BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20961_g1_i2 len=819 path=[2773:0-149 1649:150-176 1676:177-343
1843:344-388 1887:389-432 138:433-461 1958:462-525 227:526-549
251:550-613 315:614-748 517:749-818]

Length=819
                                                                      Score     E

ref|XP_008392920.1|  PREDICTED: putative F-box protein At1g67623      86.7    1e-16   
ref|XP_008392951.1|  PREDICTED: putative F-box protein At1g67623      82.8    2e-15   
gb|EYU24957.1|  hypothetical protein MIMGU_mgv1a012932mg              77.4    1e-13   
ref|XP_010102219.1|  hypothetical protein L484_024500                 77.4    5e-13   
gb|EYU29468.1|  hypothetical protein MIMGU_mgv1a023471mg              75.5    7e-13   
gb|EYU26998.1|  hypothetical protein MIMGU_mgv1a013775mg              73.9    2e-12   
ref|XP_009758974.1|  PREDICTED: putative F-box protein At1g67623      74.3    2e-12   
ref|XP_009594016.1|  PREDICTED: F-box protein At2g35280-like isof...  71.6    2e-12   
gb|EYU29471.1|  hypothetical protein MIMGU_mgv1a025262mg              73.9    2e-12   
ref|XP_002514995.1|  conserved hypothetical protein                   72.8    2e-12   Ricinus communis
ref|XP_007223930.1|  hypothetical protein PRUPE_ppa011068mg           72.4    6e-12   
ref|XP_010026170.1|  PREDICTED: F-box protein At1g67340-like          72.0    9e-12   
gb|KDO65488.1|  hypothetical protein CISIN_1g038912mg                 71.2    1e-11   
ref|XP_008223161.1|  PREDICTED: putative F-box protein At1g67623      71.6    2e-11   
ref|XP_008246000.1|  PREDICTED: putative F-box protein At1g67623      71.2    2e-11   
gb|KCW58612.1|  hypothetical protein EUGRSUZ_H01273                   68.2    4e-11   
ref|XP_007038386.1|  F-box family protein, putative                   70.5    8e-11   
emb|CDP19436.1|  unnamed protein product                              68.6    1e-10   
ref|XP_009594015.1|  PREDICTED: uncharacterized protein LOC104090...  68.9    2e-10   
ref|XP_006357910.1|  PREDICTED: uncharacterized protein LOC102585858  68.6    2e-10   
emb|CDP11207.1|  unnamed protein product                              67.0    3e-10   
emb|CDP13051.1|  unnamed protein product                              67.8    3e-10   
ref|XP_011075640.1|  PREDICTED: uncharacterized protein LOC105160074  67.8    4e-10   
emb|CAN71689.1|  hypothetical protein VITISV_039291                   67.0    7e-10   Vitis vinifera
ref|XP_010656578.1|  PREDICTED: putative F-box protein At1g67623      66.6    9e-10   
ref|XP_009602865.1|  PREDICTED: putative F-box protein At1g67623      66.2    2e-09   
emb|CDP05332.1|  unnamed protein product                              65.9    2e-09   
ref|XP_006369824.1|  hypothetical protein POPTR_0001s32860g           63.5    5e-09   
ref|XP_010110206.1|  hypothetical protein L484_009811                 64.3    9e-09   
ref|XP_006421666.1|  hypothetical protein CICLE_v10006753mg           62.8    1e-08   
ref|XP_006438107.1|  hypothetical protein CICLE_v10033456mg           62.0    2e-08   
emb|CDP07942.1|  unnamed protein product                              60.1    5e-08   
gb|ACR36762.1|  unknown                                               60.1    5e-08   Zea mays [maize]
ref|XP_004166031.1|  PREDICTED: putative F-box protein At1g67623-...  62.0    6e-08   
ref|XP_004137554.1|  PREDICTED: putative F-box protein At1g67623-...  62.0    7e-08   
emb|CDP20768.1|  unnamed protein product                              61.2    7e-08   
ref|XP_002318952.1|  F-box family protein                             61.2    8e-08   Populus trichocarpa [western balsam poplar]
gb|KHN18407.1|  Putative F-box protein                                61.2    8e-08   
ref|XP_010669037.1|  PREDICTED: putative F-box protein At1g67623      60.5    9e-08   
ref|NP_001141028.1|  hypothetical protein                             60.1    2e-07   Zea mays [maize]
ref|XP_011023775.1|  PREDICTED: putative F-box protein At1g67623      59.7    3e-07   
ref|XP_004508629.1|  PREDICTED: putative F-box protein At1g67623-...  59.7    3e-07   
ref|XP_007026049.1|  F-box family protein                             59.7    3e-07   
ref|XP_006390380.1|  hypothetical protein EUTSA_v10019573mg           59.7    3e-07   
ref|XP_007158314.1|  hypothetical protein PHAVU_002G142400g           58.2    7e-07   
ref|XP_006484338.1|  PREDICTED: putative F-box protein At1g67623-...  58.5    1e-06   
ref|XP_010668259.1|  PREDICTED: putative F-box protein At1g67623      57.8    1e-06   
ref|XP_010682301.1|  PREDICTED: putative F-box protein At1g67623      57.8    2e-06   
ref|XP_008453691.1|  PREDICTED: putative F-box protein At1g67623      57.8    2e-06   
ref|XP_010109211.1|  hypothetical protein L484_011832                 54.7    2e-06   
ref|XP_008672405.1|  PREDICTED: hypothetical protein isoform X1       58.2    2e-06   
ref|XP_007155183.1|  hypothetical protein PHAVU_003G180500g           57.0    3e-06   
ref|XP_007012042.1|  F-box family protein                             57.4    3e-06   
ref|XP_002458999.1|  hypothetical protein SORBIDRAFT_03g044140        57.4    4e-06   Sorghum bicolor [broomcorn]
ref|XP_010242755.1|  PREDICTED: putative F-box protein At1g67623      55.8    6e-06   
ref|XP_011085125.1|  PREDICTED: putative F-box protein At1g67623      55.5    7e-06   
ref|XP_010684458.1|  PREDICTED: F-box protein At2g35280-like          55.8    9e-06   
ref|XP_010667999.1|  PREDICTED: putative F-box protein At1g67623      55.5    9e-06   
ref|XP_004971088.1|  PREDICTED: F-box protein At1g67340-like          56.2    9e-06   
ref|XP_009403599.1|  PREDICTED: F-box protein At1g67340-like          56.2    1e-05   
ref|XP_003613186.1|  F-box protein                                    55.1    2e-05   
ref|XP_006646623.1|  PREDICTED: F-box protein At1g67340-like          55.1    2e-05   
ref|XP_010668136.1|  PREDICTED: F-box protein At2g35280-like          54.7    2e-05   
emb|CDM85592.1|  unnamed protein product                              55.1    2e-05   
ref|XP_006584029.1|  PREDICTED: putative F-box protein At1g67623-...  53.9    3e-05   
dbj|BAJ85831.1|  predicted protein                                    54.3    4e-05   
ref|XP_004239208.1|  PREDICTED: F-box protein At1g67340               54.3    4e-05   
ref|XP_008656929.1|  PREDICTED: F-box protein At1g67340               54.3    4e-05   
dbj|BAB86182.1|  OJ1485_B09.11                                        53.5    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567414.1|  PREDICTED: F-box protein At1g67340-like          53.5    7e-05   
ref|XP_003609669.1|  F-box protein                                    53.1    7e-05   
ref|NP_001045230.2|  Os01g0921800                                     53.1    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003638510.1|  F-box protein                                    52.8    1e-04   
gb|EAY77017.1|  hypothetical protein OsI_04973                        53.1    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_009413567.1|  PREDICTED: F-box protein At1g67340-like          52.4    2e-04   
emb|CDY12640.1|  BnaA02g13080D                                        51.6    3e-04   
ref|XP_009127548.1|  PREDICTED: F-box protein At1g67340-like          51.6    3e-04   
ref|XP_004508220.1|  PREDICTED: putative F-box protein At1g67623-...  50.8    4e-04   
ref|XP_006601395.1|  PREDICTED: putative F-box protein At1g67623-...  50.4    6e-04   
ref|XP_009416578.1|  PREDICTED: F-box protein At1g67340-like          50.8    6e-04   
ref|XP_004508221.1|  PREDICTED: putative F-box protein At1g67623-...  50.1    6e-04   
ref|XP_007163763.1|  hypothetical protein PHAVU_001G2619001g          50.4    8e-04   
ref|XP_008446037.1|  PREDICTED: F-box protein At1g67340               50.4    8e-04   
gb|KHN24065.1|  F-box protein                                         49.3    0.001   



>ref|XP_008392920.1| PREDICTED: putative F-box protein At1g67623 [Malus domestica]
 ref|XP_008387082.1| PREDICTED: putative F-box protein At1g67623 [Malus domestica]
 ref|XP_008340936.1| PREDICTED: putative F-box protein At1g67623 [Malus domestica]
Length=268

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 5/104 (5%)
 Frame = -3

Query  730  SIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKP  551
            SI SLP E++V++LARV++ S+DDL +A+LSC+ +NE   DD +++H+  +KFP+V W+ 
Sbjct  31   SIQSLPNEVLVQVLARVASRSFDDLYSAKLSCKNFNESAQDDHIFEHVDISKFPLVSWRA  90

Query  550  EIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPESPTNI  419
                   KR  F  +C D  N EALY +G+ +  +++   P  I
Sbjct  91   -----SEKRTRFLKRCRDLGNAEALYRQGMCDLFTSKRIEPAGI  129



>ref|XP_008392951.1| PREDICTED: putative F-box protein At1g67623 [Malus domestica]
Length=270

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 5/105 (5%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            SSI SLP E++V++LA+V++ S+DDL +A LSC+ +NE   DD +++H+  +KFP+V W+
Sbjct  32   SSIQSLPNEVLVQVLAKVASRSFDDLYSAMLSCKDFNESAQDDHIFEHVDISKFPLVSWR  91

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPESPTNI  419
                    K   F  +C D  N EALY +G+ +  +++   P  +
Sbjct  92   A-----SEKHTRFLMRCRDLGNSEALYRQGMRDLFTSKRIEPAGV  131



>gb|EYU24957.1| hypothetical protein MIMGU_mgv1a012932mg [Erythranthe guttata]
Length=235

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -3

Query  775  RRTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVY  596
            R  ++ K     V S   S+P ELV E+L+RV++ S  D+ NA+LSC+  NE+  D  VY
Sbjct  3    RNPNNKKRNTKAVSSMFDSIPHELVSEVLSRVASSSIKDIFNAKLSCKMLNEIAEDMYVY  62

Query  595  KHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            +H+S  + PI+ WKP  +E    +  F   C+ +EN E+LY + +
Sbjct  63   QHVSLDEVPIIPWKPISQE----QVTFLNTCLQSENPESLYRQAV  103



>ref|XP_010102219.1| hypothetical protein L484_024500 [Morus notabilis]
 gb|EXB93162.1| hypothetical protein L484_024500 [Morus notabilis]
Length=363

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 65/105 (62%), Gaps = 3/105 (3%)
 Frame = -3

Query  751  INNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKF  572
            +  V PS I  LP++L+VEILARV+A S  D   A+LSC+R+ EL  DD +Y+H+S  ++
Sbjct  37   VQTVSPSPILCLPKDLMVEILARVAACSRTDFFRAKLSCKRFYELSDDDYIYRHMSLHEY  96

Query  571  PIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRP  437
             I     +++  ++    FF +C+   NL+A+Y +G+ +  +  P
Sbjct  97   LITFALFKLDNREQS---FFDRCLKCGNLDAMYREGVRSAKALPP  138



>gb|EYU29468.1| hypothetical protein MIMGU_mgv1a023471mg [Erythranthe guttata]
Length=235

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 4/93 (4%)
 Frame = -3

Query  739  VPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQ  560
            V S   S+P ELV E+L+RV++ S  D+ NA+LSC+  NE+  D  VY+ +S  + PI+ 
Sbjct  15   VSSMFDSIPHELVSEVLSRVASSSIKDIFNAKLSCKMLNEIAEDTYVYQRVSLDEVPIIP  74

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            WKP  +E    +  F  +C+ +EN E+LY + +
Sbjct  75   WKPISQE----QVTFLNRCLQSENPESLYRQAV  103



>gb|EYU26998.1| hypothetical protein MIMGU_mgv1a013775mg [Erythranthe guttata]
Length=211

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = -3

Query  739  VPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQ  560
            V S   S+P ELV E+L+RV++ S  D+ NA+LSC+  NE+  D  VY+ +S  + PI+ 
Sbjct  15   VSSMFDSIPHELVSEVLSRVASSSIKDIFNAKLSCKMLNEIAKDMYVYQRVSLDEVPIIP  74

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            WKP  +E +     F   C+ +EN E+LY + +
Sbjct  75   WKPISQEQET----FLNTCLQSENPESLYRQAV  103



>ref|XP_009758974.1| PREDICTED: putative F-box protein At1g67623 [Nicotiana sylvestris]
Length=252

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-VQW  557
            S+I SLP EL+ E++ARV++ S+ D +N +LSC+ +N +  D  +Y+H+S  +FP+   W
Sbjct  20   SNIKSLPNELLSEVIARVASFSFTDYINVKLSCKIFNGVSNDRYIYRHMSMEEFPLGPSW  79

Query  556  KPEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPESPT  425
            K + EE ++K  LF   C ++ N EALY KG+ +    R E PT
Sbjct  80   KRDKEEKEKKLSLFMRMCTESGNAEALYRKGVVD--FFRKERPT  121



>ref|XP_009594016.1| PREDICTED: F-box protein At2g35280-like isoform X2 [Nicotiana 
tomentosiformis]
Length=122

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-VQW  557
            S+I SLP EL+ E++ARV++ S+ D +N +LSC+ +N +  D  +Y H+S  +FP+   W
Sbjct  30   SNIKSLPNELLSEVIARVASSSFTDYINVKLSCKIFNGVSNDQYIYHHMSMEEFPLGPPW  89

Query  556  KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            K + EE ++K  LF   C +  N EALY KG+
Sbjct  90   KRDKEEKEKKVSLFMRMCRENGNAEALYRKGV  121



>gb|EYU29471.1| hypothetical protein MIMGU_mgv1a025262mg [Erythranthe guttata]
Length=235

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 56/93 (60%), Gaps = 4/93 (4%)
 Frame = -3

Query  739  VPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQ  560
            V S   S+P ELV E+L+RV++ S  D+ NA+LSC+  NE+  D  VY+ +S  + PI+ 
Sbjct  15   VSSMFDSIPHELVSEVLSRVASSSIKDIFNAKLSCKMLNEIAEDTYVYQRVSLEEVPIIP  74

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            WKP  +E    +  F   C+ +EN E LY + +
Sbjct  75   WKPISQE----QVTFLNTCLQSENPECLYRQAV  103



>ref|XP_002514995.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47549.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            +  +P+EL+ EILARV++ S+ D  NA+ +C+ + E   DD ++KH S   FP++ WK  
Sbjct  22   LSCMPRELLTEILARVASESFTDFFNAKTTCKEFLEAASDDYIFKHASIDCFPVIPWKIT  81

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPESPTNISPGCNRENNGKRL  380
             + +      F  KC  +EN E+L+ +G+ +  ST  E  + +       N G R+
Sbjct  82   DDAST-----FLDKCKKSENPESLFRQGMIDYFSTTLEKNSGLDYLKRATNKGHRV  132



>ref|XP_007223930.1| hypothetical protein PRUPE_ppa011068mg [Prunus persica]
 gb|EMJ25129.1| hypothetical protein PRUPE_ppa011068mg [Prunus persica]
Length=225

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            + SLP+EL+VE+LA+V+++S++DL +A+LSC+ +N++  +D +++ +  +KFP+V W+ +
Sbjct  20   MQSLPKELLVEVLAKVASNSFNDLYSAKLSCKDFNKMAEEDYIFQCIDISKFPLVSWRFD  79

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
             + +K     F   C    N EALY +GL +
Sbjct  80   DKFSK-----FLKHCKKCGNAEALYRQGLRD  105



>ref|XP_010026170.1| PREDICTED: F-box protein At1g67340-like [Eucalyptus grandis]
Length=224

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = -3

Query  730  SIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFP-IVQWK  554
            S   LP+++V+E+LA V+A+S DD  NA++SC+ +NEL  ++ VY+ +S  K   I+ W 
Sbjct  5    SFDVLPRDMVLEVLASVAANSMDDFFNAKISCKTFNELAEENYVYRQISLDKISRILWWH  64

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            P  EE K     F  +CI  +NLEALY +GL
Sbjct  65   P--EEGKA----FIERCIKCDNLEALYTQGL  89



>gb|KDO65488.1| hypothetical protein CISIN_1g038912mg, partial [Citrus sinensis]
Length=199

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -3

Query  730  SIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKP  551
            SI SLP EL+ EILARV A S DDLLNA LSC+ +NE+  D  V +  S  K P + W  
Sbjct  6    SIFSLPDELLSEILARVGACSLDDLLNAGLSCKLFNEITFDKYVLRQASIEKIPAMPW--  63

Query  550  EIEENKRKRCLFFYKCIDAENLEALYGKGL  461
                   K   F  KC D+ N EALY +G+
Sbjct  64   ------HKNYSFLEKCRDSGNPEALYKQGV  87



>ref|XP_008223161.1| PREDICTED: putative F-box protein At1g67623 [Prunus mume]
Length=254

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            + SLP EL+VE+LA+V+++S++DL +A+LSC+ +N++  +D +++ +  +KFP+V W+ +
Sbjct  20   MQSLPNELLVEVLAKVASNSFNDLYSAKLSCKDFNKMAKEDNIFQRVDMSKFPLVSWRFD  79

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
             + +K     F   C    N EALY +GL +
Sbjct  80   DKFSK-----FLKHCKRCGNEEALYRQGLRD  105



>ref|XP_008246000.1| PREDICTED: putative F-box protein At1g67623 [Prunus mume]
Length=254

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            + SLP EL+VE+LA+V+++S++DL +A+LSC+ +N++  +D +++ +  +KFP+V W+ +
Sbjct  20   MQSLPNELLVEVLAKVASNSFNDLYSAKLSCKDFNKMAKEDNIFQRVDMSKFPLVSWRFD  79

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
             + +K     F   C    N EALY +GL +
Sbjct  80   DKFSK-----FLKHCKRCGNEEALYRQGLRD  105



>gb|KCW58612.1| hypothetical protein EUGRSUZ_H01273 [Eucalyptus grandis]
Length=109

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 7/87 (8%)
 Frame = -3

Query  718  LPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAK-FPIVQWKPEIE  542
            LP+++ +E+LA V+A+S DD  NA++SC+ +NEL   D VY+ +S  K   I+ W P  E
Sbjct  9    LPRDMALEVLALVAANSMDDFFNAKISCKIFNELAEADYVYRQISLDKILRILWWHP--E  66

Query  541  ENKRKRCLFFYKCIDAENLEALYGKGL  461
            E K     F  +CI   NLEALY +GL
Sbjct  67   EGKA----FIERCIKCNNLEALYTQGL  89



>ref|XP_007038386.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY22887.1| F-box family protein, putative [Theobroma cacao]
Length=292

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHA  578
            K+  N+ P+ I SLP EL+ E+LARV+A+S+ D  + +LSC+ ++++  D  + +H+S  
Sbjct  70   KSKTNLFPN-IFSLPNELMTEVLARVAAYSFHDFFDVKLSCKVFHQIADDKYILQHVSLE  128

Query  577  KFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            KFP+  W         K+  F  KC  + + EALY +G+
Sbjct  129  KFPVTPW------CSTKQSFFLEKCKRSGHPEALYREGV  161



>emb|CDP19436.1| unnamed protein product [Coffea canephora]
Length=198

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            +SI SLP E++ E+LARV++ S  DL  A+L C+   E+   DIVY+ +S AKF IV W 
Sbjct  35   TSILSLPTEVLSEVLARVASSSSTDLFWAKLCCKLLYEVSDADIVYQRVSLAKFEIVPW-  93

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
                +   K   F  KC +++N EALY KG+ +
Sbjct  94   ----QKNHKVSSFLKKCRESKNPEALYRKGVVD  122



>ref|XP_009594015.1| PREDICTED: uncharacterized protein LOC104090588 isoform X1 [Nicotiana 
tomentosiformis]
Length=262

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-VQW  557
            S+I SLP EL+ E++ARV++ S+ D +N +LSC+ +N +  D  +Y H+S  +FP+   W
Sbjct  30   SNIKSLPNELLSEVIARVASSSFTDYINVKLSCKIFNGVSNDQYIYHHMSMEEFPLGPPW  89

Query  556  KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            K + EE ++K  LF   C +  N EALY KG+
Sbjct  90   KRDKEEKEKKVSLFMRMCRENGNAEALYRKGV  121



>ref|XP_006357910.1| PREDICTED: uncharacterized protein LOC102585858 [Solanum tuberosum]
Length=261

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = -3

Query  781  KMRRTDDAKTI-NNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDD  605
            K+R T + K I      S+I SLP EL+ EI+ARV++ S+ + +NA+LSC+ ++E+  + 
Sbjct  12   KIRGTRNNKLIMKENFSSAIESLPNELLTEIVARVASTSFQNYINAKLSCKVFHEVANER  71

Query  604  IVYKHLSHAKFPIV-QWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
             VY++ + A+F I   W+ E +E   K   F   C +  N EALY KG+ +
Sbjct  72   YVYQNATLAEFSIEPSWEKEKQEKINKVASFLELCRECGNTEALYRKGVMD  122



>emb|CDP11207.1| unnamed protein product [Coffea canephora]
Length=181

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            +SI SLP E++ E+LARV++ S  DL  A+L C+ +NE+     +Y+ +S  KF IV W 
Sbjct  11   TSILSLPTEVLFEVLARVASSSSTDLFRAKLCCKLFNEVSDAKNIYQRVSLDKFEIVPW-  69

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPE  434
                +   K   F  KC +++N EALY KG+ +  S + E
Sbjct  70   ----QKNHKVSSFLKKCRESKNSEALYRKGVVDFFSDKHE  105



>emb|CDP13051.1| unnamed protein product [Coffea canephora]
Length=231

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            +SI SLP+ELV E+LA V+A S  DL  A+L C+  +E+  ++ +Y+ +S  KF IV W+
Sbjct  11   TSISSLPRELVSEVLALVAASSSTDLFRAKLCCKVLSEVSEENYIYQRVSLNKFAIVPWR  70

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
                    K  +F  KC  ++N EALY KG+ +
Sbjct  71   -----KNHKVSMFLKKCRRSKNPEALYRKGVVD  98



>ref|XP_011075640.1| PREDICTED: uncharacterized protein LOC105160074 [Sesamum indicum]
Length=251

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 60/99 (61%), Gaps = 4/99 (4%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHA  578
            +++     S + ++P+EL++EIL R++  S+ D+ NA+LSC+ ++E   D  VY+++S  
Sbjct  32   RSVQATNSSMMDNIPRELLIEILCRLAHTSFTDIHNAKLSCKDFHEAAEDPCVYQNMSLD  91

Query  577  KFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
             FP+V WKP  E+ +     F  KC D +N E  Y + +
Sbjct  92   NFPLVAWKPLTEKEE----AFLTKCQDCQNPEIPYRQAV  126



>emb|CAN71689.1| hypothetical protein VITISV_039291 [Vitis vinifera]
Length=241

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 10/102 (10%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHA  578
            KT  N   S+I SL  +L++E+L RV++ S+ DL NA+LSCR + E   D  V K++S  
Sbjct  5    KTKRNSYGSTIESLSSDLLIEVLTRVASSSFTDLFNAKLSCRNFLEASKDTFVMKNISIE  64

Query  577  KFPIVQW---KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            KFP + W   K E+         F   C ++ N E LY +G+
Sbjct  65   KFPTIPWWQVKDEVSS-------FLKACKESGNPEVLYRQGM  99



>ref|XP_010656578.1| PREDICTED: putative F-box protein At1g67623 [Vitis vinifera]
Length=245

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 10/102 (10%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHA  578
            KT  N   S+I  LP +L++E+L RV+  S+ DL NA+LSCR + E   D  + K++S  
Sbjct  5    KTKRNSHGSTIEYLPSDLLIEVLTRVATSSFTDLFNAKLSCRNFLEASDDKFIMKNISIE  64

Query  577  KFPIVQW---KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            KFP + W   K E+         F   C ++ N EALY +G+
Sbjct  65   KFPAIPWWQVKDEVSS-------FLKACKESGNPEALYRQGM  99



>ref|XP_009602865.1| PREDICTED: putative F-box protein At1g67623 [Nicotiana tomentosiformis]
Length=261

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = -3

Query  772  RTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYK  593
            R ++  T      S+I SLP EL+ E++ARV++ S+   +N +LSC+ ++E+  +  VY+
Sbjct  15   RRNNKDTKEKFSSSNIESLPNELLTEVVARVASCSFKSYINIKLSCKVFHEIAKERYVYQ  74

Query  592  HLSHAKFPIV-QWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
            + + A FPI   W+   +E   K   F   C ++ N EALY KG+ +
Sbjct  75   NATMADFPIEPSWERNKQEKINKLTSFMELCRESGNTEALYRKGVMD  121



>emb|CDP05332.1| unnamed protein product [Coffea canephora]
Length=242

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 67/117 (57%), Gaps = 10/117 (9%)
 Frame = -3

Query  805  GLGHK*EWKMRRTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRW  626
            G+G K   ++R   +   +N    S + SLP ELV E+LARV++ S  DL  A+L    +
Sbjct  3    GVGSKAMKRIRNRGNRMLVN----SPMISLPPELVTEVLARVASSSATDLFTAKLR-HGF  57

Query  625  NELGCDDIVYKHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
            +++  +  VYK +S  KFP+V W      ++R+   FF KC  ++N EALY +G+ +
Sbjct  58   SQIAEESYVYKRVSLDKFPVVAW-----HHRRQIAAFFNKCKCSKNPEALYRQGVVD  109



>ref|XP_006369824.1| hypothetical protein POPTR_0001s32860g, partial [Populus trichocarpa]
 gb|ERP66393.1| hypothetical protein POPTR_0001s32860g, partial [Populus trichocarpa]
Length=186

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 6/98 (6%)
 Frame = -3

Query  721  SLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPEIE  542
            S P +L+ E LARV++ S+ DL  A+LSCR + E   +  +++H++  KFP++ W+    
Sbjct  4    SFPGDLLTEALARVASTSFSDLFTAKLSCREFLEAASEKYIFEHITIEKFPVIPWRI---  60

Query  541  ENKRKRCLFFYKCIDAENLEALYGKGLSN-GSSTRPES  431
             +    C F   C +  N EAL+ +G+    SS +PES
Sbjct  61   -SHSASC-FLDSCKENGNPEALFRQGMFEFFSSKKPES  96



>ref|XP_010110206.1| hypothetical protein L484_009811 [Morus notabilis]
 gb|EXC25503.1| hypothetical protein L484_009811 [Morus notabilis]
Length=269

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 9/104 (9%)
 Frame = -3

Query  760  AKTINNVVPSS----IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYK  593
            AK I+ V  ++    I SL  +LV+EILA VSA S  DL +A+LSC+ + ++  +D +Y+
Sbjct  22   AKKISKVPQAASSFPICSLLSDLVLEILACVSASSLRDLFSAKLSCKLFKKIAQEDYIYR  81

Query  592  HLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
             +S   F +V      E        FF +C++  NLEALY +GL
Sbjct  82   KISLDDFFVVDIYLNAEATS-----FFNRCLECGNLEALYQQGL  120



>ref|XP_006421666.1| hypothetical protein CICLE_v10006753mg, partial [Citrus clementina]
 gb|ESR34906.1| hypothetical protein CICLE_v10006753mg, partial [Citrus clementina]
Length=175

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 47/83 (57%), Gaps = 8/83 (10%)
 Frame = -3

Query  709  ELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPEIEENKR  530
            EL+ EILARV A S DDLLNA LSC+ +NE+  D  V +  S  K P + W         
Sbjct  1    ELLSEILARVGACSLDDLLNAGLSCKLFNEITFDKYVLRQASIEKIPAMPW--------H  52

Query  529  KRCLFFYKCIDAENLEALYGKGL  461
            K   F  KC D+ N EALY +G+
Sbjct  53   KNYSFLEKCRDSGNPEALYKQGV  75



>ref|XP_006438107.1| hypothetical protein CICLE_v10033456mg, partial [Citrus clementina]
 gb|ESR51347.1| hypothetical protein CICLE_v10033456mg, partial [Citrus clementina]
Length=175

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -3

Query  769  TDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKH  590
            T   +   N + +SI SLP  L+ E++A+V++ S  DL   +LSC+ + +   DD V++H
Sbjct  8    TKRTRKKRNKLGTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEH  67

Query  589  LSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
             S  KF +V W P  +   R   LF  +C  + N EALY +G+ N
Sbjct  68   ASLDKFYVV-W-PMTD---RHANLFLMRCKKSGNPEALYRQGMHN  107



>emb|CDP07942.1| unnamed protein product [Coffea canephora]
Length=126

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 61/100 (61%), Gaps = 5/100 (5%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            +SI SL  E++ E+LARV++ S  DL  A+L C+ + E+   D +Y+ +S  KF IV W+
Sbjct  11   TSILSLSTEVLSEVLARVASSSSTDLFWAKLCCKLFYEVSDADNIYQRVSLDKFEIVPWQ  70

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPE  434
               + +K  R  F  KC +++N EALY KG+ +  + + E
Sbjct  71   ---KNDKVSR--FLKKCRESKNPEALYRKGVVDYFTDKHE  105



>gb|ACR36762.1| unknown [Zea mays]
Length=147

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSW--DDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  + +LP +LV+ IL++++A S    DLL+  L+C+R NELG  D+V+   S A   + 
Sbjct  47   PDYLDALPDDLVLSILSKLAAASSAPSDLLSVHLTCKRLNELGSHDMVFAKASPASLAVK  106

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W    +        F  +C DA NLEA Y  G+
Sbjct  107  AAAWSEPAQR-------FLKRCADAGNLEACYNLGM  135



>ref|XP_004166031.1| PREDICTED: putative F-box protein At1g67623-like, partial [Cucumis 
sativus]
Length=246

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = -3

Query  787  EWKMRRTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCD  608
            E ++ R  +   I+ + P+ I SLP +L+ E+LA+V+  S+ DL+ A+L+ + + E   D
Sbjct  14   ETQISRITEKNQIDVLSPTVIKSLPNDLLTEVLAKVATSSYIDLVQAKLATKHFLEASND  73

Query  607  DIVYKHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
              +++H S   F  + W      N  K   F   C ++EN E+LY KG+
Sbjct  74   RYIFQHASLGNFRNLLWN-----NSPKFWSFMETCNNSENPESLYRKGM  117



>ref|XP_004137554.1| PREDICTED: putative F-box protein At1g67623-like [Cucumis sativus]
 gb|KGN63874.1| hypothetical protein Csa_1G025065 [Cucumis sativus]
Length=260

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = -3

Query  781  KMRRTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDI  602
            ++ R  +   I+ + P+ I SLP +L+ E+LA+V+  S+ DL+ A+L+ + + E   D  
Sbjct  16   QISRITEKNQIDVLSPTVIKSLPNDLLTEVLAKVATSSYIDLIQAKLATKHFLEASNDRY  75

Query  601  VYKHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            +++H+S   F  + W      N  K   F   C ++EN E+LY KG+
Sbjct  76   IFQHVSLGNFRNLLW-----NNSPKFWSFMETCNNSENPESLYRKGM  117



>emb|CDP20768.1| unnamed protein product [Coffea canephora]
Length=228

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 5/100 (5%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            +SI SLP E++ E+LARV++ S  DL  A+L C+ + E+   + +Y+ +S  KF IV W 
Sbjct  11   TSILSLPTEVLSEVLARVASSSSTDLFRAKLCCKLFYEVSDANNIYQRVSLDKFEIVLW-  69

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSSTRPE  434
                +   K   F   C +++N EALY KG+ +  + + E
Sbjct  70   ----QKNHKVSRFLKNCRESKNPEALYRKGVVDFFTDKHE  105



>ref|XP_002318952.1| F-box family protein [Populus trichocarpa]
 gb|EEE94875.1| F-box family protein [Populus trichocarpa]
Length=238

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 6/97 (6%)
 Frame = -3

Query  718  LPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPEIEE  539
             P++L+ E+LARV++ S  DL  A+LSC+ + E   ++ +++H++  K P++ W+     
Sbjct  17   FPKDLLTEVLARVASASISDLFTAKLSCKEFLEAASENYIFEHITIEKLPVIPWRISHGA  76

Query  538  NKRKRCLFFYKCIDAENLEALYGKGLSN-GSSTRPES  431
            +      F  +C +  N EAL+ +G+    SS +PES
Sbjct  77   SS-----FLARCKENGNPEALFRQGMVEFFSSNKPES  108



>gb|KHN18407.1| Putative F-box protein [Glycine soja]
Length=247

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 5/96 (5%)
 Frame = -3

Query  748  NNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFP  569
            N    S I SLP++L+VE++ARV++ S  DL N +  C+ + +   D+ V++ +S  KFP
Sbjct  19   NGSSTSPIKSLPKDLLVEVVARVASDSIVDLRNMKQCCKDFLDASEDNYVWQQVSLDKFP  78

Query  568  IVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            +++W P    N +  C F   C ++ N+E+LY +GL
Sbjct  79   LMRWLP----NDKASC-FLKCCRESGNIESLYREGL  109



>ref|XP_010669037.1| PREDICTED: putative F-box protein At1g67623 [Beta vulgaris subsp. 
vulgaris]
Length=193

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQW  557
            P+ +H+LP E+++EIL+RV A S  DL  +RL+C+  N++  D+ +YK +S  +  +   
Sbjct  9    PNIVHALPTEIIIEILSRVGAASAPDLFASRLTCKAINKMSHDEKIYKKVSSEQLYMRSL  68

Query  556  KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            +   +ENK K   FF  C   +N EAL   G+
Sbjct  69   RN--DENKAK---FFDLCFQYKNPEALLHYGM  95



>ref|NP_001141028.1| hypothetical protein [Zea mays]
 gb|ACF85218.1| unknown [Zea mays]
 tpg|DAA56096.1| TPA: hypothetical protein ZEAMMB73_508510 [Zea mays]
Length=261

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSW--DDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  + +LP +LV+ IL++++A S    DLL+  L+C+R NELG  D+V+   S A   + 
Sbjct  47   PDYLDALPDDLVLSILSKLAAASSAPSDLLSVHLTCKRLNELGSHDMVFAKASPASLAVK  106

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W    E  +R    F  +C DA NLEA Y  G+
Sbjct  107  AAAWS---EPAQR----FLKRCADAGNLEACYNLGM  135



>ref|XP_011023775.1| PREDICTED: putative F-box protein At1g67623 [Populus euphratica]
Length=238

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 55/97 (57%), Gaps = 6/97 (6%)
 Frame = -3

Query  718  LPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPEIEE  539
             P++L+ E+LARV++ S  DL  A+LSC+ + E   ++ +++H++  K P++ W      
Sbjct  17   FPKDLLTEVLARVASASISDLFTAKLSCKEFLEAASENYIFEHITIEKLPVIPWTISHGA  76

Query  538  NKRKRCLFFYKCIDAENLEALYGKGLSN-GSSTRPES  431
            +      F  +C +  N EAL+  G+    SS +PES
Sbjct  77   SS-----FLARCKENGNPEALFRHGMVEFFSSNKPES  108



>ref|XP_004508629.1| PREDICTED: putative F-box protein At1g67623-like [Cicer arietinum]
Length=245

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 59/92 (64%), Gaps = 7/92 (8%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            +SI SLP++L++E++  V++ S+ DL N ++ C+ + E+  D  V +++S   FP++QW 
Sbjct  22   TSIESLPRDLLLEVVTNVASQSFIDLHNMKMCCKDFLEVTEDKHVLQNISLDNFPLIQWF  81

Query  553  PEIEENKRKRCLFFYK-CIDAENLEALYGKGL  461
                    +R L F K C++ EN+E+L+ +GL
Sbjct  82   LN------ERALSFLKRCMECENIESLFREGL  107



>ref|XP_007026049.1| F-box family protein [Theobroma cacao]
 gb|EOY28671.1| F-box family protein [Theobroma cacao]
Length=239

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            S+I SLP+E++ EIL   +++S  D +NA++SC+ +     D  + +++S A    V W 
Sbjct  7    SNIQSLPREMLAEILKHAASNSITDFVNAQMSCKAFLGASNDYQILENVSMANISFVPW-  65

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
                +N++   +F  KC DA+N EALY KG+ N
Sbjct  66   ---YKNEK---IFLKKCKDAKNSEALYRKGMIN  92



>ref|XP_006390380.1| hypothetical protein EUTSA_v10019573mg [Eutrema salsugineum]
 gb|ESQ27666.1| hypothetical protein EUTSA_v10019573mg [Eutrema salsugineum]
Length=262

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = -3

Query  730  SIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKP  551
            S++SLP+EL+VEI +RV+A S+ D+ N +L  + +     D  V++ +S    P+  W  
Sbjct  21   SLNSLPEELLVEISSRVAASSFSDVHNLQLVSKTFQNYCNDGYVFQRVSFHGIPLFPWH-  79

Query  550  EIEENKRKRCLFFYKCIDAENLEALYGKGL  461
                N+ K   FF +C+   N EALY KGL
Sbjct  80   --RRNREKFSKFFKRCLRNGNPEALYRKGL  107



>ref|XP_007158314.1| hypothetical protein PHAVU_002G142400g [Phaseolus vulgaris]
 gb|ESW30308.1| hypothetical protein PHAVU_002G142400g [Phaseolus vulgaris]
Length=209

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = -3

Query  766  DDAKTINNVVPSS---IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVY  596
            D+ + + +   SS   I S+PQ+L++ ++AR+S+ S+ D  N ++ CR +     D+ ++
Sbjct  7    DNKRQLTDTNQSSLIPIKSIPQDLLINVVARISSESYIDHYNMKVCCRDFFHASKDNYMW  66

Query  595  KHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSS  446
            + +S  KFP++ W      +K     F   C +  N+EALY  GL    S
Sbjct  67   QQVSLEKFPLIPW-----SHKEAFDSFMQNCKEGGNIEALYRVGLQELKS  111



>ref|XP_006484338.1| PREDICTED: putative F-box protein At1g67623-like [Citrus sinensis]
 gb|KDO82011.1| hypothetical protein CISIN_1g035556mg [Citrus sinensis]
Length=261

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = -3

Query  739  VPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQ  560
            + +SI SLP  L+ E++A+V++ S  DL   +LSC+ + +   DD V++H S  KF +V 
Sbjct  33   LGTSIESLPHALLTEVMAQVASTSLVDLSRLKLSCKYFLQAADDDFVFEHASLDKFYVV-  91

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
            W        R   LF  +C  + N EALY +G+ +
Sbjct  92   WPM----TDRHASLFLMRCKKSGNPEALYRQGMHD  122



>ref|XP_010668259.1| PREDICTED: putative F-box protein At1g67623 [Beta vulgaris subsp. 
vulgaris]
Length=234

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            +HSLP E+++EIL+RV A S  DL   RL+C+  N++  D+ +YK +S     +   +  
Sbjct  12   VHSLPTEIIIEILSRVGAASAPDLFACRLTCKAINKMSHDEKIYKKISFEHLYMHSLRN-  70

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGL  461
             +ENK K   FF  C+  +N EAL   G+
Sbjct  71   -DENKSK---FFDLCLQYKNPEALLRYGM  95



>ref|XP_010682301.1| PREDICTED: putative F-box protein At1g67623 [Beta vulgaris subsp. 
vulgaris]
Length=234

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQW  557
            P+ +H+LP E+++EIL+RV A S  DL   RL+C+  N++  D  +YK +S     +   
Sbjct  9    PNIVHALPTEIIIEILSRVGAASAPDLFACRLTCKAINKISHDGKLYKKVSFEHLYMRSL  68

Query  556  KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            +   +ENK K   FF  C++ +N EAL   G+
Sbjct  69   RN--DENKAK---FFDLCLEYKNPEALLRYGM  95



>ref|XP_008453691.1| PREDICTED: putative F-box protein At1g67623 [Cucumis melo]
Length=258

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (53%), Gaps = 9/108 (8%)
 Frame = -3

Query  778  MRRTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIV  599
            + RT        + P+ I SLP +L+ E+LA+V+A S+ DL+ A+L+ +++ E   D  +
Sbjct  16   ISRTTQKNRTGVLSPTVIKSLPNDLLTEVLAKVAASSYVDLVQAKLATKQFLEASKDRYI  75

Query  598  YKHLSHAKFPIVQW--KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            ++H+S   F    W   PE          F   C + EN E+LY KG+
Sbjct  76   FQHVSLGNFENHLWNNSPEFWS-------FIETCNNNENPESLYRKGM  116



>ref|XP_010109211.1| hypothetical protein L484_011832 [Morus notabilis]
 gb|EXC21391.1| hypothetical protein L484_011832 [Morus notabilis]
Length=88

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 5/82 (6%)
 Frame = -3

Query  706  LVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPEIEENKRK  527
            ++ EILARV+  S   L N + SC  +NE+G  + VY+++S  +  +          + +
Sbjct  1    MIEEILARVATSSMRALFNTKRSCTLFNEVGNSNYVYRYVSLDRLTL-----NFSYMRPE  55

Query  526  RCLFFYKCIDAENLEALYGKGL  461
             C F+ KCI++EN EA+Y +GL
Sbjct  56   ECSFYQKCIESENPEAMYREGL  77



>ref|XP_008672405.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA56097.1| TPA: hypothetical protein ZEAMMB73_508510 [Zea mays]
Length=390

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSW--DDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  + +LP +LV+ IL++++A S    DLL+  L+C+R NELG  D+V+   S A   + 
Sbjct  47   PDYLDALPDDLVLSILSKLAAASSAPSDLLSVHLTCKRLNELGSHDMVFAKASPASLAVK  106

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W    +        F  +C DA NLEA Y  G+
Sbjct  107  AAAWSEPAQR-------FLKRCADAGNLEACYNLGM  135



>ref|XP_007155183.1| hypothetical protein PHAVU_003G180500g, partial [Phaseolus vulgaris]
 gb|ESW27177.1| hypothetical protein PHAVU_003G180500g, partial [Phaseolus vulgaris]
Length=253

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 58/98 (59%), Gaps = 7/98 (7%)
 Frame = -3

Query  754  TINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAK  575
            T ++++P  I S+PQ+L++ ++ARVS+ S+ D  N ++ CR +     ++ +++ +S  K
Sbjct  38   TTSSLIP--IKSIPQDLLLNVVARVSSQSYIDHYNMKVCCRDFFIASKENYMWQQVSLEK  95

Query  574  FPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            FP++ W      +K     F   C ++ N+EALY  GL
Sbjct  96   FPLIPW-----SHKEAFDSFMQSCKESGNIEALYRVGL  128



>ref|XP_007012042.1| F-box family protein [Theobroma cacao]
 gb|EOY29661.1| F-box family protein [Theobroma cacao]
Length=320

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            ++I+SLP+E++ EIL   +++S  D  N +LSC+ + E   D+ +++++S     +V W 
Sbjct  13   TNINSLPREMLAEILRHAASNSIVDFRNVKLSCKAFLEASNDNHIFENVSMENISLVPW-  71

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
                   +K  +F  +C DA+N EALY  G+
Sbjct  72   ------YKKEKIFLKRCKDAKNAEALYRTGM  96



>ref|XP_002458999.1| hypothetical protein SORBIDRAFT_03g044140 [Sorghum bicolor]
 gb|EES04119.1| hypothetical protein SORBIDRAFT_03g044140 [Sorghum bicolor]
Length=394

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSW--DDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  + +LP +LV+ IL +++A S    DLL+  L+C+R NELG  D+V+   S A   + 
Sbjct  47   PDYLDALPDDLVLSILTKLAASSSAPSDLLSVHLTCKRLNELGGHDMVFAKASPASLAVK  106

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W    +        F  +C DA NLEA Y  G+
Sbjct  107  AAAWSEPAQR-------FLKRCADAGNLEACYILGM  135



>ref|XP_010242755.1| PREDICTED: putative F-box protein At1g67623 [Nelumbo nucifera]
Length=221

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 7/91 (8%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            + SLP +LVVEIL  V++ S  DL NA+LSC  + EL  + ++ + +S        WK  
Sbjct  1    MESLPDDLVVEILGHVASSSLSDLFNAKLSCSSFKELAEEKLILRSVSLD--TKASWK--  56

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGLSN  455
               N +K   +F  C+ AEN  A Y +GL +
Sbjct  57   ---NPKKYASYFSDCLMAENPHACYLQGLGD  84



>ref|XP_011085125.1| PREDICTED: putative F-box protein At1g67623 [Sesamum indicum]
Length=222

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = -3

Query  739  VPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQ  560
            + S++ S+P++L+  ILARV+  S +   N +LSC+   E+     VYK +S  +FP+  
Sbjct  1    MSSNLDSIPKDLLTHILARVATSSLNSYFNVKLSCKMLKEVAECSNVYKCISLDEFPM-D  59

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               ++  + R    F  +C++ ENL+ALY  G+
Sbjct  60   ALHDMNGDVRS---FINRCVECENLDALYMLGM  89



>ref|XP_010684458.1| PREDICTED: F-box protein At2g35280-like [Beta vulgaris subsp. 
vulgaris]
Length=271

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQW  557
            P+ +HSLP E+++EIL+ V A S  DL   R++C+  N++  D+ +YK +S     +   
Sbjct  9    PNIVHSLPTEIIIEILSCVGAASAPDLFACRMTCKAINKMSHDEKIYKKVSFEHLYMHSL  68

Query  556  KPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            +   +ENK K   FF  C+  +N EAL   G+
Sbjct  69   RN--DENKAK---FFDLCLQYKNPEALLCYGM  95



>ref|XP_010667999.1| PREDICTED: putative F-box protein At1g67623 [Beta vulgaris subsp. 
vulgaris]
Length=243

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = -3

Query  742  VVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIV  563
            + PS +  LP E++ E+LARV+A S  DL   +LSC+  +E+  +  V + +S       
Sbjct  16   IQPSMVDYLPTEIITEVLARVAASSVADLFRCKLSCKALHEISGEKKVLQQVSIESLFSR  75

Query  562  QWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
             W+ +      K+  FF +C+++ N EAL   G+
Sbjct  76   AWRRD-----DKKSSFFTRCVESNNPEALLRLGM  104



>ref|XP_004971088.1| PREDICTED: F-box protein At1g67340-like [Setaria italica]
Length=391

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  +  LP +LV+ IL+++  SA +  DLL+  L+C+R NELG  D+V+   S A   + 
Sbjct  51   PDYLDELPDDLVLSILSKLAASASAPSDLLSVHLTCKRLNELGGHDMVFAKASPASLAVK  110

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W    +        F  +C DA NLEA Y  G+
Sbjct  111  AAAWSEPAQR-------FLKRCADAGNLEACYILGM  139



>ref|XP_009403599.1| PREDICTED: F-box protein At1g67340-like [Musa acuminata subsp. 
malaccensis]
Length=385

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = -3

Query  772  RTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSW--DDLLNARLSCRRWNELGCDDIV  599
            R   ++ +   +P    SLP ELVV IL ++SA +    DL+  R++C+R NELG D + 
Sbjct  47   RMMASEGVAGEMPDFFDSLPDELVVSILCKLSASAARPADLVGVRITCKRLNELGSDPLA  106

Query  598  YKHLSHAKFPI--VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
                S     +    W     E       F  +C DA NLEA Y  G+
Sbjct  107  LAMASMKSLAVRAKNWSESAHE-------FLKQCADAGNLEACYILGM  147



>ref|XP_003613186.1| F-box protein [Medicago truncatula]
 gb|AES96144.1| F-box plant-like protein [Medicago truncatula]
Length=254

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 3/102 (3%)
 Frame = -3

Query  748  NNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFP  569
            N+   S + + P +L+V+I+ +V++ S  DL   +LSC+ +     D  VY+H S  KF 
Sbjct  18   NDAPISIVKAFPNDLLVDIVGKVASGSMVDLYKIKLSCKEFLSASEDRFVYQHASLDKFA  77

Query  568  IVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSST  443
            ++      EE   K   F  +C ++ NLE LY +G+    ST
Sbjct  78   LIPLPWFTEE---KETSFLRRCRESGNLEILYREGMEQYFST  116



>ref|XP_006646623.1| PREDICTED: F-box protein At1g67340-like [Oryza brachyantha]
Length=256

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  +  LP +LV+ +L+++  SA S  DLL+  L+C+R N LG  D+V+   S A   + 
Sbjct  44   PDYLDELPDDLVLAVLSKLAASASSPSDLLSVHLTCKRLNGLGRHDMVFAKASPASLAVK  103

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W   ++        F  +C DA NLEA Y  G+
Sbjct  104  AASWSEPVQR-------FLKRCADAGNLEACYILGM  132



>ref|XP_010668136.1| PREDICTED: F-box protein At2g35280-like [Beta vulgaris subsp. 
vulgaris]
Length=233

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWKPE  548
            +H+LP E+++EIL+RV A S  +L   +L+C+  NE+  D+ +YK +S     +   +  
Sbjct  12   VHALPTEIIIEILSRVGAASAPNLFACKLTCKAINEMSHDEKIYKKVSFEHVYMRSMRN-  70

Query  547  IEENKRKRCLFFYKCIDAENLEALYGKGL  461
             +ENK K   FF  C+  +N EAL   G+
Sbjct  71   -DENKAK---FFDLCLQYKNPEALLRYGM  95



>emb|CDM85592.1| unnamed protein product [Triticum aestivum]
Length=383

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  +  +P +LV+ I +++  SA+S  DLL+  L+C+R N LG  D+V+   S A   + 
Sbjct  48   PDYLDGIPDDLVLSIFSKLAASANSPSDLLSVHLTCKRLNGLGQQDMVFAKASPASLAVK  107

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W   ++        F  +C DA NLEA Y  G+
Sbjct  108  AAAWSEPVQR-------FLKRCADAGNLEACYILGM  136



>ref|XP_006584029.1| PREDICTED: putative F-box protein At1g67623-like [Glycine max]
 gb|KHN02970.1| Putative F-box protein [Glycine soja]
Length=241

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 4/109 (4%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHA  578
            K   +V  ++I SLP+EL VEI A+V+  S  D    +L C+ +     DD VY+H S  
Sbjct  12   KKHGSVSVTTIKSLPKELQVEIFAKVATRSIFDHCMIKLCCKEFLHAAEDDYVYRHASME  71

Query  577  KFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKG-LSNGSSTRPE  434
             F +V   P    NK     F  +C ++ N E LY +G L   +S+R E
Sbjct  72   NFALVPL-PWFTGNKESS--FLKRCRESGNSEILYREGMLQYFTSSRVE  117



>dbj|BAJ85831.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  +  +P +LV+ I +++  SA S  DLL+  L+C+R N LG  D+V+   S A   + 
Sbjct  42   PDYLDGIPDDLVLSIFSKLAASASSPSDLLSVHLTCKRLNGLGQQDMVFAKASPASLAVK  101

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W   ++        F  +C DA NLEA Y  G+
Sbjct  102  AAAWSEPVQR-------FLKRCADAGNLEACYILGM  130



>ref|XP_004239208.1| PREDICTED: F-box protein At1g67340 [Solanum lycopersicum]
Length=386

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIV  563
            P    SLP +LVV IL ++  SA S  D +N  ++C+R N LGC  +V   LS A   ++
Sbjct  51   PDLFDSLPDDLVVSILCKLTSSAASPADFVNVLITCKRLNGLGCHSLV---LSKASQKML  107

Query  562  QWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
              K +   +  +R  F  +C DA N+EA Y  G+
Sbjct  108  TVKAQNWSDSAQR--FLKQCADAGNVEACYTLGM  139



>ref|XP_008656929.1| PREDICTED: F-box protein At1g67340 [Zea mays]
 gb|AFW84134.1| hypothetical protein ZEAMMB73_570285 [Zea mays]
Length=382

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARVSAHSWD--DLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  + +LP +LV+ IL +V+A S    DLL+  L+C+R NELG  D+V+   S A   + 
Sbjct  47   PDYLDALPDDLVLSILTKVAADSSAPADLLSVHLTCKRLNELGSHDMVFAKASPASLSVK  106

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W    +        F  +  DA NLEA Y  G+
Sbjct  107  AAAWSEAAQR-------FLKRSADAGNLEACYILGM  135



>dbj|BAB86182.1| OJ1485_B09.11 [Oryza sativa Japonica Group]
Length=388

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 11/103 (11%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLS  584
            K +    P  +  LP +LV+ +L+++  SA S  DLL+  L+C+R N LG  D+V+   S
Sbjct  48   KRLAGGGPDYLDELPDDLVLAVLSKLAASASSPSDLLSVHLTCKRLNGLGRHDMVFAKAS  107

Query  583  HAKFPI--VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
             A   +    W   ++        F   C DA NLEA Y  G+
Sbjct  108  PASLAVKAASWSEPVQR-------FLKLCADAGNLEACYILGM  143



>ref|XP_003567414.1| PREDICTED: F-box protein At1g67340-like [Brachypodium distachyon]
Length=386

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 49/93 (53%), Gaps = 11/93 (12%)
 Frame = -3

Query  727  IHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI--VQ  560
            +  LP +LV+ IL+++  SA S  DLL+  L+C+R N LG  D+V+ + S A   +    
Sbjct  55   LDELPDDLVLSILSKLAASASSPSDLLSVHLTCKRLNGLGHQDMVFANASPASLAVKAAA  114

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            W    +        F  +C DA NLEA Y  G+
Sbjct  115  WSEPAQR-------FLKRCADAGNLEACYILGM  140



>ref|XP_003609669.1| F-box protein [Medicago truncatula]
 gb|AES91866.1| F-box plant-like protein [Medicago truncatula]
Length=256

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (52%), Gaps = 4/106 (4%)
 Frame = -3

Query  757  KTINNVVPSSI-HSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSH  581
            K+  N  P SI  +LP +L+V I+ +V++ S  DL   +LSC+ +     D  VY+H + 
Sbjct  14   KSRKNQTPISIVKTLPNDLLVNIVGKVASRSMADLCKIKLSCKEFLNASEDGYVYQHAAM  73

Query  580  AKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSST  443
             KF +V      +E   K   F  +C ++ NLE  Y +G+    ST
Sbjct  74   DKFALVPLPWFTDE---KETSFLSRCKESGNLEITYREGMVQYFST  116



>ref|NP_001045230.2| Os01g0921800 [Oryza sativa Japonica Group]
 dbj|BAD88375.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF07144.2| Os01g0921800 [Oryza sativa Japonica Group]
Length=369

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 11/103 (11%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLS  584
            K +    P  +  LP +LV+ +L+++  SA S  DLL+  L+C+R N LG  D+V+   S
Sbjct  29   KRLAGGGPDYLDELPDDLVLAVLSKLAASASSPSDLLSVHLTCKRLNGLGRHDMVFAKAS  88

Query  583  HAKFPI--VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
             A   +    W   ++        F   C DA NLEA Y  G+
Sbjct  89   PASLAVKAASWSEPVQR-------FLKLCADAGNLEACYILGM  124



>ref|XP_003638510.1| F-box protein [Medicago truncatula]
 gb|KEH35004.1| F-box plant-like protein [Medicago truncatula]
Length=250

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 55/113 (49%), Gaps = 4/113 (4%)
 Frame = -3

Query  778  MRRTDDAKTIN-NVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDI  602
            M  +   K IN   + S + +LP EL+  I+ +V+  S  DL    LSC+ + +   D  
Sbjct  1    MALSSVKKEINETAIISLVEALPDELLANIVGKVATFSMADLFKTTLSCKDFCKALEDPH  60

Query  601  VYKHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGLSNGSST  443
            VY+H +  KF ++   P       K  +F  +C +  NLE +Y +G+    ST
Sbjct  61   VYQHAALDKFALI---PLAWFTSEKETMFLSRCREMGNLEIIYREGMVQYFST  110



>gb|EAY77017.1| hypothetical protein OsI_04973 [Oryza sativa Indica Group]
Length=389

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 11/96 (11%)
 Frame = -3

Query  736  PSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI-  566
            P  +  LP +LV+ +L+++  SA S  DLL+  L+C+R N LG  D+V+   S A   + 
Sbjct  56   PDYLDELPDDLVLAVLSKLAASASSPSDLLSVHLTCKRLNGLGRHDMVFAKASPASLAVK  115

Query  565  -VQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               W   ++        F   C DA NLEA Y  G+
Sbjct  116  AASWSEPVQR-------FLKLCADAGNLEACYILGM  144



>ref|XP_009413567.1| PREDICTED: F-box protein At1g67340-like [Musa acuminata subsp. 
malaccensis]
Length=393

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 56/110 (51%), Gaps = 11/110 (10%)
 Frame = -3

Query  784  WKMRRTDDAKTINNVVPSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGC  611
            WKM      + ++   P     LP +LVV IL ++  SA S  DL++  ++C+R N LG 
Sbjct  49   WKM----ATEAVSEDSPDFFDGLPDDLVVSILCKLIASATSPSDLISVLVTCKRLNRLGL  104

Query  610  DDIVYKHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            + +V  H++  K   V+ K   E   R    F  +C DA NLEA Y  G+
Sbjct  105  NPLVL-HMASVKSLAVRAKKWSESAHR----FLKRCADAGNLEACYILGM  149



>emb|CDY12640.1| BnaA02g13080D [Brassica napus]
Length=345

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWD--DLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            + S+P++LVV IL R+++ S    D +N  ++C+R N L    +V   LS   F  V+ +
Sbjct  49   LDSIPEDLVVSILRRLASTSRSPADFINVLMTCKRLNSLATSPLVLSRLSRKAFA-VKAQ  107

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               E   R    F  +C+DA NLEA Y  G+
Sbjct  108  NWSEAAHR----FLKRCVDAGNLEACYTLGM  134



>ref|XP_009127548.1| PREDICTED: F-box protein At1g67340-like [Brassica rapa]
Length=377

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 7/91 (8%)
 Frame = -3

Query  727  IHSLPQELVVEILARVSAHSWD--DLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQWK  554
            + S+P++LVV IL R+++ S    D +N  ++C+R N L    +V   LS   F  V+ +
Sbjct  49   LDSIPEDLVVSILRRLASTSRSPADFINVLMTCKRLNSLATSPLVLSRLSRKAFA-VKAQ  107

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
               E   R    F  +C+DA NLEA Y  G+
Sbjct  108  NWSEAAHR----FLKRCVDAGNLEACYTLGM  134



>ref|XP_004508220.1| PREDICTED: putative F-box protein At1g67623-like [Cicer arietinum]
Length=252

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 51/98 (52%), Gaps = 7/98 (7%)
 Frame = -3

Query  748  NNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFP  569
            N    S   SLP+EL+VEI  +V++ S  DL   +L+C+ +     +  VY+H S   F 
Sbjct  17   NEFSVSITKSLPKELLVEIAGKVASRSIVDLCKMKLTCKEFLSASEESCVYQHASMENFA  76

Query  568  IV--QWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            ++   W  + +E       F  +C ++ NLE LY +G+
Sbjct  77   LIPLPWFTDEKETS-----FLNRCRNSGNLEILYREGM  109



>ref|XP_006601395.1| PREDICTED: putative F-box protein At1g67623-like [Glycine max]
Length=249

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 15/117 (13%)
 Frame = -3

Query  805  GLGHK*EWKMRRTDDAKTINNVVPSSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRW  626
            GLG K     +R ++ +  ++   +++ +LP++++VEI A+V+  S  DL   +  CR +
Sbjct  11   GLGVK-----KRRNEKQHKHDGSFTTVKALPKDMLVEIFAKVATRSIFDLCMVKQCCREF  65

Query  625  NELGCDDIVYKHLSHAKFPIV--QWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
                 DD VY+H S   + +V  QW  E          F  +C ++ N E  Y +G+
Sbjct  66   LHAAEDDYVYRHASMENYALVPLQWLKESS--------FLKRCKESGNSEFAYREGM  114



>ref|XP_009416578.1| PREDICTED: F-box protein At1g67340-like [Musa acuminata subsp. 
malaccensis]
Length=342

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 44/90 (49%), Gaps = 11/90 (12%)
 Frame = -3

Query  718  LPQELVVEILARVSAHSW--DDLLNARLSCRRWNELGCDDIVYKHLSHAKFPI--VQWKP  551
            LP +LVV IL R+SA +    DLL   ++C+R N LG D +V  + S     I  + W  
Sbjct  33   LPDDLVVAILCRLSASTARPSDLLGVLIACKRLNRLGLDPLVLSNASVESLAIRAMNWSA  92

Query  550  EIEENKRKRCLFFYKCIDAENLEALYGKGL  461
                       F  +C DA NLEA Y  G+
Sbjct  93   SAHR-------FLKRCADAGNLEACYILGM  115



>ref|XP_004508221.1| PREDICTED: putative F-box protein At1g67623-like [Cicer arietinum]
Length=252

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 7/93 (8%)
 Frame = -3

Query  733  SSIHSLPQELVVEILARVSAHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIV--Q  560
            S   SLP+EL+VEI  +V++ S  DL   +L+C+ +     +  VY+H S   F ++   
Sbjct  22   SITKSLPKELLVEIAGKVASRSIVDLCKMKLTCKEFLSASEESCVYQHASMENFALIPLP  81

Query  559  WKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            W  + +E       F  +C ++ NLE LY +G+
Sbjct  82   WFTDEKETS-----FLNRCRNSGNLEILYREGM  109



>ref|XP_007163763.1| hypothetical protein PHAVU_001G2619001g [Phaseolus vulgaris]
 gb|ESW35757.1| hypothetical protein PHAVU_001G2619001g [Phaseolus vulgaris]
Length=350

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 49/101 (49%), Gaps = 7/101 (7%)
 Frame = -3

Query  757  KTINNVVPSSIHSLPQELVVEILARVSA--HSWDDLLNARLSCRRWNELGCDDIVYKHLS  584
            KT          SLP +L++ IL ++SA   S  D +N  ++C+R N LG   +V    S
Sbjct  9    KTCPEKTSDFFESLPDDLLLSILCKLSATASSPSDFINVLVTCKRLNSLGLHSLVLSKAS  68

Query  583  HAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            H  F +   KP+   +   R  F   C DA N+EA Y  G+
Sbjct  69   HKTFLV---KPQNWCDSVHR--FLKHCADAGNIEACYTLGM  104



>ref|XP_008446037.1| PREDICTED: F-box protein At1g67340 [Cucumis melo]
Length=382

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 7/107 (7%)
 Frame = -3

Query  775  RRTDDAKTINNVVPSSIHSLPQELVVEILARV--SAHSWDDLLNARLSCRRWNELGCDDI  602
            +R   +  I   +     SLP +LV+ IL+    +A S  D +N  L+C+R N LG + +
Sbjct  37   KRNKHSSDIKTPISDLFDSLPDDLVITILSNFCSAASSPSDFINILLTCKRLNNLGLNPM  96

Query  601  VYKHLSHAKFPIVQWKPEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
            V    S   F I + K   E   R    F  +C DA N+EA Y  G+
Sbjct  97   VLSRASQKTFAI-RAKNWTESAHR----FLKQCSDAGNVEACYTLGM  138



>gb|KHN24065.1| F-box protein [Glycine soja]
Length=206

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 44/91 (48%), Gaps = 11/91 (12%)
 Frame = -3

Query  721  SLPQELVVEILARVS--AHSWDDLLNARLSCRRWNELGCDDIVYKHLSHAKFPIVQ--WK  554
            SLP +LV+ IL ++S  A S  D ++  ++C+R N LG   +V    SH  F +    W 
Sbjct  21   SLPDDLVLSILCKLSSTATSPSDFISVLITCKRLNSLGLHSLVLSKASHKTFSVKAKNWC  80

Query  553  PEIEENKRKRCLFFYKCIDAENLEALYGKGL  461
              +         F   C DA N+EA Y  G+
Sbjct  81   DSLHR-------FLKHCADAGNIEACYTLGM  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561306781368