPVSDPILDSKVLPITA  389

Query  2709  GKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACS  2888
             G  SF +GAQLKNAIGNW R LA+                              + +   
Sbjct  390   GDLSFGSGAQLKNAIGNWCRCLAE-----------------------------DSLEEDE  420

Query  2889  KPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVL  3068
             K F LLN +SDL+MLPKDML+  +VR+EVCP+  L LI R+L  F PDEFCPD +P  VL
Sbjct  421   KYFSLLNELSDLLMLPKDMLMDLSVREEVCPSISLPLIKRILCNFTPDEFCPDHVPGAVL  480

Query  3069  EALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKK  3248
             E LN+E   E ++ S V+FP +++P+ Y PPS+              S+++R+ S + +K
Sbjct  481   EELNAESVAE-QKLSGVSFPYASSPVTYVPPSSI--------NVGDISRMSRNASVIQRK  531

Query  3249  SYTsddeldeldsPLNLI---------KMENSEVTKPgggsgngngngVRYQLLREVW  3395
              YTSD+ELDELDSPL  +            N +V K             RY+LLREVW
Sbjct  532   GYTSDEELDELDSPLTFVIDKVSVSLSSGHNGKV-KQQDEQVGEVVENARYELLREVW  588



>ref|XP_010481889.1| PREDICTED: uncharacterized protein LOC104760629 [Camelina sativa]
Length=841

 Score =   425 bits (1093),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 250/525 (48%), Positives = 327/525 (62%), Gaps = 53/525 (10%)
 Frame = +3

Query  1833  EQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSVLRRLS  2012
             E + + LE EL+E+AA+E  ++SVVAEH SS +KVHAPARRL+R Y HAC+     +R S
Sbjct  360   EPRTETLEDELKESAALEAAVYSVVAEHSSSMSKVHAPARRLARFYLHACRGTDHSKRAS  419

Query  2013  AARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKN  2192
             AAR+ VSG+ILV+KACGNDVPRLTFWLSN ++LRA + +  EK ++              
Sbjct  420   AARAAVSGMILVSKACGNDVPRLTFWLSNSIVLRAMLSRGMEKMKI--------------  465

Query  2193  ERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFT  2372
                         P K S         ++WE+   F  ALEK E+WIFSR+++S+WWQ+ T
Sbjct  466   -----------VPEKSSS--------DEWEDFRAFLAALEKFESWIFSRVVKSVWWQSMT  506

Query  2373  PHMQSGAATSLDSEINKIYQRTSSSCSEEPEN---FSLELWKKAFRDAYERICPVRAGGH  2543
             PHMQS A          I ++ S        N   +++ELWK AFR A ER+CP+R    
Sbjct  507   PHMQSAAVK------GSISRKVSGKRRLGHRNQGLYAIELWKNAFRAACERLCPLRGSRQ  560

Query  2544  ECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASF  2723
             ECGCL +L+KL+M+Q ++RLDVAMFNAILRESA ++PTDPVSDPIS+  VLPIPAGKASF
Sbjct  561   ECGCLPMLAKLVMEQLISRLDVAMFNAILRESAAEMPTDPVSDPISDINVLPIPAGKASF  620

Query  2724  AAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYL  2903
              AGAQLKNAIG WSRWL D F       +    +   NK D+SN  E K +    + F+L
Sbjct  621   GAGAQLKNAIGTWSRWLEDQF-------EPREDKSGRNKDDDSNNKE-KPESENFRLFHL  672

Query  2904  LNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNS  3083
             LN++ DLMMLP  ML  ++ RKEVCPT G  +I RVL  F+PDEF P  IP  + + LNS
Sbjct  673   LNSLGDLMMLPFKMLADKSTRKEVCPTLGPPIIKRVLRNFVPDEFNPHRIPRRLFDVLNS  732

Query  3084  EDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsd  3263
             E   E +   ++ FPC+A+P VY  PS  +          ++  L+ S SSV KK YTS+
Sbjct  733   EVSTEEDNGCIIIFPCAASPTVYLMPSVDS--IKRFIGELNNPSLSESGSSVFKKQYTSE  790

Query  3264  deldeldsPLN-LIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             DELD+LD+ +N ++    +  +      G G    VRYQLLRE+W
Sbjct  791   DELDDLDTSINSILSAPGTTNSSEWMPKGYGRRKTVRYQLLREIW  835


 Score = 95.9 bits (237),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 90/169 (53%), Gaps = 16/169 (9%)
 Frame = +3

Query  165  MVLGPSGKTRGVPSVQGEYLINIVEIKPWPPSQSLKTLKAVVIQWEHGDKNSGSTTQVAP  344
            MVLG   K+R    V  EYL++I E+KPWP SQ     + V+++WE+G+ NSGS   V  
Sbjct  1    MVLGLRTKSRKDNGVFVEYLVSIKELKPWPTSQV--PAQCVLLKWENGENNSGSFIAV--  56

Query  345  MLETESGVGNGRIEFNESFRVPITLLREISSKSVNGDTFQKNCIEFNLYEPRRDTTVKGQ  524
                   VG   I FNESFR+ +TL      K    + F KN +E ++Y+ ++       
Sbjct  57   -------VGKDTIMFNESFRLTLTL----EPKFGTDNKFHKNLLELHVYDAKKKDKGVKN  105

Query  525  -LLGTAVIDFANYGVVKEGLNVSVPINCKRSYRNTVQPLLCLKIQTVGK  668
             LLGTA ++ A++GV+   + V  P   K+S RN     + L ++  G+
Sbjct  106  KLLGTASVNLADFGVLTNSVPVGAPFTFKKSSRNDASSEIYLTVEPAGE  154



>ref|XP_010928485.1| PREDICTED: uncharacterized protein LOC105050237 isoform X4 [Elaeis 
guineensis]
Length=572

 Score =   417 bits (1071),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 213/398 (54%), Positives = 268/398 (67%), Gaps = 26/398 (7%)
 Frame = +3

Query  1815  RKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENS  1994
             +K  E+EQ+I+ LE ELRE AA+EI L+SVV EHGSS +KVH PARRLSRLY HACK  S
Sbjct  181   QKISEMEQRIEKLEEELREVAALEISLYSVVPEHGSSAHKVHTPARRLSRLYIHACKHWS  240

Query  1995  VLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL---PLSSE  2165
               +R + A++ VSGL L+AK+CGNDVPRLTFWLSN V+LR  I +      L    + S 
Sbjct  241   QDKRATVAKNTVSGLALIAKSCGNDVPRLTFWLSNTVVLREIISQTFGNMSLLNPTMRSF  300

Query  2166  YSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTF------EDWENPLGFTKALEKVEAW  2327
              S     K E K +PLKW     + + GN L   F      +DW+     T ALEK+E+W
Sbjct  301   ESNGGAKKTEGKLTPLKW-----RNNAGNRLAKVFGFMQQIDDWQETSTLTAALEKIESW  355

Query  2328  IFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSC--SEEPENFSLELWKKAFR  2501
             IF+RI+ES+WWQT TPHMQS       +   K Y R        ++  +FS  LWK AF 
Sbjct  356   IFARIVESVWWQTLTPHMQSPVEEMYTA---KGYGRLLGPALGDQQQGSFSSNLWKSAFH  412

Query  2502  DAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPIS  2681
             DA+ R+CPVRAGGHECGCL +L++++++QCV+RLDVAMFNAILRESA++IPTDPVSDPI 
Sbjct  413   DAFTRLCPVRAGGHECGCLPVLARMVIEQCVSRLDVAMFNAILRESANEIPTDPVSDPIV  472

Query  2682  NPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGH  2861
             +P+VLPIPAG  SF +GAQLKN+IGNWSRWL  LFGI               +  + +G 
Sbjct  473   DPKVLPIPAGDLSFGSGAQLKNSIGNWSRWLTGLFGI------YADDSIKYGQLADEDGD  526

Query  2862  ERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEV  2975
              R+     SK F LLN +SDL+MLPKDMLL R++RKE+
Sbjct  527   RREGAPE-SKSFCLLNELSDLLMLPKDMLLERSIRKEI  563



>emb|CDX79881.1| BnaA05g02750D [Brassica napus]
Length=565

 Score =   416 bits (1068),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 243/527 (46%), Positives = 329/527 (62%), Gaps = 68/527 (13%)
 Frame = +3

Query  1818  KCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV  1997
             K + LE++I+ LE ELRE AA+EI L+SVV +H SS++K+H PARRLSR+Y HACK  + 
Sbjct  107   KIEHLEKRIERLEEELREVAALEISLYSVVPDHSSSSHKLHTPARRLSRIYIHACKHFTR  166

Query  1998  LRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKN  2177
              +R S AR+ VSGL+LVA++CGNDV RLTFWLSN + LR  I +   K      S  SK 
Sbjct  167   GKRASIARNSVSGLVLVARSCGNDVSRLTFWLSNIISLRDIISQAFGKSHHTSESNGSKK  226

Query  2178  AVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIW  2357
                                       L    EDW+    FT +LE +E W+FSRI+ES+W
Sbjct  227   G-------------------------LQQLLEDWQETETFTTSLETIEQWVFSRIVESVW  261

Query  2358  WQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAG  2537
             WQ FTP+MQS                T S+ SE+  +FS  LW  AFR+A +R+CPVR  
Sbjct  262   WQVFTPYMQS----------------TESNSSEKQGSFSTSLWNNAFREALQRLCPVRGA  305

Query  2538  GHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKA  2717
             GHECGCL +L++++M++C++R DVAMFNAILRES   IPTDPVSDPI + +VLPIPAG+ 
Sbjct  306   GHECGCLPVLARMVMEKCISRFDVAMFNAILRESEHQIPTDPVSDPILDSKVLPIPAGEL  365

Query  2718  SFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPF  2897
             SF +GAQLKNAIGNWSR L ++FG++ +D+DDD   + + KA                 F
Sbjct  366   SFGSGAQLKNAIGNWSRCLTEMFGMNSEDDDDDDHVESDGKA-----------------F  408

Query  2898  YLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEAL  3077
              LLN +SDL+MLPKDML   ++R+E+CP+  L LI R+L  F PDEFCPD +P  VLE L
Sbjct  409   VLLNELSDLLMLPKDMLTESSIREEICPSITLPLIKRILCNFTPDEFCPDHVPGAVLEEL  468

Query  3078  NSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYT  3257
             NS +    E     +FP +A+ + Y PPS      +   ++  + +++R+ S +  + YT
Sbjct  469   NSAESNGDETLPEESFPYAASSVSYTPPSTM---KLGEKVAELAGKMSRNVSMIQSRGYT  525

Query  3258  sddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVWM  3398
             SD+EL+ELDSPL  I  ++S+VT     +        RY+LLR+VW+
Sbjct  526   SDEELEELDSPLTSIVDKSSDVTDSFTSNE-------RYKLLRQVWV  565



>gb|EPS74447.1| hypothetical protein M569_00306, partial [Genlisea aurea]
Length=461

 Score =   411 bits (1056),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 214/459 (47%), Positives = 299/459 (65%), Gaps = 49/459 (11%)
 Frame = +3

Query  1812  ERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKEN  1991
             + + +E+E +I+ LE ELR+ AA+EI L+SVV +HG+S  KVHAPAR LSRLY HAC++ 
Sbjct  7     DERIEEMETRIENLESELRQVAALEIALYSVVPDHGTSAYKVHAPARHLSRLYIHACEKW  66

Query  1992  SVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSEKQQL---PLSS  2162
             S  ++ S AR+ V+GLILV+K+CGNDV RLTFWLSN V+ R  + +  E   L   P++ 
Sbjct  67    SPEKQASVARNTVAGLILVSKSCGNDVSRLTFWLSNAVVFREIVSQAIENSSLLPSPVNP  126

Query  2163  EYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRI  2342
             + + N V +  ++   L+                + +DW+     T ALEKVE+WIF R+
Sbjct  127   KGNANGVKEESKQLGVLQ----------------SADDWQEKWTLTAALEKVESWIFYRV  170

Query  2343  IESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERIC  2522
             +ESIWWQT TP+MQ             I +R +    +E  NFS++ WK AF DA +R+C
Sbjct  171   VESIWWQTLTPNMQGPP----------IGERLAVGDKKE-GNFSIDSWKNAFHDALKRLC  219

Query  2523  PVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPI  2702
             PVRAGGHECGCL +++K +++QC+ RLDVAMFNAILRESA ++PTDPVSDPI +  VLPI
Sbjct  220   PVRAGGHECGCLPVIAKKVLEQCIGRLDVAMFNAILRESAHEMPTDPVSDPIVDSRVLPI  279

Query  2703  PAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNGHERKAQDA  2882
             PAG  SF +GAQLK ++G+WSRWL+D                  ++   ++G E++ ++ 
Sbjct  280   PAGDLSFRSGAQLKYSVGSWSRWLSD--------------AVLGSEETKTDGLEKETKE-  324

Query  2883  CSKPFY-LLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPN  3059
               K F+ LLN +SDL+MLPKD++L   +R EVCP+  + L+ R+L  F PDEF PD +P 
Sbjct  325   -RKTFFPLLNELSDLLMLPKDLILDSKIRMEVCPSISVELVKRILCNFSPDEFSPDHVPG  383

Query  3060  VVLEALNSEDHMEVEEESVVNFPCSAAPIVYA--PPSAA  3170
              VLEALN E H      + ++FP SA+P+VY   PPS++
Sbjct  384   AVLEALNYECHNANNGINSISFPYSASPVVYMTPPPSSS  422



>ref|XP_002865440.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41699.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   417 bits (1071),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 287/695 (41%), Positives = 384/695 (55%), Gaps = 97/695 (14%)
 Frame = +3

Query  1344  TLSNGIQEDARTGVSDNGLAEGENTEGHQGNTQELVTERDKHQETGEGKELIIEKGQCSE  1523
             TL +   E A     +N L E E     Q N Q ++   +  Q+  E       K Q SE
Sbjct  13    TLKHSNNEAALVSEIENLLREEERK--RQSN-QPVIVSSEIDQKQKEDTNTFQLKKQFSE  69

Query  1524  GEPVNSCLQDNTTKQHLEGNSAIIA-GRESVGAKTTCDERLNHVSSVHTLGESNRANGSV  1700
                    L  +  K+ ++  +  +A GR+++G +     RL  + S+    + N+ + S 
Sbjct  70    IRSGPVSLPPDAAKKQMKLRTNTLALGRKTLGMEGI--PRLKQLKSIQLHFDGNKDDSSQ  127

Query  1701  RSNQFVLRDKRNSIEGITSNDWKDTKVRSKETSNVVLERKCQELEQKIQMLEGELREAAA  1880
             +    V+    N +  IT  D                         K + LE EL+EAA 
Sbjct  128   KKANGVI----NKVGLITPQD------------------------SKTETLEDELKEAAV  159

Query  1881  VEIGLFSVVAEHGSSTNKVHAPARRLSRLYFHACKENSV--LRRLSAARSVVSGLILVAK  2054
             +E  ++SVVAEH SS +KVHAPARRL+R Y HACK N     +R SAAR+ VSGLILV+K
Sbjct  160   LEAAVYSVVAEHSSSMSKVHAPARRLARFYLHACKGNGSDQSKRASAARAAVSGLILVSK  219

Query  2055  ACGNDVPRLTFWLSNCVLLRAAICKFSEKQQLPLSSEYSKNAVVKNERKASPLKWQSFPH  2234
             ACGNDVPRLTFWLSN ++LRA + +  EK ++                          P 
Sbjct  220   ACGNDVPRLTFWLSNSIVLRAILSRGMEKMKI-------------------------VPE  254

Query  2235  KKSVGNDLPGTFEDWENPLGFTKALEKVEAWIFSRIIESIWWQTFTPHMQS----GAATS  2402
             K   G+D      +WE+P  F  ALEK E+WIFSR+++S+WWQ+ TPHMQS    G+ + 
Sbjct  255   K--AGSD------EWEDPRAFLAALEKFESWIFSRVVKSVWWQSMTPHMQSPAVKGSISR  306

Query  2403  LDSEINKIYQRTSSSCSEEPENFSLELWKKAFRDAYERICPVRAGGHECGCLHLLSKLIM  2582
               S   ++  RT          +++ELWK AFR A ER+CP+R    ECGCL +L+KL+M
Sbjct  307   KVSGKRRLGHRTQGL-------YAIELWKNAFRAACERLCPLRGLRQECGCLPMLAKLVM  359

Query  2583  QQCVARLDVAMFNAILRESADDIPTDPVSDPISNPEVLPIPAGKASFAAGAQLKNAIGNW  2762
             +Q ++RLDVAMFNAILRESA ++PTDPVSDP+S+  VLPIPAGKASF AGAQLKNAIG W
Sbjct  360   EQLISRLDVAMFNAILRESAGEMPTDPVSDPVSDINVLPIPAGKASFGAGAQLKNAIGTW  419

Query  2763  SRWLADLFGIddddedddlveddeNKADNSNGHERKAQDACSKPFYLLNAMSDLMMLPKD  2942
             SRWL D F       +    +   NK D  N ++ K +    + F+LLN++ DLMMLP  
Sbjct  420   SRWLEDQF-------EQREDKSRRNK-DEDNNNKEKPECEHFRLFHLLNSLGDLMMLPFK  471

Query  2943  MLLSRTVRKEVCPTFGLSLITRVLNVFIPDEFCPDPIPNVVLEALNSEDHMEVEEESVVN  3122
             ML  ++ RKEVCPT G  +I RVL  F+PDEF P  IP  + + LNSE   E +   +  
Sbjct  472   MLADKSTRKEVCPTLGPPIIKRVLRNFVPDEFNPHRIPRRLFDVLNSEVLTEEDTGCITV  531

Query  3123  FPCSAAPIVYAPPSAAAldgilgdisssssqltrsrssVLKKSYTsddeldeldsPLNLI  3302
             FP +A+P +Y  PS  +          ++  L+ + SSV KK YTSDDELD+LD+ +N I
Sbjct  532   FPSAASPTIYLMPSTDS--IKRFIGELNNPSLSETGSSVFKKQYTSDDELDDLDTSINSI  589

Query  3303  ----KMENSEVTKPgggsgngngngVRYQLLREVW  3395
                    NS    P    G G    VRYQLLRE+W
Sbjct  590   FSAPGTTNSSEWMP---KGYGRRKTVRYQLLREIW  621



>emb|CDY14825.1| BnaC04g48220D [Brassica napus]
Length=613

 Score =   415 bits (1067),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 272/659 (41%), Positives = 381/659 (58%), Gaps = 74/659 (11%)
 Frame = +3

Query  1425  HQGNTQELVTERDKHQETGEGKELIIEKGQCSEGEPVNSCLQDNTTKQHLEGNSAIIAGR  1604
              + N+Q+ V+E++KH+E  E   L              +   D+TT+      S      
Sbjct  26    QKTNSQKKVSEQEKHKEALESNNL-------------TTVASDSTTQ------SDPSEAY  66

Query  1605  ESVGAKTTCDERLNHVSSVHTLGESNRANGSVRS-NQFVLRDKRN-SIEGITSNDWKDTK  1778
             E+V  +   D  +                  V+  N  V  D  N ++   + N+  D  
Sbjct  67    ETVDVRYLDDVTVRKEKEDADADADGDEQEEVKGVNADVWEDASNGALSAGSENEAPDAT  126

Query  1779  VRSKETSNVVLERKCQELEQKIQMLEGELREAAAVEIGLFSVVAEHGSSTNKVHAPARRL  1958
                ++ S   L+ K + LE +I+ LE ELRE AA+E+ L+SVV +H SS +K+H PARR+
Sbjct  127   DSIEDGS---LKEKIEFLETRIERLEEELREVAALEVSLYSVVPDHSSSAHKLHTPARRI  183

Query  1959  SRLYFHACKENSVLRRLSAARSVVSGLILVAKACGNDVPRLTFWLSNCVLLRAAICKFSE  2138
             SR+Y HACK  +  +R + AR+ VSGL+LVA++CGNDV RLTFWLSN + LR  I K   
Sbjct  184   SRIYIHACKHFARGKRATIARNSVSGLVLVARSCGNDVSRLTFWLSNIITLREIISKAFG  243

Query  2139  KQQLPLSSEYSKNAVVKNERKASPLKWQSFPHKKSVGNDLPGTFEDWENPLGFTKALEKV  2318
             K ++  SSE + +    +  K + L+W+         N L    EDW+    FT ALEKV
Sbjct  244   KSRVTESSEGNGSENGGDSGKKTNLRWK---------NGLQELLEDWQETETFTTALEKV  294

Query  2319  EAWIFSRIIESIWWQTFTPHMQSGAATSLDSEINKIYQRTSSSCSEEPENFSLELWKKAF  2498
             E W+FSRI+ES+WWQ FTPHMQS           +    ++S  +E+   FS+ LWK AF
Sbjct  295   ELWVFSRIVESVWWQVFTPHMQSP----------ENNNSSASKSNEKQGAFSISLWKNAF  344

Query  2499  RDAYERICPVRAGGHECGCLHLLSKLIMQQCVARLDVAMFNAILRESADDIPTDPVSDPI  2678
              DA +R+CP+R GGHECGCL +L++++M++CV R DVAMFNAILRES   IPTDPVSDPI
Sbjct  345   GDALQRLCPMRGGGHECGCLPVLARMVMEKCVGRFDVAMFNAILRESEHQIPTDPVSDPI  404

Query  2679  SNPEVLPIPAGKASFAAGAQLKNAIGNWSRWLADLFGIddddedddlveddeNKADNSNG  2858
              + +VLP+PAG  SF +GAQLKNAIGNWSR L ++FG+                 ++ + 
Sbjct  405   LDTKVLPVPAGDLSFGSGAQLKNAIGNWSRCLTEMFGM-----------------NSDDD  447

Query  2859  HERKAQDACSKPFYLLNAMSDLMMLPKDMLLSRTVRKEVCPTFGLSLITRVLNVFIPDEF  3038
             H        SK F LLN +SDL+MLPKDML+  ++R+E+C +  LSLI R+L  F PDEF
Sbjct  448   HVESEGGDSSKAFLLLNELSDLLMLPKDMLMESSIREEICSSITLSLIKRILCNFTPDEF  507

Query  3039  CPDPIPNVVLEALNSEDHMEVEEESVVNFPCSAAPIVYAPPSAAAldgilgdisssssql  3218
             CPD +P  VLE LN+    EV+ E   +FP +A+ + Y PPS      +   ++ ++ +L
Sbjct  508   CPDDVPGAVLEELNA---AEVQSEE-ASFPYAASSVTYKPPST---MDVAEKVAEAAGKL  560

Query  3219  trsrssVLKKSYTsddeldeldsPLNLIKMENSEVTKPgggsgngngngVRYQLLREVW  3395
             +R+ S + +K YTSD+EL+ELDSPL  I  + SE             +  RY LLR+VW
Sbjct  561   SRNVSMIQRKGYTSDEELEELDSPLTSIVDKTSEFND-------SATSNARYNLLRQVW  612



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12225807624380