BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20937_g2_i1 len=2408 path=[4379:0-1364 127:1365-1388 151:1389-2407]

Length=2408
                                                                      Score     E

ref|XP_006362049.1|  PREDICTED: ATP-dependent RNA helicase DBP2-like    877   0.0      
ref|XP_011089533.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    873   0.0      
ref|XP_004246279.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    872   0.0      
ref|XP_009796073.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    859   0.0      
ref|XP_010325759.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    853   0.0      
ref|XP_009600280.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    850   0.0      
ref|XP_010253045.1|  PREDICTED: ATP-dependent RNA helicase DBP2-like    847   0.0      
ref|XP_009600279.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    840   0.0      
gb|EYU46026.1|  hypothetical protein MIMGU_mgv1a003854mg                826   0.0      
emb|CDP20487.1|  unnamed protein product                                823   0.0      
ref|XP_007146899.1|  hypothetical protein PHAVU_006G079800g             813   0.0      
gb|KEH34507.1|  DEAD-box ATP-dependent RNA helicase                     811   0.0      
ref|XP_007208448.1|  hypothetical protein PRUPE_ppa003525mg             808   0.0      
ref|XP_008240531.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    807   0.0      
ref|XP_002266157.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    806   0.0      Vitis vinifera
gb|KDP45713.1|  hypothetical protein JCGZ_17320                         801   0.0      
gb|KHN18654.1|  ATP-dependent RNA helicase DBP2                         800   0.0      
ref|XP_006432066.1|  hypothetical protein CICLE_v10000727mg             795   0.0      
gb|KDO45071.1|  hypothetical protein CISIN_1g008428mg                   794   0.0      
gb|KDO45073.1|  hypothetical protein CISIN_1g008428mg                   791   0.0      
ref|XP_004294724.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    791   0.0      
ref|XP_008384660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    791   0.0      
ref|XP_008358920.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    790   0.0      
ref|XP_008349521.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    790   0.0      
ref|XP_010922760.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    788   0.0      
ref|XP_008788522.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    786   0.0      
ref|XP_009354913.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    783   0.0      
ref|XP_002319430.1|  DEAD box protein P68                               782   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009374389.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    782   0.0      
ref|XP_009796074.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    781   0.0      
ref|XP_006842508.1|  hypothetical protein AMTR_s00077p00105110          781   0.0      
ref|XP_002523955.1|  dead box ATP-dependent RNA helicase, putative      780   0.0      Ricinus communis
ref|XP_011021058.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    778   0.0      
ref|XP_004500377.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    769   0.0      
ref|XP_006432064.1|  hypothetical protein CICLE_v10000727mg             763   0.0      
ref|XP_009600281.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    762   0.0      
gb|AAF75791.1|AF271892_1  DEAD box protein P68                          758   0.0      Pisum sativum [garden pea]
gb|KEH34508.1|  DEAD-box ATP-dependent RNA helicase                     754   0.0      
ref|XP_010094427.1|  ATP-dependent RNA helicase DBP2                    740   0.0      
ref|XP_001769905.1|  predicted protein                                  733   0.0      
ref|XP_001785829.1|  predicted protein                                  726   0.0      
ref|XP_002960303.1|  hypothetical protein SELMODRAFT_75384              724   0.0      
gb|KHN24726.1|  ATP-dependent RNA helicase DBP2                         718   0.0      
ref|XP_006432065.1|  hypothetical protein CICLE_v10000727mg             699   0.0      
gb|KDO45074.1|  hypothetical protein CISIN_1g008428mg                   699   0.0      
gb|KEH34509.1|  DEAD-box ATP-dependent RNA helicase                     673   0.0      
gb|KDO45075.1|  hypothetical protein CISIN_1g008428mg                   655   0.0      
ref|XP_008240621.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    653   0.0      
ref|XP_008384661.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    651   0.0      
ref|XP_008358921.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    651   0.0      
ref|XP_008349522.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    650   0.0      
ref|XP_009374390.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    644   0.0      
gb|EPS64666.1|  hypothetical protein M569_10114                         641   0.0      
ref|XP_009354920.1|  PREDICTED: ATP-dependent RNA helicase DBP2-l...    636   0.0      
ref|XP_006432068.1|  hypothetical protein CICLE_v10000727mg             610   0.0      
gb|KDO45076.1|  hypothetical protein CISIN_1g008428mg                   609   0.0      
ref|XP_003058608.1|  predicted protein                                  608   0.0      
emb|CAN75572.1|  hypothetical protein VITISV_009507                     604   0.0      Vitis vinifera
ref|XP_002507998.1|  predicted protein                                  598   0.0      Micromonas commoda
ref|XP_003080884.1|  DEAD box protein P68 (ISS)                         593   0.0      
ref|XP_002958649.1|  hypothetical protein VOLCADRAFT_69703              583   0.0      
ref|XP_001697438.1|  predicted protein                                  580   0.0      Chlamydomonas reinhardtii
ref|XP_002326066.2|  hypothetical protein POPTR_0019s151302g            555   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_001786160.1|  predicted protein                                  548   0.0      
ref|XP_001419411.1|  predicted protein                                  539   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_007515604.1|  predicted protein                                  544   0.0      
ref|XP_005538679.1|  p68 RNA helicase                                   362   4e-110   
ref|XP_001948642.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    364   5e-110   Acyrthosiphon pisum
ref|XP_002553117.1|  KLTH0D09328p                                       358   7e-110   Lachancea thermotolerans CBS 6340
ref|XP_456892.1|  DEHA2A12958p                                          358   9e-110   Debaryomyces hansenii CBS767
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    359   2e-109   
ref|XP_448941.1|  hypothetical protein                                  356   6e-109   [Candida] glabrata CBS 138
ref|NP_001164095.1|  ATP-dependent RNA helicase p62                     356   6e-109   Tribolium castaneum [rust-red flour beetle]
ref|XP_008345253.1|  PREDICTED: pre-mRNA-processing ATP-dependent...    351   2e-108   
gb|ENN71022.1|  hypothetical protein YQE_12421                          354   5e-108   
ref|XP_002774065.1|  RNA helicase, putative                             357   6e-108   Perkinsus marinus ATCC 50983
ref|NP_014287.3|  DEAD-box ATP-dependent RNA helicase DBP2              353   9e-108   Saccharomyces cerevisiae S288C
sp|A6ZRX0.1|DBP2_YEAS7  RecName: Full=ATP-dependent RNA helicase ...    353   9e-108   Saccharomyces cerevisiae YJM789
ref|XP_002421819.1|  ATP-dependent RNA helicase, putative               352   2e-107   Candida dubliniensis CD36
dbj|BAM20360.1|  DEAD box ATP-dependent RNA helicase                    352   2e-107   
ref|XP_003670835.1|  hypothetical protein NDAI_0F02740                  352   3e-107   
dbj|BAG30754.1|  DEAD box polypeptide 5                                 351   3e-107   Papilio xuthus [Chinese swallowtail]
emb|CDF91522.1|  ZYBA0S12-00826g1_1                                     351   5e-107   
ref|XP_002437244.1|  hypothetical protein SORBIDRAFT_10g023440          351   6e-107   Sorghum bicolor [broomcorn]
ref|XP_002007476.1|  GI12369                                            357   8e-107   Drosophila mojavensis
ref|XP_004965954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   1e-106   
gb|ACV83780.1|  DEAD box ATP-dependent RNA helicase-like protein        353   1e-106   Heliconius melpomene [common postman]
gb|EHJ76805.1|  DEAD box ATP-dependent RNA helicase-like protein        357   1e-106   
gb|EHJ72566.1|  DEAD box polypeptide 5                                  351   1e-106   
gb|EFA12741.1|  Rm62                                                    356   2e-106   
ref|XP_001761340.1|  predicted protein                                  350   3e-106   
ref|XP_002495378.1|  ZYRO0B09856p                                       348   3e-106   Zygosaccharomyces rouxii CBS 732
ref|XP_003677495.1|  hypothetical protein NCAS_0G02560                  349   3e-106   
ref|XP_008555060.1|  PREDICTED: ATP-dependent RNA helicase p62-like     349   3e-106   
ref|XP_010101088.1|  DEAD-box ATP-dependent RNA helicase 37             350   3e-106   
ref|XP_002046853.1|  GJ12262                                            355   4e-106   Drosophila virilis
gb|EFX78251.1|  hypothetical protein DAPPUDRAFT_213150                  346   4e-106   
ref|NP_001166829.1|  DEAD box polypeptide 5 isoform 2                   347   5e-106   Bombyx mori [silk moth]
gb|KHC61282.1|  ATP-dependent RNA helicase DBP2                         348   7e-106   
gb|EFZ12253.1|  hypothetical protein SINV_05205                         353   7e-106   
gb|KGQ83987.1|  ATP-dependent RNA helicase DBP2                         348   7e-106   
gb|KGR07069.1|  ATP-dependent RNA helicase DBP2                         348   8e-106   
gb|KHC54337.1|  ATP-dependent RNA helicase DBP2                         348   8e-106   
gb|KGQ81587.1|  ATP-dependent RNA helicase DBP2                         348   8e-106   
sp|Q59LU0.2|DBP2_CANAL  RecName: Full=ATP-dependent RNA helicase ...    348   8e-106   Candida albicans
ref|NP_001037582.1|  DEAD box polypeptide 5 isoform 1                   347   8e-106   Bombyx mori [silk moth]
gb|KHC67218.1|  ATP-dependent RNA helicase DBP2                         348   8e-106   
ref|XP_002067737.1|  GK12550                                            355   1e-105   Drosophila willistoni
gb|ERL93297.1|  hypothetical protein D910_10592                         348   1e-105   
ref|XP_001997052.1|  GH22580                                            354   1e-105   Drosophila grimshawi
ref|XP_004179875.1|  hypothetical protein TBLA_0C05580                  347   1e-105   
ref|XP_003955888.1|  hypothetical protein KAFR_0B04560                  347   2e-105   
ref|XP_001604593.1|  PREDICTED: ATP-dependent RNA helicase p62 is...    347   2e-105   Nasonia vitripennis
ref|XP_003745440.1|  PREDICTED: probable ATP-dependent RNA helica...    345   2e-105   
ref|XP_456137.1|  hypothetical protein                                  347   2e-105   Kluyveromyces lactis NRRL Y-1140
ref|XP_001862487.1|  ATP-dependent RNA helicase p62                     357   2e-105   Culex quinquefasciatus
ref|XP_005189172.1|  PREDICTED: probable ATP-dependent RNA helica...    357   2e-105   
ref|XP_002135340.1|  GA28491                                            346   2e-105   Drosophila pseudoobscura pseudoobscura
sp|Q0DB53.2|RH52A_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA...    348   2e-105   Oryza sativa Japonica Group [Japonica rice]
gb|KDR17554.1|  ATP-dependent RNA helicase p62                          347   3e-105   
ref|XP_002010212.1|  GI14822                                            357   3e-105   Drosophila mojavensis
emb|CAA93395.1|  RNA elicase                                            346   3e-105   Saccharomyces cerevisiae [brewer's yeast]
gb|EEQ43358.1|  hypothetical protein CAWG_01593                         347   3e-105   Candida albicans
gb|EEU08734.1|  Dbp2p                                                   346   3e-105   Saccharomyces cerevisiae JAY291
ref|XP_002007182.1|  GI12524                                            347   4e-105   Drosophila mojavensis
ref|NP_985329.2|  AFL221Cp                                              346   4e-105   Eremothecium gossypii ATCC 10895
ref|XP_002108975.1|  hypothetical protein TRIADDRAFT_63563              349   5e-105   Trichoplax adhaerens
ref|XP_003682141.1|  hypothetical protein TDEL_0F01190                  345   6e-105   
ref|XP_006392681.1|  hypothetical protein EUTSA_v10011413mg             341   6e-105   
gb|EFN70084.1|  Probable ATP-dependent RNA helicase DDX17               350   6e-105   
ref|XP_004198636.1|  Piso0_002019                                       345   6e-105   
ref|XP_008209140.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   6e-105   
ref|XP_011062219.1|  PREDICTED: ATP-dependent RNA helicase dbp2-like    347   7e-105   
ref|XP_001605420.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   7e-105   Nasonia vitripennis
ref|XP_008555058.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    350   8e-105   
ref|NP_648062.2|  CG10077, isoform A                                    353   9e-105   Drosophila melanogaster
ref|XP_008209141.1|  PREDICTED: ATP-dependent RNA helicase p62 is...    346   9e-105   
gb|EFN81574.1|  Probable ATP-dependent RNA helicase DDX17               350   9e-105   
ref|XP_008555059.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    350   9e-105   
ref|XP_001971526.1|  GG15018                                            353   1e-104   Drosophila erecta
ref|XP_002093968.1|  GE20460                                            352   1e-104   Drosophila yakuba
ref|XP_002426835.1|  DEAD box ATP-dependent RNA helicase, putative      348   1e-104   Pediculus humanus corporis [human body lice]
ref|XP_001778715.1|  predicted protein                                  345   1e-104   
gb|EZA62252.1|  putative ATP-dependent RNA helicase DDX5                345   1e-104   
emb|CDO96429.1|  unnamed protein product                                345   1e-104   
ref|XP_002135506.1|  GA28589                                            352   1e-104   Drosophila pseudoobscura pseudoobscura
gb|EFN64357.1|  Probable ATP-dependent RNA helicase DDX5                347   1e-104   
ref|XP_002083905.1|  GD13105                                            352   2e-104   Drosophila simulans
ref|XP_003706564.1|  PREDICTED: probable ATP-dependent RNA helica...    349   2e-104   
sp|A5DL80.3|DBP2_PICGU  RecName: Full=ATP-dependent RNA helicase ...    344   2e-104   Meyerozyma guilliermondii
ref|XP_006615333.1|  PREDICTED: probable ATP-dependent RNA helica...    349   2e-104   
ref|XP_003691490.1|  PREDICTED: probable ATP-dependent RNA helica...    349   2e-104   
ref|XP_006615332.1|  PREDICTED: probable ATP-dependent RNA helica...    349   2e-104   
ref|XP_011054428.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    347   2e-104   
dbj|BAO41526.1|  ATP-dependent RNA helicase DBP2                        343   2e-104   
gb|EMG48788.1|  ATP-dependent RNA helicase DBP2                         343   3e-104   
ref|XP_001653435.1|  DEAD box ATP-dependent RNA helicase                353   3e-104   Aedes aegypti
gb|EFN75298.1|  Probable ATP-dependent RNA helicase DDX5                346   3e-104   
ref|XP_001956121.1|  GF24750                                            345   3e-104   Drosophila ananassae
ref|XP_001958367.1|  GF10884                                            351   3e-104   Drosophila ananassae
gb|KDR12221.1|  putative ATP-dependent RNA helicase DDX5                347   4e-104   
ref|XP_002106416.1|  GD16140                                            350   4e-104   Drosophila simulans
ref|XP_005993826.1|  PREDICTED: probable ATP-dependent RNA helica...    343   4e-104   
ref|XP_004201815.1|  Piso0_002019                                       343   4e-104   
ref|XP_008209138.1|  PREDICTED: probable ATP-dependent RNA helica...    344   4e-104   
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg             342   4e-104   
ref|XP_001690022.1|  DEAD-box RNA helicase                              342   4e-104   Chlamydomonas reinhardtii
ref|XP_004518941.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    342   4e-104   
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                    344   5e-104   
gb|ERL94437.1|  hypothetical protein D910_11714                         342   5e-104   
ref|XP_008209139.1|  PREDICTED: probable ATP-dependent RNA helica...    344   5e-104   
ref|XP_001605403.2|  PREDICTED: probable ATP-dependent RNA helica...    344   5e-104   Nasonia vitripennis
ref|XP_003397328.1|  PREDICTED: probable ATP-dependent RNA helica...    348   5e-104   
ref|XP_003646993.1|  hypothetical protein Ecym_5422                     343   6e-104   
ref|XP_003491789.1|  PREDICTED: probable ATP-dependent RNA helica...    348   6e-104   
ref|XP_001602045.2|  PREDICTED: ATP-dependent RNA helicase dbp2-l...    345   6e-104   Nasonia vitripennis
ref|XP_010554902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    344   8e-104   
emb|CDY10596.1|  BnaC03g70180D                                          341   8e-104   
gb|EGI65460.1|  Putative ATP-dependent RNA helicase DDX17               347   8e-104   
gb|EZA54645.1|  putative ATP-dependent RNA helicase DDX17               347   9e-104   
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   9e-104   
ref|XP_007013410.1|  P-loop containing nucleoside triphosphate hy...    345   9e-104   
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   9e-104   
ref|XP_003493914.1|  PREDICTED: probable ATP-dependent RNA helica...    342   1e-103   
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   1e-103   
ref|XP_395774.2|  PREDICTED: probable ATP-dependent RNA helicase ...    342   1e-103   Apis mellifera [bee]
ref|XP_003690078.1|  PREDICTED: probable ATP-dependent RNA helica...    342   1e-103   
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   1e-103   
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg                340   1e-103   
ref|XP_006560268.1|  PREDICTED: probable ATP-dependent RNA helica...    343   1e-103   
emb|CCE27540.1|  probable RNA helicase dbp2 (DEAD box protein)          342   1e-103   
ref|XP_006621258.1|  PREDICTED: probable ATP-dependent RNA helica...    343   1e-103   
ref|XP_002055665.1|  GJ19487                                            352   2e-103   Drosophila virilis
ref|XP_006560269.1|  PREDICTED: probable ATP-dependent RNA helica...    342   2e-103   
gb|KHG00046.1|  DEAD-box ATP-dependent RNA helicase 52B                 344   2e-103   
dbj|BAN20948.1|  DEAD box ATP-dependent RNA helicase                    348   2e-103   
ref|XP_004529456.1|  PREDICTED: probable ATP-dependent RNA helica...    352   2e-103   
ref|XP_010534903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-103   
gb|EZA62386.1|  putative ATP-dependent RNA helicase DDX17               342   2e-103   
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                    340   2e-103   
ref|XP_006656210.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    343   2e-103   
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                    339   2e-103   
gb|KFP69316.1|  putative ATP-dependent RNA helicase DDX17               337   2e-103   
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase                340   2e-103   
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   2e-103   
ref|NP_572424.1|  CG10777, isoform B                                    352   2e-103   Drosophila melanogaster
gb|AHG63129.1|  ATP-dependent RNA helicase RhlE                         339   2e-103   
gb|EQK99950.1|  ATP-dependent RNA helicase dbp-2                        338   2e-103   
emb|CDY02459.1|  BnaA08g00660D                                          340   2e-103   
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20                340   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003489670.1|  PREDICTED: probable ATP-dependent RNA helica...    343   2e-103   
gb|EMT09661.1|  DEAD-box ATP-dependent RNA helicase 20                  337   2e-103   
ref|XP_003400944.1|  PREDICTED: probable ATP-dependent RNA helica...    343   2e-103   
gb|EFN89962.1|  Probable ATP-dependent RNA helicase DDX17               341   2e-103   
ref|XP_002493605.1|  Essential ATP-dependent RNA helicase of the ...    341   2e-103   Komagataella phaffii GS115
ref|NP_001130628.1|  putative DEAD-box ATP-dependent RNA helicase...    343   2e-103   Zea mays [maize]
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   2e-103   
ref|XP_001867417.1|  ATP-dependent RNA helicase p62                     344   3e-103   Culex quinquefasciatus
ref|XP_003697465.1|  PREDICTED: probable ATP-dependent RNA helica...    343   3e-103   
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    343   3e-103   
ref|XP_010768436.1|  PREDICTED: probable ATP-dependent RNA helica...    343   3e-103   
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein                341   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_623193.4|  PREDICTED: probable ATP-dependent RNA helicase ...    341   3e-103   Apis mellifera [bee]
gb|EPS58220.1|  hypothetical protein M569_16595                         341   3e-103   
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   3e-103   
ref|XP_002044465.1|  GM11962                                            351   4e-103   Drosophila sechellia
ref|XP_003399019.1|  PREDICTED: ATP-dependent RNA helicase p62-like     340   4e-103   
ref|XP_009073300.1|  PREDICTED: probable ATP-dependent RNA helica...    338   4e-103   
ref|XP_003699317.1|  PREDICTED: ATP-dependent RNA helicase p62-like     340   4e-103   
ref|XP_006354152.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    342   4e-103   
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                   339   4e-103   
ref|XP_001992482.1|  GH24775                                            352   4e-103   Drosophila grimshawi
ref|XP_004518940.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    342   4e-103   
ref|XP_003707128.1|  PREDICTED: probable ATP-dependent RNA helica...    341   5e-103   
ref|XP_004931451.1|  PREDICTED: probable ATP-dependent RNA helica...    348   5e-103   
gb|AAI34864.1|  LOC556764 protein                                       339   5e-103   Danio rerio [leopard danio]
gb|ADB44900.1|  DEAD(Asp-Glu-Ala-Asp) box polypeptide 5                 340   5e-103   
ref|XP_004981371.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    343   5e-103   
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   5e-103   
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg             338   5e-103   
ref|XP_008328999.1|  PREDICTED: probable ATP-dependent RNA helica...    338   5e-103   
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570             338   5e-103   
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein           338   6e-103   
ref|XP_004931452.1|  PREDICTED: probable ATP-dependent RNA helica...    348   6e-103   
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   6e-103   
ref|XP_011068510.1|  PREDICTED: probable ATP-dependent RNA helica...    341   6e-103   
gb|KFV68880.1|  putative ATP-dependent RNA helicase DDX17               337   6e-103   
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   6e-103   
gb|EMC76814.1|  putative ATP-dependent RNA helicase DDX17               338   6e-103   
ref|XP_011068511.1|  PREDICTED: probable ATP-dependent RNA helica...    341   6e-103   
ref|XP_002775023.1|  RNA helicase, putative                             343   6e-103   Perkinsus marinus ATCC 50983
ref|XP_009603916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   7e-103   
gb|KGG52981.1|  hypothetical protein DI09_11p260                        339   7e-103   
gb|KFZ49707.1|  putative ATP-dependent RNA helicase DDX17               337   7e-103   
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                  338   7e-103   
gb|KFO61287.1|  putative ATP-dependent RNA helicase DDX17               337   7e-103   
gb|KFO06156.1|  putative ATP-dependent RNA helicase DDX17               337   7e-103   
gb|KFP74117.1|  putative ATP-dependent RNA helicase DDX17               337   7e-103   
ref|XP_005176971.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    342   7e-103   
gb|KGL73587.1|  putative ATP-dependent RNA helicase DDX17               337   7e-103   
gb|KFQ42674.1|  putative ATP-dependent RNA helicase DDX17               337   7e-103   
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700          338   7e-103   
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30                341   7e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002976623.1|  hypothetical protein SELMODRAFT_151274             341   7e-103   
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   8e-103   
emb|CDM81540.1|  unnamed protein product                                338   8e-103   
gb|AFK42127.1|  unknown                                                 338   8e-103   
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   8e-103   
gb|ABR16327.1|  unknown                                                 338   9e-103   Picea sitchensis
gb|KFR08900.1|  putative ATP-dependent RNA helicase DDX17               338   9e-103   
gb|KFP10244.1|  putative ATP-dependent RNA helicase DDX17               337   9e-103   
ref|XP_004523443.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    342   1e-102   
ref|XP_008555054.1|  PREDICTED: probable ATP-dependent RNA helica...    340   1e-102   
ref|XP_008555055.1|  PREDICTED: probable ATP-dependent RNA helica...    340   1e-102   
gb|KFW90864.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   1e-102   
ref|XP_002776285.1|  RNA helicase, putative                             343   1e-102   Perkinsus marinus ATCC 50983
gb|KFQ23731.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFZ60114.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFP53210.1|  putative ATP-dependent RNA helicase DDX17               338   1e-102   
ref|XP_008555053.1|  PREDICTED: probable ATP-dependent RNA helica...    340   1e-102   
gb|KFV00645.1|  putative ATP-dependent RNA helicase DDX17               338   1e-102   
ref|XP_004362848.1|  putative RNA helicase                              347   1e-102   
gb|KFO81715.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFQ77919.1|  putative ATP-dependent RNA helicase DDX17               338   1e-102   
gb|KFV60123.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFV75709.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFO95968.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg             340   1e-102   
gb|KFQ18808.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFM02164.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFQ80585.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFP37484.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg             338   1e-102   
ref|XP_008555056.1|  PREDICTED: probable ATP-dependent RNA helica...    340   1e-102   
ref|XP_008544242.1|  PREDICTED: ATP-dependent RNA helicase dbp2-like    341   1e-102   
ref|XP_007145713.1|  hypothetical protein PHAVU_007G262000g             341   1e-102   
ref|XP_002067260.1|  GK16276                                            350   1e-102   
gb|KFQ57153.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
gb|KFP59950.1|  putative ATP-dependent RNA helicase DDX17               337   1e-102   
ref|XP_504478.1|  YALI0E27715p                                          339   1e-102   
gb|KFO88513.1|  putative ATP-dependent RNA helicase DDX17               337   2e-102   
gb|AAI17661.1|  LOC556764 protein                                       338   2e-102   
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494             340   2e-102   
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                   337   2e-102   
gb|EGI69554.1|  Putative ATP-dependent RNA helicase DDX17               340   2e-102   
ref|XP_002060316.1|  GJ16043                                            340   2e-102   
gb|KGL90702.1|  putative ATP-dependent RNA helicase DDX17               337   2e-102   
gb|KFR10998.1|  putative ATP-dependent RNA helicase DDX17               337   2e-102   
ref|XP_007239643.1|  PREDICTED: probable ATP-dependent RNA helica...    337   2e-102   
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg             337   2e-102   
ref|XP_007014728.1|  Dead box ATP-dependent RNA helicase, putativ...    341   2e-102   
ref|XP_006675622.1|  hypothetical protein BATDEDRAFT_29115              337   2e-102   
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   2e-102   
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-102   
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-102   
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-102   
gb|EHJ75591.1|  hypothetical protein KGM_15102                          335   2e-102   
ref|XP_003692261.1|  PREDICTED: ATP-dependent RNA helicase p62-like     338   2e-102   
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative      337   2e-102   
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-102   
ref|XP_002101215.1|  GE17497                                            350   2e-102   
ref|XP_003485490.1|  PREDICTED: ATP-dependent RNA helicase p62-like     337   2e-102   
ref|XP_011072507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-102   
ref|XP_001773533.1|  predicted protein                                  340   2e-102   
ref|XP_009785248.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   2e-102   
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    339   3e-102   
ref|NP_731033.1|  Rm62, isoform C                                       339   3e-102   
emb|CAA37037.1|  unnamed protein product                                339   3e-102   
ref|XP_003701916.1|  PREDICTED: probable ATP-dependent RNA helica...    340   3e-102   
ref|XP_008544268.1|  PREDICTED: probable ATP-dependent RNA helica...    344   3e-102   
ref|NP_731032.1|  Rm62, isoform E                                       339   3e-102   
ref|XP_006492811.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   3e-102   
ref|XP_002283489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   3e-102   
gb|KDR17563.1|  putative ATP-dependent RNA helicase DDX5                342   3e-102   
ref|XP_001865019.1|  DEAD box ATP-dependent RNA helicase                342   3e-102   
ref|XP_009863069.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-102   
ref|NP_001191665.1|  ATP-dependent RNA helicase DDX5                    340   3e-102   
ref|XP_004234756.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   3e-102   
ref|XP_009924066.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-102   
ref|XP_004523442.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    343   3e-102   
ref|XP_009502718.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-102   
gb|EGI60733.1|  Putative ATP-dependent RNA helicase DDX5                339   3e-102   
ref|NP_731031.1|  Rm62, isoform D                                       339   3e-102   
ref|XP_009979992.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-102   
ref|XP_001355346.2|  GA10556                                            348   3e-102   
ref|XP_001978588.1|  GG17597                                            349   3e-102   
ref|XP_009972429.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-102   
ref|XP_010746618.1|  PREDICTED: probable ATP-dependent RNA helica...    341   4e-102   
ref|XP_006837823.1|  hypothetical protein AMTR_s00104p00136740          341   4e-102   
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   4e-102   
gb|EFA01112.1|  hypothetical protein TcasGA2_TC010324                   339   4e-102   
gb|KHN39300.1|  DEAD-box ATP-dependent RNA helicase 20                  334   4e-102   
ref|XP_004523441.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    343   4e-102   
ref|XP_006623000.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    337   4e-102   
ref|XP_009045278.1|  hypothetical protein LOTGIDRAFT_110000             336   4e-102   
ref|XP_010307626.1|  PREDICTED: probable ATP-dependent RNA helica...    338   4e-102   
ref|XP_011062225.1|  PREDICTED: ATP-dependent RNA helicase dbp2-like    340   4e-102   
ref|XP_007029089.1|  P-loop containing nucleoside triphosphate hy...    340   4e-102   
ref|XP_003701915.1|  PREDICTED: probable ATP-dependent RNA helica...    340   5e-102   
ref|XP_008198995.1|  PREDICTED: ATP-dependent RNA helicase dbp2-like    339   5e-102   
gb|EXX56938.1|  Dbp2p                                                   339   5e-102   
gb|EZA62250.1|  putative ATP-dependent RNA helicase DDX5                337   5e-102   
ref|XP_006385358.1|  DEAD box RNA helicase family protein               336   5e-102   
ref|XP_004294989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   5e-102   
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg             339   5e-102   
gb|EDL33793.1|  mCG19408                                                340   5e-102   
ref|XP_002531166.1|  dead box ATP-dependent RNA helicase, putative      338   6e-102   
ref|XP_002973432.1|  hypothetical protein SELMODRAFT_52088              336   6e-102   
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    336   6e-102   
ref|XP_002955411.1|  DEAD-box RNA helicase, ATP-dependent               337   6e-102   
ref|XP_006622999.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    337   6e-102   
ref|XP_010524794.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    339   6e-102   
ref|XP_005183399.1|  PREDICTED: probable ATP-dependent RNA helica...    342   6e-102   
ref|XP_005797543.1|  PREDICTED: probable ATP-dependent RNA helica...    340   7e-102   
emb|CDM82047.1|  unnamed protein product                                344   7e-102   
gb|KHG22973.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    339   7e-102   
gb|EFA81766.1|  putative RNA helicase                                   345   7e-102   
ref|XP_008415927.1|  PREDICTED: probable ATP-dependent RNA helica...    340   7e-102   
ref|XP_003240334.1|  PREDICTED: ATP-dependent RNA helicase p62-like     336   7e-102   
ref|XP_007574088.1|  PREDICTED: probable ATP-dependent RNA helica...    340   7e-102   
gb|AAI54494.1|  LOC556764 protein                                       336   7e-102   
gb|KDP26941.1|  hypothetical protein JCGZ_21034                         339   7e-102   
ref|XP_008929884.1|  PREDICTED: probable ATP-dependent RNA helica...    338   8e-102   
gb|KHG12304.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    339   8e-102   
ref|XP_006429937.1|  hypothetical protein CICLE_v10011322mg             339   8e-102   
ref|XP_002949526.1|  hypothetical protein VOLCADRAFT_59325              342   9e-102   
gb|KDO70827.1|  hypothetical protein CISIN_1g007368mg                   339   9e-102   
ref|XP_002976475.1|  hypothetical protein SELMODRAFT_105510             339   9e-102   
ref|XP_009330949.1|  PREDICTED: probable ATP-dependent RNA helica...    338   9e-102   
gb|EWM27261.1|  dead-box atp-dependent rna helicase                     335   1e-101   
gb|EFQ25261.1|  DEAD/DEAH box helicase                                  337   1e-101   
ref|XP_010168247.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_002026077.1|  GL16096                                            337   1e-101   
ref|XP_005176970.1|  PREDICTED: ATP-dependent RNA helicase p62-li...    343   1e-101   
ref|XP_008328998.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
gb|KDR17555.1|  putative ATP-dependent RNA helicase DDX17               342   1e-101   
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative           342   1e-101   
ref|XP_009599889.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   1e-101   
ref|XP_005934556.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
ref|XP_009481222.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_010225318.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_005934555.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
ref|XP_010145760.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_007208033.1|  hypothetical protein PRUPE_ppa002959mg             339   1e-101   
ref|XP_005584769.1|  PREDICTED: probable ATP-dependent RNA helica...    337   1e-101   
ref|XP_005470257.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342             335   1e-101   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...    340   1e-101   
ref|WP_024007115.1|  DEAD/DEAH box helicase                             334   1e-101   
ref|XP_009584901.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_008315294.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
dbj|BAE87404.1|  unnamed protein product                                337   1e-101   
ref|XP_005514775.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_003533906.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   1e-101   
ref|XP_004539285.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
ref|XP_004563118.1|  PREDICTED: probable ATP-dependent RNA helica...    335   1e-101   
ref|XP_010013794.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_004539284.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
ref|XP_010085938.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_004228610.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   1e-101   
gb|EOB03912.1|  Putative ATP-dependent RNA helicase DDX17               338   1e-101   
ref|XP_008290039.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
gb|KDP40778.1|  hypothetical protein JCGZ_24777                         335   1e-101   
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   1e-101   
ref|XP_009951301.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_001955183.1|  GF18634                                            341   1e-101   
ref|XP_009933308.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_003448018.1|  PREDICTED: probable ATP-dependent RNA helica...    339   1e-101   
gb|ETN66630.1|  DEAD box ATP-dependent RNA helicase                     340   1e-101   
ref|XP_007431410.1|  PREDICTED: probable ATP-dependent RNA helica...    338   1e-101   
ref|XP_010185205.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_009646040.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_008939400.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_001510775.2|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
gb|EQB53300.1|  hypothetical protein CGLO_06986                         333   2e-101   
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   2e-101   
ref|XP_006560064.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_003745777.1|  PREDICTED: ATP-dependent RNA helicase p62-like     336   2e-101   
ref|XP_006790684.1|  PREDICTED: probable ATP-dependent RNA helica...    336   2e-101   
ref|XP_009805513.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
gb|KFB45018.1|  AGAP005652-PA-like protein                              342   2e-101   
ref|XP_006621259.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_002285108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   2e-101   
ref|XP_008634834.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_002973232.1|  hypothetical protein SELMODRAFT_267628             338   2e-101   
ref|XP_004340175.1|  ATPdependent RNA helicase DBP2, putative           336   2e-101   
ref|XP_008240826.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   2e-101   
ref|XP_009767732.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    336   2e-101   
ref|XP_007431409.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_010408888.1|  PREDICTED: probable ATP-dependent RNA helica...    339   2e-101   
ref|XP_003697466.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                   338   2e-101   
prf||1406327A  growth regulated nuclear 68 protein                      337   2e-101
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   2e-101   
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    334   2e-101   
ref|XP_001379329.2|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   2e-101   
ref|XP_006090871.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_008575122.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
ref|XP_009900873.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
emb|CDP14280.1|  unnamed protein product                                338   2e-101   
gb|KHG25034.1|  DEAD-box ATP-dependent RNA helicase 37 -like protein    338   2e-101   
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   2e-101   
ref|XP_010208864.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    338   2e-101   
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   2e-101   
ref|XP_008147637.1|  PREDICTED: probable ATP-dependent RNA helica...    338   2e-101   
emb|CAA46581.1|  p68 RNA helicase                                       338   2e-101   
emb|CDQ70726.1|  unnamed protein product                                338   2e-101   
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    334   2e-101   
ref|XP_010854711.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   
gb|KFM70435.1|  putative ATP-dependent RNA helicase DDX5                335   3e-101   
ref|XP_008349416.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   3e-101   
ref|XP_003976906.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    334   3e-101   
ref|XP_006092504.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    334   3e-101   
ref|XP_007527735.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_010132422.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_010288347.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_005738053.1|  PREDICTED: probable ATP-dependent RNA helica...    334   3e-101   
ref|XP_005468521.1|  PREDICTED: probable ATP-dependent RNA helica...    334   3e-101   
ref|XP_010549900.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    337   3e-101   
gb|EHH58260.1|  hypothetical protein EGM_08064                          337   3e-101   
ref|XP_001963936.1|  GF20995                                            347   3e-101   
ref|NP_031866.2|  probable ATP-dependent RNA helicase DDX5              338   3e-101   
ref|XP_001763089.1|  predicted protein                                  334   3e-101   
ref|XP_006146842.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_002176921.1|  predicted protein                                  335   3e-101   
ref|XP_005016061.1|  PREDICTED: probable ATP-dependent RNA helica...    338   3e-101   
ref|XP_008384403.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   3e-101   
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552              335   3e-101   
ref|XP_004900897.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   
ref|XP_005694069.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   
gb|KFV83443.1|  putative ATP-dependent RNA helicase DDX5                337   3e-101   
ref|XP_005282962.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   
ref|XP_004593035.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   
gb|ACN11269.1|  Probable ATP-dependent RNA helicase DDX5                337   3e-101   
ref|XP_009566745.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   
ref|XP_002719530.1|  PREDICTED: probable ATP-dependent RNA helica...    337   3e-101   



>ref|XP_006362049.1| PREDICTED: ATP-dependent RNA helicase DBP2-like [Solanum tuberosum]
Length=558

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/570 (81%), Positives = 493/570 (86%), Gaps = 17/570 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNS-----TTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDA  2071
             MSYVPPHLRNS     TT  T+ S G DH  S+  SR +PS  +S NG+       SN A
Sbjct  1     MSYVPPHLRNSAAGKTTTTPTINSKGADHFSSKHTSR-IPSLEKSSNGY-------SNSA  52

Query  2070  GRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPA  1891
              R+S   +NY  P  +  PDP FP WKPSERVL  K EQIEEIRLRLNVDV V+  S PA
Sbjct  53    RRSS---LNYSLPNTVAVPDPAFPHWKPSERVLRLKSEQIEEIRLRLNVDVNVSPGSCPA  109

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P+P+ESF DMCL  SIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAF+
Sbjct  110   PSPIESFPDMCLDASIMKDIEKHGYTAPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFS  169

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             IPMIQHCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS SLDSFKTAIVVGGTNI 
Sbjct  170   IPMIQHCLAQQPLQRGDGPLALVLAPTRELAQQIEKEVTAFSMSLDSFKTAIVVGGTNIS  229

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
             +QRSELRAGV+IVVATPGRLIDHLQQGNTSLSRI+FVVLDEADRMLDMGFEPQIREVM N
Sbjct  230   EQRSELRAGVHIVVATPGRLIDHLQQGNTSLSRIAFVVLDEADRMLDMGFEPQIREVMRN  289

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRL  1171
             LP KHQTLLFSATMPAEIEALAQ+YLT+PVR+KVG VSSPTANV+Q LEKVPEN+KID L
Sbjct  290   LPVKHQTLLFSATMPAEIEALAQDYLTNPVRIKVGKVSSPTANVSQTLEKVPENDKIDHL  349

Query  1170  LDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAA  991
             LDLLVEE+AQAEKSGHPF LTIVFVERKTKC+EVAEAL +QGLLATALHGGRSQ+EREAA
Sbjct  350   LDLLVEEAAQAEKSGHPFPLTIVFVERKTKCDEVAEALTQQGLLATALHGGRSQNEREAA  409

Query  990   LRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATS  811
             LRDFR GP +ILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTG+ATS
Sbjct  410   LRDFRHGPINILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGRATS  469

Query  810   FYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGS  631
             FYTDRDMYLVAQIR+AIAD+GSGN VT A GKTARRKEREAAAA KEA   LSKLSL+GS
Sbjct  470   FYTDRDMYLVAQIRRAIADIGSGNDVTIAMGKTARRKEREAAAAEKEARSELSKLSLVGS  529

Query  630   TPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             T +NVEDKYRHMIAP+M +KEGAAD AWDD
Sbjct  530   T-VNVEDKYRHMIAPSMIKKEGAADDAWDD  558



>ref|XP_011089533.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Sesamum 
indicum]
Length=566

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/568 (79%), Positives = 489/568 (86%), Gaps = 5/568 (1%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTAT--TVVSNG-GDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGR  2065
             MSYVPPHLR+S+ AT    V NG  D  H +        FT +KN + +     S +AG 
Sbjct  1     MSYVPPHLRSSSAATIAATVGNGVADQFHPKQVKSSSTKFTSAKNNYSTGNSINSGNAGY  60

Query  2064  NSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPA  1885
              S  +   +S R +VAPDPVFPQWKPS+RVL  K EQ++E+RLRLNVDV+V  DS  APA
Sbjct  61    RSSGS--GVSTRNVVAPDPVFPQWKPSDRVLRLKPEQVQEVRLRLNVDVSVPPDSLHAPA  118

Query  1884  PVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIP  1705
             P+E+F DM LH SIMKDIA H+YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAFTIP
Sbjct  119   PIEAFADMNLHTSIMKDIAFHEYTTPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFTIP  178

Query  1704  MIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQ  1525
             MIQHCLAQPP++RG GPLALVLAPTRELAQQIE EVKAFSRSLDSFKTAIVVGGTN+ +Q
Sbjct  179   MIQHCLAQPPIQRGVGPLALVLAPTRELAQQIEKEVKAFSRSLDSFKTAIVVGGTNMAEQ  238

Query  1524  RSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLP  1345
             RSELRAGV+IVVATPGR IDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM NLP
Sbjct  239   RSELRAGVHIVVATPGRFIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMQNLP  298

Query  1344  KKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLD  1165
             +KHQTLLFSATMP EIE LAQEYLT+PVRVKVG VSSPTANV+QILEKVPENEKIDRLLD
Sbjct  299   QKHQTLLFSATMPVEIEELAQEYLTNPVRVKVGKVSSPTANVSQILEKVPENEKIDRLLD  358

Query  1164  LLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALR  985
             +LVE +A++E+   PF LTIVFVERK++C+EVAEAL +QGL A ALHGGRSQSEREAALR
Sbjct  359   ILVEAAAESERFDRPFPLTIVFVERKSRCDEVAEALTEQGLQAAALHGGRSQSEREAALR  418

Query  984   DFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFY  805
             DFR GPT ILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFY
Sbjct  419   DFRHGPTRILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFY  478

Query  804   TDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTP  625
             TDRD+YLVAQIRKAI D  SGNT+T+A GKTARRKE+EA AA KEA + LSKLSL+GST 
Sbjct  479   TDRDVYLVAQIRKAIQDADSGNTITYAIGKTARRKEKEAIAAQKEAKVELSKLSLVGSTG  538

Query  624   INVEDKYRHMIAPAMSRKEGAADGAWDD  541
             INVEDKYRHMIAPA+ RKEGAAD AWDD
Sbjct  539   INVEDKYRHMIAPAVIRKEGAADDAWDD  566



>ref|XP_004246279.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum lycopersicum]
Length=558

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/570 (80%), Positives = 492/570 (86%), Gaps = 17/570 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNS-----TTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDA  2071
             MSYVPPHLRNS     TT  T+ S G DH  S+  SR + S  +S NG+       S+ A
Sbjct  1     MSYVPPHLRNSAAGKTTTTPTINSIGADHFSSKHTSR-ISSLEKSSNGY-------SSSA  52

Query  2070  GRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPA  1891
              R+S   +NY  P     PDP+FP WKPSERVL  K EQIEEIRLRLNVDV V+  S PA
Sbjct  53    RRSS---LNYSLPNTFAVPDPIFPHWKPSERVLRLKSEQIEEIRLRLNVDVNVSPVSCPA  109

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P+P+ESF DMCLH SIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAF+
Sbjct  110   PSPIESFPDMCLHASIMKDIEKHGYTAPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFS  169

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             IPMIQHCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS SLDSFKTAIVVGGTNI 
Sbjct  170   IPMIQHCLAQQPLQRGDGPLALVLAPTRELAQQIEKEVTAFSMSLDSFKTAIVVGGTNIS  229

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
             +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RI+FVVLDEADRMLDMGFEPQIREVM N
Sbjct  230   EQRSELRAGVHIVVATPGRLIDHLQQGNTSLGRIAFVVLDEADRMLDMGFEPQIREVMRN  289

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRL  1171
             LP KHQTLLFSATMPAEIEALAQ+YLT+PVR+KVG VSSPTANV+Q LEKVPEN+KIDRL
Sbjct  290   LPVKHQTLLFSATMPAEIEALAQDYLTNPVRIKVGKVSSPTANVSQTLEKVPENDKIDRL  349

Query  1170  LDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAA  991
             LDLLVEE+AQAEKSGHPF LTIVFVERKTKC+EVAEAL +QGLLATALHGGRSQ+EREAA
Sbjct  350   LDLLVEEAAQAEKSGHPFPLTIVFVERKTKCDEVAEALTQQGLLATALHGGRSQNEREAA  409

Query  990   LRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATS  811
             LRDFR GP +ILV+TDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTG+ATS
Sbjct  410   LRDFRHGPINILVSTDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGRATS  469

Query  810   FYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGS  631
             FYTDRDMYLVAQIR+AIAD+GSGN VT A GKTARRKEREAAAA KEA   LSK SL+GS
Sbjct  470   FYTDRDMYLVAQIRRAIADIGSGNDVTIAMGKTARRKEREAAAAEKEARSELSKFSLVGS  529

Query  630   TPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             T +NVEDKYRHMIAP+M +KEGAAD AWDD
Sbjct  530   T-VNVEDKYRHMIAPSMIKKEGAADDAWDD  558



>ref|XP_009796073.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nicotiana sylvestris]
Length=564

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/570 (79%), Positives = 488/570 (86%), Gaps = 11/570 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSN----GGDHLHSELNSRQLPSFTQSK-NGFISNGEYCSNDA  2071
             MSYVPPHLRNS+   T   N    G DH  S+L+S Q       + + F SNG   S+  
Sbjct  1     MSYVPPHLRNSSAGKTTTLNSNGAGADHFSSKLSSHQSRIHCNGELDKFSSNGYSNSSRR  60

Query  2070  GRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPA  1891
                + +T +  +      PDP FPQWKPSERVL  K EQIEEIRLRLNVDV VA  S+ A
Sbjct  61    SSVNYSTTSRTA-----IPDPEFPQWKPSERVLRLKSEQIEEIRLRLNVDVNVAPGSSSA  115

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             PAP+ESF DMCLHPSIMKDI  H YT PTS+QAQ+MPVALSGRDLLGCAETGSGKTAAF+
Sbjct  116   PAPIESFPDMCLHPSIMKDIEKHGYTAPTSIQAQSMPVALSGRDLLGCAETGSGKTAAFS  175

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             IPMIQHCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS SLDSFKTAIVVGGT+I 
Sbjct  176   IPMIQHCLAQQPLQRGDGPLALVLAPTRELAQQIEQEVTAFSLSLDSFKTAIVVGGTSIS  235

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
             +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RISFVVLDEADRMLDMGFEPQIREVM N
Sbjct  236   EQRSELRAGVHIVVATPGRLIDHLQQGNTSLCRISFVVLDEADRMLDMGFEPQIREVMRN  295

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRL  1171
             LP+KHQTLLFSATMP EIEALAQ+YLT+PVR+KVG VSSPTANV QILEKVPEN+KIDRL
Sbjct  296   LPEKHQTLLFSATMPTEIEALAQDYLTNPVRIKVGKVSSPTANVFQILEKVPENDKIDRL  355

Query  1170  LDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAA  991
             LDLLVEE+AQ+E+SGHPF LTIVFVERKTKC+EVAEAL +QGLLATALHGGRSQSEREAA
Sbjct  356   LDLLVEEAAQSERSGHPFPLTIVFVERKTKCDEVAEALTQQGLLATALHGGRSQSEREAA  415

Query  990   LRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATS  811
             LRDFR GP +ILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTG+ATS
Sbjct  416   LRDFRHGPINILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGRATS  475

Query  810   FYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGS  631
             FYTDRDMYLVAQIR+AIAD+GSGN VTFA GKTARRKEREAAAA KEA   LSKLSL+ S
Sbjct  476   FYTDRDMYLVAQIRRAIADIGSGNDVTFAMGKTARRKEREAAAAEKEARSTLSKLSLVES  535

Query  630   TPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
               +NVEDKYRHMI PAM +KEGAAD AWDD
Sbjct  536   A-VNVEDKYRHMITPAMIKKEGAADDAWDD  564



>ref|XP_010325759.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum lycopersicum]
Length=598

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/610 (75%), Positives = 492/610 (81%), Gaps = 57/610 (9%)
 Frame = -3

Query  2235  MSYVPPHLRNS-----TTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDA  2071
             MSYVPPHLRNS     TT  T+ S G DH  S+  SR + S  +S NG+       S+ A
Sbjct  1     MSYVPPHLRNSAAGKTTTTPTINSIGADHFSSKHTSR-ISSLEKSSNGY-------SSSA  52

Query  2070  GRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPA  1891
              R+S   +NY  P     PDP+FP WKPSERVL  K EQIEEIRLRLNVDV V+  S PA
Sbjct  53    RRSS---LNYSLPNTFAVPDPIFPHWKPSERVLRLKSEQIEEIRLRLNVDVNVSPVSCPA  109

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P+P+ESF DMCLH SIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAF+
Sbjct  110   PSPIESFPDMCLHASIMKDIEKHGYTAPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFS  169

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             IPMIQHCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS SLDSFKTAIVVGGTNI 
Sbjct  170   IPMIQHCLAQQPLQRGDGPLALVLAPTRELAQQIEKEVTAFSMSLDSFKTAIVVGGTNIS  229

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
             +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RI+FVVLDEADRMLDMGFEPQIREVM N
Sbjct  230   EQRSELRAGVHIVVATPGRLIDHLQQGNTSLGRIAFVVLDEADRMLDMGFEPQIREVMRN  289

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEK----  1183
             LP KHQTLLFSATMPAEIEALAQ+YLT+PVR+KVG VSSPTANV+Q LEKVPEN+K    
Sbjct  290   LPVKHQTLLFSATMPAEIEALAQDYLTNPVRIKVGKVSSPTANVSQTLEKVPENDKVPQQ  349

Query  1182  ------------------------------------IDRLLDLLVEESAQAEKSGHPFSL  1111
                                                 IDRLLDLLVEE+AQAEKSGHPF L
Sbjct  350   YNNLAMREETTSLPPRGRGKVCEHSTLQTLSMGLHWIDRLLDLLVEEAAQAEKSGHPFPL  409

Query  1110  TIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASR  931
             TIVFVERKTKC+EVAEAL +QGLLATALHGGRSQ+EREAALRDFR GP +ILV+TDVASR
Sbjct  410   TIVFVERKTKCDEVAEALTQQGLLATALHGGRSQNEREAALRDFRHGPINILVSTDVASR  469

Query  930   GLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADV  751
             GLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTG+ATSFYTDRDMYLVAQIR+AIAD+
Sbjct  470   GLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGRATSFYTDRDMYLVAQIRRAIADI  529

Query  750   GSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRK  571
             GSGN VT A GKTARRKEREAAAA KEA   LSK SL+GST +NVEDKYRHMIAP+M +K
Sbjct  530   GSGNDVTIAMGKTARRKEREAAAAEKEARSELSKFSLVGST-VNVEDKYRHMIAPSMIKK  588

Query  570   EGAADGAWDD  541
             EGAAD AWDD
Sbjct  589   EGAADDAWDD  598



>ref|XP_009600280.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=564

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/573 (79%), Positives = 490/573 (86%), Gaps = 17/573 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTA--TTVVSNGG--DHLHSELNSRQLPSFTQSKNGFISNGEY----CS  2080
             MSYVPPHLRN +    TT+ S+G   D+  S+L+S Q        +    NGE      +
Sbjct  1     MSYVPPHLRNFSAGKTTTLNSDGAAADYFSSKLSSHQ--------SRIHCNGELDKSSSN  52

Query  2079  NDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDS  1900
               +  +  ++VNY +      PDP FPQWKPSERVL  K EQIEEIRLRLNVDV VA  S
Sbjct  53    GYSNSSRRSSVNYSTASRTAIPDPEFPQWKPSERVLRLKSEQIEEIRLRLNVDVNVAPGS  112

Query  1899  NPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTA  1720
             + APAP+ESF DMCLHPSIMKDI  H YT PTS+QAQ+MPVALSGRDLLGCAETGSGKTA
Sbjct  113   SSAPAPIESFPDMCLHPSIMKDIEKHGYTAPTSIQAQSMPVALSGRDLLGCAETGSGKTA  172

Query  1719  AFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGT  1540
             AF+IPMIQHCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS SLDSFKT+IVVGGT
Sbjct  173   AFSIPMIQHCLAQQPLQRGDGPLALVLAPTRELAQQIEKEVTAFSLSLDSFKTSIVVGGT  232

Query  1539  NIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREV  1360
             NI +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RISFVVLDEADRMLDMGFEPQIREV
Sbjct  233   NISEQRSELRAGVHIVVATPGRLIDHLQQGNTSLCRISFVVLDEADRMLDMGFEPQIREV  292

Query  1359  MHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKI  1180
             M NLP+KHQTLLFSATMP EIEALAQ+YLT+PVR+KVG VSSPTANV+QILEKVPEN+KI
Sbjct  293   MRNLPEKHQTLLFSATMPTEIEALAQDYLTNPVRIKVGKVSSPTANVSQILEKVPENDKI  352

Query  1179  DRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSER  1000
             DRLLDLLVEE+AQ+E+SGHPF LTIVFVERKTKC+EVAEAL +QGLLATALHGGRSQSER
Sbjct  353   DRLLDLLVEEAAQSERSGHPFPLTIVFVERKTKCDEVAEALTQQGLLATALHGGRSQSER  412

Query  999   EAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQ  820
             EAALRDFR GP +ILVATDVASRGLDV GV HVINLDLPKTMEDYVHRIGRTGRAGSTG+
Sbjct  413   EAALRDFRHGPINILVATDVASRGLDVTGVGHVINLDLPKTMEDYVHRIGRTGRAGSTGR  472

Query  819   ATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSL  640
             ATSFYTDRDMYLVAQIR+AIAD+GSGN VTFA GKTARRKEREAAAA KEA   LSKLSL
Sbjct  473   ATSFYTDRDMYLVAQIRRAIADIGSGNDVTFAMGKTARRKEREAAAAEKEARSTLSKLSL  532

Query  639   MGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             + S  +NVEDKYRHMI PAM +KEGAAD AWDD
Sbjct  533   VESA-VNVEDKYRHMITPAMIKKEGAADDAWDD  564



>ref|XP_010253045.1| PREDICTED: ATP-dependent RNA helicase DBP2-like [Nelumbo nucifera]
Length=572

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/579 (77%), Positives = 482/579 (83%), Gaps = 21/579 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATT--------------VVSNGGDHLHSELNSRQLPSFTQSKNGFIS  2098
             MSYVPPHLR S+T ++                S   ++ H   +S    S   S +   S
Sbjct  1     MSYVPPHLRTSSTPSSHCLPTATRNSTTTKTSSETLEYDHKFYSSNPHYSLKNSSSAPPS  60

Query  2097  NGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDV  1918
                  SN A R S    N    R L  P+PVF QWKPSERV   K EQIEE+RLRLNVDV
Sbjct  61    ----FSNGARRTSG---NLPLSRALAVPEPVFQQWKPSERVFRLKPEQIEEVRLRLNVDV  113

Query  1917  AVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAET  1738
              VA DS PAPAP+ESFTDMCLH SIMKDIA H+YT PTS+QAQAMPVALSGRDLLGCAET
Sbjct  114   TVASDSPPAPAPIESFTDMCLHSSIMKDIAFHEYTRPTSIQAQAMPVALSGRDLLGCAET  173

Query  1737  GSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTA  1558
             GSGKTAAFTIPMIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EVKAFSRSL+SF+TA
Sbjct  174   GSGKTAAFTIPMIQHCLAQPPIRRGDGPLALVLAPTRELAQQIEKEVKAFSRSLESFRTA  233

Query  1557  IVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFE  1378
             IVVGGTNI +QRSELRAGVNIVVATPGR IDHLQQGNTSLSRISFVVLDEADRMLDMGFE
Sbjct  234   IVVGGTNIAEQRSELRAGVNIVVATPGRFIDHLQQGNTSLSRISFVVLDEADRMLDMGFE  293

Query  1377  PQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKV  1198
             PQIREVM NLPKKHQTLLFSATMP EIEALAQEYLT+PV+VKVG VSSPTANV+QILEKV
Sbjct  294   PQIREVMRNLPKKHQTLLFSATMPVEIEALAQEYLTNPVQVKVGKVSSPTANVSQILEKV  353

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EKIDRLL LLVEE++QAE+SGH   LTIVFVERKT+C+EV EAL+ QGL A ALHGG
Sbjct  354   VESEKIDRLLALLVEEASQAERSGHSLPLTIVFVERKTRCDEVTEALVAQGLHAVALHGG  413

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             RSQSERE+ALRDFR G T+ILVATDVASRGLDV GVAHV+NLDLPKTMEDYVHRIGRTGR
Sbjct  414   RSQSERESALRDFRTGSTNILVATDVASRGLDVTGVAHVVNLDLPKTMEDYVHRIGRTGR  473

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIA  658
             AGSTGQATSFYTDRDM+LVA IRKAIADV SGNTV FATGK ARRKEREAAAA KEA +A
Sbjct  474   AGSTGQATSFYTDRDMFLVAHIRKAIADVESGNTVAFATGKVARRKEREAAAAQKEARLA  533

Query  657   LSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             LS+LS+ G T IN+EDKYR+M+AP   +KEGAAD AWDD
Sbjct  534   LSRLSMTGPTSINIEDKYRYMLAPTNIKKEGAADDAWDD  572



>ref|XP_009600279.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=579

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/588 (77%), Positives = 490/588 (83%), Gaps = 32/588 (5%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTA--TTVVSNGG--DHLHSELNSRQLPSFTQSKNGFISNGEY----CS  2080
             MSYVPPHLRN +    TT+ S+G   D+  S+L+S Q        +    NGE      +
Sbjct  1     MSYVPPHLRNFSAGKTTTLNSDGAAADYFSSKLSSHQ--------SRIHCNGELDKSSSN  52

Query  2079  NDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDS  1900
               +  +  ++VNY +      PDP FPQWKPSERVL  K EQIEEIRLRLNVDV VA  S
Sbjct  53    GYSNSSRRSSVNYSTASRTAIPDPEFPQWKPSERVLRLKSEQIEEIRLRLNVDVNVAPGS  112

Query  1899  NPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTA  1720
             + APAP+ESF DMCLHPSIMKDI  H YT PTS+QAQ+MPVALSGRDLLGCAETGSGKTA
Sbjct  113   SSAPAPIESFPDMCLHPSIMKDIEKHGYTAPTSIQAQSMPVALSGRDLLGCAETGSGKTA  172

Query  1719  AFTIPMIQ---------------HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFS  1585
             AF+IPMIQ               HCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS
Sbjct  173   AFSIPMIQVANFMSMSYCESVSVHCLAQQPLQRGDGPLALVLAPTRELAQQIEKEVTAFS  232

Query  1584  RSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEA  1405
              SLDSFKT+IVVGGTNI +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RISFVVLDEA
Sbjct  233   LSLDSFKTSIVVGGTNISEQRSELRAGVHIVVATPGRLIDHLQQGNTSLCRISFVVLDEA  292

Query  1404  DRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTA  1225
             DRMLDMGFEPQIREVM NLP+KHQTLLFSATMP EIEALAQ+YLT+PVR+KVG VSSPTA
Sbjct  293   DRMLDMGFEPQIREVMRNLPEKHQTLLFSATMPTEIEALAQDYLTNPVRIKVGKVSSPTA  352

Query  1224  NVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQG  1045
             NV+QILEKVPEN+KIDRLLDLLVEE+AQ+E+SGHPF LTIVFVERKTKC+EVAEAL +QG
Sbjct  353   NVSQILEKVPENDKIDRLLDLLVEEAAQSERSGHPFPLTIVFVERKTKCDEVAEALTQQG  412

Query  1044  LLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDY  865
             LLATALHGGRSQSEREAALRDFR GP +ILVATDVASRGLDV GV HVINLDLPKTMEDY
Sbjct  413   LLATALHGGRSQSEREAALRDFRHGPINILVATDVASRGLDVTGVGHVINLDLPKTMEDY  472

Query  864   VHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaa  685
             VHRIGRTGRAGSTG+ATSFYTDRDMYLVAQIR+AIAD+GSGN VTFA GKTARRKEREAA
Sbjct  473   VHRIGRTGRAGSTGRATSFYTDRDMYLVAQIRRAIADIGSGNDVTFAMGKTARRKEREAA  532

Query  684   aahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             AA KEA   LSKLSL+ S  +NVEDKYRHMI PAM +KEGAAD AWDD
Sbjct  533   AAEKEARSTLSKLSLVESA-VNVEDKYRHMITPAMIKKEGAADDAWDD  579



>gb|EYU46026.1| hypothetical protein MIMGU_mgv1a003854mg [Erythranthe guttata]
Length=559

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/567 (75%), Positives = 476/567 (84%), Gaps = 10/567 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATT--VVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRN  2062
             MSYVPPHLRNS+ A    VV+   DH H +  +     FT +K+   +       + G  
Sbjct  1     MSYVPPHLRNSSAAAATAVVNGHTDHFHGKQLNSSYSQFTSAKSNNSNGNSTNFWNGGSR  60

Query  2061  SCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAP  1882
             S    NY+S      PD VFPQWKPS+RV+  + EQI+E+RLRLNV+  V  DS  AP+P
Sbjct  61    SSG--NYVSS----VPDAVFPQWKPSDRVIRLEPEQIQEVRLRLNVEATVPPDSQLAPSP  114

Query  1881  VESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPM  1702
             +ESFTDM LH SIMKDIALH YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAFTIPM
Sbjct  115   IESFTDMNLHASIMKDIALHGYTTPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFTIPM  174

Query  1701  IQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQR  1522
             IQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EVKAF RSLDSFKTAIVVGGTNI +QR
Sbjct  175   IQHCLAQPPIRRGDGPLALVLAPTRELAQQIEKEVKAFGRSLDSFKTAIVVGGTNISEQR  234

Query  1521  SELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPK  1342
             SELRAGV+IVVATPGR IDHLQQGNTS+SRISFVVLDEADRMLDMGFEPQIREVM NLP+
Sbjct  235   SELRAGVDIVVATPGRFIDHLQQGNTSISRISFVVLDEADRMLDMGFEPQIREVMQNLPE  294

Query  1341  KHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDL  1162
             KHQTLLFSATMP EIE LAQEYLT+PVRVKVG VSSPTANV+Q+LEKVPENEK+DRLL++
Sbjct  295   KHQTLLFSATMPVEIEELAQEYLTNPVRVKVGKVSSPTANVSQVLEKVPENEKVDRLLNM  354

Query  1161  LVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRD  982
             LVE + Q+E+ GH F LTIVFVERK++C+EVAEAL++QGL A ALHGGR+QSERE ALRD
Sbjct  355   LVEAANQSERCGHSFPLTIVFVERKSRCDEVAEALIQQGLQAAALHGGRTQSERETALRD  414

Query  981   FRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             FR GP+ ILVATD+ASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQ+TSFYT
Sbjct  415   FRHGPSRILVATDIASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQSTSFYT  474

Query  801   DRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPI  622
             DRDM+LVAQI+KAI DV SGNT++FATGKTARRKEREA AA K+       + L+ S  I
Sbjct  475   DRDMFLVAQIKKAIQDVDSGNTLSFATGKTARRKEREALAAQKDGKGG--TVPLVESRAI  532

Query  621   NVEDKYRHMIAPAMSRKEGAADGAWDD  541
             NVEDKYRHMI+P+++ KEGAAD AWDD
Sbjct  533   NVEDKYRHMISPSLTTKEGAADDAWDD  559



>emb|CDP20487.1| unnamed protein product [Coffea canephora]
Length=559

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/571 (76%), Positives = 484/571 (85%), Gaps = 18/571 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG------DHLHSELNSRQLPSFTQSKNGFISNGEYCSND  2074
             MSYVPPHLRNS T T   +         +H HS         ++   +   ++     N 
Sbjct  1     MSYVPPHLRNSNTDTAATAATTVTTLDTNHFHS---------YSNPSSETNNSSNNYLNS  51

Query  2073  AGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNP  1894
             A R   +TVNY SPR + APD VFP WKPSERVL    EQI+E+RLRLN+DV VA DS P
Sbjct  52    ARR---STVNYTSPRTVSAPDIVFPNWKPSERVLRLTPEQIDEVRLRLNLDVIVAPDSPP  108

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
             APAP+ESFTDMCLH SIMKDI+ H YT PT +Q+QAMPVALSGRDLLGCAETGSGKTAAF
Sbjct  109   APAPIESFTDMCLHSSIMKDISFHGYTTPTPIQSQAMPVALSGRDLLGCAETGSGKTAAF  168

Query  1713  TIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNI  1534
             +IPMIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EVKAFS+SLDSF+TAIVVGGTNI
Sbjct  169   SIPMIQHCLAQPPVRRGDGPLALVLAPTRELAQQIEKEVKAFSKSLDSFRTAIVVGGTNI  228

Query  1533  GDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMH  1354
             GDQRSELR GV++VVATPGR IDHLQQGNTSLSRISF+VLDEADRMLDMGFEPQ+REVM 
Sbjct  229   GDQRSELRLGVDVVVATPGRFIDHLQQGNTSLSRISFIVLDEADRMLDMGFEPQMREVMQ  288

Query  1353  NLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDR  1174
             NLP+KHQTLLFSATMP EIE LAQEYLT+PV+VKVG VS PTANV Q LEKVPENEKIDR
Sbjct  289   NLPQKHQTLLFSATMPVEIEMLAQEYLTNPVQVKVGKVSCPTANVLQSLEKVPENEKIDR  348

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             LL +LVEE+A+AE+ GHPF LTIVFVERKT+C+EVAEAL+ QGL A  LHGGRSQSERE 
Sbjct  349   LLGMLVEEAARAERFGHPFPLTIVFVERKTRCDEVAEALIAQGLKAVVLHGGRSQSEREL  408

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
             +L DFR   T+ILVATDVASRGLDV+GVAHV+NLDLPKTMEDYVHRIGRTGRAGS+G+AT
Sbjct  409   SLHDFRHSTTNILVATDVASRGLDVSGVAHVVNLDLPKTMEDYVHRIGRTGRAGSSGRAT  468

Query  813   SFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMG  634
             SFYTDRDMYLVAQI+KAI DV SGNTV++ATGK ARR E+EAAAAHKEA IALSK+SL+G
Sbjct  469   SFYTDRDMYLVAQIKKAIVDVESGNTVSYATGKVARRMEKEAAAAHKEARIALSKVSLLG  528

Query  633   STPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             + P+NVEDKY+HMI PAM+RKEGAAD AWDD
Sbjct  529   TAPLNVEDKYKHMIFPAMARKEGAADDAWDD  559



>ref|XP_007146899.1| hypothetical protein PHAVU_006G079800g [Phaseolus vulgaris]
 gb|ESW18893.1| hypothetical protein PHAVU_006G079800g [Phaseolus vulgaris]
Length=571

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/574 (74%), Positives = 471/574 (82%), Gaps = 12/574 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSN-------  2077
             MSYVPPHLRN+++AT V +     +  + N+    +    K  F SN    +N       
Sbjct  1     MSYVPPHLRNNSSAT-VATARTPSVTLDNNNHHHHNNNHHKLAFASNNNTNANCSPSLPS  59

Query  2076  --DAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMD  1903
               +A R S A     SPR    PDPVFPQW+PSER      EQIEE+R RLN+DV VA D
Sbjct  60    FHNASRRSSAAPP--SPRIFATPDPVFPQWQPSERASRMTPEQIEEVRSRLNLDVTVASD  117

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
             S PAPAP+ESFTDMCL  SIMKDIA H+YT PTS+QAQAMP+ALSGRDLLGCAETGSGKT
Sbjct  118   SPPAPAPIESFTDMCLDSSIMKDIAFHEYTRPTSIQAQAMPIALSGRDLLGCAETGSGKT  177

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGG  1543
             AAFTIPMIQHCLAQP +RR DGPLALVLAPTRELAQQIE EVKAFSRSL+S KTAIVVGG
Sbjct  178   AAFTIPMIQHCLAQPSIRRNDGPLALVLAPTRELAQQIEKEVKAFSRSLESLKTAIVVGG  237

Query  1542  TNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  1363
             TNI  QRSELRAGV I VATPGR IDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE
Sbjct  238   TNIEKQRSELRAGVEIAVATPGRFIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  297

Query  1362  VMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEK  1183
             VM +LP+KHQTLLFSATMP EIEALA+EYL  PV+VKVG VSSPT NV+Q L K+ ENEK
Sbjct  298   VMRSLPEKHQTLLFSATMPVEIEALAKEYLASPVQVKVGKVSSPTTNVSQTLVKISENEK  357

Query  1182  IDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSE  1003
             IDRLLDLLVE+++QAEK GHPF LTIVFVERKT+C+EVAEAL+ QGL A +LHGGRSQ+E
Sbjct  358   IDRLLDLLVEDASQAEKCGHPFPLTIVFVERKTRCDEVAEALVAQGLSAVSLHGGRSQNE  417

Query  1002  REAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTG  823
             REAAL+DFR G T+ILVATDVASRGLDV GV+HVINLDLPKTMEDYVHRIGRTGRAGSTG
Sbjct  418   REAALQDFRSGSTNILVATDVASRGLDVTGVSHVINLDLPKTMEDYVHRIGRTGRAGSTG  477

Query  822   QATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLS  643
              ATSFYTDRDM+LVA IRKAIAD  SGNT+TFATGK ARRKE+EAAAA KEANIA SK  
Sbjct  478   LATSFYTDRDMFLVANIRKAIADAESGNTLTFATGKVARRKEKEAAAAQKEANIAFSKQL  537

Query  642   LMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
              +G+  IN+EDKY+ MIA A  ++EGAAD AWDD
Sbjct  538   GLGAASINIEDKYKFMIAAANIKREGAADSAWDD  571



>gb|KEH34507.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=561

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/568 (75%), Positives = 471/568 (83%), Gaps = 10/568 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG--DHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRN  2062
             MSYVPPHLRN+ ++TTV +N G  D+ H   +     +F+ S     SN     N + R 
Sbjct  1     MSYVPPHLRNAASSTTVSTNTGTLDNHHHHHHHNNNLAFSNSH----SNSPSLFNASRRT  56

Query  2061  SCATVNYLSPRGLVA-PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPA  1885
             S A     S R + A PD VFP+W+PSERV     +QIEE+R RLN+DV V+ DS  APA
Sbjct  57    SAAPP---SSRTIAAVPDTVFPKWQPSERVSRMNPDQIEEVRHRLNLDVTVSSDSLAAPA  113

Query  1884  PVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIP  1705
             P+ESF DMCLHPSIMKDIA HDYT PTS+QAQAMP+ALSGRDLLGCAETGSGKTAAFTIP
Sbjct  114   PIESFNDMCLHPSIMKDIAYHDYTRPTSIQAQAMPIALSGRDLLGCAETGSGKTAAFTIP  173

Query  1704  MIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQ  1525
             MIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EV+AFSRSL+SFKTAIVVGGTNI  Q
Sbjct  174   MIQHCLAQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESFKTAIVVGGTNIEKQ  233

Query  1524  RSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLP  1345
             RSELRAGV I VATPGR IDHLQQGNTSLSRIS+VVLDEADRMLDMGFEPQIRE+M +LP
Sbjct  234   RSELRAGVEIAVATPGRFIDHLQQGNTSLSRISYVVLDEADRMLDMGFEPQIREIMRSLP  293

Query  1344  KKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLD  1165
             +KHQTLLFSATMP EIEAL++EYL  PV+VKVG VSSPT NV+Q L KV ENEKIDRLLD
Sbjct  294   EKHQTLLFSATMPVEIEALSKEYLASPVQVKVGKVSSPTTNVSQTLVKVSENEKIDRLLD  353

Query  1164  LLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALR  985
             LLVEE++QAEK GHPF LTIVFVERKT+C+EVAEAL+ QGL A +LHGGRSQSEREAAL 
Sbjct  354   LLVEEASQAEKCGHPFPLTIVFVERKTRCDEVAEALIAQGLSAVSLHGGRSQSEREAALH  413

Query  984   DFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFY  805
             DFR   TSILVATDVASRGLDV GV+HVINLDLPKT EDY+HRIGRTGRAGSTG ATSFY
Sbjct  414   DFRSSSTSILVATDVASRGLDVTGVSHVINLDLPKTTEDYIHRIGRTGRAGSTGIATSFY  473

Query  804   TDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTP  625
             TDRDM+LV+ IRKAIAD  SGN V FATGK ARRKE+EAAAAHKEANIALSK    G+  
Sbjct  474   TDRDMFLVSNIRKAIADAESGNAVAFATGKVARRKEKEAAAAHKEANIALSKHLGPGAAS  533

Query  624   INVEDKYRHMIAPAMSRKEGAADGAWDD  541
             IN+EDKYR MIA + S+ EG AD AWDD
Sbjct  534   INIEDKYRFMIAASNSKGEGTADSAWDD  561



>ref|XP_007208448.1| hypothetical protein PRUPE_ppa003525mg [Prunus persica]
 gb|EMJ09647.1| hypothetical protein PRUPE_ppa003525mg [Prunus persica]
Length=568

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/569 (74%), Positives = 478/569 (84%), Gaps = 5/569 (1%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPS----FTQSKNGFISNGEYCSNDAG  2068
             MSYVPPHLR+S+T TT  +        + +    PS    F   K+   S   +  ++A 
Sbjct  1     MSYVPPHLRSSSTTTTTTTETSSVTLDDQSKLSYPSSNSHFNNDKSSAASFSSFSHSNAS  60

Query  2067  RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAP  1888
             R S  +++  + R L  PD V PQWKPSERVL  K E IEE+ LRLN+DV+V+ DS PAP
Sbjct  61    RWSSGSISTAN-RALARPDAVVPQWKPSERVLRMKPELIEEVCLRLNLDVSVSPDSAPAP  119

Query  1887  APVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTI  1708
             AP+ESF DMCLH SIMKDIA H YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAF I
Sbjct  120   APIESFADMCLHASIMKDIAYHGYTTPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFAI  179

Query  1707  PMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGD  1528
             PMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS+SL+SF+TAIVVGGTNI +
Sbjct  180   PMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSKSLESFRTAIVVGGTNIAE  239

Query  1527  QRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNL  1348
             QRSELRAGV++VVATPGR IDHLQQGNTS++RISFVVLDEADRMLDMGFEPQIREVM NL
Sbjct  240   QRSELRAGVDVVVATPGRFIDHLQQGNTSVTRISFVVLDEADRMLDMGFEPQIREVMRNL  299

Query  1347  PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLL  1168
              +KHQTLLFSATMP EIE LAQEYLT+PV+VKVG VSSPTANV Q LEKV E+EK DRLL
Sbjct  300   SEKHQTLLFSATMPEEIEELAQEYLTNPVQVKVGKVSSPTANVTQTLEKVSESEKTDRLL  359

Query  1167  DLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAAL  988
              LLVEE+++ E+SGHPF LTIVFVERKT+C+EVA+AL+ QGL A ALHGGR+Q EREAAL
Sbjct  360   ALLVEEASRVERSGHPFPLTIVFVERKTRCDEVADALVAQGLHAVALHGGRTQGEREAAL  419

Query  987   RDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSF  808
             R+FR+G T+ILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRAGS GQATSF
Sbjct  420   REFRKGTTNILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRAGSMGQATSF  479

Query  807   YTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGST  628
             YTDRDM+LVA I+KAIADVGSGN V FATGKTARRKEREAAAA K A +ALSK S+ G T
Sbjct  480   YTDRDMFLVANIKKAIADVGSGNAVAFATGKTARRKEREAAAAQKHARVALSKCSITGPT  539

Query  627   PINVEDKYRHMIAPAMSRKEGAADGAWDD  541
              +N+EDKYR MIA + S++EGAAD AWDD
Sbjct  540   SVNIEDKYRFMIADSNSKREGAADSAWDD  568



>ref|XP_008240531.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Prunus mume]
Length=572

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/579 (73%), Positives = 479/579 (83%), Gaps = 21/579 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSND------  2074
             MSYVPPHLR+S+T TT  +       S           QSK  + S+  + +ND      
Sbjct  1     MSYVPPHLRSSSTTTTTTTTTTTETSSVTLD------DQSKLSYPSSNSHFNNDKSSAAS  54

Query  2073  --------AGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDV  1918
                     A R S   ++  + R L  PD V PQWKPSERVL  K E IEE+ LRLN+DV
Sbjct  55    FSSFSHSNASRWSSGAISTAN-RALARPDAVIPQWKPSERVLRMKPELIEEVCLRLNLDV  113

Query  1917  AVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAET  1738
             +V+ DS PAPAP+ESF DMCLHPSIMKDIA H YT PTS+QAQAMPVALSGRDLLGCAET
Sbjct  114   SVSPDSAPAPAPIESFADMCLHPSIMKDIAYHGYTTPTSIQAQAMPVALSGRDLLGCAET  173

Query  1737  GSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTA  1558
             GSGKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS+S++SF+TA
Sbjct  174   GSGKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSKSIESFRTA  233

Query  1557  IVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFE  1378
             IVVGGTNI +QRSELRAGV++VVATPGR IDHLQQGNTS++RISFVVLDEADRMLDMGFE
Sbjct  234   IVVGGTNIAEQRSELRAGVDVVVATPGRFIDHLQQGNTSVTRISFVVLDEADRMLDMGFE  293

Query  1377  PQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKV  1198
             PQIREVM NL +KHQTLLFSATMP EIE LAQEYLT+PV+VKVG VSSPTANV Q LEKV
Sbjct  294   PQIREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTNPVQVKVGKVSSPTANVTQTLEKV  353

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK DRLL LLVEE+++ E+SGHPF LTIVFVERKT+C+EVA+AL+ QGL A ALHGG
Sbjct  354   SESEKTDRLLALLVEEASRVERSGHPFPLTIVFVERKTRCDEVADALVAQGLHAVALHGG  413

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             R+Q EREAALR+FR+G T+ILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGR
Sbjct  414   RTQGEREAALREFRKGTTNILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGR  473

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIA  658
             AGS GQATSFYTDRDM+LVA I+KAIADVGSGN V FATGKTARRKEREAAAA K+A +A
Sbjct  474   AGSMGQATSFYTDRDMFLVANIKKAIADVGSGNAVAFATGKTARRKEREAAAAQKQARVA  533

Query  657   LSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             LSK S+ G T +N+EDKYR MIA + S++EGAAD AWDD
Sbjct  534   LSKCSITGPTSVNIEDKYRFMIADSNSKREGAADSAWDD  572



>ref|XP_002266157.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI15808.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/572 (75%), Positives = 474/572 (83%), Gaps = 11/572 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG-------DHLHSELNSRQLPSFTQSKNGFISNGEYCSN  2077
             MSYVPPHLRN +++ +  S          D  H   N+    S++ + +    +    S 
Sbjct  1     MSYVPPHLRNPSSSISRTSKPTETSAVTLDDTHRTTNNL---SYSSTNSHLSHSNASSSP  57

Query  2076  DAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSN  1897
                R + +    + PR    P+PVFPQWKPS+RV L K EQIEE+RLRLNVDV VA D  
Sbjct  58    SLSRWASSNAAAV-PRTPSVPEPVFPQWKPSDRVFLMKPEQIEEVRLRLNVDVTVAPDLP  116

Query  1896  PAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAA  1717
             PAPAP+ESFTDM LH SIMKDI  H+YT PT +QAQAMPVALSGRDLLGCAETGSGKTAA
Sbjct  117   PAPAPIESFTDMGLHQSIMKDITFHEYTRPTFIQAQAMPVALSGRDLLGCAETGSGKTAA  176

Query  1716  FTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTN  1537
             F IPMIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EVKAFSRSLDSF+TAIVVGGTN
Sbjct  177   FAIPMIQHCLAQPPVRRGDGPLALVLAPTRELAQQIEKEVKAFSRSLDSFRTAIVVGGTN  236

Query  1536  IGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  1357
             I +QRSELRAGVNIVVATPGR I HLQ+GNTSLSRISFVVLDEADRMLDMGFEPQIREVM
Sbjct  237   ISEQRSELRAGVNIVVATPGRFIHHLQEGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  296

Query  1356  HNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKID  1177
              NLP+KHQTLLFSATMP EIE LAQEYL +PV+VKVG VS PTANV+QILEKV E+EKID
Sbjct  297   QNLPQKHQTLLFSATMPMEIETLAQEYLNNPVQVKVGKVSCPTANVSQILEKVSESEKID  356

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
              LL LLVEE++QAE+ G PF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGRSQ+ERE
Sbjct  357   GLLALLVEEASQAERCGRPFPLTIVFVERKTRCDEVAEALVAQGLRAVALHGGRSQAERE  416

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
             AALRDFR G T+ILVATDVASRGLDV GVAHVINLDLPK ME+YVHRIGRTGRAGSTGQA
Sbjct  417   AALRDFRNGATNILVATDVASRGLDVTGVAHVINLDLPKAMENYVHRIGRTGRAGSTGQA  476

Query  816   TSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLM  637
             TSFYTDRD++LVA IRKAIADVGSGNTV FATGK AR+KEREAAAA KEA IALS LSLM
Sbjct  477   TSFYTDRDVFLVAHIRKAIADVGSGNTVAFATGKVARKKEREAAAAQKEARIALSNLSLM  536

Query  636   GSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             G T +N+E+KYR M++P+  + EGAAD AWDD
Sbjct  537   GPTSLNIEEKYRFMMSPSSIKTEGAADDAWDD  568



>gb|KDP45713.1| hypothetical protein JCGZ_17320 [Jatropha curcas]
Length=577

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/581 (71%), Positives = 470/581 (81%), Gaps = 20/581 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSN-------  2077
             MSYVPPHLRNS++  T  ++      +      L +    +N  + +   CSN       
Sbjct  1     MSYVPPHLRNSSSHATTATSTTIINTTTTAFSSL-TLDSDQNANLDHSSSCSNFHSPTSN  59

Query  2076  --------DAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVD  1921
                     +A R +C+T  + SPR L  P+PVFPQW PS+RVL    +QIE++R RLNV+
Sbjct  60    WNSLPTLSNASRRTCSTA-FQSPRTLSIPEPVFPQWNPSDRVLRLNSQQIEDVRTRLNVE  118

Query  1920  VAVAM-DSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             V VA  DS PAPAP+ESF DMCLHPSIMKDIA H Y+ PTS+QAQA+ VALSGRDLLGCA
Sbjct  119   VNVASEDSLPAPAPIESFEDMCLHPSIMKDIAYHGYSRPTSIQAQAITVALSGRDLLGCA  178

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFK  1564
             ETGSGKTAAFTIPMIQHCLAQ P++RGDGPLALVLAPTRELAQQIE EVK FSRSL++F+
Sbjct  179   ETGSGKTAAFTIPMIQHCLAQSPIQRGDGPLALVLAPTRELAQQIEKEVKCFSRSLENFR  238

Query  1563  TAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMG  1384
             TAIVVGGTNI +QRSELRAGV+++VATPGR IDHLQQGNT LSRISF+VLDEADRMLDMG
Sbjct  239   TAIVVGGTNIAEQRSELRAGVDVIVATPGRFIDHLQQGNTCLSRISFIVLDEADRMLDMG  298

Query  1383  FEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILE  1204
             FEPQIREV+HNLPK+HQTLLFSATMP EIE L QEYLT PV++KVG VSSPTANV+Q+L+
Sbjct  299   FEPQIREVLHNLPKRHQTLLFSATMPVEIETLTQEYLTAPVQIKVGKVSSPTANVSQVLK  358

Query  1203  KVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALH  1024
             KV ENEKID LL  LVE+++QAE+SGHPF LT+VFVERKT+C+EVAEAL+ QGL A ALH
Sbjct  359   KVSENEKIDCLLAFLVEDASQAERSGHPFPLTVVFVERKTRCDEVAEALVAQGLRAVALH  418

Query  1023  GGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRT  844
             GGRSQSEREAAL DFR G TSILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRT
Sbjct  419   GGRSQSEREAALNDFRSGSTSILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRT  478

Query  843   GRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeAN  664
             GRAGS GQATSFYTDRDM+LV+QI+KAIAD  +GNTV FATGK ARRKEREAA   KE  
Sbjct  479   GRAGSAGQATSFYTDRDMFLVSQIKKAIADAEAGNTVAFATGKVARRKEREAAGLQKEVR  538

Query  663   IALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
              ALSK    G   IN+EDKYR+MIA A  + EGAAD AWDD
Sbjct  539   NALSKSG--GPASINIEDKYRYMIASANIKGEGAADSAWDD  577



>gb|KHN18654.1| ATP-dependent RNA helicase DBP2 [Glycine soja]
Length=570

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/575 (74%), Positives = 470/575 (82%), Gaps = 15/575 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEY--CS------  2080
             MSYVPPHLRN+T+ +   +         L++         K  F SN     CS      
Sbjct  1     MSYVPPHLRNATSTSVATARTPS---VTLDNNNNNHHHHHKLAFPSNTTTTNCSPSLSFH  57

Query  2079  NDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDS  1900
             N+A R S A     SPR L  PD +FPQW+PSERV     EQIEEIR RLN+DVAVA DS
Sbjct  58    NNASRRSSAAPP--SPRILANPDTIFPQWQPSERVSRMTPEQIEEIRSRLNLDVAVASDS  115

Query  1899  NPAPAP--VESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGK  1726
              PAPAP  +ESFTDMCLHPSIMKDIA H+YT PTS+QAQAMP+ALSGRDLLGCAETGSGK
Sbjct  116   PPAPAPAPIESFTDMCLHPSIMKDIAYHEYTRPTSIQAQAMPIALSGRDLLGCAETGSGK  175

Query  1725  TAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVG  1546
             TAAFTIPMIQHCLAQPP+RR DGPLALVLAPTRELAQQIE EVKAFSRSL+S KTAIVVG
Sbjct  176   TAAFTIPMIQHCLAQPPIRRNDGPLALVLAPTRELAQQIEKEVKAFSRSLESLKTAIVVG  235

Query  1545  GTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  1366
             GTNI  QR ELRAGV I VATPGR IDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR
Sbjct  236   GTNIEKQRFELRAGVEIAVATPGRFIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  295

Query  1365  EVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENE  1186
             EVM NLP+KHQTLL SATMP EIE L++EYL +PV+VKVG VSSPT NV+Q L K+ ENE
Sbjct  296   EVMRNLPEKHQTLLLSATMPVEIEELSKEYLANPVQVKVGKVSSPTTNVSQTLVKISENE  355

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             KIDRLLDLLVEE++QAEK GHPF LTIVFVERKT+C+EVAEAL+ QGL A +LHGGRSQS
Sbjct  356   KIDRLLDLLVEEASQAEKCGHPFPLTIVFVERKTRCDEVAEALVAQGLSAVSLHGGRSQS  415

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             EREAAL DFR G T+ILVATDVASRGLDV GV+HVINLDLPKTMEDYVHRIGRTGRAGST
Sbjct  416   EREAALHDFRSGTTNILVATDVASRGLDVTGVSHVINLDLPKTMEDYVHRIGRTGRAGST  475

Query  825   GQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKL  646
             G ATSFYTDRDM+L+A IRKAIAD  SGNT+TFATGK ARRKE+EAAAA KEANIALSK 
Sbjct  476   GLATSFYTDRDMFLMANIRKAIADAESGNTLTFATGKVARRKEKEAAAAQKEANIALSKQ  535

Query  645   SLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
               +G+  +N+EDKY+ MI    +++EGAAD AWDD
Sbjct  536   LGLGAASMNIEDKYKFMITATNTKREGAADSAWDD  570



>ref|XP_006432066.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
 ref|XP_006432067.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
 ref|XP_006464954.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45306.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
 gb|ESR45307.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
Length=564

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/537 (76%), Positives = 448/537 (83%), Gaps = 19/537 (4%)
 Frame = -3

Query  2151  LNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVL  1972
              +S+ LP+F+ S +       Y S+                    P PVF  WKPS+RVL
Sbjct  47    FSSKSLPNFSNSNSNTTCRRSYASHPV------------------PQPVFNNWKPSDRVL  88

Query  1971  LFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQA  1792
              F  EQIEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QA
Sbjct  89    RFNPEQIEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQA  148

Query  1791  QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQ  1612
             QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQ
Sbjct  149   QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQ  208

Query  1611  IETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSR  1432
             IE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR
Sbjct  209   IEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSR  268

Query  1431  ISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVK  1252
             +SFVVLDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQEYLTDPV+VK
Sbjct  269   VSFVVLDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQEYLTDPVQVK  328

Query  1251  VGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             VG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+E
Sbjct  329   VGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDE  388

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINL  892
             V+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATDVASRGLDV GVAHV+NL
Sbjct  389   VSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATDVASRGLDVMGVAHVVNL  448

Query  891   DLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGkt  712
             DLPKT+EDYVHRIGRTGR GS GQATSFYTDRDM LVAQI+KAI D  SGN V FATGK 
Sbjct  449   DLPKTVEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNAVAFATGKV  508

Query  711   arrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             ARRKEREAAAA K A +A SKLS+MG + +N+EDKYR MIA +  ++EGAAD AWDD
Sbjct  509   ARRKEREAAAAQKGATVATSKLSMMGPS-VNIEDKYRFMIAASNMKREGAADSAWDD  564



>gb|KDO45071.1| hypothetical protein CISIN_1g008428mg [Citrus sinensis]
 gb|KDO45072.1| hypothetical protein CISIN_1g008428mg [Citrus sinensis]
Length=565

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/537 (76%), Positives = 448/537 (83%), Gaps = 19/537 (4%)
 Frame = -3

Query  2151  LNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVL  1972
              +S+ LP+F+ S +       Y S+                    P PVF  WKPS+RVL
Sbjct  48    FSSKSLPNFSNSNSNTTCRRSYASHPV------------------PQPVFNNWKPSDRVL  89

Query  1971  LFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQA  1792
              F  EQIEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QA
Sbjct  90    RFNPEQIEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQA  149

Query  1791  QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQ  1612
             QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQ
Sbjct  150   QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQ  209

Query  1611  IETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSR  1432
             IE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR
Sbjct  210   IEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSR  269

Query  1431  ISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVK  1252
             +SFV+LDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQEYLTDPV+VK
Sbjct  270   VSFVILDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQEYLTDPVQVK  329

Query  1251  VGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             VG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+E
Sbjct  330   VGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDE  389

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINL  892
             V+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATDVASRGLDV GVAHV+NL
Sbjct  390   VSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATDVASRGLDVMGVAHVVNL  449

Query  891   DLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGkt  712
             DLPKT+EDYVHRIGRTGR GS GQATSFYTDRDM LVAQI+KAI D  SGN V FATGK 
Sbjct  450   DLPKTVEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNAVAFATGKV  509

Query  711   arrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             ARRKEREAAAA K A +A SKLS+MG + +N+EDKYR MIA +  ++EGAAD AWDD
Sbjct  510   ARRKEREAAAAQKGATVATSKLSMMGPS-VNIEDKYRFMIAASNMKREGAADSAWDD  565



>gb|KDO45073.1| hypothetical protein CISIN_1g008428mg [Citrus sinensis]
Length=565

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/537 (76%), Positives = 447/537 (83%), Gaps = 19/537 (4%)
 Frame = -3

Query  2151  LNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVL  1972
              +S+ LP+F+ S +       Y S+                    P PVF  WKPS+RVL
Sbjct  48    FSSKSLPNFSNSNSNTTCRRSYASHPV------------------PQPVFNNWKPSDRVL  89

Query  1971  LFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQA  1792
              F  EQIEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QA
Sbjct  90    RFNPEQIEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQA  149

Query  1791  QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQ  1612
             QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQ
Sbjct  150   QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQ  209

Query  1611  IETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSR  1432
             IE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR
Sbjct  210   IEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSR  269

Query  1431  ISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVK  1252
             +SFV+LDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQ YLTDPV+VK
Sbjct  270   VSFVILDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQGYLTDPVQVK  329

Query  1251  VGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             VG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+E
Sbjct  330   VGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDE  389

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINL  892
             V+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATDVASRGLDV GVAHV+NL
Sbjct  390   VSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATDVASRGLDVMGVAHVVNL  449

Query  891   DLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGkt  712
             DLPKT+EDYVHRIGRTGR GS GQATSFYTDRDM LVAQI+KAI D  SGN V FATGK 
Sbjct  450   DLPKTVEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNAVAFATGKV  509

Query  711   arrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             ARRKEREAAAA K A +A SKLS+MG + +N+EDKYR MIA +  ++EGAAD AWDD
Sbjct  510   ARRKEREAAAAQKGATVATSKLSMMGPS-VNIEDKYRFMIAASNMKREGAADSAWDD  565



>ref|XP_004294724.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like [Fragaria 
vesca subsp. vesca]
Length=570

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/578 (72%), Positives = 478/578 (83%), Gaps = 21/578 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG---------DHLHSELNSRQLPSFTQSKNGFI----SN  2095
             MSYVPPHLRNS++ TT  +            D   S+L+     +   S   F     SN
Sbjct  1     MSYVPPHLRNSSSTTTTTTTTSAAAKSSSATDADRSKLSYSASSNSHSSAAPFSSFSHSN  60

Query  2094  GEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA  1915
             G   S+ A  +S A       R +  PD V PQWKPSERVL  K E IEE+ LRLN+DV+
Sbjct  61    GSRWSSAA--HSSAN------RAISPPDAVVPQWKPSERVLRMKPELIEEVCLRLNLDVS  112

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             V+ DS P PAP+ESFTDMCLHPSIMKDIA H YT+PT +QAQAMP+ALSGRDLLGCAETG
Sbjct  113   VSSDSAPPPAPIESFTDMCLHPSIMKDIAFHGYTMPTPIQAQAMPIALSGRDLLGCAETG  172

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKTAAF IPMIQHCLAQ P++RGDGPLALVLAPTRELAQQIE EVKAFS+SL+SFKTAI
Sbjct  173   SGKTAAFAIPMIQHCLAQAPVQRGDGPLALVLAPTRELAQQIEEEVKAFSKSLESFKTAI  232

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             VVGGTNI +QRSELRAGV+IVVATPGR IDHLQQGNTS+SRISFVVLDEADRMLDMGFEP
Sbjct  233   VVGGTNIAEQRSELRAGVHIVVATPGRFIDHLQQGNTSVSRISFVVLDEADRMLDMGFEP  292

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVP  1195
             QIREVM NL +KHQTLLFSATMP EI  LAQEYL +PV+VKVG VS+PTANV Q LEKVP
Sbjct  293   QIREVMRNLSEKHQTLLFSATMPEEIAGLAQEYLNNPVQVKVGKVSTPTANVTQSLEKVP  352

Query  1194  ENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGR  1015
             ++EK DRLL LLVEES++AE++GHPF LTIVFVERKT+C++VAEAL+ QGL A ALHGGR
Sbjct  353   DSEKTDRLLGLLVEESSRAERAGHPFPLTIVFVERKTRCDDVAEALVAQGLHAVALHGGR  412

Query  1014  SQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRA  835
             +Q+EREAALR+FR+G T+ILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRA
Sbjct  413   TQTEREAALREFRKGTTNILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRA  472

Query  834   GSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIAL  655
             GS GQATSFYTDRDM+LVA I+KAIADVGSGN ++FATGK+ARRKEREAAAAH +A ++L
Sbjct  473   GSMGQATSFYTDRDMFLVANIKKAIADVGSGNALSFATGKSARRKEREAAAAHNQARVSL  532

Query  654   SKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             SK S MG T IN+ DKY+ M++   ++KEGAAD AWDD
Sbjct  533   SKSSSMGPTSINIADKYKFMVSDPDNQKEGAADDAWDD  570



>ref|XP_008384660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Malus domestica]
Length=570

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/577 (72%), Positives = 470/577 (81%), Gaps = 19/577 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQ--SKNGFISNGEYCSNDAG--  2068
             MSYVPPHLR+S+  TT  +       ++ + R L   ++  S N  I+N +     +   
Sbjct  1     MSYVPPHLRSSSRTTTTTTT----TTAKPSXRTLDDXSKLSSSNSHINNDKSSGGASFSS  56

Query  2067  --------RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAV  1912
                     R S   V+  S      PD V PQWKPS+RVL  K E IEE+ LRLN+DV+ 
Sbjct  57    FSHSNASSRGSSGAVSQAS---RARPDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSA  113

Query  1911  AMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGS  1732
             + DS PAPAP+ESFTDMCLHPSIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGS
Sbjct  114   SPDSAPAPAPIESFTDMCLHPSIMKDIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGS  173

Query  1731  GKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIV  1552
             GKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS SL+SF+TAIV
Sbjct  174   GKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSASLESFRTAIV  233

Query  1551  VGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQ  1372
             VGGTNI +QRSELRAGV++VVATPGR IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQ
Sbjct  234   VGGTNISEQRSELRAGVDVVVATPGRFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQ  293

Query  1371  IREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPE  1192
             IREVM NL +KHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTANV Q LEKVPE
Sbjct  294   IREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPE  353

Query  1191  NEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRS  1012
             +EK DRLL LLVEE+++ E +GHPF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+
Sbjct  354   SEKTDRLLALLVEEASRVEGTGHPFPLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRT  413

Query  1011  QSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAG  832
             Q+EREAALRDFR+G TSILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRAG
Sbjct  414   QTEREAALRDFRKGTTSILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRAG  473

Query  831   STGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALS  652
             S GQ+TSFYTDRDM+LVA I+KAI+D GSGN V FATGKTARRKE+EAAAA K+A +ALS
Sbjct  474   SMGQSTSFYTDRDMFLVANIKKAISDAGSGNAVAFATGKTARRKEKEAAAAQKQARVALS  533

Query  651   KLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
               S  G   +N+EDKYR M A + ++KEGAAD AWDD
Sbjct  534   NSSTAGPASVNIEDKYRFMFADSNNKKEGAADSAWDD  570



>ref|XP_008358920.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Malus domestica]
Length=571

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/577 (72%), Positives = 468/577 (81%), Gaps = 18/577 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSE--LNSRQLPSFTQSKNGFISNGEYCSNDAG--  2068
             MSYVPPHLR+S+  TT  +       S   L+ R   S   S N  I+N +     +   
Sbjct  1     MSYVPPHLRSSSRTTTTTTTTTTAKPSXRTLDDR---SKLSSSNSHINNDKSSGGASFSS  57

Query  2067  --------RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAV  1912
                     R S   V+  S      PD V PQWKPS+RVL  K E IEE+ LRLN+DV+ 
Sbjct  58    FSHSNASSRGSSGAVSQAS---RARPDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSA  114

Query  1911  AMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGS  1732
             + DS PAPAP+ESFTDMCLHPSIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGS
Sbjct  115   SPDSAPAPAPIESFTDMCLHPSIMKDIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGS  174

Query  1731  GKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIV  1552
             GKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS SL+SF+TAIV
Sbjct  175   GKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSASLESFRTAIV  234

Query  1551  VGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQ  1372
             VGGTNI +QRSELRAGV++VVATPGR IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQ
Sbjct  235   VGGTNISEQRSELRAGVDVVVATPGRFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQ  294

Query  1371  IREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPE  1192
             IREVM NL +KHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTANV Q LEKVPE
Sbjct  295   IREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPE  354

Query  1191  NEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRS  1012
             +EK DRLL LLVEE+++ E +GHPF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+
Sbjct  355   SEKTDRLLALLVEEASRVEGTGHPFPLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRT  414

Query  1011  QSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAG  832
             Q+EREAALRDFR+G TSILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRAG
Sbjct  415   QTEREAALRDFRKGTTSILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRAG  474

Query  831   STGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALS  652
             S GQ+TSFYTDRDM+LVA I+KAI+D GSGN V FATGKTARRKE+EAAAA K+A +ALS
Sbjct  475   SMGQSTSFYTDRDMFLVANIKKAISDAGSGNAVAFATGKTARRKEKEAAAAQKQARVALS  534

Query  651   KLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
               S  G   +N+EDKYR M A + ++KEGAAD AWDD
Sbjct  535   NSSTAGPASVNIEDKYRFMFADSNNKKEGAADSAWDD  571



>ref|XP_008349521.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Malus domestica]
Length=570

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/577 (72%), Positives = 470/577 (81%), Gaps = 19/577 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQ--SKNGFISNGEYCSNDAG--  2068
             MSYVPPHLR+S+  TT  +       ++ + R L   ++  S N  I+N +     +   
Sbjct  1     MSYVPPHLRSSSRTTTTTTT----TTAKPSXRTLDDRSKLSSSNSHINNDKSSGGASFSS  56

Query  2067  --------RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAV  1912
                     R S   V+  S      PD V PQWKPS+RVL  K E IEE+ LRLN+DV+ 
Sbjct  57    FSHSNASSRGSSGAVSQAS---RARPDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSA  113

Query  1911  AMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGS  1732
             + DS PAPAP+ESFTDMCLHPSIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGS
Sbjct  114   SPDSAPAPAPIESFTDMCLHPSIMKDIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGS  173

Query  1731  GKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIV  1552
             GKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS SL+SF+TAIV
Sbjct  174   GKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSASLESFRTAIV  233

Query  1551  VGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQ  1372
             VGGTNI +QRSELRAGV++VVATPGR IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQ
Sbjct  234   VGGTNISEQRSELRAGVDVVVATPGRFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQ  293

Query  1371  IREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPE  1192
             IREVM NL +KHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTANV Q LEKVPE
Sbjct  294   IREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPE  353

Query  1191  NEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRS  1012
             +EK DRLL LLVEE+++ E +GHPF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+
Sbjct  354   SEKTDRLLALLVEEASRVEGTGHPFPLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRT  413

Query  1011  QSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAG  832
             Q+EREAALRDFR+G TSILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRAG
Sbjct  414   QTEREAALRDFRKGTTSILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRAG  473

Query  831   STGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALS  652
             S GQ+TSFYTDRDM+LVA I+KAI+D GSGN V FATGKTARRKE+EAAAA K+A +ALS
Sbjct  474   SMGQSTSFYTDRDMFLVANIKKAISDAGSGNAVAFATGKTARRKEKEAAAAQKQARVALS  533

Query  651   KLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
               S  G   +N+EDKYR M A + ++KEGAAD AWDD
Sbjct  534   NSSTAGPASVNIEDKYRFMFADSNNKKEGAADSAWDD  570



>ref|XP_010922760.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DBP2-like 
[Elaeis guineensis]
Length=575

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/580 (71%), Positives = 468/580 (81%), Gaps = 20/580 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNS----TTATTVVSNGGDHLHSELNS--------RQLPSFTQ---SKNGFI  2101
             MSY+PPHLR +    T + T  S    H               R LPS +    +   F+
Sbjct  1     MSYIPPHLRAAAATPTPSPTAASPSTHHRSVTAKPSAGTLEVVRSLPSPSPRDGAAASFV  60

Query  2100  SNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVD  1921
               G     D G  +      LS      P+PVF QWKPS+RVL    +QIEE+RLRLNV+
Sbjct  61    VPGRRPGADGGLLASQHSRVLS-----VPEPVFNQWKPSDRVLALSPDQIEEVRLRLNVE  115

Query  1920  VAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAE  1741
             VAV+ DS PAPAP+ESF DMCLH SIMKDIA H+YT PTS+QAQAMPVALSGRDLLGCAE
Sbjct  116   VAVSSDSLPAPAPIESFNDMCLHSSIMKDIAFHEYTRPTSIQAQAMPVALSGRDLLGCAE  175

Query  1740  TGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKT  1561
             TGSGKTAAFTIPMIQHCLAQPPLR GDGPLALVLAPTRELAQQIE EVK FSRSL++ +T
Sbjct  176   TGSGKTAAFTIPMIQHCLAQPPLRHGDGPLALVLAPTRELAQQIEKEVKTFSRSLEALRT  235

Query  1560  AIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGF  1381
             AIVVGGTNI +QRSELRAGV+++VATPGR IDHLQQGNTSL RISFVVLDEAD+MLDMGF
Sbjct  236   AIVVGGTNISEQRSELRAGVHVIVATPGRFIDHLQQGNTSLLRISFVVLDEADKMLDMGF  295

Query  1380  EPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEK  1201
             EPQIREVM NLP+KHQTLLFSATMP EIE LAQEYL++PV+ K G VSSPTANV+QILEK
Sbjct  296   EPQIREVMRNLPRKHQTLLFSATMPVEIEELAQEYLSNPVQTKAGKVSSPTANVSQILEK  355

Query  1200  VPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHG  1021
             V E+EKID LL LLV+E++QAE  GH + LTIVFV+RK++C+EVAEAL+ QGL A  LHG
Sbjct  356   VAESEKIDHLLALLVDEASQAENFGHAYPLTIVFVDRKSRCQEVAEALVAQGLDAVVLHG  415

Query  1020  GRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTG  841
             GR+QSERE+ALRDFR+G T+ILVATDVASRGLDV GVA+V+NLDLP+TMEDYVHRIGRTG
Sbjct  416   GRTQSERESALRDFRKGSTNILVATDVASRGLDVTGVAYVVNLDLPRTMEDYVHRIGRTG  475

Query  840   RAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANI  661
             RAGS G+ATSFYTDRDMYLVAQIR+AIADV SGN+V +ATGK AR+KEREAAA H+EA +
Sbjct  476   RAGSMGRATSFYTDRDMYLVAQIRQAIADVESGNSVAYATGKIARKKEREAAAVHREARL  535

Query  660   ALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             ALS+LSL G   IN+EDKYR+M+     +KEGAAD AW+D
Sbjct  536   ALSRLSLNGPASINIEDKYRYMLTTTSLKKEGAADDAWND  575



>ref|XP_008788522.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=578

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/583 (70%), Positives = 470/583 (81%), Gaps = 23/583 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNST---TATTVVSNGGDHLHSELNS---------RQLPSFT------QSKN  2110
             MSY+PPHLR +    T +   +    H  S             R+LPS T       + +
Sbjct  1     MSYIPPHLRAAAATPTPSPTAAIPSPHHRSATAKPSAGTLETVRRLPSSTPGDGAAAAAS  60

Query  2109  GFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRL  1930
              F++ G     D G     ++     R    P+PVF QW+PS+RVL    EQIEE+RLRL
Sbjct  61    SFLAPGRRPGADGG-----SLESQHSRAPSVPEPVFGQWEPSDRVLALSPEQIEEVRLRL  115

Query  1929  NVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLG  1750
             NVDV V+ DS PA AP+ESF DMCLH SIMKDIA H+YT PTS+QAQAMPVALSGRDLLG
Sbjct  116   NVDVTVSPDSLPAAAPIESFNDMCLHSSIMKDIAFHEYTRPTSIQAQAMPVALSGRDLLG  175

Query  1749  CAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDS  1570
             CAETGSGKTAAFTIPMIQHCLAQPPLR GDGPLALVL+PTREL+QQIE EVKAFSRSL++
Sbjct  176   CAETGSGKTAAFTIPMIQHCLAQPPLRHGDGPLALVLSPTRELSQQIEKEVKAFSRSLEA  235

Query  1569  FKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLD  1390
              +TAIVVGGTNI +QRSELRAGV++VVATPGR IDHLQQGNTSL RISF+VLDEAD+MLD
Sbjct  236   LRTAIVVGGTNISEQRSELRAGVHVVVATPGRFIDHLQQGNTSLIRISFIVLDEADKMLD  295

Query  1389  MGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQI  1210
             MGFEPQIREVM NLP+KHQTLLFSATMP EIE LAQEYL++PV++KVG VSSPTANV+QI
Sbjct  296   MGFEPQIREVMCNLPRKHQTLLFSATMPVEIEQLAQEYLSNPVQIKVGKVSSPTANVSQI  355

Query  1209  LEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATA  1030
             LEKV E+EKID LL LLV+E++QAE  GH + LTIVFVERK++C+EVAEAL+ QGL A  
Sbjct  356   LEKVAESEKIDHLLALLVDEASQAENFGHAYPLTIVFVERKSRCKEVAEALVAQGLDAVV  415

Query  1029  LHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIG  850
             LHGGR+QSEREAALRDFR+G  +ILVATDVASRGLDV GVAHV+N DLP+TMEDYVHRIG
Sbjct  416   LHGGRTQSEREAALRDFRKGSANILVATDVASRGLDVTGVAHVVNFDLPRTMEDYVHRIG  475

Query  849   RTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahke  670
             RTGRAGS G+ATSFYTDRDMYLVAQIRKAIAD+ SGN+V +ATGK AR+KEREA   H+E
Sbjct  476   RTGRAGSIGRATSFYTDRDMYLVAQIRKAIADMESGNSVAYATGKIARKKEREAVTLHRE  535

Query  669   ANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             A +ALS+LSL G+  IN+EDKY++M+     +KEGAADGAW+D
Sbjct  536   ARLALSRLSLNGTASINIEDKYQYMLTTTSVKKEGAADGAWND  578



>ref|XP_009354913.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Pyrus x bretschneideri]
Length=574

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/492 (79%), Positives = 437/492 (89%), Gaps = 0/492 (0%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMK  1837
             PD V PQWKPS+RV     E IEE+ LRLN+DV+V+ DS PAPAP+ESFTDMCLHPSIMK
Sbjct  83    PDSVVPQWKPSDRVFRMNPEMIEEVCLRLNLDVSVSSDSAPAPAPIESFTDMCLHPSIMK  142

Query  1836  DIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG  1657
             DI  H YT PTS+QAQAMP+ALSGRDLLGCAETGSGKTAAF IPMIQHCLAQPP++RGDG
Sbjct  143   DIDNHGYTTPTSIQAQAMPIALSGRDLLGCAETGSGKTAAFAIPMIQHCLAQPPVQRGDG  202

Query  1656  PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPG  1477
             PLALVLAPTRELAQQIE EVK+F  SL+SF+TAIVVGGTNI +QRSELRAGV++VVATPG
Sbjct  203   PLALVLAPTRELAQQIEKEVKSFGASLESFRTAIVVGGTNISEQRSELRAGVDVVVATPG  262

Query  1476  RLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEI  1297
             R IDHLQQGNTS++RISFVVLDEADRMLDMGFEPQIREVM NL +KHQTLLFSATMP EI
Sbjct  263   RFIDHLQQGNTSITRISFVVLDEADRMLDMGFEPQIREVMRNLSEKHQTLLFSATMPEEI  322

Query  1296  EALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPF  1117
             E LAQEYLT PV+VKVG VSSPTANV Q LEKVPE+EK D+LL LLVEE+++ E +GHPF
Sbjct  323   EELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPESEKTDQLLALLVEEASRVEGTGHPF  382

Query  1116  SLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVA  937
              LTIVFVERKT+C+EVAEAL  QGL A  LHGGR+Q+EREAALRDFR+G TSILVATDVA
Sbjct  383   PLTIVFVERKTRCDEVAEALAAQGLHAVTLHGGRTQTEREAALRDFRKGTTSILVATDVA  442

Query  936   SRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIA  757
             SRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRAGS GQ+TSFYTDRDM+LVA I+KAI+
Sbjct  443   SRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRAGSMGQSTSFYTDRDMFLVANIKKAIS  502

Query  756   DVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMS  577
             D GSGN V FATGKTARRKE+EAAAA K+A +ALSK S+ G T +N+EDKYR M A + +
Sbjct  503   DAGSGNAVAFATGKTARRKEKEAAAAQKQARVALSKSSIAGPTSVNIEDKYRFMFADSHN  562

Query  576   RKEGAADGAWDD  541
             +KEGAADGAWDD
Sbjct  563   KKEGAADGAWDD  574



>ref|XP_002319430.1| DEAD box protein P68 [Populus trichocarpa]
 gb|EEE95353.1| DEAD box protein P68 [Populus trichocarpa]
Length=559

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/571 (72%), Positives = 462/571 (81%), Gaps = 18/571 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSC  2056
             MSY+PPHLRNS++  T+ ++   H     ++   P+ + S + F ++         R S 
Sbjct  1     MSYIPPHLRNSSSNATITASRA-HSVPPTDTNDHPNLSHSSSNFNTSSSTTFASPSRRSS  59

Query  2055  ATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVE  1876
                +    R +  P PVFP W PS+RVL F  +QI EIR RLN+DV+VA  S  APA +E
Sbjct  60    GAFS----RTISVPQPVFPNWTPSDRVLRFNPDQIAEIRSRLNIDVSVASGSPLAPAAIE  115

Query  1875  SFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQ  1696
             SF DMCLH SIMKDIA H+YT PTS+QAQAM VALSGRDLLGCAETGSGKTAAFTIPMIQ
Sbjct  116   SFEDMCLHQSIMKDIAHHEYTRPTSIQAQAMTVALSGRDLLGCAETGSGKTAAFTIPMIQ  175

Query  1695  HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSE  1516
             HCLAQP +RRGDGPLALVLAPTRELAQQIE EVK FSRSL+SF+TAIVVGGTNI DQR E
Sbjct  176   HCLAQPTVRRGDGPLALVLAPTRELAQQIEKEVKGFSRSLESFRTAIVVGGTNIADQRLE  235

Query  1515  LRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKH  1336
             LRAGV+++VATPGRLIDHLQQGNTSLSRISF+VLDEADRMLDMGFEPQIREVM NLP+KH
Sbjct  236   LRAGVDVIVATPGRLIDHLQQGNTSLSRISFIVLDEADRMLDMGFEPQIREVMRNLPEKH  295

Query  1335  QTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLV  1156
             QTLLFSATMP EIE L QEYLT PV+V+VG VSSPTANV+QIL KV E+EKID LL LLV
Sbjct  296   QTLLFSATMPVEIETLTQEYLTSPVQVRVGKVSSPTANVSQILTKVSESEKIDCLLALLV  355

Query  1155  EESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFR  976
             E+++QAE+S  PF LTIVFVERKT+C EVAEAL+ Q L A ALHGGRSQS+REAALRDFR
Sbjct  356   EDASQAERSNQPFPLTIVFVERKTRCNEVAEALVAQALQAVALHGGRSQSDREAALRDFR  415

Query  975   RGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDR  796
              G TSILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTD+
Sbjct  416   SGSTSILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDQ  475

Query  795   DMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLS------LMG  634
             D++LVAQI+KAIADV SGNTV FATGKTARRKEREAAA       AL K +      + G
Sbjct  476   DLFLVAQIKKAIADVESGNTVAFATGKTARRKEREAAA-------ALHKEARNDPSKVTG  528

Query  633   STPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
                IN+EDKYR M+AP++ + EGAAD AWDD
Sbjct  529   PACINIEDKYRFMMAPSIIKSEGAADSAWDD  559



>ref|XP_009374389.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Pyrus x bretschneideri]
Length=571

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/492 (80%), Positives = 436/492 (89%), Gaps = 0/492 (0%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMK  1837
             PD V PQWKPS+RVL  K E IEE+ LRLN+DV+V+ DS  APAP+ESFTDMCLHPSIMK
Sbjct  80    PDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSVSPDSASAPAPIESFTDMCLHPSIMK  139

Query  1836  DIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG  1657
             DI  H YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPP++RGDG
Sbjct  140   DIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPVQRGDG  199

Query  1656  PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPG  1477
             PLALVLAPTRELAQQIE EVKAFS SL+SF+TAIVVGGTNI +QRSELRAGV++VVATPG
Sbjct  200   PLALVLAPTRELAQQIEKEVKAFSASLESFRTAIVVGGTNISEQRSELRAGVDVVVATPG  259

Query  1476  RLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEI  1297
             R IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQIREVM NL +KHQTLLFSATMP EI
Sbjct  260   RFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQIREVMRNLSEKHQTLLFSATMPEEI  319

Query  1296  EALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPF  1117
             E LAQEYLT PV+VKVG VSSPTANV Q LEKVPE+EK DRLL LLVEE+++ E +GHPF
Sbjct  320   EELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPESEKTDRLLALLVEEASRVEGTGHPF  379

Query  1116  SLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVA  937
              LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+Q+EREAALRDFR+G TSILVATDVA
Sbjct  380   PLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRTQTEREAALRDFRKGTTSILVATDVA  439

Query  936   SRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIA  757
             SRGLDV+GVAHVINLDLPK+MEDYVHRIGRTGRAGS GQ+TSFYTDRDM+LVA I+KAI+
Sbjct  440   SRGLDVSGVAHVINLDLPKSMEDYVHRIGRTGRAGSMGQSTSFYTDRDMFLVANIKKAIS  499

Query  756   DVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMS  577
             D GSGN V FATGKTARRKE+EAAAA K+A +ALS  S  G    N+EDKYR M A + +
Sbjct  500   DAGSGNAVAFATGKTARRKEKEAAAAQKQARVALSNSSTAGPASANIEDKYRFMFADSNN  559

Query  576   RKEGAADGAWDD  541
             +KEGAAD AWDD
Sbjct  560   KKEGAADSAWDD  571



>ref|XP_009796074.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Nicotiana 
sylvestris]
Length=534

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/570 (74%), Positives = 458/570 (80%), Gaps = 41/570 (7%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSN----GGDHLHSELNSRQLPSFTQSK-NGFISNGEYCSNDA  2071
             MSYVPPHLRNS+   T   N    G DH  S+L+S Q       + + F SNG   S+  
Sbjct  1     MSYVPPHLRNSSAGKTTTLNSNGAGADHFSSKLSSHQSRIHCNGELDKFSSNGYSNSSRR  60

Query  2070  GRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPA  1891
                + +T +  +      PDP FPQWKPSERVL  K EQIEEIRLRLNVDV VA  S+ A
Sbjct  61    SSVNYSTTSRTA-----IPDPEFPQWKPSERVLRLKSEQIEEIRLRLNVDVNVAPGSSSA  115

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             PAP+ESF DMCLHPSIMKDI  H YT PTS+QAQ+MPVALSGRDLLGCAETGSGKTAAF+
Sbjct  116   PAPIESFPDMCLHPSIMKDIEKHGYTAPTSIQAQSMPVALSGRDLLGCAETGSGKTAAFS  175

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             IPMIQHCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS SLDSFKTAIVVGGT+I 
Sbjct  176   IPMIQHCLAQQPLQRGDGPLALVLAPTRELAQQIEQEVTAFSLSLDSFKTAIVVGGTSIS  235

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
             +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RISFVVLDEADRMLDMGFEPQIREVM N
Sbjct  236   EQRSELRAGVHIVVATPGRLIDHLQQGNTSLCRISFVVLDEADRMLDMGFEPQIREVMRN  295

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRL  1171
             LP+KHQTLLFSATMP EIEALAQ+YLT+PVR+KVG VSSPTANV QILEKVPEN+KIDRL
Sbjct  296   LPEKHQTLLFSATMPTEIEALAQDYLTNPVRIKVGKVSSPTANVFQILEKVPENDKIDRL  355

Query  1170  LDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAA  991
             LDLLVEE+AQ+E+SGHPF LTIVFVERKTKC+EVAEAL +QGLLATALHGGRSQSEREAA
Sbjct  356   LDLLVEEAAQSERSGHPFPLTIVFVERKTKCDEVAEALTQQGLLATALHGGRSQSEREAA  415

Query  990   LRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATS  811
             LRDFR GP +ILVATDVASRGLDV GVAHVINLDLPK                       
Sbjct  416   LRDFRHGPINILVATDVASRGLDVTGVAHVINLDLPK-----------------------  452

Query  810   FYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGS  631
                    YLVAQIR+AIAD+GSGN VTFA GKTARRKEREAAAA KEA   LSKLSL+ S
Sbjct  453   -------YLVAQIRRAIADIGSGNDVTFAMGKTARRKEREAAAAEKEARSTLSKLSLVES  505

Query  630   TPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
               +NVEDKYRHMI PAM +KEGAAD AWDD
Sbjct  506   A-VNVEDKYRHMITPAMIKKEGAADDAWDD  534



>ref|XP_006842508.1| hypothetical protein AMTR_s00077p00105110 [Amborella trichopoda]
 gb|ERN04183.1| hypothetical protein AMTR_s00077p00105110 [Amborella trichopoda]
Length=561

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/565 (74%), Positives = 466/565 (82%), Gaps = 4/565 (1%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSC  2056
             MSYVPPHLR S+      S+  +     LNS +L S   +     ++  Y S+    +  
Sbjct  1     MSYVPPHLRASSLPH---SHSTETPSQPLNSHKLSSLY-NDTASKNSFSYSSSFGSPSRS  56

Query  2055  ATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVE  1876
              T N   PR L  P+P+F QWKPS+RVL    EQIE++RLRLN+DV++ +DS PAPAP+E
Sbjct  57    RTSNVSQPRALSVPEPIFQQWKPSDRVLRLMPEQIEDVRLRLNIDVSIPLDSLPAPAPIE  116

Query  1875  SFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQ  1696
             SF DMCLH  IMKDIA H+YT PT +QAQAMP+ALSGRDLLGCAETGSGKTAAF+IPMIQ
Sbjct  117   SFEDMCLHTIIMKDIAFHEYTRPTPIQAQAMPIALSGRDLLGCAETGSGKTAAFSIPMIQ  176

Query  1695  HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSE  1516
             HCLAQ PLRRGDGPLALVLAPTRELAQQIE EVKAFSRSL+SF+TAIVVGGTNI +QRSE
Sbjct  177   HCLAQQPLRRGDGPLALVLAPTRELAQQIEKEVKAFSRSLESFRTAIVVGGTNIAEQRSE  236

Query  1515  LRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKH  1336
             LRAGV+IVVATPGR IDHLQQGN+SLS +SFVVLDEADRMLDMGFEPQIREVM NLPKKH
Sbjct  237   LRAGVHIVVATPGRFIDHLQQGNSSLSSVSFVVLDEADRMLDMGFEPQIREVMRNLPKKH  296

Query  1335  QTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLV  1156
             QTLLFSATMP EIEALAQEYL +PV+VKVG VSSPTANV+QILEK  E+EKIDRLL LLV
Sbjct  297   QTLLFSATMPVEIEALAQEYLNNPVQVKVGKVSSPTANVSQILEKAIESEKIDRLLALLV  356

Query  1155  EESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFR  976
             EE++QAEKSG P  LTIVFVERKT+C+EV EAL+ QGL A +LHGGRSQSEREAAL  FR
Sbjct  357   EEASQAEKSGQPLPLTIVFVERKTRCDEVVEALVAQGLHAVSLHGGRSQSEREAALCSFR  416

Query  975   RGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDR  796
              G T+ILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAG+TGQATSFYTDR
Sbjct  417   SGSTNILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGTTGQATSFYTDR  476

Query  795   DMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINV  616
             DM +VA IRK IADV SGN + FATGK ARRKEREAAAA +EA    SK SL G   INV
Sbjct  477   DMLVVAHIRKGIADVESGNAMAFATGKEARRKEREAAAALREAKNGFSKFSLSGPASINV  536

Query  615   EDKYRHMIAPAMSRKEGAADGAWDD  541
             EDKYR+M+AP   ++EG+AD AWDD
Sbjct  537   EDKYRYMLAPQTIKREGSADDAWDD  561



>ref|XP_002523955.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF38442.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=564

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/575 (71%), Positives = 464/575 (81%), Gaps = 21/575 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDH----------LHSELNSRQLPSFTQSKNGFISNGEY  2086
             MSYVPPHLRNST  TT  +               L ++ +++   S  +S +  +SNG  
Sbjct  1     MSYVPPHLRNSTATTTTTTTTTTTTTTTITSSITLENDHSTKLSTSTWKSLSSTLSNGSR  60

Query  2085  CSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAM  1906
              +         T  + SPR L  PDPV PQW PSERVL    +Q+E++R RLN++V VA 
Sbjct  61    RT---------TAAFTSPRTLSVPDPVLPQWTPSERVLRLNSQQVEDVRARLNIEVTVAS  111

Query  1905  DSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGK  1726
              S PAPAP+ESF DMCL+ +IMKDIA H YT PT +Q QAM V+LSGRDLL CAETGSGK
Sbjct  112   GSPPAPAPIESFEDMCLNQNIMKDIAYHGYTRPTPIQVQAMTVSLSGRDLLACAETGSGK  171

Query  1725  TAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVG  1546
             TAAFTIPMIQHCLAQ P+RRGDGPLALVLAPTRELAQQIE EVK FSRSLDSF+TAIVVG
Sbjct  172   TAAFTIPMIQHCLAQSPIRRGDGPLALVLAPTRELAQQIEKEVKCFSRSLDSFRTAIVVG  231

Query  1545  GTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  1366
             GTNI DQRSELRAGV+I+VATPGR IDHLQQGNTSLSRISF+VLDEADRMLDMGFEPQIR
Sbjct  232   GTNIADQRSELRAGVDIMVATPGRFIDHLQQGNTSLSRISFIVLDEADRMLDMGFEPQIR  291

Query  1365  EVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENE  1186
             EV+HNLP++HQTLLFSATMP EIE LAQEYLT PV+VKVG VS  TANV+Q+L+KV E+E
Sbjct  292   EVLHNLPERHQTLLFSATMPEEIETLAQEYLTTPVQVKVGKVSGLTANVSQVLKKVSESE  351

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             KID LL LLVE+++QAE++ HPF LT+VFV+RK +C+EVAEAL+ QGL A ALHGGRSQ+
Sbjct  352   KIDCLLGLLVEDASQAERADHPFPLTVVFVDRKARCDEVAEALVAQGLRAVALHGGRSQN  411

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             EREAAL DFR G T ILVATDVASRGLDV GV HVINLDLPKTMEDYVHR+GRTGRAGS 
Sbjct  412   EREAALHDFRSGSTDILVATDVASRGLDVTGVTHVINLDLPKTMEDYVHRVGRTGRAGSA  471

Query  825   GQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKL  646
             GQATSFYTDRD++LVAQI+KAIADV SGNTV FATGK ARRKEREAAA+ KEA   LSK 
Sbjct  472   GQATSFYTDRDLFLVAQIKKAIADVKSGNTVAFATGKVARRKEREAAASQKEARNDLSK-  530

Query  645   SLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
              L+G T IN+EDKYR MIA + ++ EG AD AWDD
Sbjct  531   -LLGPTSINIEDKYRFMIASSNTKGEGVADSAWDD  564



>ref|XP_011021058.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=559

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/571 (73%), Positives = 463/571 (81%), Gaps = 18/571 (3%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSC  2056
             MSY+PPHLRNS++  T+ ++   H    +++   P+ + S + F ++    S    R S 
Sbjct  1     MSYIPPHLRNSSSTATITTSRA-HSVPPIDTNDHPNLSHSSSNFNTSSSTTSASPSRRSA  59

Query  2055  ATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVE  1876
                    PR +  P PV P W PS+RVL F  +QI EIR RLN+DV+VA  S  APA +E
Sbjct  60    GAF----PRTISVPQPVVPNWTPSDRVLRFNPDQIAEIRSRLNIDVSVASGSPLAPAAIE  115

Query  1875  SFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQ  1696
             SF DMCLH SIMK IA H+YT PTS+QAQAM VALSGRDLLGCAETGSGKTAAFTIPMIQ
Sbjct  116   SFEDMCLHQSIMKAIAHHEYTRPTSIQAQAMTVALSGRDLLGCAETGSGKTAAFTIPMIQ  175

Query  1695  HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSE  1516
             HCLAQPP+RRGDGPLALVLAPTRELAQQIE EVK FSRSL+SF+TAIVVGGTNI DQR E
Sbjct  176   HCLAQPPVRRGDGPLALVLAPTRELAQQIEKEVKGFSRSLESFRTAIVVGGTNIADQRLE  235

Query  1515  LRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKH  1336
             LRAGV+++VATPGRLIDHLQQGNTSLSRISF+VLDEADRMLDMGFEPQIREVM NLP+KH
Sbjct  236   LRAGVDVIVATPGRLIDHLQQGNTSLSRISFIVLDEADRMLDMGFEPQIREVMRNLPEKH  295

Query  1335  QTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLV  1156
             QTLLFSATMP EIE L QEYLT PV+VKVG VSSPTANV+QIL KV E+EKID LL LLV
Sbjct  296   QTLLFSATMPVEIETLTQEYLTSPVQVKVGKVSSPTANVSQILTKVSESEKIDCLLALLV  355

Query  1155  EESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFR  976
             E+++QAE+S  PF LTIVFVERKT+C EVAEAL+ Q L A ALHGGRSQSEREAALRDFR
Sbjct  356   EDASQAERSNQPFPLTIVFVERKTRCNEVAEALVAQALRAVALHGGRSQSEREAALRDFR  415

Query  975   RGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDR  796
              G TSILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTD+
Sbjct  416   SGSTSILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDQ  475

Query  795   DMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLS------LMG  634
             D++LVAQI+KAIADV SGNTV FATGKTARRKEREAAA       AL K +      +MG
Sbjct  476   DLFLVAQIKKAIADVESGNTVAFATGKTARRKEREAAA-------ALQKEARNDPSKVMG  528

Query  633   STPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
                IN+EDKYR MIAP+  + EGAAD AWDD
Sbjct  529   PACINIEDKYRFMIAPSSIKSEGAADSAWDD  559



>ref|XP_004500377.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DBP2-like 
[Cicer arietinum]
Length=575

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/576 (71%), Positives = 458/576 (80%), Gaps = 35/576 (6%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG------DHLHSELN------------SRQLPSFTQSKN  2110
             MSYVPPHLRN+T+ T   +         D+ H   N            +   PSF     
Sbjct  1     MSYVPPHLRNATSTTVATTTRPSSSSTLDNHHHNTNLAFSSSHSHSHSNNNTPSF-----  55

Query  2109  GFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRL  1930
                      SN + R S A     S R L  PD VFP+W+PSERV     +QIEE+R+RL
Sbjct  56    ---------SNASRRTSAAPP---SSRILAVPDTVFPKWQPSERVSRMNPDQIEEVRIRL  103

Query  1929  NVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLG  1750
             N+DV V+ DS  APA +ESF DMCLHPSIMKDIA H+YT PTS+Q+QAMP+AL+GRDLLG
Sbjct  104   NLDVTVSSDSPAAPAAIESFNDMCLHPSIMKDIAYHEYTRPTSIQSQAMPIALTGRDLLG  163

Query  1749  CAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDS  1570
             CAETGSGKTAAFTIPMIQHCLAQ P+RRGDGPLALVLAPTRELAQQIE EV+AFSRSL+S
Sbjct  164   CAETGSGKTAAFTIPMIQHCLAQTPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLES  223

Query  1569  FKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLD  1390
              KTAIVVGGTNI  QRSELRAGV I VATPGR IDHLQQGNTSLSRIS+VVLDEADRMLD
Sbjct  224   LKTAIVVGGTNIEKQRSELRAGVEIAVATPGRFIDHLQQGNTSLSRISYVVLDEADRMLD  283

Query  1389  MGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQI  1210
             MGFEPQIRE+M NLP+KHQTLLFSATMP EIEAL++EYL +PV+VKVG VSSPT NV+Q 
Sbjct  284   MGFEPQIREIMRNLPEKHQTLLFSATMPVEIEALSKEYLANPVQVKVGKVSSPTTNVSQT  343

Query  1209  LEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATA  1030
             L KV E+EKIDRLLDLLVEE++QAEK+GHPF LTIVFVERKT+C+EVAEAL+ QGL A +
Sbjct  344   LVKVSESEKIDRLLDLLVEEASQAEKAGHPFPLTIVFVERKTRCDEVAEALVAQGLSAVS  403

Query  1029  LHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIG  850
             LHGGRSQSEREAAL DFR   TSILVATDVASRGLDV GV+HVINLDLPKT EDY+HRIG
Sbjct  404   LHGGRSQSEREAALHDFRSSSTSILVATDVASRGLDVTGVSHVINLDLPKTTEDYIHRIG  463

Query  849   RTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahke  670
             RTGRAGSTG ATSFYTDRDM+LV  IRKAIAD  SGN V FATGK ARRKE+EAAAAHKE
Sbjct  464   RTGRAGSTGIATSFYTDRDMFLVTNIRKAIADAESGNAVAFATGKVARRKEKEAAAAHKE  523

Query  669   ANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGA  562
             ANIALS+    G+  IN+EDKYR MI  +  ++EGA
Sbjct  524   ANIALSRHLGSGAASINIEDKYRFMITASNIKREGA  559



>ref|XP_006432064.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
 gb|ESR45304.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
Length=485

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/471 (82%), Positives = 420/471 (89%), Gaps = 1/471 (0%)
 Frame = -3

Query  1953  IEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVA  1774
             IEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QAQAMPVA
Sbjct  16    IEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQAQAMPVA  75

Query  1773  LSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVK  1594
             LSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQIE EVK
Sbjct  76    LSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQIEKEVK  135

Query  1593  AFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVL  1414
             A SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR+SFVVL
Sbjct  136   ALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSRVSFVVL  195

Query  1413  DEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSS  1234
             DEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQEYLTDPV+VKVG VSS
Sbjct  196   DEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQEYLTDPVQVKVGKVSS  255

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
             PTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+EV+EAL+
Sbjct  256   PTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDEVSEALV  315

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
              +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATDVASRGLDV GVAHV+NLDLPKT+
Sbjct  316   AEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATDVASRGLDVMGVAHVVNLDLPKTV  375

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrker  694
             EDYVHRIGRTGR GS GQATSFYTDRDM LVAQI+KAI D  SGN V FATGK ARRKER
Sbjct  376   EDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNAVAFATGKVARRKER  435

Query  693   eaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             EAAAA K A +A SKLS+MG + +N+EDKYR MIA +  ++EGAAD AWDD
Sbjct  436   EAAAAQKGATVATSKLSMMGPS-VNIEDKYRFMIAASNMKREGAADSAWDD  485



>ref|XP_009600281.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X3 [Nicotiana 
tomentosiformis]
Length=549

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/588 (72%), Positives = 460/588 (78%), Gaps = 62/588 (11%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTA--TTVVSNGG--DHLHSELNSRQLPSFTQSKNGFISNGEY----CS  2080
             MSYVPPHLRN +    TT+ S+G   D+  S+L+S Q        +    NGE      +
Sbjct  1     MSYVPPHLRNFSAGKTTTLNSDGAAADYFSSKLSSHQ--------SRIHCNGELDKSSSN  52

Query  2079  NDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDS  1900
               +  +  ++VNY +      PDP FPQWKPSERVL  K EQIEEIRLRLNVDV VA  S
Sbjct  53    GYSNSSRRSSVNYSTASRTAIPDPEFPQWKPSERVLRLKSEQIEEIRLRLNVDVNVAPGS  112

Query  1899  NPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTA  1720
             + APAP+ESF DMCLHPSIMKDI  H YT PTS+QAQ+MPVALSGRDLLGCAETGSGKTA
Sbjct  113   SSAPAPIESFPDMCLHPSIMKDIEKHGYTAPTSIQAQSMPVALSGRDLLGCAETGSGKTA  172

Query  1719  AFTIPMIQ---------------HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFS  1585
             AF+IPMIQ               HCLAQ PL+RGDGPLALVLAPTRELAQQIE EV AFS
Sbjct  173   AFSIPMIQVANFMSMSYCESVSVHCLAQQPLQRGDGPLALVLAPTRELAQQIEKEVTAFS  232

Query  1584  RSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEA  1405
              SLDSFKT+IVVGGTNI +QRSELRAGV+IVVATPGRLIDHLQQGNTSL RISFVVLDEA
Sbjct  233   LSLDSFKTSIVVGGTNISEQRSELRAGVHIVVATPGRLIDHLQQGNTSLCRISFVVLDEA  292

Query  1404  DRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTA  1225
             DRMLDMGFEPQIREVM NLP+KHQTLLFSATMP EIEALAQ+YLT+PVR+KVG VSSPTA
Sbjct  293   DRMLDMGFEPQIREVMRNLPEKHQTLLFSATMPTEIEALAQDYLTNPVRIKVGKVSSPTA  352

Query  1224  NVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQG  1045
             NV+QILEKVPEN+KIDRLLDLLVEE+AQ+E+SGHPF LTIVFVERKTKC+EVAEAL +QG
Sbjct  353   NVSQILEKVPENDKIDRLLDLLVEEAAQSERSGHPFPLTIVFVERKTKCDEVAEALTQQG  412

Query  1044  LLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDY  865
             LLATALHGGRSQSEREAALRDFR GP +ILVATDVASRGLDV GV HVINLDLPK     
Sbjct  413   LLATALHGGRSQSEREAALRDFRHGPINILVATDVASRGLDVTGVGHVINLDLPK-----  467

Query  864   VHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaa  685
                                      YLVAQIR+AIAD+GSGN VTFA GKTARRKEREAA
Sbjct  468   -------------------------YLVAQIRRAIADIGSGNDVTFAMGKTARRKEREAA  502

Query  684   aahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             AA KEA   LSKLSL+ S  +NVEDKYRHMI PAM +KEGAAD AWDD
Sbjct  503   AAEKEARSTLSKLSLVESA-VNVEDKYRHMITPAMIKKEGAADDAWDD  549



>gb|AAF75791.1|AF271892_1 DEAD box protein P68 [Pisum sativum]
Length=622

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/565 (71%), Positives = 454/565 (80%), Gaps = 16/565 (3%)
 Frame = -3

Query  2235  MSYVPPHLRN-------STTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSN  2077
             MSYVPPHLRN       +TT  +  S   DH H   N     S+  S +  ++NG     
Sbjct  1     MSYVPPHLRNASSTAVATTTRPSASSGTLDHHHHNTNLAFSSSYPHSNSSSLANG-----  55

Query  2076  DAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSN  1897
                R + A  + +S   +  PD VFP W+PSERV     +QIEE+ +RLN+DV V+ DS 
Sbjct  56    --SRRTSAATSAISEL-VTVPDTVFPNWQPSERVSRMNPDQIEEV-VRLNLDVTVSSDST  111

Query  1896  PAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAA  1717
              AP P+ESF DMCLHPSIMKDIA H+YT P+S+QAQAMP+ALSGRDLLGCAETGSGKTAA
Sbjct  112   AAPGPIESFNDMCLHPSIMKDIAYHEYTRPSSIQAQAMPIALSGRDLLGCAETGSGKTAA  171

Query  1716  FTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTN  1537
             FTIPM+QHCL QPP+RRGDGPLALVLAPTRELAQQIE EV+AFSRSL+S K  IVVGGTN
Sbjct  172   FTIPMLQHCLVQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESLKNCIVVGGTN  231

Query  1536  IGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  1357
             I  QRSELRAGV I VATPGR IDHLQQGNTSLSRIS+VVLDEADRMLDMGFEPQIRE+M
Sbjct  232   IEKQRSELRAGVEIAVATPGRFIDHLQQGNTSLSRISYVVLDEADRMLDMGFEPQIREIM  291

Query  1356  HNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKID  1177
              +LP+KHQTLLFSATMP EIEALA+EYL +PV+VKVG VSSPT NV+Q L KV  +EKID
Sbjct  292   RSLPEKHQTLLFSATMPVEIEALAKEYLANPVQVKVGKVSSPTTNVSQTLVKVSGSEKID  351

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
             RLLDLLVEE++QAEK GH F LTIVFVERKT+C+EVAEAL+ QGL A +LHGG SQ+ERE
Sbjct  352   RLLDLLVEEASQAEKCGHRFPLTIVFVERKTRCDEVAEALVAQGLSAVSLHGGHSQNERE  411

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
             AAL++FR   TSILVATDVASRGLDV GV+HVINLDLPKT EDY+HRIGRTGRAGSTG A
Sbjct  412   AALQNFRSSSTSILVATDVASRGLDVTGVSHVINLDLPKTTEDYIHRIGRTGRAGSTGIA  471

Query  816   TSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLM  637
             TSFYTDRDM+LV  IRKAIAD  SGN V FATGK ARRKE+EAAAAHKEANIA S+   +
Sbjct  472   TSFYTDRDMFLVTNIRKAIADAESGNAVAFATGKVARRKEKEAAAAHKEANIASSRHLGL  531

Query  636   GSTPINVEDKYRHMIAPAMSRKEGA  562
             G+  IN+EDKYR MIA + SR EGA
Sbjct  532   GAASINIEDKYRFMIAASNSRGEGA  556



>gb|KEH34508.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=530

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/568 (72%), Positives = 448/568 (79%), Gaps = 41/568 (7%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG--DHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRN  2062
             MSYVPPHLRN+ ++TTV +N G  D+ H   +     +F+ S     SN     N + R 
Sbjct  1     MSYVPPHLRNAASSTTVSTNTGTLDNHHHHHHHNNNLAFSNSH----SNSPSLFNASRRT  56

Query  2061  SCATVNYLSPRGLVA-PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPA  1885
             S A     S R + A PD VFP+W+PSERV             R+N              
Sbjct  57    SAAPP---SSRTIAAVPDTVFPKWQPSERV------------SRMN--------------  87

Query  1884  PVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIP  1705
                   D CLHPSIMKDIA HDYT PTS+QAQAMP+ALSGRDLLGCAETGSGKTAAFTIP
Sbjct  88    -----PDQCLHPSIMKDIAYHDYTRPTSIQAQAMPIALSGRDLLGCAETGSGKTAAFTIP  142

Query  1704  MIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQ  1525
             MIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EV+AFSRSL+SFKTAIVVGGTNI  Q
Sbjct  143   MIQHCLAQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESFKTAIVVGGTNIEKQ  202

Query  1524  RSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLP  1345
             RSELRAGV I VATPGR IDHLQQGNTSLSRIS+VVLDEADRMLDMGFEPQIRE+M +LP
Sbjct  203   RSELRAGVEIAVATPGRFIDHLQQGNTSLSRISYVVLDEADRMLDMGFEPQIREIMRSLP  262

Query  1344  KKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLD  1165
             +KHQTLLFSATMP EIEAL++EYL  PV+VKVG VSSPT NV+Q L KV ENEKIDRLLD
Sbjct  263   EKHQTLLFSATMPVEIEALSKEYLASPVQVKVGKVSSPTTNVSQTLVKVSENEKIDRLLD  322

Query  1164  LLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALR  985
             LLVEE++QAEK GHPF LTIVFVERKT+C+EVAEAL+ QGL A +LHGGRSQSEREAAL 
Sbjct  323   LLVEEASQAEKCGHPFPLTIVFVERKTRCDEVAEALIAQGLSAVSLHGGRSQSEREAALH  382

Query  984   DFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFY  805
             DFR   TSILVATDVASRGLDV GV+HVINLDLPKT EDY+HRIGRTGRAGSTG ATSFY
Sbjct  383   DFRSSSTSILVATDVASRGLDVTGVSHVINLDLPKTTEDYIHRIGRTGRAGSTGIATSFY  442

Query  804   TDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTP  625
             TDRDM+LV+ IRKAIAD  SGN V FATGK ARRKE+EAAAAHKEANIALSK    G+  
Sbjct  443   TDRDMFLVSNIRKAIADAESGNAVAFATGKVARRKEKEAAAAHKEANIALSKHLGPGAAS  502

Query  624   INVEDKYRHMIAPAMSRKEGAADGAWDD  541
             IN+EDKYR MIA + S+ EG AD AWDD
Sbjct  503   INIEDKYRFMIAASNSKGEGTADSAWDD  530



>ref|XP_010094427.1| ATP-dependent RNA helicase DBP2 [Morus notabilis]
 gb|EXB56008.1| ATP-dependent RNA helicase DBP2 [Morus notabilis]
Length=509

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/564 (70%), Positives = 433/564 (77%), Gaps = 57/564 (10%)
 Frame = -3

Query  2232  SYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCA  2053
             SYVPPHLRNS + TT  +       S +++      + + NGF            R + A
Sbjct  3     SYVPPHLRNSDSTTTTTTANTTTAASRVSATDFTKLSYTSNGF------------RRTSA  50

Query  2052  TVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVES  1873
             TV  LS +GL   DPVFP WKPSERVL    EQIEE+RLRLNVDV    DS PA AP+ES
Sbjct  51    TVPPLS-KGLAVADPVFPLWKPSERVLAMNPEQIEEVRLRLNVDVTSPPDSEPASAPIES  109

Query  1872  FTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQH  1693
             FTDMCLHP+IMKDIALH+YT PTS+QAQAMP ALSGRDLLGCAETGSGKTAAF IPMIQH
Sbjct  110   FTDMCLHPNIMKDIALHEYTRPTSIQAQAMPAALSGRDLLGCAETGSGKTAAFAIPMIQH  169

Query  1692  CLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSEL  1513
             CLAQ P+ RGDGPLALVLAPTRELAQQIE EVKAFS+SL+SFKTAIVVGGTNI +QRSEL
Sbjct  170   CLAQSPIHRGDGPLALVLAPTRELAQQIEKEVKAFSKSLESFKTAIVVGGTNIAEQRSEL  229

Query  1512  RAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQ  1333
             RAGV+IVVATPGR IDHLQQGNTSLSR+SFVVLDEADRMLDMGFEPQIREVM NLP+KHQ
Sbjct  230   RAGVDIVVATPGRFIDHLQQGNTSLSRVSFVVLDEADRMLDMGFEPQIREVMQNLPEKHQ  289

Query  1332  TLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVE  1153
             TLLFSATMP EIEALAQEYL+ PV+VKVG VSSPTANV Q LEKV E+EKIDRLL LLVE
Sbjct  290   TLLFSATMPVEIEALAQEYLSKPVQVKVGKVSSPTANVCQSLEKVCESEKIDRLLALLVE  349

Query  1152  ESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRR  973
             E+++AE++GHPF LTIVFVERK                                      
Sbjct  350   EASRAERTGHPFPLTIVFVERK--------------------------------------  371

Query  972   GPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRD  793
                   VATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGS GQATSFYTDRD
Sbjct  372   ------VATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSMGQATSFYTDRD  425

Query  792   MYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVE  613
             M+LVA I+KAIADV SGNTV FA GK ARRKEREAAA  ++A IA+SKLS+ G+  +N+E
Sbjct  426   MFLVAHIKKAIADVESGNTVEFAMGKIARRKEREAAATQRDARIAVSKLSMNGTNSLNIE  485

Query  612   DKYRHMIAPAMSRKEGAADGAWDD  541
             DKYR MIA    ++EGAAD AWDD
Sbjct  486   DKYRFMIASLSIKREGAADSAWDD  509



>ref|XP_001769905.1| predicted protein [Physcomitrella patens]
 ref|XP_001769935.1| predicted protein [Physcomitrella patens]
 gb|EDQ65265.1| predicted protein [Physcomitrella patens]
 gb|EDQ65295.1| predicted protein [Physcomitrella patens]
Length=582

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/499 (74%), Positives = 425/499 (85%), Gaps = 2/499 (0%)
 Frame = -3

Query  2031  RGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLH  1852
             RG   P+ V+  W+PSERV   + EQI E+R RLNVDV +A  S PAPAP+ESF DMCLH
Sbjct  84    RGAGHPEVVWATWQPSERVQKLQPEQIAEVRARLNVDVEIATGSEPAPAPIESFEDMCLH  143

Query  1851  PSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPL  1672
              SIMKD+  H+YT PT +QAQA+PVALSGRDLLGCAETGSGKTAAF++PMIQHCLAQPP+
Sbjct  144   LSIMKDVTFHNYTTPTPIQAQALPVALSGRDLLGCAETGSGKTAAFSLPMIQHCLAQPPI  203

Query  1671  RRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIV  1492
             RRGDGPLALVLAPTRELAQQIE EVKAF RS + F+TAIVVGGTNI +QRSELRAGV IV
Sbjct  204   RRGDGPLALVLAPTRELAQQIEKEVKAFCRSAEGFRTAIVVGGTNIYEQRSELRAGVEIV  263

Query  1491  VATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSAT  1312
             VATPGR IDHLQQGN+SLSR+S+VVLDEADRMLDMGFEPQIREVM +LPKKHQTLLFSAT
Sbjct  264   VATPGRFIDHLQQGNSSLSRVSYVVLDEADRMLDMGFEPQIREVMRSLPKKHQTLLFSAT  323

Query  1311  MPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEK  1132
             MP EIEALAQEYL +P+RVKVG VSSPTANV Q LEK+ E EKI+ LL LLV+E +Q+  
Sbjct  324   MPEEIEALAQEYLDNPIRVKVGRVSSPTANVTQNLEKITEKEKIESLLALLVDEHSQSLD  383

Query  1131  SGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
             +  P  LTIVFVERK +C+EV +AL++QGL ATALHGGRSQSEREAALRDFR+G T+ILV
Sbjct  384   TNQPPPLTIVFVERKARCDEVTDALVEQGLKATALHGGRSQSEREAALRDFRKGTTNILV  443

Query  951   ATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             ATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAG++G+ATSFYT+RDM+LVAQI
Sbjct  444   ATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGASGRATSFYTERDMFLVAQI  503

Query  771   RKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMI  592
             R+AI +  SGN + FATGK ARRKERE AAA +E  +A   ++ +G+T + V+DKY+HM+
Sbjct  504   RRAITEAESGNAMAFATGKAARRKEREQAAAFREGRVAPLGVAQIGATTVRVDDKYKHML  563

Query  591   APAMSRK--EGAADGAWDD  541
             + A   K  EGAAD AW+D
Sbjct  564   SAAADPKKGEGAADDAWED  582



>ref|XP_001785829.1| predicted protein [Physcomitrella patens]
 gb|EDQ49361.1| predicted protein [Physcomitrella patens]
Length=538

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/567 (65%), Positives = 431/567 (76%), Gaps = 31/567 (5%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSC  2056
             M YVPPHLR                 +  +          ++ +   G + ++   R S 
Sbjct  1     MPYVPPHLRAGAAPAAAAPASSGGAAARRDG--------GRDSY--GGSFGASAGARRSA  50

Query  2055  ATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVE  1876
             +     + RG+  P+ V+P WKPSERV     EQI E+R RLNVDV +  D+ PAPAP+E
Sbjct  51    SEGEGSAARGVGHPEVVWPDWKPSERVRKLLPEQIAEVRARLNVDVEITPDTEPAPAPIE  110

Query  1875  SFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQ  1696
             SF DMCLH SIMKD+  H+YT PT +QAQA+PVALSGRDLLGCAETGSGKTAAF++PMIQ
Sbjct  111   SFEDMCLHLSIMKDVTFHNYTTPTPIQAQALPVALSGRDLLGCAETGSGKTAAFSLPMIQ  170

Query  1695  HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSE  1516
             HCLAQPP+RRGDGPLALVLAPTRELAQQIE EVKAFSRS + FKT+IVVGGTNI +QRSE
Sbjct  171   HCLAQPPIRRGDGPLALVLAPTRELAQQIEKEVKAFSRSAEGFKTSIVVGGTNIYEQRSE  230

Query  1515  LRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKH  1336
             LRAGV IVVATPGR IDHLQQGN+SLSR+S+VVLDEADRMLDMGFEPQIREVM +LPKKH
Sbjct  231   LRAGVEIVVATPGRFIDHLQQGNSSLSRVSYVVLDEADRMLDMGFEPQIREVMRSLPKKH  290

Query  1335  QTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLV  1156
             QTLLFSATMP EIEALAQEYL  PVRVKVG VSSPTANV Q LEK+ E EKID LL LLV
Sbjct  291   QTLLFSATMPEEIEALAQEYLNKPVRVKVGRVSSPTANVTQNLEKITEKEKIDSLLALLV  350

Query  1155  EESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFR  976
             +E +Q+  S  P  LTIVFVERK +C+EV +AL++QGL ATALHGGRSQSEREAALRDFR
Sbjct  351   DEHSQSLDSNQPPPLTIVFVERKARCDEVTDALVEQGLKATALHGGRSQSEREAALRDFR  410

Query  975   RGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDR  796
             +G T+ILVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAG++G+ATSFYT+R
Sbjct  411   KGTTNILVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGASGRATSFYTER  470

Query  795   DMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINV  616
             D++LVAQIR+AI +  SGNT+  A G                  +    ++ +G+T + V
Sbjct  471   DVFLVAQIRRAITEAESGNTM--AEG-----------------RMTPLGVAQVGATTVRV  511

Query  615   EDKYRHMIAPAMSRK--EGAADGAWDD  541
             +DKY+HM++     K  EGAAD AW+D
Sbjct  512   DDKYKHMLSATADPKKGEGAADDAWED  538



>ref|XP_002960303.1| hypothetical protein SELMODRAFT_75384 [Selaginella moellendorffii]
 ref|XP_002967410.1| hypothetical protein SELMODRAFT_168957 [Selaginella moellendorffii]
 gb|EFJ32009.1| hypothetical protein SELMODRAFT_168957 [Selaginella moellendorffii]
 gb|EFJ37842.1| hypothetical protein SELMODRAFT_75384 [Selaginella moellendorffii]
Length=575

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/576 (67%), Positives = 446/576 (77%), Gaps = 12/576 (2%)
 Frame = -3

Query  2235  MSYVPPHLR-----NSTTATTVVSNGGDHLH-SELNSRQLP---SF-TQSKNGFISNGEY  2086
             M Y+PPHLR     NS  AT    +        +  SR      SF + S+N   +NG  
Sbjct  1     MPYIPPHLRSGASSNSRAATPASPSPSQRSSSGDFGSRDRDYGGSFGSYSRNRPDANGFA  60

Query  2085  CSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAM  1906
               N  GR      +    RGL  P+ V+ +W+PSERV   + +QI ++R RLNVDV +  
Sbjct  61    SGNGYGREKWPFPSR-DTRGLPPPEAVWSRWQPSERVRRMQSDQIADVRARLNVDVEITD  119

Query  1905  DSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGK  1726
              +  A APVE+F DMCLH +IMKDIA H+YT PT +QAQAMPVALSGRDLLGCAETGSGK
Sbjct  120   GTPAAQAPVETFEDMCLHANIMKDIAFHEYTNPTPIQAQAMPVALSGRDLLGCAETGSGK  179

Query  1725  TAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVG  1546
             TAAF IPMIQHCLAQPP+R GDGPLALVLAPTRELAQQIE EV+AFSRS D FKTAIVVG
Sbjct  180   TAAFAIPMIQHCLAQPPIRHGDGPLALVLAPTRELAQQIEKEVRAFSRSTDGFKTAIVVG  239

Query  1545  GTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  1366
             GT+IG+QRSELR+GV +VVATPGR IDHLQQGN+SL R+S+VVLDEADRMLDMGF PQI+
Sbjct  240   GTHIGEQRSELRSGVQVVVATPGRFIDHLQQGNSSLLRVSYVVLDEADRMLDMGFLPQIK  299

Query  1365  EVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENE  1186
             EVM NLPKKHQTLLFSATMP EIEALAQEYLT PV+VKVG VSSPT+NV Q LEKV E +
Sbjct  300   EVMQNLPKKHQTLLFSATMPEEIEALAQEYLTKPVQVKVGKVSSPTSNVLQSLEKVDEKD  359

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             KID LL +LVE S Q+E++G P  LTIVFVERK +C++VA+AL+ QGL A ALHGGR+Q 
Sbjct  360   KIDYLLAMLVESSNQSERAGQPPPLTIVFVERKARCDDVADALLAQGLKAAALHGGRTQG  419

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             EREAALRDFR+G  SILVATDVASRGLDV GVAHV+NLDLPK MEDYVHRIGRTGRAG++
Sbjct  420   EREAALRDFRKGAISILVATDVASRGLDVTGVAHVVNLDLPKVMEDYVHRIGRTGRAGAS  479

Query  825   GQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANI-ALSK  649
             G+ATS YTDRD +LVAQIRKAIA+  +GN + FATGK ARRKERE AAA KE  +   S 
Sbjct  480   GRATSLYTDRDAFLVAQIRKAIAEAEAGNVMAFATGKAARRKEREEAAAFKEGRLTGTSG  539

Query  648   LSLMGSTPINVEDKYRHMIAPAMSRKEGAADGAWDD  541
             +   GST + V+DKY+HM+  ++  K+G AD AWDD
Sbjct  540   VGTFGSTTVRVDDKYKHMLVASVDPKKGVADDAWDD  575



>gb|KHN24726.1| ATP-dependent RNA helicase DBP2 [Glycine soja]
Length=441

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/441 (83%), Positives = 394/441 (89%), Gaps = 0/441 (0%)
 Frame = -3

Query  1863  MCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLA  1684
             MCLHPSIMKDIA H+YT PTS+QAQAMP+ALSGRDLLGCAETGSGKTAAFTIPMIQHCLA
Sbjct  1     MCLHPSIMKDIAYHEYTRPTSIQAQAMPIALSGRDLLGCAETGSGKTAAFTIPMIQHCLA  60

Query  1683  QPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAG  1504
             Q P+RR DGPLALVLAPTRELAQQIE EVKAFSRSL+S KTAIVVGGTNI  QRSELRAG
Sbjct  61    QHPIRRNDGPLALVLAPTRELAQQIEKEVKAFSRSLESLKTAIVVGGTNIEKQRSELRAG  120

Query  1503  VNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLL  1324
             V I VATPGR IDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM NLP+KHQTLL
Sbjct  121   VEIAVATPGRFIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMRNLPEKHQTLL  180

Query  1323  FSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESA  1144
             FSATMP EIE L++EYL +PV+VKVG VSSPT NV+Q L K+ ENEKIDRLLDLLVEE++
Sbjct  181   FSATMPVEIEELSKEYLANPVQVKVGKVSSPTTNVSQTLVKISENEKIDRLLDLLVEEAS  240

Query  1143  QAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPT  964
             QAEK GHP  LTIVFVERKT+C+EVAEAL+ QGL A +LHGGRSQSEREAAL DFR G T
Sbjct  241   QAEKCGHPCPLTIVFVERKTRCDEVAEALVAQGLSAVSLHGGRSQSEREAALHDFRSGST  300

Query  963   SILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYL  784
             +ILVATDVASRGLDV GV+HVINLDLPKTMEDYVHRIGRTGRAGSTG ATSFYTDRDM+L
Sbjct  301   NILVATDVASRGLDVTGVSHVINLDLPKTMEDYVHRIGRTGRAGSTGLATSFYTDRDMFL  360

Query  783   VAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKY  604
             VA IRKAIAD  SGNT+TFATGK ARRKE+EAAAA KEANIALSK   +G+  +N+EDKY
Sbjct  361   VANIRKAIADAESGNTLTFATGKVARRKEKEAAAAQKEANIALSKQLGLGAASMNIEDKY  420

Query  603   RHMIAPAMSRKEGAADGAWDD  541
             + MI    ++KEGAAD AWDD
Sbjct  421   KFMITATNTKKEGAADSAWDD  441



>ref|XP_006432065.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
 gb|ESR45305.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
Length=433

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/434 (82%), Positives = 387/434 (89%), Gaps = 1/434 (0%)
 Frame = -3

Query  1842  MKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRG  1663
             MKDI  H+YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RG
Sbjct  1     MKDIEFHEYTRPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRG  60

Query  1662  DGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVAT  1483
             DGPLALVLAPTRELAQQIE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVAT
Sbjct  61    DGPLALVLAPTRELAQQIEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVAT  120

Query  1482  PGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPA  1303
             PGR +DHLQQGNTSLSR+SFVVLDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP 
Sbjct  121   PGRFLDHLQQGNTSLSRVSFVVLDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPV  180

Query  1302  EIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGH  1123
             EIEALAQEYLTDPV+VKVG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS H
Sbjct  181   EIEALAQEYLTDPVQVKVGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCH  240

Query  1122  PFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATD  943
             PF LTIVFVERKT+C+EV+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATD
Sbjct  241   PFPLTIVFVERKTRCDEVSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATD  300

Query  942   VASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKA  763
             VASRGLDV GVAHV+NLDLPKT+EDYVHRIGRTGR GS GQATSFYTDRDM LVAQI+KA
Sbjct  301   VASRGLDVMGVAHVVNLDLPKTVEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKA  360

Query  762   IADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPA  583
             I D  SGN V FATGK ARRKEREAAAA K A +A SKLS+MG + +N+EDKYR MIA +
Sbjct  361   IVDAESGNAVAFATGKVARRKEREAAAAQKGATVATSKLSMMGPS-VNIEDKYRFMIAAS  419

Query  582   MSRKEGAADGAWDD  541
               ++EGAAD AWDD
Sbjct  420   NMKREGAADSAWDD  433



>gb|KDO45074.1| hypothetical protein CISIN_1g008428mg [Citrus sinensis]
Length=433

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/434 (82%), Positives = 387/434 (89%), Gaps = 1/434 (0%)
 Frame = -3

Query  1842  MKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRG  1663
             MKDI  H+YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RG
Sbjct  1     MKDIEFHEYTRPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRG  60

Query  1662  DGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVAT  1483
             DGPLALVLAPTRELAQQIE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVAT
Sbjct  61    DGPLALVLAPTRELAQQIEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVAT  120

Query  1482  PGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPA  1303
             PGR +DHLQQGNTSLSR+SFV+LDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP 
Sbjct  121   PGRFLDHLQQGNTSLSRVSFVILDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPV  180

Query  1302  EIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGH  1123
             EIEALAQEYLTDPV+VKVG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS H
Sbjct  181   EIEALAQEYLTDPVQVKVGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCH  240

Query  1122  PFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATD  943
             PF LTIVFVERKT+C+EV+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATD
Sbjct  241   PFPLTIVFVERKTRCDEVSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATD  300

Query  942   VASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKA  763
             VASRGLDV GVAHV+NLDLPKT+EDYVHRIGRTGR GS GQATSFYTDRDM LVAQI+KA
Sbjct  301   VASRGLDVMGVAHVVNLDLPKTVEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKA  360

Query  762   IADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPA  583
             I D  SGN V FATGK ARRKEREAAAA K A +A SKLS+MG + +N+EDKYR MIA +
Sbjct  361   IVDAESGNAVAFATGKVARRKEREAAAAQKGATVATSKLSMMGPS-VNIEDKYRFMIAAS  419

Query  582   MSRKEGAADGAWDD  541
               ++EGAAD AWDD
Sbjct  420   NMKREGAADSAWDD  433



>gb|KEH34509.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=456

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/455 (75%), Positives = 378/455 (83%), Gaps = 10/455 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG--DHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRN  2062
             MSYVPPHLRN+ ++TTV +N G  D+ H   +     +F+ S     SN     N + R 
Sbjct  1     MSYVPPHLRNAASSTTVSTNTGTLDNHHHHHHHNNNLAFSNSH----SNSPSLFNASRRT  56

Query  2061  SCATVNYLSPRGLVA-PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPA  1885
             S A     S R + A PD VFP+W+PSERV     +QIEE+R RLN+DV V+ DS  APA
Sbjct  57    SAAPP---SSRTIAAVPDTVFPKWQPSERVSRMNPDQIEEVRHRLNLDVTVSSDSLAAPA  113

Query  1884  PVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIP  1705
             P+ESF DMCLHPSIMKDIA HDYT PTS+QAQAMP+ALSGRDLLGCAETGSGKTAAFTIP
Sbjct  114   PIESFNDMCLHPSIMKDIAYHDYTRPTSIQAQAMPIALSGRDLLGCAETGSGKTAAFTIP  173

Query  1704  MIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQ  1525
             MIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EV+AFSRSL+SFKTAIVVGGTNI  Q
Sbjct  174   MIQHCLAQPPIRRGDGPLALVLAPTRELAQQIEKEVQAFSRSLESFKTAIVVGGTNIEKQ  233

Query  1524  RSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLP  1345
             RSELRAGV I VATPGR IDHLQQGNTSLSRIS+VVLDEADRMLDMGFEPQIRE+M +LP
Sbjct  234   RSELRAGVEIAVATPGRFIDHLQQGNTSLSRISYVVLDEADRMLDMGFEPQIREIMRSLP  293

Query  1344  KKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLD  1165
             +KHQTLLFSATMP EIEAL++EYL  PV+VKVG VSSPT NV+Q L KV ENEKIDRLLD
Sbjct  294   EKHQTLLFSATMPVEIEALSKEYLASPVQVKVGKVSSPTTNVSQTLVKVSENEKIDRLLD  353

Query  1164  LLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALR  985
             LLVEE++QAEK GHPF LTIVFVERKT+C+EVAEAL+ QGL A +LHGGRSQSEREAAL 
Sbjct  354   LLVEEASQAEKCGHPFPLTIVFVERKTRCDEVAEALIAQGLSAVSLHGGRSQSEREAALH  413

Query  984   DFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             DFR   TSILVATDVASRGLDV GV+HVINLDLPK
Sbjct  414   DFRSSSTSILVATDVASRGLDVTGVSHVINLDLPK  448



>gb|KDO45075.1| hypothetical protein CISIN_1g008428mg [Citrus sinensis]
Length=503

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/426 (76%), Positives = 356/426 (84%), Gaps = 18/426 (4%)
 Frame = -3

Query  2151  LNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVL  1972
              +S+ LP+F+ S +       Y S+                    P PVF  WKPS+RVL
Sbjct  48    FSSKSLPNFSNSNSNTTCRRSYASHPV------------------PQPVFNNWKPSDRVL  89

Query  1971  LFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQA  1792
              F  EQIEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QA
Sbjct  90    RFNPEQIEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQA  149

Query  1791  QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQ  1612
             QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQ
Sbjct  150   QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQ  209

Query  1611  IETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSR  1432
             IE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR
Sbjct  210   IEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSR  269

Query  1431  ISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVK  1252
             +SFV+LDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQEYLTDPV+VK
Sbjct  270   VSFVILDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQEYLTDPVQVK  329

Query  1251  VGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             VG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+E
Sbjct  330   VGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDE  389

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINL  892
             V+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILVATDVASRGLDV GVAHV+NL
Sbjct  390   VSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILVATDVASRGLDVMGVAHVVNL  449

Query  891   DLPKTM  874
             DLPK +
Sbjct  450   DLPKVL  455



>ref|XP_008240621.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Prunus 
mume]
Length=461

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/466 (72%), Positives = 380/466 (82%), Gaps = 21/466 (5%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSND------  2074
             MSYVPPHLR+S+T TT  +       S           QSK  + S+  + +ND      
Sbjct  1     MSYVPPHLRSSSTTTTTTTTTTTETSSVTLD------DQSKLSYPSSNSHFNNDKSSAAS  54

Query  2073  --------AGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDV  1918
                     A R S   ++  + R L  PD V PQWKPSERVL  K E IEE+ LRLN+DV
Sbjct  55    FSSFSHSNASRWSSGAISTAN-RALARPDAVIPQWKPSERVLRMKPELIEEVCLRLNLDV  113

Query  1917  AVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAET  1738
             +V+ DS PAPAP+ESF DMCLHPSIMKDIA H YT PTS+QAQAMPVALSGRDLLGCAET
Sbjct  114   SVSPDSAPAPAPIESFADMCLHPSIMKDIAYHGYTTPTSIQAQAMPVALSGRDLLGCAET  173

Query  1737  GSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTA  1558
             GSGKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS+S++SF+TA
Sbjct  174   GSGKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSKSIESFRTA  233

Query  1557  IVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFE  1378
             IVVGGTNI +QRSELRAGV++VVATPGR IDHLQQGNTS++RISFVVLDEADRMLDMGFE
Sbjct  234   IVVGGTNIAEQRSELRAGVDVVVATPGRFIDHLQQGNTSVTRISFVVLDEADRMLDMGFE  293

Query  1377  PQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKV  1198
             PQIREVM NL +KHQTLLFSATMP EIE LAQEYLT+PV+VKVG VSSPTANV Q LEKV
Sbjct  294   PQIREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTNPVQVKVGKVSSPTANVTQTLEKV  353

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK DRLL LLVEE+++ E+SGHPF LTIVFVERKT+C+EVA+AL+ QGL A ALHGG
Sbjct  354   SESEKTDRLLALLVEEASRVERSGHPFPLTIVFVERKTRCDEVADALVAQGLHAVALHGG  413

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             R+Q EREAALR+FR+G T+ILVATDVASRGLDV+GVAHVINLDLPK
Sbjct  414   RTQGEREAALREFRKGTTNILVATDVASRGLDVSGVAHVINLDLPK  459



>ref|XP_008384661.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Malus 
domestica]
Length=459

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/464 (72%), Positives = 376/464 (81%), Gaps = 19/464 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQ--SKNGFISNGEYCSNDAG--  2068
             MSYVPPHLR+S+  TT  +       ++ + R L   ++  S N  I+N +     +   
Sbjct  1     MSYVPPHLRSSSRTTTTTTT----TTAKPSXRTLDDXSKLSSSNSHINNDKSSGGASFSS  56

Query  2067  --------RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAV  1912
                     R S   V+  S      PD V PQWKPS+RVL  K E IEE+ LRLN+DV+ 
Sbjct  57    FSHSNASSRGSSGAVSQAS---RARPDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSA  113

Query  1911  AMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGS  1732
             + DS PAPAP+ESFTDMCLHPSIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGS
Sbjct  114   SPDSAPAPAPIESFTDMCLHPSIMKDIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGS  173

Query  1731  GKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIV  1552
             GKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS SL+SF+TAIV
Sbjct  174   GKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSASLESFRTAIV  233

Query  1551  VGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQ  1372
             VGGTNI +QRSELRAGV++VVATPGR IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQ
Sbjct  234   VGGTNISEQRSELRAGVDVVVATPGRFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQ  293

Query  1371  IREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPE  1192
             IREVM NL +KHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTANV Q LEKVPE
Sbjct  294   IREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPE  353

Query  1191  NEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRS  1012
             +EK DRLL LLVEE+++ E +GHPF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+
Sbjct  354   SEKTDRLLALLVEEASRVEGTGHPFPLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRT  413

Query  1011  QSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             Q+EREAALRDFR+G TSILVATDVASRGLDV+GVAHVINLDLPK
Sbjct  414   QTEREAALRDFRKGTTSILVATDVASRGLDVSGVAHVINLDLPK  457



>ref|XP_008358921.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Malus 
domestica]
Length=460

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/464 (73%), Positives = 374/464 (81%), Gaps = 18/464 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSE--LNSRQLPSFTQSKNGFISNGEYCSNDAG--  2068
             MSYVPPHLR+S+  TT  +       S   L+ R   S   S N  I+N +     +   
Sbjct  1     MSYVPPHLRSSSRTTTTTTTTTTAKPSXRTLDDR---SKLSSSNSHINNDKSSGGASFSS  57

Query  2067  --------RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAV  1912
                     R S   V+  S      PD V PQWKPS+RVL  K E IEE+ LRLN+DV+ 
Sbjct  58    FSHSNASSRGSSGAVSQAS---RARPDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSA  114

Query  1911  AMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGS  1732
             + DS PAPAP+ESFTDMCLHPSIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGS
Sbjct  115   SPDSAPAPAPIESFTDMCLHPSIMKDIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGS  174

Query  1731  GKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIV  1552
             GKTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS SL+SF+TAIV
Sbjct  175   GKTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSASLESFRTAIV  234

Query  1551  VGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQ  1372
             VGGTNI +QRSELRAGV++VVATPGR IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQ
Sbjct  235   VGGTNISEQRSELRAGVDVVVATPGRFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQ  294

Query  1371  IREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPE  1192
             IREVM NL +KHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTANV Q LEKVPE
Sbjct  295   IREVMRNLSEKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPE  354

Query  1191  NEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRS  1012
             +EK DRLL LLVEE+++ E +GHPF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+
Sbjct  355   SEKTDRLLALLVEEASRVEGTGHPFPLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRT  414

Query  1011  QSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             Q+EREAALRDFR+G TSILVATDVASRGLDV+GVAHVINLDLPK
Sbjct  415   QTEREAALRDFRKGTTSILVATDVASRGLDVSGVAHVINLDLPK  458



>ref|XP_008349522.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Malus 
domestica]
Length=459

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/463 (73%), Positives = 374/463 (81%), Gaps = 17/463 (4%)
 Frame = -3

Query  2235  MSYVPPHLRNST-TATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAG---  2068
             MSYVPPHLR+S+ T TT  +         L+ R   S   S N  I+N +     +    
Sbjct  1     MSYVPPHLRSSSRTTTTTTTTTAKPSXRTLDDR---SKLSSSNSHINNDKSSGGASFSSF  57

Query  2067  -------RNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVA  1909
                    R S   V+  S      PD V PQWKPS+RVL  K E IEE+ LRLN+DV+ +
Sbjct  58    SHSNASSRGSSGAVSQAS---RARPDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSAS  114

Query  1908  MDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSG  1729
              DS PAPAP+ESFTDMCLHPSIMKDI  H YT PTS+QAQAMPVALSGRDLLGCAETGSG
Sbjct  115   PDSAPAPAPIESFTDMCLHPSIMKDIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGSG  174

Query  1728  KTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVV  1549
             KTAAF IPMIQHCLAQPP++RGDGPLALVLAPTRELAQQIE EVKAFS SL+SF+TAIVV
Sbjct  175   KTAAFAIPMIQHCLAQPPVQRGDGPLALVLAPTRELAQQIEKEVKAFSASLESFRTAIVV  234

Query  1548  GGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQI  1369
             GGTNI +QRSELRAGV++VVATPGR IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQI
Sbjct  235   GGTNISEQRSELRAGVDVVVATPGRFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQI  294

Query  1368  REVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPEN  1189
             REVM NL +KHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTANV Q LEKVPE+
Sbjct  295   REVMRNLSEKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPES  354

Query  1188  EKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQ  1009
             EK DRLL LLVEE+++ E +GHPF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+Q
Sbjct  355   EKTDRLLALLVEEASRVEGTGHPFPLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRTQ  414

Query  1008  SEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             +EREAALRDFR+G TSILVATDVASRGLDV+GVAHVINLDLPK
Sbjct  415   TEREAALRDFRKGTTSILVATDVASRGLDVSGVAHVINLDLPK  457



>ref|XP_009374390.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Pyrus 
x bretschneideri]
Length=460

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/379 (83%), Positives = 343/379 (91%), Gaps = 0/379 (0%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMK  1837
             PD V PQWKPS+RVL  K E IEE+ LRLN+DV+V+ DS  APAP+ESFTDMCLHPSIMK
Sbjct  80    PDSVVPQWKPSDRVLGMKPEMIEEVCLRLNLDVSVSPDSASAPAPIESFTDMCLHPSIMK  139

Query  1836  DIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG  1657
             DI  H YT PTS+QAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPP++RGDG
Sbjct  140   DIDNHGYTTPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPVQRGDG  199

Query  1656  PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPG  1477
             PLALVLAPTRELAQQIE EVKAFS SL+SF+TAIVVGGTNI +QRSELRAGV++VVATPG
Sbjct  200   PLALVLAPTRELAQQIEKEVKAFSASLESFRTAIVVGGTNISEQRSELRAGVDVVVATPG  259

Query  1476  RLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEI  1297
             R IDHLQQ NTSL+RISFVVLDEADRMLDMGFEPQIREVM NL +KHQTLLFSATMP EI
Sbjct  260   RFIDHLQQRNTSLTRISFVVLDEADRMLDMGFEPQIREVMRNLSEKHQTLLFSATMPEEI  319

Query  1296  EALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPF  1117
             E LAQEYLT PV+VKVG VSSPTANV Q LEKVPE+EK DRLL LLVEE+++ E +GHPF
Sbjct  320   EELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPESEKTDRLLALLVEEASRVEGTGHPF  379

Query  1116  SLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVA  937
              LTIVFVERKT+C+EVAEAL+ QGL A ALHGGR+Q+EREAALRDFR+G TSILVATDVA
Sbjct  380   PLTIVFVERKTRCDEVAEALVAQGLHAVALHGGRTQTEREAALRDFRKGTTSILVATDVA  439

Query  936   SRGLDVNGVAHVINLDLPK  880
             SRGLDV+GVAHVINLDLPK
Sbjct  440   SRGLDVSGVAHVINLDLPK  458



>gb|EPS64666.1| hypothetical protein M569_10114, partial [Genlisea aurea]
Length=387

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/380 (82%), Positives = 341/380 (90%), Gaps = 0/380 (0%)
 Frame = -3

Query  1857  LHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQP  1678
             LH SIM+DIA H Y+ PTS+QAQAMPVALSGRDLLGCAETGSGKTAAF+IPMIQHCLAQP
Sbjct  3     LHSSIMEDIAFHAYSTPTSIQAQAMPVALSGRDLLGCAETGSGKTAAFSIPMIQHCLAQP  62

Query  1677  PLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVN  1498
             P++RGDG LALVLAPTRELAQQIE EVKAFSRSLD FKTAIVVGGTN+ +Q+S+LRAGV+
Sbjct  63    PIQRGDGALALVLAPTRELAQQIEKEVKAFSRSLDVFKTAIVVGGTNMSEQKSDLRAGVH  122

Query  1497  IVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFS  1318
             +VVATPGR IDHLQQ NTSLSRISFVVLDEADRMLDMGFEPQIREVM NLP++HQTLLFS
Sbjct  123   VVVATPGRFIDHLQQRNTSLSRISFVVLDEADRMLDMGFEPQIREVMQNLPERHQTLLFS  182

Query  1317  ATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQA  1138
             ATMP EIE LAQEYL  PV VKVG  SSPT NV+Q L KV E EKIDRLLD+LVE +AQ+
Sbjct  183   ATMPVEIEHLAQEYLNSPVCVKVGKFSSPTTNVSQDLFKVLETEKIDRLLDMLVEGAAQS  242

Query  1137  EKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSI  958
             E+SG PF LTIVFVERK++C+EVAEAL +QGL A ALHGGRSQSEREAAL DFR GPT I
Sbjct  243   ERSGRPFPLTIVFVERKSRCDEVAEALTQQGLRAAALHGGRSQSEREAALGDFRHGPTRI  302

Query  957   LVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVA  778
             LVATDVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAGSTG+ATSF+TDRD +LV+
Sbjct  303   LVATDVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGRATSFHTDRDAFLVS  362

Query  777   QIRKAIADVGSGNTVTFATG  718
              IRKAI DV SGN V+FA G
Sbjct  363   HIRKAIQDVDSGNAVSFAVG  382



>ref|XP_009354920.1| PREDICTED: ATP-dependent RNA helicase DBP2-like isoform X2 [Pyrus 
x bretschneideri]
Length=463

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/379 (81%), Positives = 339/379 (89%), Gaps = 0/379 (0%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMK  1837
             PD V PQWKPS+RV     E IEE+ LRLN+DV+V+ DS PAPAP+ESFTDMCLHPSIMK
Sbjct  83    PDSVVPQWKPSDRVFRMNPEMIEEVCLRLNLDVSVSSDSAPAPAPIESFTDMCLHPSIMK  142

Query  1836  DIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG  1657
             DI  H YT PTS+QAQAMP+ALSGRDLLGCAETGSGKTAAF IPMIQHCLAQPP++RGDG
Sbjct  143   DIDNHGYTTPTSIQAQAMPIALSGRDLLGCAETGSGKTAAFAIPMIQHCLAQPPVQRGDG  202

Query  1656  PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPG  1477
             PLALVLAPTRELAQQIE EVK+F  SL+SF+TAIVVGGTNI +QRSELRAGV++VVATPG
Sbjct  203   PLALVLAPTRELAQQIEKEVKSFGASLESFRTAIVVGGTNISEQRSELRAGVDVVVATPG  262

Query  1476  RLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEI  1297
             R IDHLQQGNTS++RISFVVLDEADRMLDMGFEPQIREVM NL +KHQTLLFSATMP EI
Sbjct  263   RFIDHLQQGNTSITRISFVVLDEADRMLDMGFEPQIREVMRNLSEKHQTLLFSATMPEEI  322

Query  1296  EALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPF  1117
             E LAQEYLT PV+VKVG VSSPTANV Q LEKVPE+EK D+LL LLVEE+++ E +GHPF
Sbjct  323   EELAQEYLTKPVQVKVGKVSSPTANVTQTLEKVPESEKTDQLLALLVEEASRVEGTGHPF  382

Query  1116  SLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVA  937
              LTIVFVERKT+C+EVAEAL  QGL A  LHGGR+Q+EREAALRDFR+G TSILVATDVA
Sbjct  383   PLTIVFVERKTRCDEVAEALAAQGLHAVTLHGGRTQTEREAALRDFRKGTTSILVATDVA  442

Query  936   SRGLDVNGVAHVINLDLPK  880
             SRGLDV+GVAHVINLDLPK
Sbjct  443   SRGLDVSGVAHVINLDLPK  461



>ref|XP_006432068.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
 gb|ESR45308.1| hypothetical protein CICLE_v10000727mg [Citrus clementina]
Length=434

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/400 (76%), Positives = 332/400 (83%), Gaps = 18/400 (5%)
 Frame = -3

Query  2151  LNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVL  1972
              +S+ LP+F+ S +       Y S+                    P PVF  WKPS+RVL
Sbjct  47    FSSKSLPNFSNSNSNTTCRRSYASHPV------------------PQPVFNNWKPSDRVL  88

Query  1971  LFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQA  1792
              F  EQIEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QA
Sbjct  89    RFNPEQIEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQA  148

Query  1791  QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQ  1612
             QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQ
Sbjct  149   QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQ  208

Query  1611  IETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSR  1432
             IE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR
Sbjct  209   IEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSR  268

Query  1431  ISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVK  1252
             +SFVVLDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQEYLTDPV+VK
Sbjct  269   VSFVVLDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQEYLTDPVQVK  328

Query  1251  VGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             VG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+E
Sbjct  329   VGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDE  388

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
             V+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILV
Sbjct  389   VSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILV  428



>gb|KDO45076.1| hypothetical protein CISIN_1g008428mg [Citrus sinensis]
Length=435

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/400 (76%), Positives = 332/400 (83%), Gaps = 18/400 (5%)
 Frame = -3

Query  2151  LNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVL  1972
              +S+ LP+F+ S +       Y S+                    P PVF  WKPS+RVL
Sbjct  48    FSSKSLPNFSNSNSNTTCRRSYASHPV------------------PQPVFNNWKPSDRVL  89

Query  1971  LFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQA  1792
              F  EQIEE+RLRLNVDV VA  S PAPAP+ESFTDMCLHPSIMKDI  H+YT PTS+QA
Sbjct  90    RFNPEQIEEVRLRLNVDVTVASGSVPAPAPIESFTDMCLHPSIMKDIEFHEYTRPTSIQA  149

Query  1791  QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQ  1612
             QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC+AQ P+ RGDGPLALVLAPTRELAQQ
Sbjct  150   QAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCVAQTPVGRGDGPLALVLAPTRELAQQ  209

Query  1611  IETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSR  1432
             IE EVKA SRSLDSFKTAIVVGGTNI +QRSELR GV+IVVATPGR +DHLQQGNTSLSR
Sbjct  210   IEKEVKALSRSLDSFKTAIVVGGTNIAEQRSELRGGVSIVVATPGRFLDHLQQGNTSLSR  269

Query  1431  ISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVK  1252
             +SFV+LDEADRMLDMGFEPQIREVM NLP KHQTLLFSATMP EIEALAQEYLTDPV+VK
Sbjct  270   VSFVILDEADRMLDMGFEPQIREVMQNLPDKHQTLLFSATMPVEIEALAQEYLTDPVQVK  329

Query  1251  VGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             VG VSSPTANV QILEKV ENEK+DRLL LLVEE+  AEKS HPF LTIVFVERKT+C+E
Sbjct  330   VGKVSSPTANVIQILEKVSENEKVDRLLALLVEEAFLAEKSCHPFPLTIVFVERKTRCDE  389

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
             V+EAL+ +GL A ALHGGR+QS+RE+ALRDFR G T+ILV
Sbjct  390   VSEALVAEGLHAVALHGGRNQSDRESALRDFRNGSTNILV  429



>ref|XP_003058608.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57063.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=471

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/474 (64%), Positives = 369/474 (78%), Gaps = 3/474 (1%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMK  1837
             P  +FP+WKPSERV    + QIEEIR R++V V        AP PVESF DM L+  I+ 
Sbjct  1     PPAIFPKWKPSERVQALTVNQIEEIRRRMDVTVECKEGDEAAP-PVESFEDMMLNAKILL  59

Query  1836  DIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG  1657
             DI  H+Y  PT +QAQA+P+ LSGRD+LGCAETGSGKTAAF+IPMIQHCL Q P++RGDG
Sbjct  60    DIRFHEYDKPTPIQAQAIPIILSGRDVLGCAETGSGKTAAFSIPMIQHCLEQDPIKRGDG  119

Query  1656  PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPG  1477
             P A+V+APTRELAQQIE E K FSRS   FKT IVVGGTN+ DQRS+LR GV + VATPG
Sbjct  120   PFAIVMAPTRELAQQIEKEAKVFSRSSKGFKTTIVVGGTNMSDQRSDLRQGVEVCVATPG  179

Query  1476  RLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEI  1297
             RLIDHL QGNT+L R+S V+LDEADRMLDMGFEPQIREVM NLP  HQTLLFSATMPAE+
Sbjct  180   RLIDHLHQGNTNLGRVSLVILDEADRMLDMGFEPQIREVMQNLPTPHQTLLFSATMPAEV  239

Query  1296  EALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPF  1117
             E+LA +YL  PV+VKVG VS PTANVAQ LEK+ + +K+DRL +LL+EE A+AEK G   
Sbjct  240   ESLAADYLNKPVKVKVGAVSVPTANVAQHLEKLVDAQKVDRLCELLLEEKAEAEKFGGSL  299

Query  1116  SLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVA  937
              +T+VFVERK + +EV E L  +G+ A A HGGRSQ EREAAL D++ G  S+L ATDVA
Sbjct  300   PMTVVFVERKARADEVMELLNAEGVSAAAFHGGRSQQEREAALSDYKNGKCSVLCATDVA  359

Query  936   SRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIA  757
             +RGLDV G+AHV+NLD+P+  EDYVHR+GRTGRAG TG+ATSFYTDRD Y+VAQ+++A+A
Sbjct  360   ARGLDVKGIAHVVNLDMPRMFEDYVHRVGRTGRAGMTGRATSFYTDRDSYIVAQVKRALA  419

Query  756   DVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHM  595
             ++ +GN   FATGK AR KEREAA A +E      +   +G   I V++K++HM
Sbjct  420   ELEAGNAFAFATGKEARAKEREAAKAWREGR--EEEPEAVGGVNIIVDEKFKHM  471



>emb|CAN75572.1| hypothetical protein VITISV_009507 [Vitis vinifera]
Length=489

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/441 (72%), Positives = 352/441 (80%), Gaps = 11/441 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGG-------DHLHSELNSRQLPSFTQSKNGFISNGEYCSN  2077
             MSYVPPHLRN +++ +  S          D  H   N+    S     +   ++     +
Sbjct  1     MSYVPPHLRNPSSSJSRTSKPTETSAVTLDDTHRTTNNLSYSSTNSHLSHSNASSSXSLS  60

Query  2076  DAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSN  1897
                 ++ A V    PR    P+PVFPQWKPS+RV   K EQIEE+RLRLNVDV VA D  
Sbjct  61    RWASSNAAAV----PRTPSVPEPVFPQWKPSDRVFXMKPEQIEEVRLRLNVDVTVAPDLP  116

Query  1896  PAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAA  1717
             PAPAP+ESFTDM LH SIMKDI  H+YT PT +QAQAMPVALSGRDLLGCAETGSGKTAA
Sbjct  117   PAPAPIESFTDMGLHQSIMKDIXFHEYTRPTFIQAQAMPVALSGRDLLGCAETGSGKTAA  176

Query  1716  FTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTN  1537
             F IPMIQHCLAQPP+RRGDGPLALVLAPTRELAQQIE EVKAFSRSLDSF+TAIVVGGTN
Sbjct  177   FAIPMIQHCLAQPPVRRGDGPLALVLAPTRELAQQIEKEVKAFSRSLDSFRTAIVVGGTN  236

Query  1536  IGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  1357
             I +QRSELRAGVNIVVATPGR I HLQ+GNTSLSRISFVVLDEADRMLDMGFEPQIREVM
Sbjct  237   ISEQRSELRAGVNIVVATPGRFIHHLQEGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  296

Query  1356  HNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKID  1177
              NLP+KHQTLLFSATMP EIE LAQEYL +PV+VKVG VS PTANV+QILEKV E+EKID
Sbjct  297   QNLPQKHQTLLFSATMPMEIETLAQEYLNNPVQVKVGKVSCPTANVSQILEKVSESEKID  356

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
              LL LLVEE++QAE+ G PF LTIVFVERKT+C+EVAEAL+ QGL A ALHGGRSQ+ERE
Sbjct  357   GLLALLVEEASQAERCGRPFPLTIVFVERKTRCDEVAEALVAQGLRAVALHGGRSQAERE  416

Query  996   AALRDFRRGPTSILVATDVAS  934
             AALRDFR G T+ILV   ++S
Sbjct  417   AALRDFRNGATNILVCLCISS  437



>ref|XP_002507998.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO69256.1| predicted protein, partial [Micromonas sp. RCC299]
Length=481

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/480 (63%), Positives = 367/480 (76%), Gaps = 0/480 (0%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMK  1837
             P  VF  WKPSERV    + Q EEIR R++V V V   ++ AP P+ESF DM L   IM 
Sbjct  2     PPAVFANWKPSERVQALSVNQCEEIRRRMDVTVEVPPGTDEAPPPIESFEDMNLDTKIMM  61

Query  1836  DIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG  1657
             DI   ++  PT +QAQA+PV  SGRD+LGCAETGSGKTAAF+IPMIQHCL QP ++RGDG
Sbjct  62    DIKYKEFDKPTPIQAQAIPVICSGRDVLGCAETGSGKTAAFSIPMIQHCLQQPEIKRGDG  121

Query  1656  PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPG  1477
             P A+V+APTRELAQQIE E K FSRS   FKT IVVGGTN+ +QR +L+ GV + VATPG
Sbjct  122   PFAIVMAPTRELAQQIEKEAKIFSRSSKGFKTTIVVGGTNMSEQRMDLKNGVEVCVATPG  181

Query  1476  RLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEI  1297
             RLIDHL QGNT+L+R+S V+LDEADRMLDMGFEPQIREVM NLPK HQTLLFSATMP E+
Sbjct  182   RLIDHLHQGNTNLARVSLVILDEADRMLDMGFEPQIREVMMNLPKPHQTLLFSATMPVEV  241

Query  1296  EALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPF  1117
             EALA +YL  PV+VKVG VS PT+NVAQ LEK+ +++K+DRL +LL+EE A+AEK G   
Sbjct  242   EALAADYLNKPVKVKVGAVSVPTSNVAQHLEKLVDSQKVDRLCELLLEEKAEAEKFGGQL  301

Query  1116  SLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVA  937
              +T+VFVERK + +E+   L  +G+ A A HGGRSQ EREAAL DF  G  ++LVATDVA
Sbjct  302   PMTVVFVERKARADEIMTLLNAEGVAAAAFHGGRSQQEREAALADFTTGRCAVLVATDVA  361

Query  936   SRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIA  757
             +RGLDV GV HV+NLDLP+  EDYVHR+GRTGRAG TG+ATSFYTDRD +LVAQI++A+ 
Sbjct  362   ARGLDVKGVQHVVNLDLPRMFEDYVHRVGRTGRAGMTGRATSFYTDRDSFLVAQIKRALQ  421

Query  756   DVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAPAMS  577
             ++ +GN   FATGK AR KEREAA A +E      + + +G   I V+DK++HM   A S
Sbjct  422   ELENGNAFAFATGKEARAKEREAAKAWREGRAGEPEQAAVGGVDIIVDDKFKHMKLSASS  481



>ref|XP_003080884.1| DEAD box protein P68 (ISS) [Ostreococcus tauri]
 emb|CAL55052.1| Helicase, C-terminal [Ostreococcus tauri]
Length=571

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/549 (57%), Positives = 381/549 (69%), Gaps = 10/549 (2%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSC  2056
             M YVPPHLR    A    S G    H   +  +                   +  G  + 
Sbjct  1     MGYVPPHLRGGGDANANASAGDGRDHGRGSGHRDDRGPPPGRRLDDRDAARGDGRGGGAA  60

Query  2055  ATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVE  1876
                 +          PVF  W+PS R       Q  EIR RL V V V      AP+ +E
Sbjct  61    RGGAHA---------PVFAAWRPSARAEALTTAQATEIRERLGVTVDVEDGEPEAPSAIE  111

Query  1875  SFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQ  1696
             SF DM L   I+ DI   +Y  P+ +QAQA+PV LSGRD+LGCAETGSGKTAAF+IPMIQ
Sbjct  112   SFEDMELKRDILADIKFREYDKPSPIQAQAIPVILSGRDVLGCAETGSGKTAAFSIPMIQ  171

Query  1695  HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSE  1516
             H L Q PLR+GDGP A+V+APTRELAQQIETE K F+RS   F+TAI+VGGTN+ +QRS 
Sbjct  172   HALNQAPLRQGDGPFAIVMAPTRELAQQIETEAKTFTRSSKGFRTAIIVGGTNMSEQRSM  231

Query  1515  LRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKH  1336
             LR GV IVVATPGRLIDHLQQGNT+L+R+SFVVLDEADRMLDMGFEPQIREV+ NLPK H
Sbjct  232   LRGGVQIVVATPGRLIDHLQQGNTNLARVSFVVLDEADRMLDMGFEPQIREVLMNLPKPH  291

Query  1335  QTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLV  1156
             QTLLFSATMP E+EALA +YL  PV+VKVG  S+PTANV+Q LEKV + EK+DRL+ +L+
Sbjct  292   QTLLFSATMPVEVEALAADYLNKPVKVKVGQTSAPTANVSQQLEKVVDAEKVDRLVTMLI  351

Query  1155  EESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFR  976
              E  +A+K GH   +T+VFVERK + +E+AE L  + + A ALHGGRSQ EREAAL D++
Sbjct  352   SEQREAQKLGHSMPMTVVFVERKHRADEIAELLNAENVSAAALHGGRSQGEREAALHDYK  411

Query  975   RGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDR  796
              G  S+LVATDVA+RGLDV GVAHV+NLDLP+  EDYVHRIGRTGRAG +G++TSFYTDR
Sbjct  412   TGRCSVLVATDVAARGLDVKGVAHVVNLDLPRNFEDYVHRIGRTGRAGMSGRSTSFYTDR  471

Query  795   DMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaa-hkeANIALSKLSLMGSTPIN  619
             D ++VAQI++A+ ++ +GN   FATG+ AR KERE A A  +      + +   G   I 
Sbjct  472   DSFIVAQIKRALMELEAGNAFAFATGREARAKEREEARAWREGKQHEAAVVETEGGVTIT  531

Query  618   VEDKYRHMI  592
             VEDK++HM+
Sbjct  532   VEDKFKHMM  540



>ref|XP_002958649.1| hypothetical protein VOLCADRAFT_69703 [Volvox carteri f. nagariensis]
 gb|EFJ40315.1| hypothetical protein VOLCADRAFT_69703 [Volvox carteri f. nagariensis]
Length=582

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/591 (55%), Positives = 396/591 (67%), Gaps = 35/591 (6%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCS-----NDA  2071
             M YVPPHLR         S       S   + + P   +  +GF  +G Y +     +  
Sbjct  1     MPYVPPHLRGKQQDAASPS------ESSSTAARAP---EGSSGFPRSGSYGTRLDNVSYG  51

Query  2070  GRN--------------SCATVNYL-SPRGLVAPDP----VFPQWKPSERVLLFKLEQIE  1948
             GR               S +T N+  + RG     P    VF  W+P+ RV     E I+
Sbjct  52    GRGEGGFSRQGSSGLPRSGSTQNFGDASRGYHRSGPAVEAVFANWQPTSRVQALSDENIQ  111

Query  1947  EIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALS  1768
             EIR RL V V V      A  P+ESF +M LHP+I+ DIA H Y  PT +QAQ +P+ALS
Sbjct  112   EIRQRLKVTVDVTEGEPKAAPPIESFQEMNLHPNILADIAHHKYETPTPIQAQGLPIALS  171

Query  1767  GRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAF  1588
             GRD+LGCAETGSGKTA+F+IPMIQHCL QPPLR GDGP+ALVLAPTRELAQQIE EV+AF
Sbjct  172   GRDILGCAETGSGKTASFSIPMIQHCLNQPPLRPGDGPMALVLAPTRELAQQIEREVRAF  231

Query  1587  SRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             SRS   + +T+IVVGG  + +QR +LR GV +VVATPGR ID LQQ  T+LSR+S+VVLD
Sbjct  232   SRSSSRNVRTSIVVGGVPMQEQRHDLRNGVEVVVATPGRFIDLLQQSYTNLSRVSYVVLD  291

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSP  1231
             EADRMLDMGFEPQI+EVM+NLP +HQTLLFSATMP EIE LA+ YL  PV VK+G VS+P
Sbjct  292   EADRMLDMGFEPQIKEVMNNLPPRHQTLLFSATMPKEIEELARAYLNKPVTVKIGAVSTP  351

Query  1230  TANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMK  1051
             TANVAQ LE  PE +K+D L+ L+  E A     G P  LTIVFVERK +C+EVA AL +
Sbjct  352   TANVAQRLEHAPEGQKLDILVALISSEVAAEASGGPPMPLTIVFVERKNRCDEVAAALQE  411

Query  1050  QGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTME  871
              G+ A ALHGG  Q EREAALRDF +G   +LVATD+ASRGLDV G+ HVIN+DLPKT E
Sbjct  412   DGIPANALHGGLGQFEREAALRDFAKGHIKVLVATDLASRGLDVKGIGHVINMDLPKTFE  471

Query  870   DYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkere  691
             DYVHRIGRTGRAG+ G+ATS + DRD +LVAQI++A+A++  GN   FATGK AR++ER+
Sbjct  472   DYVHRIGRTGRAGTKGRATSLWNDRDSFLVAQIKQALAELEKGNGFAFATGKEARKEERQ  531

Query  690   aaaahkeANIALSKLSLMGSTPINVEDKY-RHMIAPAMSRKEGAADGAWDD  541
              A   K   +    +   G+  + V+DKY     A   +   G AD AWDD
Sbjct  532   LAREFKWLKMTSQGMLQTGAGAVKVDDKYAHMATAAPAAAGSGVADAAWDD  582



>ref|XP_001697438.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00100.1| predicted protein [Chlamydomonas reinhardtii]
Length=515

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/516 (59%), Positives = 368/516 (71%), Gaps = 26/516 (5%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTV--------VSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCS  2080
             M YVPPHLR   + +             GG H        +L S+ +       +G Y  
Sbjct  1     MPYVPPHLRGKQSESAAPEPSSSSRAPEGGSH------GNRLDSYDRR-----GDGGYGR  49

Query  2079  NDAGRNSCATVNYLSPRGLVAP-DPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMD  1903
               +G     +    +     AP +PVF  W+P+ RVL    + I EIR RL V V    D
Sbjct  50    QGSGLPRTGSTQSFN----RAPIEPVFNTWQPTSRVLSLSDDTIAEIRQRLKVTVEGTED  105

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
              + A +P+ESF +M LHP+I+ DI  H Y  PT +QAQ +P+ALSGRD+LGCAETGSGKT
Sbjct  106   -DKAASPIESFAEMNLHPNIVADIQHHKYETPTPIQAQGLPIALSGRDILGCAETGSGKT  164

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLD-SFKTAIVVG  1546
             A+F+IPMIQHCL Q PLR GDGP+ALVLAPTRELAQQIE EVKAFSRS   S +T+IVVG
Sbjct  165   ASFSIPMIQHCLNQQPLRAGDGPMALVLAPTRELAQQIEREVKAFSRSSGRSVRTSIVVG  224

Query  1545  GTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  1366
             G  + +QR +LR GV +VVATPGR IDHLQQGNT+L RIS+VVLDEADRMLDMGFEPQI+
Sbjct  225   GVPMHEQRHDLRNGVEVVVATPGRFIDHLQQGNTNLGRISYVVLDEADRMLDMGFEPQIK  284

Query  1365  EVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENE  1186
             EVM+NLP KHQTLLFSATMP EIE LA+ YL  PV VK+G VS+PTANV+Q LE  PE +
Sbjct  285   EVMNNLPPKHQTLLFSATMPKEIEELARAYLNKPVTVKIGAVSTPTANVSQRLEHAPEPQ  344

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K+D L+ L+  E A     G P  LTIVFVERKT+C+EVA AL + G+ A ALHGG +Q+
Sbjct  345   KLDILVALISAEVAAEAAGGPPMPLTIVFVERKTRCDEVAAALREDGINANALHGGLNQN  404

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             EREAALRDF +G   +LVATDVASRGLD+ G+ HVIN+DLPKT EDYVHRIGRTGRAG+ 
Sbjct  405   EREAALRDFAKGDIKVLVATDVASRGLDIKGIGHVINMDLPKTFEDYVHRIGRTGRAGTK  464

Query  825   GQATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATG  718
             G+ATS + DRD YLVAQI++A++++  GN   FATG
Sbjct  465   GRATSLWNDRDSYLVAQIKQALSELEKGNGFAFATG  500



>ref|XP_002326066.2| hypothetical protein POPTR_0019s151302g, partial [Populus trichocarpa]
 gb|EEF00448.2| hypothetical protein POPTR_0019s151302g, partial [Populus trichocarpa]
Length=403

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/409 (70%), Positives = 325/409 (79%), Gaps = 6/409 (1%)
 Frame = -3

Query  2235  MSYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSC  2056
             MSY+PPHLRNS++ TTV +         L    L   + +      +     N     + 
Sbjct  1     MSYIPPHLRNSSSTTTVTTRRTQS--PPLTDTNLSHSSSNSTSSAPSSFSTFNSLSLRTS  58

Query  2055  ATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVE  1876
             A+V     R +  P PVFPQW PS+RVL F  +QIEEIR +L ++V+VA  S PAPAP+E
Sbjct  59    ASVA----RTISVPQPVFPQWTPSDRVLRFTPDQIEEIRSQLKINVSVASGSPPAPAPIE  114

Query  1875  SFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQ  1696
             SF DMCLH SIMKDIA H+YT PT +QAQAM VALSGRDLLGCAETGSGKTAAFTIPMIQ
Sbjct  115   SFEDMCLHQSIMKDIAHHEYTRPTLIQAQAMTVALSGRDLLGCAETGSGKTAAFTIPMIQ  174

Query  1695  HCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSE  1516
             HCLAQPP++RGDGPLA+VLAPTRELAQQIE EVK FSRSL+SF+TAIVVGGT   DQ SE
Sbjct  175   HCLAQPPVQRGDGPLAMVLAPTRELAQQIEKEVKRFSRSLESFRTAIVVGGTKSADQGSE  234

Query  1515  LRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKH  1336
             LRAGV+++VATPGRLIDHLQQGNTSLSRISF+VLDEADRMLDMGFEPQIREVMHNLP+KH
Sbjct  235   LRAGVDVIVATPGRLIDHLQQGNTSLSRISFIVLDEADRMLDMGFEPQIREVMHNLPEKH  294

Query  1335  QTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLV  1156
             QTLLFSATMP EIE LAQEYL  PV+VKVG VSSPTANV+QIL KV  +EKID LL LLV
Sbjct  295   QTLLFSATMPVEIETLAQEYLISPVQVKVGKVSSPTANVSQILTKVSASEKIDCLLALLV  354

Query  1155  EESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQ  1009
             E+++QAEKS   F LTIVFVERKT+C EVAEAL+ QGL A ALHGGRSQ
Sbjct  355   EDASQAEKSNQSFPLTIVFVERKTRCNEVAEALVAQGLQAVALHGGRSQ  403



>ref|XP_001786160.1| predicted protein [Physcomitrella patens]
 gb|EDQ49028.1| predicted protein [Physcomitrella patens]
Length=377

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/377 (76%), Positives = 324/377 (86%), Gaps = 2/377 (1%)
 Frame = -3

Query  1665  GDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVA  1486
             GDGPLALVLAPTRELAQQIE EVKAFSRS + FKT+IVVGGTNI +QRSELRAGV IVVA
Sbjct  1     GDGPLALVLAPTRELAQQIEKEVKAFSRSAEGFKTSIVVGGTNIYEQRSELRAGVEIVVA  60

Query  1485  TPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMP  1306
             TPGR IDHLQQGN+SLSR+S+VVLDEADRMLDMGFEPQIREVM +LPKKHQTLLFSATMP
Sbjct  61    TPGRFIDHLQQGNSSLSRVSYVVLDEADRMLDMGFEPQIREVMRSLPKKHQTLLFSATMP  120

Query  1305  AEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSG  1126
              EIEALAQEYL  PVRVKVG VSSPTANV Q LEK+ E EKID LL LLV+E +Q+  S 
Sbjct  121   EEIEALAQEYLNKPVRVKVGRVSSPTANVTQNLEKITEKEKIDSLLALLVDEHSQSLDSN  180

Query  1125  HPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVAT  946
              P  LTIVFVERK +C+EV +AL++QGL ATALHGGRSQSEREAALRDFR+G T+ILVAT
Sbjct  181   QPPPLTIVFVERKARCDEVTDALVEQGLKATALHGGRSQSEREAALRDFRKGTTNILVAT  240

Query  945   DVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRK  766
             DVASRGLDV GVAHVINLDLPKTMEDYVHRIGRTGRAG++G+ATSFYT+RD++LVAQIR+
Sbjct  241   DVASRGLDVTGVAHVINLDLPKTMEDYVHRIGRTGRAGASGRATSFYTERDVFLVAQIRR  300

Query  765   AIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTPINVEDKYRHMIAP  586
             AI +  SGNT+ FATGK ARRKERE AAA +E  +    ++ +G+T + V+DKY+HM++ 
Sbjct  301   AITEAESGNTMAFATGKAARRKEREQAAAFREGRMTPLGVAQVGATTVRVDDKYKHMLSA  360

Query  585   AMSRK--EGAADGAWDD  541
                 K  EGAAD AW+D
Sbjct  361   TADPKKGEGAADDAWED  377



>ref|XP_001419411.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97704.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=394

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 310/388 (80%), Gaps = 0/388 (0%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             Q  EIR RL V V +       P+ +ESF DM L   IM DI   +Y  P+ +QAQA+PV
Sbjct  6     QTTEIRERLGVTVEIEEGEAAVPSAIESFEDMTLVRDIMADIRYREYDKPSPIQAQAIPV  65

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
              LSGRD+LGCAETGSGKTAAF+IPMIQH L Q PLR+GDGP A+V+APTRELAQQIE E 
Sbjct  66    ILSGRDVLGCAETGSGKTAAFSIPMIQHALNQAPLRQGDGPYAIVMAPTRELAQQIEAEA  125

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
             K F+RS   F+TAI+VGGTN+ +QR  LR+GV IVVATPGRLIDHLQQGNT+LSR+SFVV
Sbjct  126   KTFTRSSKGFRTAIIVGGTNMSEQRGALRSGVQIVVATPGRLIDHLQQGNTNLSRVSFVV  185

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIREV+ NLPK HQTLLFSATMP+E+EALA +YL  PV+VKVG  S
Sbjct  186   LDEADRMLDMGFEPQIREVLMNLPKPHQTLLFSATMPSEVEALASDYLHKPVKVKVGTTS  245

Query  1236  SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEAL  1057
             +PTANV+Q LEKV + EK+DRL+ +L+ E  +A K G    +T++FVERK + +E+AE L
Sbjct  246   APTANVSQHLEKVVDAEKVDRLVTMLIGEQREAMKLGQDMPMTVIFVERKNRADEIAELL  305

Query  1056  MKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKT  877
               + + A ALHGGRSQ EREAAL D++ G  S+LVATDVA+RGLDV GVAHV+NLDLP+ 
Sbjct  306   NAENVPAAALHGGRSQGEREAALHDYKTGRCSVLVATDVAARGLDVKGVAHVVNLDLPRN  365

Query  876   MEDYVHRIGRTGRAGSTGQATSFYTDRD  793
              EDYVHRIGRTGRAG +G++TSFYTDRD
Sbjct  366   FEDYVHRIGRTGRAGMSGRSTSFYTDRD  393



>ref|XP_007515604.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14483.1| predicted protein [Bathycoccus prasinos]
Length=575

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/577 (53%), Positives = 384/577 (67%), Gaps = 29/577 (5%)
 Frame = -3

Query  2229  YVPPHLRNSTTA--TTVVSNGGDHLHSELNSRQLPSFTQSKNGFI--SNGEYCSNDAGRN  2062
             YVPPHLR S  A  T+ +S GG+            +F    +G +  S GE  ++   R+
Sbjct  5     YVPPHLRASDAAESTSSLSGGGNG-----------AFNNDDSGGLGPSAGERSNHQQHRS  53

Query  2061  SCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAP  1882
                T                 +W+PSERVL     QIE++R RLNV      +     AP
Sbjct  54    RTTTA--AEDNTTTNKIKTKTKWQPSERVLNLTKSQIEDMRERLNVLAESPEEDTNEYAP  111

Query  1881  VESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPM  1702
             +ESF DM L   I   I  H +  PT +QAQ +PV LSG D+LGCAETGSGKTAAF IPM
Sbjct  112   IESFEDMKLDREIALSIKAHGFDKPTPIQAQGIPVILSGSDVLGCAETGSGKTAAFAIPM  171

Query  1701  IQHCL----AQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDS--FKTAIVVGGT  1540
             I +C+    A    RRGDGP A+VLAPTRELAQQIE E KAFS+++D   FKT IVVGG+
Sbjct  172   IHYCVSISDAYGATRRGDGPTAIVLAPTRELAQQIEKETKAFSQAIDKRRFKTTIVVGGS  231

Query  1539  NIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREV  1360
             ++ +QR +LR GV  VVATPGRLIDH+ Q NT+L R SF+VLDEADRMLDMGFE QI E+
Sbjct  232   SMNEQRGDLRNGVECVVATPGRLIDHIHQNNTNLRRASFLVLDEADRMLDMGFEQQILEI  291

Query  1359  MHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPEN-EK  1183
             ++  PK  QTLLFSATMP E+E LA EYL  PV+VKVG VS+PT+NVAQ LEKVP +  K
Sbjct  292   LNATPKPRQTLLFSATMPPEVEVLAGEYLVKPVKVKVGTVSAPTSNVAQSLEKVPNDVAK  351

Query  1182  IDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSE  1003
             IDRL  +LVEE  ++   G+   ++IVFVERK K E+VA+ L  +G+   +LHGGR+Q E
Sbjct  352   IDRLCRMLVEEKMESVAHGNAPPMSIVFVERKAKAEDVADMLNAEGVATASLHGGRTQGE  411

Query  1002  REAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTG  823
             REAAL+DF RG  S+LVATDVA+RGLDV GV HV+N+DLP+  EDYVHRIGRTGR G TG
Sbjct  412   REAALKDFTRGLCSVLVATDVAARGLDVKGVQHVVNMDLPRNFEDYVHRIGRTGRNGMTG  471

Query  822   QATSFYTDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIA-LSKL  646
             +ATSFYTD D ++V+QI++A+ ++ SGN   FATGK AR KE+EA  A +E   A  SK 
Sbjct  472   RATSFYTDSDAFIVSQIKRALQELESGNAFAFATGKEARAKEKEAQRAWREERSADQSKT  531

Query  645   SLMGSTPINVEDKYRHMIA----PAMSRKEGAADGAW  547
                    I+V+DK++ M+      A   + GAAD AW
Sbjct  532   ETDSGGIISVDDKFKSMLVTSANAATGNQSGAADDAW  568



>ref|XP_005538679.1| p68 RNA helicase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82643.1| p68 RNA helicase [Cyanidioschyzon merolae strain 10D]
Length=645

 Score =   362 bits (929),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 266/402 (66%), Gaps = 15/402 (4%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             E +   R R+ + V         P P ESF +    P+I++ I    +T PT++QAQA P
Sbjct  173   EHVASFRQRMEITVR----GKNVPNPCESFLEAGFPPAIVQCIQRAGFTAPTAIQAQAWP  228

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             VAL GRDL+G AETGSGKT A+ +P + H   QPPLRRGDGP+ LVLAPTRELA QI+TE
Sbjct  229   VALKGRDLIGIAETGSGKTCAYLLPALVHIHGQPPLRRGDGPICLVLAPTRELAVQIQTE  288

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  +    + A V GG + G Q  EL  G+ I++ATPGRLID L+ G T+L R++++
Sbjct  289   ATKFG-TASRIRNACVYGGVSRGPQARELSRGIEILIATPGRLIDFLESGRTNLRRVTYL  347

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLT--DPVRVKVG  1246
             VLDEADRMLDMGFEPQ+R+++  +    QTL+F+AT P +++ +A+E+LT  D +++ +G
Sbjct  348   VLDEADRMLDMGFEPQLRKIVGQIRPDRQTLMFTATWPRQVQVIAREFLTAGDWIQINIG  407

Query  1245  NVS-SPTANVAQILEKVPENEKIDRL---LDLLVEESAQAEKSGHPFSLTIVFVERKTKC  1078
              +  S   ++ Q+++ + E+EK +RL   L  L+  SA  + +    +  +VF + K K 
Sbjct  408   GLDLSANKSIRQVVQVLDEDEKPERLQSLLKTLLNASADTDSN----AKVLVFTDTKRKA  463

Query  1077  EEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVI  898
             ++++  L   GL A ALHG ++Q ER+ A+  FR G   +LVATDVA+RGLD+  +++V+
Sbjct  464   DQLSRRLQHWGLAALALHGDKTQMERDRAIGSFRSGQARLLVATDVAARGLDIKNISYVV  523

Query  897   NLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             N D P T+EDYVHRIGRTGRAGSTG A SF+T  +  L +++
Sbjct  524   NYDFPGTIEDYVHRIGRTGRAGSTGTAYSFFTPANARLASEL  565



>ref|XP_001948642.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Acyrthosiphon 
pisum]
Length=718

 Score =   364 bits (934),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 264/388 (68%), Gaps = 11/388 (3%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             +E+ L   VD A+ +     P P + F +     S+++++    ++ PT++QAQ  P+AL
Sbjct  84    DEVNL-YRVDKAITIRGANVPDPSQFFIEGNFPESVVQELKKQGFSEPTAIQAQGWPIAL  142

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+G A+TGSGKT A+ +P   H   Q PL+RGDGP+ALVLAPTRELAQQI++  K 
Sbjct  143   SGRDLVGIAQTGSGKTLAYMLPAAVHISNQEPLQRGDGPIALVLAPTRELAQQIQSVAKM  202

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             FS S+   +   + GGT  G Q  +L+ GV IV+ATPGRLID L++G+T+L R++++VLD
Sbjct  203   FSSSI---RNTCIFGGTPKGPQAHDLQNGVEIVIATPGRLIDFLERGSTNLKRVTYLVLD  259

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E++ALA ++L D +++ VG++  +
Sbjct  260   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAADFLVDYIQINVGSLELA  319

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ Q++E   ++EK  +L DLL+      + S  P    I+FVE+K K +E+   + 
Sbjct  320   ANHNIQQLIEVCEDHEKDYKLFDLLM------KISNEPGFKAIIFVEKKKKVDELTRQIK  373

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
              +G +AT++HG +SQ +R+  L +FR G + ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  374   NEGYIATSMHGDKSQQDRDHVLNEFRNGKSPILVATDVAARGLDVDDVKYVINFDYPNSS  433

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDM  790
             EDYVHRIGRTGR+   G A +F++  +M
Sbjct  434   EDYVHRIGRTGRSKQAGIAYTFFSTNNM  461



>ref|XP_002553117.1| KLTH0D09328p [Lachancea thermotolerans]
 emb|CAR22679.1| KLTH0D09328p [Lachancea thermotolerans CBS 6340]
Length=551

 Score =   358 bits (920),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 198/450 (44%), Positives = 280/450 (62%), Gaps = 26/450 (6%)
 Frame = -3

Query  2082  SNDAGRNSCATVNYLSPRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDV  1918
             S   GR   +      P  LVAPD     P  P+++ +     F +E  E +R R + +V
Sbjct  37    SYGGGRGGFSRPPPSQPMELVAPDWDQELPNLPKFEKN-----FYVEH-ESVRNRSDAEV  90

Query  1917  AVAMDSNPA-------PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRD  1759
                  +N         P P+ +F +      ++ ++    +  PT +Q Q  P+ALSGRD
Sbjct  91    EEFRKANEMSILGKDIPKPITTFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRD  150

Query  1758  LLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRS  1579
             ++G A TGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+TE   F +S
Sbjct  151   MIGVAATGSGKTLSYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKS  210

Query  1578  LDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADR  1399
                 +   V GG   G Q  EL  G  IV+ATPGRLID L+ G T+L R++++VLDEADR
Sbjct  211   -SRIRNTCVYGGVPRGHQIRELTRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADR  269

Query  1398  MLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTAN  1222
             MLDMGFEPQIR+++  +    QTL++SAT P E++ LA++YL DP++V VG++  + + N
Sbjct  270   MLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHN  329

Query  1221  VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGL  1042
             +AQI+E V + EK DRLL  L  E+A  +K     S  ++F   K  C+E+   L + G 
Sbjct  330   IAQIVEVVSDMEKRDRLLKHL--ETASEDKD----SKILIFASTKRTCDEITRYLRQDGW  383

Query  1041  LATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYV  862
              A A+HG ++Q+ER+  L++FR G + I+VATDVA+RG+DV G+  VIN D+P  +EDYV
Sbjct  384   PALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYV  443

Query  861   HRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             HRIGRTGRAG+TG A SF+T+ +  + AQ+
Sbjct  444   HRIGRTGRAGATGTAISFFTEANKGMGAQL  473



>ref|XP_456892.1| DEHA2A12958p [Debaryomyces hansenii CBS767]
 sp|Q6BY27.1|DBP2_DEBHA RecName: Full=ATP-dependent RNA helicase DBP2 [Debaryomyces hansenii 
CBS767]
 emb|CAG84869.1| DEHA2A12958p [Debaryomyces hansenii CBS767]
Length=536

 Score =   358 bits (918),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 252/383 (66%), Gaps = 8/383 (2%)
 Frame = -3

Query  1905  DSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGK  1726
             D    P P+ SF +      ++K++    +  PTS+Q Q  P+ALSGRD++G A TGSGK
Sbjct  96    DGTDIPKPITSFDEAGFPDYVLKEVKQQGFPKPTSIQCQGWPMALSGRDMVGIASTGSGK  155

Query  1725  TAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVG  1546
             T ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V G
Sbjct  156   TLSYCLPSIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQQECSKFGSS-SRIRNTCVYG  214

Query  1545  GTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  1366
             G   G Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR
Sbjct  215   GAPKGQQIRDLARGVEICIATPGRLIDMLETGKTNLRRVTYLVLDEADRMLDMGFEPQIR  274

Query  1365  EVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPEN  1189
             +++  +    QTL++SAT P E++AL ++YL DP++V VG++  + +  + Q++E V E 
Sbjct  275   KIVDQIRPDRQTLMWSATWPKEVQALTRDYLNDPIQVTVGSLELAASHTITQLVEVVTEF  334

Query  1188  EKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQ  1009
             EK DRL+  L  E+A A+    P +  ++F   K  C+E+   L   G  A A+HG + Q
Sbjct  335   EKRDRLIKHL--ETATAD----PEAKCLIFASTKRTCDEITNYLRADGWPALAIHGDKQQ  388

Query  1008  SEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGS  829
              ER+  L++F+ G + I+VATDVA+RG+DV G+++VINLD+P  +EDYVHRIGRTGRAGS
Sbjct  389   GERDWVLKEFKTGKSPIMVATDVAARGIDVKGISYVINLDMPGNIEDYVHRIGRTGRAGS  448

Query  828   TGQATSFYTDRDMYLVAQIRKAI  760
             TG A SF+TD +  L   + K +
Sbjct  449   TGTAVSFFTDNNSKLGGDLCKIM  471



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score =   359 bits (922),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 272/434 (63%), Gaps = 21/434 (5%)
 Frame = -3

Query  2016  PDPVFPQWKPSERVLLFKLEQI-----EEIR-LRLNVDVAVAMDSNPAPAPVESFTDMCL  1855
             P P F Q  P E+ L  +   +      E+R  R   D+ V  + N  P P+ +F +   
Sbjct  142   PKPNFDQLVPFEKNLYVESPMVAAMSEHEVRTYRARRDITV--EGNDVPKPIRTFQEASF  199

Query  1854  HPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPP  1675
                 +  I    +  PT +Q+Q  P+AL GRDL+G AETGSGKT A+ +P + H  +QPP
Sbjct  200   PGYCLDVIVKLGFVEPTPIQSQGWPMALKGRDLIGIAETGSGKTLAYLLPALVHVSSQPP  259

Query  1674  LRRGDGPLALVLAPTRELAQQIETEVKAF----SRSLDSFKTAIVVGGTNIGDQRSELRA  1507
             L RGDGP+ LVLAPTRELA QI+ E   F    SR+  S ++  V GG   G Q S+L  
Sbjct  260   LVRGDGPIVLVLAPTRELAVQIQQEALKFGSIGSRAKISIRSTCVYGGAPKGPQISDLNK  319

Query  1506  GVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTL  1327
             GV IV+ATPGRL+D L+   T+L R++++VLDEADRMLDMGFEPQIR+++  +    QTL
Sbjct  320   GVEIVIATPGRLLDMLEAYKTNLRRVTYLVLDEADRMLDMGFEPQIRKILTQIRPDRQTL  379

Query  1326  LFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEE  1150
             L+SAT P E+EALA+++L++P +V +G+       +++QI+E + E+EK  RL+ LL   
Sbjct  380   LWSATWPREVEALARQFLSNPYKVIIGSTDLKANQSISQIVEVIKESEKYSRLIKLL---  436

Query  1149  SAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRG  970
               +A   G   S  ++FVE K  C++V + L   G  A ++HG +SQSERE  L +F+ G
Sbjct  437   --KAVMDG---SRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKSQSEREWVLAEFKSG  491

Query  969   PTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDM  790
              + I+ ATDVA+RGLDV  +  VIN D P T+EDYVHRIGRTGRAG+ G A +F+TD + 
Sbjct  492   RSLIMTATDVAARGLDVKDIKCVINYDFPMTLEDYVHRIGRTGRAGAKGTAFTFFTDSNS  551

Query  789   YLVAQIRKAIADVG  748
                 ++ K + D G
Sbjct  552   RFAGELLKILQDAG  565



>ref|XP_448941.1| hypothetical protein [Candida glabrata CBS 138]
 sp|Q6FLF3.1|DBP2_CANGA RecName: Full=ATP-dependent RNA helicase DBP2 [Candida glabrata 
CBS 138]
 emb|CAG61911.1| unnamed protein product [Candida glabrata]
Length=544

 Score =   356 bits (913),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 202/485 (42%), Positives = 287/485 (59%), Gaps = 34/485 (7%)
 Frame = -3

Query  2193  TTVVSNGGDHLHSELNSRQLPSFTQSKN-GFISNGEYCSNDAGRNSCATVNYLSPRGLVA  2017
             T   S GGD      + R    + + +N G+   G    +D G           PR L+ 
Sbjct  11    TNYNSRGGDFRGGRSSDRN--DYNRDRNQGYSHGGLRGRHDDG-----------PRELIK  57

Query  2016  PD--PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMDSNPAPAPVESFTD  1864
             PD     P   P E+   F +E  E +R R + +VA       + +  +  P P+ +F +
Sbjct  58    PDWESELPNLPPFEKN--FYVEH-EVVRNRSDQEVAQFRKESEMTITGHDIPKPITTFDE  114

Query  1863  MCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLA  1684
                   ++K++    +  PTS+Q Q  P+ALSGRD++G A TGSGKT ++ +P I H  A
Sbjct  115   AGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINA  174

Query  1683  QPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAG  1504
             QP L  GDGP+ LVLAPTRELA QI+ E   F +S    +   V GG   G Q  EL  G
Sbjct  175   QPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKS-SRIRNTCVYGGVPRGQQIRELIRG  233

Query  1503  VNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLL  1324
               IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  +    QTL+
Sbjct  234   AEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLM  293

Query  1323  FSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEES  1147
             +SAT P E++ LA++YL DP++V++G++  + + N+ Q++E V E EK DRL+  L   S
Sbjct  294   WSATWPKEVQQLARDYLNDPIQVQIGSLELAASHNITQLVEVVSEFEKRDRLVKHLDTAS  353

Query  1146  AQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGP  967
                E      S  ++F   K  C+E+   L + G  A A+HG + Q ER+  L +FR G 
Sbjct  354   QDKE------SKILIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGN  407

Query  966   TSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMY  787
             + I+VATDVA+RG+DV G+  V+N D+P  +EDYVHRIGRTGRAG+TG A SF+T+ +  
Sbjct  408   SPIMVATDVAARGIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEDNKS  467

Query  786   LVAQI  772
             L A +
Sbjct  468   LGASL  472



>ref|NP_001164095.1| ATP-dependent RNA helicase p62 [Tribolium castaneum]
 ref|XP_008200192.1| PREDICTED: ATP-dependent RNA helicase p62 isoform X1 [Tribolium 
castaneum]
Length=549

 Score =   356 bits (913),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 244/365 (67%), Gaps = 6/365 (2%)
 Frame = -3

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
             AP P+++F + C    +  +I    Y  PT++QAQ  P+A+SG+DL+G A+TGSGKT A+
Sbjct  108   APNPIQNFEEACFPDYVQHEIQKQGYDTPTAIQAQGWPIAMSGKDLVGIAQTGSGKTLAY  167

Query  1713  TIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNI  1534
              +P I H   QP + RGDGP+ALVLAPTRELAQQI+     F  S    +   + GG   
Sbjct  168   ILPAIVHINNQPSIARGDGPIALVLAPTRELAQQIQQVAHDFGSS-SYVRNTCIFGGAPK  226

Query  1533  GDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMH  1354
             G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++ 
Sbjct  227   GPQARDLERGVEICIATPGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE  286

Query  1353  NLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKID  1177
              +    QTL++SAT P E+  LAQ++L + V++ +G++  S   N+ QI++   E+EK  
Sbjct  287   QIRPDRQTLMWSATWPKEVRKLAQDFLRNYVQINIGSLQLSANHNILQIVDVCQEHEKET  346

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
             +L +LL E       +G P +  I+FVE K K E +   + + G  A  +HG +SQ ER+
Sbjct  347   KLNNLLQE----IGNNGEPGAKIIIFVETKKKVESITRTIRRYGWPAVCMHGDKSQQERD  402

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
               LR+FR G +SIL+ATDVA+RGLDV G+ +VIN D P + EDY+HRIGRTGR+ +TG +
Sbjct  403   FVLREFRNGKSSILIATDVAARGLDVEGIKYVINYDYPNSSEDYIHRIGRTGRSDTTGTS  462

Query  816   TSFYT  802
              +F+T
Sbjct  463   YAFFT  467



>ref|XP_008345253.1| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase PRP5-like 
[Malus domestica]
Length=459

 Score =   351 bits (901),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 218/268 (81%), Gaps = 17/268 (6%)
 Frame = -3

Query  1344  KKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLD  1165
             KKHQTLLFSATMP EIE LAQEYLT PV+VKVG VSSPTAN                LL 
Sbjct  209   KKHQTLLFSATMPEEIEELAQEYLTKPVQVKVGKVSSPTAN----------------LLA  252

Query  1164  LLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALR  985
             LLV E+++ E +GH F LTI+FVERKT+C+EVAEAL+ QGL A ALHGGR+Q+EREAALR
Sbjct  253   LLVAEASRVEGTGHXFPLTIMFVERKTRCDEVAEALVXQGLHAVALHGGRTQTEREAALR  312

Query  984   DFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFY  805
             DFR+G TSILVATDVASRGLDV+GVAHVINLDLPK+MEDYVHRIG TGRAGS GQ+TSFY
Sbjct  313   DFRKGTTSILVATDVASRGLDVSGVAHVINLDLPKSMEDYVHRIGXTGRAGSMGQSTSFY  372

Query  804   TDRDMYLVAQIRKAIADVGSGNTVTFATGktarrkereaaaahkeANIALSKLSLMGSTP  625
             TDRDM+LVA I+KAI+D GSGN V FATGKTARRKE+EAAA  K+A +A S+ S+ G T 
Sbjct  373   TDRDMFLVANIKKAISDAGSGNAVAFATGKTARRKEKEAAATEKQARVA-SRSSIAGPTS  431

Query  624   INVEDKYRHMIAPAMSRKEGAADGAWDD  541
             +N+ DKYR M A + ++KEGA+D AWDD
Sbjct  432   VNIXDKYRFMFADSNNKKEGASDSAWDD  459



>gb|ENN71022.1| hypothetical protein YQE_12421, partial [Dendroctonus ponderosae]
 gb|ERL89521.1| hypothetical protein D910_06887 [Dendroctonus ponderosae]
Length=560

 Score =   354 bits (908),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 176/386 (46%), Positives = 253/386 (66%), Gaps = 11/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++E+ RL   + V        AP P+++F +      +M  I    Y  PTS+QAQ  P+
Sbjct  105   EVEQFRLAKQITV-----EGEAPKPIQNFHEASFPDYVMDAIVAQGYEYPTSIQAQGWPI  159

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             A+SG D++G A+TGSGKT A+ +P I H   QP ++RGDGP+ALVLAPTRELAQQI+   
Sbjct  160   AMSGNDMVGVAQTGSGKTLAYILPAIVHINNQPEVQRGDGPVALVLAPTRELAQQIQQVA  219

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F +S    +   V GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++V
Sbjct  220   NDFGKS-SHIRNCCVFGGAPKGPQARDLERGVEICIATPGRLIDFLERGTTNLERCTYLV  278

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E++ LA +++   +++ VG++ 
Sbjct  279   LDEADRMLDMGFEPQIRKIISQIRPDRQTLMWSATWPKEVKKLAADFMNTYIQLNVGSLE  338

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   E+EK ++L +LL E       +G P S  I+FVE K K E +   
Sbjct  339   LSANHNILQIVDVCQEHEKENKLNNLLQEIGT----NGEPDSKIIIFVETKKKVEAITRT  394

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A A+HG +SQ ER+  L++FR G  +ILVATDVA+RGLDV+G+ +V+N D P 
Sbjct  395   IRRFGWPAVAMHGDKSQQERDYVLKEFRNGKATILVATDVAARGLDVDGIRYVVNYDYPN  454

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             + EDY+HRIGRTGR+ +TG + +F+T
Sbjct  455   SSEDYIHRIGRTGRSDTTGTSYAFFT  480



>ref|XP_002774065.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER05881.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=674

 Score =   357 bits (916),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 260/404 (64%), Gaps = 7/404 (2%)
 Frame = -3

Query  1980  RVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTS  1801
             RV     E+++++R  L++++   +     P P+++F + CL   I+K+I    +  PT 
Sbjct  181   RVAAMTPEEVDQVRRTLDIEI---LRGENVPNPIQTFDEACLPDYILKEINRAGFEKPTP  237

Query  1800  VQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTREL  1621
             +Q Q  PVALSGRD++G AETGSGKT AF IP + H  AQP L++GDGP+ L+LAPTREL
Sbjct  238   IQVQGWPVALSGRDMVGIAETGSGKTLAFMIPAVIHINAQPYLQKGDGPIVLILAPTREL  297

Query  1620  AQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTS  1441
             A QI+ E   F RS        V GGT  G Q   L+ GV I +ATPGRLID L+ G T+
Sbjct  298   ALQIKAECDRFGRS-SRITNTCVYGGTQRGPQARALQNGVEICIATPGRLIDFLESGTTN  356

Query  1440  LSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLT-DP  1264
             L R++++V+DEADRMLDMGFEPQ+R+++  +    QTL++SAT P E++ LA++    +P
Sbjct  357   LKRVTYLVMDEADRMLDMGFEPQVRKIVSQIRPDRQTLMWSATWPKEVQHLARDICNEEP  416

Query  1263  VRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKT  1084
             V V VG       N+ Q +E V  N K +RLL L+  ++A A   G   + T++F + K 
Sbjct  417   VLVTVGRSGHACHNIQQYVEVVENNVKPERLLALM--QAASAATGGGWTAKTLIFCDTKR  474

Query  1083  KCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAH  904
               +++   L + G  A ++HG + QSER+  L  F+ G ++I++ATDVASRGLDV  V +
Sbjct  475   GADDITRLLRRDGWPALSIHGDKKQSERDWVLNQFKTGRSAIMIATDVASRGLDVKDVKY  534

Query  903   VINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             VIN D P T+EDYVHRIGRTGRAG++G A SF++     L  Q+
Sbjct  535   VINYDFPGTIEDYVHRIGRTGRAGASGVAYSFFSPDKGKLARQL  578



>ref|NP_014287.3| DEAD-box ATP-dependent RNA helicase DBP2 [Saccharomyces cerevisiae 
S288c]
 sp|P24783.1|DBP2_YEAST RecName: Full=ATP-dependent RNA helicase DBP2; AltName: Full=DEAD 
box protein 2; AltName: Full=p68-like protein [Saccharomyces 
cerevisiae S288c]
 emb|CAA36874.1| p68 protein [Saccharomyces cerevisiae]
 emb|CAA95991.1| DBP2 [Saccharomyces cerevisiae]
 tpg|DAA10435.1| TPA: DEAD-box ATP-dependent RNA helicase DBP2 [Saccharomyces 
cerevisiae S288c]
Length=546

 Score =   353 bits (905),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 188/438 (43%), Positives = 273/438 (62%), Gaps = 26/438 (6%)
 Frame = -3

Query  2046  NYLSPRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMD  1903
             NY  P+ L+ P+     P  P ++ +     F +E  E +R R + ++A       + + 
Sbjct  51    NYNQPQELIKPNWDEELPKLPTFEKN-----FYVEH-ESVRDRSDSEIAQFRKENEMTIS  104

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
              +  P P+ +F +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT
Sbjct  105   GHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKT  164

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGG  1543
              ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+TE   F  S    +   V GG
Sbjct  165   LSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHS-SRIRNTCVYGG  223

Query  1542  TNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  1363
                  Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+
Sbjct  224   VPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRK  283

Query  1362  VMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENE  1186
             ++  +    QTL++SAT P E++ LA +YL DP++V+VG++  S + N+ QI+E V + E
Sbjct  284   IVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFE  343

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K DRL   L   S   E        T++F   K  C+++ + L + G  A A+HG + Q 
Sbjct  344   KRDRLNKYLETASQDNEYK------TLIFASTKRMCDDITKYLREDGWPALAIHGDKDQR  397

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             ER+  L++FR G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+T
Sbjct  398   ERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAT  457

Query  825   GQATSFYTDRDMYLVAQI  772
             G A SF+T+++  L A++
Sbjct  458   GTAISFFTEQNKGLGAKL  475



>sp|A6ZRX0.1|DBP2_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP2; AltName: Full=DEAD 
box protein 2; AltName: Full=p68-like protein [Saccharomyces 
cerevisiae YJM789]
 gb|EDN62702.1| ATP-dependent RNA helicase [Saccharomyces cerevisiae YJM789]
 gb|EDV12364.1| ATP dependent RNA helicase [Saccharomyces cerevisiae RM11-1a]
 emb|CAY82491.1| Dbp2p [Saccharomyces cerevisiae EC1118]
 dbj|GAA25986.1| K7_Dbp2p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EWG83730.1| Dbp2p [Saccharomyces cerevisiae R008]
 gb|EWG89125.1| Dbp2p [Saccharomyces cerevisiae P301]
 gb|EWH16480.1| Dbp2p [Saccharomyces cerevisiae P283]
 gb|AHY76985.1| Dbp2p [Saccharomyces cerevisiae YJM993]
Length=546

 Score =   353 bits (905),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 188/438 (43%), Positives = 273/438 (62%), Gaps = 26/438 (6%)
 Frame = -3

Query  2046  NYLSPRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMD  1903
             NY  P+ L+ P+     P  P ++ +     F +E  E +R R + ++A       + + 
Sbjct  51    NYNQPQELIKPNWDEELPKLPTFEKN-----FYVEH-ESVRDRSDSEIAQFRKENEMTIS  104

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
              +  P P+ +F +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT
Sbjct  105   GHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKT  164

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGG  1543
              ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+TE   F  S    +   V GG
Sbjct  165   LSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHS-SRIRNTCVYGG  223

Query  1542  TNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  1363
                  Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+
Sbjct  224   VPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRK  283

Query  1362  VMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENE  1186
             ++  +    QTL++SAT P E++ LA +YL DP++V+VG++  S + N+ QI+E V + E
Sbjct  284   IVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFE  343

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K DRL   L   S   E        T++F   K  C+++ + L + G  A A+HG + Q 
Sbjct  344   KRDRLNKYLETASQDNEYK------TLIFASTKRMCDDITKYLREDGWPALAIHGDKDQR  397

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             ER+  L++FR G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+T
Sbjct  398   ERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAT  457

Query  825   GQATSFYTDRDMYLVAQI  772
             G A SF+T+++  L A++
Sbjct  458   GTAISFFTEQNKGLGAKL  475



>ref|XP_002421819.1| ATP-dependent RNA helicase, putative [Candida dubliniensis CD36]
 emb|CAX39763.1| ATP-dependent RNA helicase, putative [Candida dubliniensis CD36]
Length=557

 Score =   352 bits (904),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/365 (48%), Positives = 245/365 (67%), Gaps = 8/365 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  113   PHPITTFDEAGFPDYVLQEVKDQGFPKPTAIQCQGWPMALSGRDMIGIAATGSGKTLSYC  172

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  173   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECAKFGKS-SRIRNTCVYGGAPKG  231

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  232   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  291

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  292   IRPDRQTLMWSATWPKEVQQLARDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  351

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  E+        +VF   K  C+E+   L   G  A A+HG + QSER+ 
Sbjct  352   LVKHL--ESALNERENK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKDQSERDW  405

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  406   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  465

Query  813   SFYTD  799
             SF+TD
Sbjct  466   SFFTD  470



>dbj|BAM20360.1| DEAD box ATP-dependent RNA helicase [Papilio polytes]
Length=539

 Score =   352 bits (902),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 265/399 (66%), Gaps = 10/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P   VL     ++EE R +  + V+  +D    P P++ F +      +M++I+   Y
Sbjct  71    YNPPPEVLNRSAYEVEEYRNKHEITVS-GLD---IPNPIQHFVEGNFPDYVMQNISNMGY  126

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT +QAQ  P+A+SG +L+G A+TGSGKT A+ +P I H   QPP+RRGDGP+ALVLA
Sbjct  127   KEPTPIQAQGWPIAMSGHNLVGIAQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLA  186

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  +    +   V GG    +Q  +L  GV IV+ATPGRLID L+
Sbjct  187   PTRELAQQIQQVACDFGNA-SYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLE  245

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E++ LA++Y
Sbjct  246   KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDY  305

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L D +++ +G++  S   N+ QI++   E+EK ++ L++L++E  Q+++ G   + TI+F
Sbjct  306   LGDYLQINIGSLQLSANHNILQIVDVCQEHEKENK-LNVLLQEIGQSQEPG---AKTIIF  361

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K K E +   + + G  A  +HG ++Q ER+  L  F++G  SILVATDVA+RGLDV
Sbjct  362   VETKRKVENITRNIRRFGWPAVCMHGDKTQQERDDVLYQFKQGRASILVATDVAARGLDV  421

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             +G+ +VIN D P + EDY+HRIGRTGR+ S G + +F+T
Sbjct  422   DGIKYVINFDYPNSSEDYIHRIGRTGRSKSKGTSYAFFT  460



>ref|XP_003670835.1| hypothetical protein NDAI_0F02740 [Naumovozyma dairenensis CBS 
421]
 emb|CCD25592.1| hypothetical protein NDAI_0F02740 [Naumovozyma dairenensis CBS 
421]
Length=561

 Score =   352 bits (903),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 191/437 (44%), Positives = 273/437 (62%), Gaps = 26/437 (6%)
 Frame = -3

Query  2043  YLSPRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMDS  1900
             +  P+ L+ P+     P  P ++ +     F +E  E +R R + +VA       + +  
Sbjct  57    FNGPQELIKPNWEQELPNLPTFEKN-----FYVEH-ETVRNRSDAEVAEFRKKNEMTISG  110

Query  1899  NPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTA  1720
             +  P P+ SF +      ++K++    +  PT +Q Q  P+ALSGRD++G A TGSGKT 
Sbjct  111   HDIPKPITSFDEAGFPDYVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTL  170

Query  1719  AFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGT  1540
             ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V GG 
Sbjct  171   SYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHS-SRIRNTCVYGGV  229

Query  1539  NIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREV  1360
               G Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR++
Sbjct  230   PRGQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKI  289

Query  1359  MHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEK  1183
             +  +    QTL++SAT P E++ LA +YL DP++V+VG++  S + N+AQ++E + E EK
Sbjct  290   VDQIRPDRQTLMWSATWPKEVQQLASDYLNDPIQVQVGSLELSASHNIAQLVEVLSEFEK  349

Query  1182  IDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSE  1003
              DRLL  L  E+A  +K     S  ++F   K  C+E+ + L + G  A A+HG + Q E
Sbjct  350   RDRLLKHL--ETASEDKE----SKILIFASTKRMCDEITKMLREDGWPALAIHGDKDQRE  403

Query  1002  REAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTG  823
             R+  L +FR G + I+VATDVA+RG+DV G+  VIN D+P  +EDYVHRIGRTGRAG+ G
Sbjct  404   RDWVLGEFRAGNSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKG  463

Query  822   QATSFYTDRDMYLVAQI  772
              A SF+T+ +  L A +
Sbjct  464   TAISFFTEDNKSLGASL  480



>dbj|BAG30754.1| DEAD box polypeptide 5 [Papilio xuthus]
Length=539

 Score =   351 bits (900),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 265/399 (66%), Gaps = 10/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P   VL     ++EE R +  + V+  +D    P P++ F +      +M++I+   Y
Sbjct  72    YNPPPEVLKRSSYEVEEYRNKHEITVS-GLD---IPNPIQHFEEGNFPDYVMQNISNMGY  127

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT +QAQ  P+A+SG +L+G A+TGSGKT A+ +P I H   QPP+RRGDGP+ALVLA
Sbjct  128   KEPTPIQAQGWPIAMSGHNLVGIAQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLA  187

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  +    +   V GG    +Q  +L  GV IV+ATPGRLID L+
Sbjct  188   PTRELAQQIQQVACDFGNA-SYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLE  246

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E++ LA++Y
Sbjct  247   KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDY  306

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L D +++ +G++  S   N+ QI++   E+EK ++ L++L++E  Q+++ G   + TI+F
Sbjct  307   LGDYLQINIGSLQLSANHNILQIVDVCQEHEKENK-LNVLLQEIGQSQEPG---AKTIIF  362

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K K E +   + + G  A  +HG ++Q ER+  L  F++G  SILVATDVA+RGLDV
Sbjct  363   VETKRKVENITRNIRRFGWPAVCMHGDKTQQERDDVLYQFKQGRASILVATDVAARGLDV  422

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             +G+ +VIN D P + EDY+HRIGRTGR+ S G + +F+T
Sbjct  423   DGIKYVINFDYPNSSEDYIHRIGRTGRSKSKGTSYAFFT  461



>emb|CDF91522.1| ZYBA0S12-00826g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=546

 Score =   351 bits (900),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 196/481 (41%), Positives = 283/481 (59%), Gaps = 38/481 (8%)
 Frame = -3

Query  2175  GGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPD-----  2011
             GGD+  +  + R   S+ + +N          N  G+       +  P+ LV P+     
Sbjct  16    GGDYRGNRSSDRN--SYNRDRN----------NGGGKFQSYRGGFSQPQELVKPNWEEEL  63

Query  2010  PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPA-------PAPVESFTDMCLH  1852
             P  P ++ +     F +E  E +R R + DVA     N         P P+ SF +    
Sbjct  64    PNLPAFEKN-----FYVEH-ESVRNRSDADVAKFRQENEMTIYGHDIPKPITSFDEAGFP  117

Query  1851  PSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPL  1672
               ++K++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ +P I H  AQP L
Sbjct  118   EYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPAIVHINAQPLL  177

Query  1671  RRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIV  1492
               GDGP+ LVLAPTRELA QI+ E   F +S    +   V GG   G Q  +L  G  IV
Sbjct  178   APGDGPVVLVLAPTRELAVQIQKECSKFGKS-SRIRNTCVYGGVPRGQQIRDLSRGAEIV  236

Query  1491  VATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSAT  1312
             +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT
Sbjct  237   IATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSAT  296

Query  1311  MPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAE  1135
              P E++ LA +YL DP++V++G++  S + ++ QI+E + E EK DRL   L   S   +
Sbjct  297   WPKEVKQLAADYLVDPIQVQIGSLELSASHDIKQIIEVITEFEKRDRLAKHLDIASQDQD  356

Query  1134  KSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSIL  955
                   S  +VF   K  C+++ + L + G  A A+HG + Q ER+  L +F+ G + I+
Sbjct  357   ------SKVLVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLNEFKTGRSPIM  410

Query  954   VATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQ  775
             VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+ G A SF+T+ +  L A 
Sbjct  411   VATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAVSFFTEANKGLGAS  470

Query  774   I  772
             +
Sbjct  471   L  471



>ref|XP_002437244.1| hypothetical protein SORBIDRAFT_10g023440 [Sorghum bicolor]
 gb|EER88611.1| hypothetical protein SORBIDRAFT_10g023440 [Sorghum bicolor]
Length=567

 Score =   351 bits (901),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 192/394 (49%), Positives = 256/394 (65%), Gaps = 20/394 (5%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V +    APAP + F    L  ++++++A   Y  PT VQ  AMP+ ++GRDL+ CA
Sbjct  41    DIPVEVSGEGAPAPADGFEAAGLAEAVLRNVARCGYDNPTPVQRYAMPIVMAGRDLMACA  100

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPL--------RRGDG-------PLALVLAPTRELAQQI  1609
             +TGSGKTAAF +P++   +  P          RR  G       P ALVLAPTRELA QI
Sbjct  101   QTGSGKTAAFCLPVVSGLVVPPAGGGSGYGYGRRDRGSFDRVAKPRALVLAPTRELAAQI  160

Query  1608  ETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRI  1429
               E + FS      +  +  GGT + +Q  +L  GV+++VATPGRL+D +++   SL  I
Sbjct  161   NEEARKFSFQT-GLRVVVAYGGTPMYNQLRDLERGVDLLVATPGRLVDMVERSRISLEGI  219

Query  1428  SFVVLDEADRMLDMGFEPQIREV--MHNLPKK--HQTLLFSATMPAEIEALAQEYLTDPV  1261
              ++V+DEADRMLDMGFEPQIR++  M N+PKK   QT+LFSAT P EI+ LA ++L + +
Sbjct  220   KYLVMDEADRMLDMGFEPQIRKIVDMMNMPKKSVRQTMLFSATFPPEIQRLASDFLYNYI  279

Query  1260  RVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTK  1081
              V VG V S T  + Q LE V + EK   L+DLL ++SA    S     LT+VFVE K +
Sbjct  280   FVTVGRVGSSTDLIEQKLEFVNDGEKRGFLIDLLQKQSAGVANSKLQQPLTLVFVETKRE  339

Query  1080  CEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHV  901
              + +   L  +G  ATA+HG R+Q ERE+AL+ F+ G T I+VATDVASRGLDV  VAHV
Sbjct  340   ADSLRYFLQSKGFPATAIHGDRTQQERESALKSFKSGTTPIMVATDVASRGLDVPNVAHV  399

Query  900   INLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTD  799
             IN DLPK++EDYVHRIGRTGRAG  G AT+F+T+
Sbjct  400   INYDLPKSIEDYVHRIGRTGRAGKAGIATAFFTE  433



>ref|XP_002007476.1| GI12369 [Drosophila mojavensis]
 gb|EDW17952.1| GI12369 [Drosophila mojavensis]
Length=794

 Score =   357 bits (917),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 189/399 (47%), Positives = 255/399 (64%), Gaps = 12/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP E VL  + +   E  L  N    + +  N  P P   F +      +M +I    +
Sbjct  108   YKPCESVLA-RTQGETETFLSSN---EITIKGNEVPTPSIEFEEGGFPDYVMNEIRKQGF  163

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
             T PT++QAQ MP+ALSGRDL+  A+TGSGKT A+ +P + H   QP L RGDGP+ALVLA
Sbjct  164   TKPTAIQAQGMPIALSGRDLVAVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLA  223

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  S    +   + GG   G Q  +L  GV IV+ATPGRLID L+
Sbjct  224   PTRELAQQIQQVASEFG-SNTQVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLE  282

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G TSL R +++VLDEADRMLDMGFEPQIR++M  +    Q L++SAT P E+  LA+E+
Sbjct  283   RGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEF  342

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L + ++V +G++S S   N+ QI++   E+EKI +L+ LL + S + E      + TI+F
Sbjct  343   LNNYIQVNIGSLSLSANHNILQIVDVCDESEKIVKLIQLLTQISGENE------TKTIIF  396

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K + +E+   + +QG  A A+HG +SQ ER+  L  FR G  SILVATDVA+RGLDV
Sbjct  397   VETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDV  456

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             + V  VIN D P   EDYVHRIGRTGR+ +TG A + +T
Sbjct  457   DDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFT  495



>ref|XP_004965954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like isoform 
X1 [Setaria italica]
Length=619

 Score =   352 bits (903),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 253/389 (65%), Gaps = 17/389 (4%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             ++ V +    AP P + F    L  ++++++A   Y  PT VQ  AMP+A++GRDL+ CA
Sbjct  66    EIPVEVSGEGAPPPADGFEAAGLAEAVLRNVARCGYESPTPVQRYAMPIAMAGRDLMACA  125

Query  1743  ETGSGKTAAFTIPMIQH----------CLAQPPLRRGDGPLALVLAPTRELAQQIETEVK  1594
             +TGSGKTAAF +P++            C  +    R   P ALVLAPTRELA QI  E K
Sbjct  126   QTGSGKTAAFCLPVVSGLVAAAAGGYGCRDRGSFERRAKPRALVLAPTRELAAQINEEAK  185

Query  1593  AFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVL  1414
              FS      +  +  GGT + DQ  EL  GV+++VATPGRL+D +++   SL  I ++ +
Sbjct  186   KFSFQT-GLRVVVAYGGTPMNDQLRELERGVDLLVATPGRLVDMVERSKISLEAIKYLAM  244

Query  1413  DEADRMLDMGFEPQIREV--MHNLPKK--HQTLLFSATMPAEIEALAQEYLTDPVRVKVG  1246
             DEADRMLDMGFEPQIR++  M N+PKK   QT+LFSAT P EI+ LA ++L + + + VG
Sbjct  245   DEADRMLDMGFEPQIRKIVDMMNMPKKSVRQTMLFSATFPPEIQRLASDFLHNYIFITVG  304

Query  1245  NVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
              V S T  + Q +E V + EK   LL+LL ++S     S  P  LT++FVE K + + + 
Sbjct  305   RVGSSTDLIEQKIEFVNDKEKRGFLLELLHKQSVGGGNSKQP--LTLIFVETKREADTLR  362

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L  +G  ATA+HG R+Q ERE+ALR F+ G T I+VATDVASRGLDV  V HVIN DL
Sbjct  363   YWLYSKGFPATAIHGDRTQQERESALRSFKSGATPIMVATDVASRGLDVPNVGHVINYDL  422

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYTD  799
             PK++EDYVHRIGRTGRAG  G+AT+F+T+
Sbjct  423   PKSIEDYVHRIGRTGRAGKAGKATAFFTE  451



>gb|ACV83780.1| DEAD box ATP-dependent RNA helicase-like protein [Heliconius 
melpomene]
Length=646

 Score =   353 bits (906),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/402 (46%), Positives = 261/402 (65%), Gaps = 12/402 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP   V     +++E  R    + V+     N  P P + F +      IM  I    +
Sbjct  200   YKPHANVEGRSDDEVEMFRATKEITVS----GNDVPRPNQVFDEGNFPDHIMNTIKEQGW  255

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT +QAQ  P+ALSGRD++G A TGSGKT A+ +P   H + Q  ++RGDGP+AL+LA
Sbjct  256   EEPTGIQAQGWPIALSGRDMVGIASTGSGKTLAYMLPAAVHIVHQQRIQRGDGPIALILA  315

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI++  +A+S +    +   + GG+  G Q  +L  GV IV+ATPGRLID L+
Sbjct  316   PTRELAQQIQSVAQAYS-AHGCIRNTCLFGGSPKGPQARDLERGVEIVIATPGRLIDFLE  374

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT P EI+ALA+++
Sbjct  375   RGTTNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEIQALAEDF  434

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             LTD V+V +G+++ S   N+ QI+E   E+EK  +L +LL E +++ +         IVF
Sbjct  435   LTDYVKVNIGSLNLSANNNIKQIIEVCEEHEKEVKLTNLLKEIASEKDNK------VIVF  488

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K K +++A A+ + G  A A+HG +SQ ER+A L +FR G T+IL+ATDVA+RGLDV
Sbjct  489   VETKKKVDDIARAVRRNGHKALAIHGDKSQQERDAVLTEFRNGATTILIATDVAARGLDV  548

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRD  793
               V  V+N D P T EDY+HRIGRTGR   +G A +++T  D
Sbjct  549   EDVKFVVNFDYPNTSEDYIHRIGRTGRCQQSGTAYTYFTSGD  590



>gb|EHJ76805.1| DEAD box ATP-dependent RNA helicase-like protein [Danaus plexippus]
Length=773

 Score =   357 bits (915),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 252/375 (67%), Gaps = 8/375 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P P   F +      IM  I    +  PT +QAQ  P+ALSGRD++G A TG
Sbjct  174   ITVSGNNVPRPNHIFDEGNFPDHIMTTIREQGWEEPTGIQAQGWPIALSGRDMVGIASTG  233

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H + QP ++RGDGP+AL+LAPTRELAQQI++  +A+S +    +   
Sbjct  234   SGKTLAYILPAAVHIVHQPRIQRGDGPIALILAPTRELAQQIQSVAQAYS-ARGFIRNTC  292

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV IV+ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  293   LFGGSPKGPQARDLEKGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEP  352

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P EI+ALA+++LTD ++V +G+++ S   N+ QI+E  
Sbjct  353   QIRKIIEQIRPDRQVLMWSATWPKEIQALAEDFLTDYIKVNIGSLNLSANNNIKQIIEVC  412

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L++LL E S++ +         IVFVE K K +++A A+ + G  A A+HG 
Sbjct  413   EEHEKESKLINLLKEISSEKDNK------VIVFVETKKKVDDIAHAVRRNGHKALAIHGD  466

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+A L +FR G T+IL+ATDVA+RGLDV  V  V+N D P T EDY+HRIGRTGR
Sbjct  467   KSQPERDAVLTEFRNGSTTILIATDVAARGLDVEDVKFVVNYDYPNTSEDYIHRIGRTGR  526

Query  837   AGSTGQATSFYTDRD  793
                +G A +++T  D
Sbjct  527   CQQSGTAYTYFTSGD  541



>gb|EHJ72566.1| DEAD box polypeptide 5 [Danaus plexippus]
Length=592

 Score =   351 bits (901),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 181/399 (45%), Positives = 260/399 (65%), Gaps = 10/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P   VL     ++EE R +  V V+ A      P P++ F +      +MK I+   Y
Sbjct  120   YNPPPSVLNRSPYEVEEYRNKHEVSVSGA----DVPNPIQHFEEGNFPDYVMKSISSMGY  175

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT +QAQ  P+A+SG++L+G A+TGSGKT A+ +P I H   Q P+RRGDGP+ALVLA
Sbjct  176   NEPTPIQAQGWPIAMSGKNLVGIAQTGSGKTLAYILPAIVHINNQQPVRRGDGPVALVLA  235

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  +    +   V GG    +Q  +L  GV IV+ATPGRLID L+
Sbjct  236   PTRELAQQIQQVATDFGNAA-YVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLE  294

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA++Y
Sbjct  295   KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVRKLAEDY  354

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L D V++ +G++  S   N+ QI++   E+EK ++ L+ L++E  Q++  G   S TI+F
Sbjct  355   LGDYVQINIGSMQLSANHNILQIVDVCQEHEKENK-LNTLLQEIGQSQDPG---SKTIIF  410

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K K E +   + + G  A  +HG ++Q ER+  L  F++G  +ILVATDVA+RGLDV
Sbjct  411   VETKRKVENITRNIRRYGWPAVCMHGDKTQQERDDVLYQFKQGRANILVATDVAARGLDV  470

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             +G+ +VIN D P + EDY+HRIGRTGR+ S G + +F+T
Sbjct  471   DGIKYVINFDYPNSSEDYIHRIGRTGRSKSKGTSYAFFT  509



>gb|EFA12741.1| Rm62 [Tribolium castaneum]
Length=776

 Score =   356 bits (913),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 244/365 (67%), Gaps = 6/365 (2%)
 Frame = -3

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
             AP P+++F + C    +  +I    Y  PT++QAQ  P+A+SG+DL+G A+TGSGKT A+
Sbjct  122   APNPIQNFEEACFPDYVQHEIQKQGYDTPTAIQAQGWPIAMSGKDLVGIAQTGSGKTLAY  181

Query  1713  TIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNI  1534
              +P I H   QP + RGDGP+ALVLAPTRELAQQI+     F  S    +   + GG   
Sbjct  182   ILPAIVHINNQPSIARGDGPIALVLAPTRELAQQIQQVAHDFGSS-SYVRNTCIFGGAPK  240

Query  1533  GDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMH  1354
             G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++ 
Sbjct  241   GPQARDLERGVEICIATPGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE  300

Query  1353  NLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKID  1177
              +    QTL++SAT P E+  LAQ++L + V++ +G++  S   N+ QI++   E+EK  
Sbjct  301   QIRPDRQTLMWSATWPKEVRKLAQDFLRNYVQINIGSLQLSANHNILQIVDVCQEHEKET  360

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
             +L +LL E       +G P +  I+FVE K K E +   + + G  A  +HG +SQ ER+
Sbjct  361   KLNNLLQE----IGNNGEPGAKIIIFVETKKKVESITRTIRRYGWPAVCMHGDKSQQERD  416

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
               LR+FR G +SIL+ATDVA+RGLDV G+ +VIN D P + EDY+HRIGRTGR+ +TG +
Sbjct  417   FVLREFRNGKSSILIATDVAARGLDVEGIKYVINYDYPNSSEDYIHRIGRTGRSDTTGTS  476

Query  816   TSFYT  802
              +F+T
Sbjct  477   YAFFT  481



>ref|XP_001761340.1| predicted protein [Physcomitrella patens]
 gb|EDQ73729.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   350 bits (898),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 210/499 (42%), Positives = 288/499 (58%), Gaps = 33/499 (7%)
 Frame = -3

Query  2232  SYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYC-------SND  2074
             SYVPPHLRN   A   V    D + +       P+   + +G+ S            SN 
Sbjct  30    SYVPPHLRNRPQAAAAV----DRVIN-------PTVADNGSGWGSGAAVNHAASWGNSNG  78

Query  2073  AGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNP  1894
             +GR+                +P     + SE +  F+ E    I      D+ V    N 
Sbjct  79    SGRSYGGVGRGHRGGWEREANPFANDEQVSETI--FEAENTG-INFDAYEDIPVETSGNN  135

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
              P PV +F ++ L P++ ++I    YT PT VQ  A+P++L GRDL+ CA+TGSGKTAAF
Sbjct  136   VPPPVNTFAEIDLGPALNENIRRCKYTKPTPVQRYAIPISLHGRDLMACAQTGSGKTAAF  195

Query  1713  TIPMIQHCLAQPPLRRGDG-----PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVV  1549
               P+I   +   P  R  G     PLAL+L+PTREL+ QI  E K F+      K  +  
Sbjct  196   CFPIIAGIMRNTPPGRSRGGRKALPLALILSPTRELSCQISDEAKKFAYQT-GIKVVVCY  254

Query  1548  GGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQI  1369
             GG  + +Q  E+  GV+I+VATPGRL D L++   SLS + ++ LDEADRMLDMGFEPQI
Sbjct  255   GGAPVHNQLREMERGVDILVATPGRLSDLLERARVSLSMVRYLALDEADRMLDMGFEPQI  314

Query  1368  REVMHNL----PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEK  1201
             R ++  +      + QT+LFSAT P EI+ LA ++L++ + + VG V S T  + Q +E 
Sbjct  315   RRIVEQMDMPPAGERQTMLFSATFPREIQRLASDFLSNYIFLAVGRVGSSTELIVQRVEY  374

Query  1200  VPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHG  1021
             V +++K   L+DL+  +SA A       SLT+VFVE K   + + + L + G  AT +HG
Sbjct  375   VQDSDKRSMLMDLIHAQSALAPPGQQ--SLTLVFVETKKGADSLEDWLCRMGFPATTIHG  432

Query  1020  GRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTG  841
              RSQ ERE ALR FR G T ILVATDVA+RGLD+  VAHV+N DLP  ++DYVHRIGRTG
Sbjct  433   DRSQQEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVVNFDLPSDIDDYVHRIGRTG  492

Query  840   RAGSTGQATSFYTDRDMYL  784
             RAG +G AT+F+ ++D  L
Sbjct  493   RAGKSGVATAFFNEKDQSL  511



>ref|XP_002495378.1| ZYRO0B09856p [Zygosaccharomyces rouxii]
 emb|CAR26445.1| ZYRO0B09856p [Zygosaccharomyces rouxii]
Length=540

 Score =   348 bits (894),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/434 (44%), Positives = 270/434 (62%), Gaps = 20/434 (5%)
 Frame = -3

Query  2043  YLSPRGLVAP--DPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMDSNPA  1891
             Y  P+ L  P  D   P   P E+   F +E  E +R R + D+A       + +  +  
Sbjct  49    YTEPQELGKPNWDEELPHLPPFEKN--FYVEH-EGVRNRSDEDIAKFRKENEMTITGHDI  105

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ SF +      ++K++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  106   PKPITSFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYC  165

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F RS    +   V GG   G
Sbjct  166   LPAIVHINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRS-SRIRNTCVYGGVPRG  224

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  G  IV+ATPGRLID L+   T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  225   QQIRDLARGAEIVIATPGRLIDMLEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  284

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA++YLTDP++V++G++  S +  + Q++E + E EK DR
Sbjct  285   IRPDRQTLMWSATWPKEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVEVISEFEKRDR  344

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L   L  E A  ++     S  +VF   K  C+++ + L + G  A A+HG + Q ER+ 
Sbjct  345   LSKHL--EIASEDQD----SKVLVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDW  398

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +F+ G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+ G A 
Sbjct  399   VLEEFKNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAI  458

Query  813   SFYTDRDMYLVAQI  772
             SF+T+ +  L A +
Sbjct  459   SFFTEGNKGLGASL  472



>ref|XP_003677495.1| hypothetical protein NCAS_0G02560 [Naumovozyma castellii CBS 
4309]
 emb|CCC71143.1| hypothetical protein NCAS_0G02560 [Naumovozyma castellii CBS 
4309]
Length=556

 Score =   349 bits (895),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 200/481 (42%), Positives = 282/481 (59%), Gaps = 36/481 (7%)
 Frame = -3

Query  2181  SNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCATVNYLSPRGLVAPD---  2011
             S GGD      + R   S+T   NG    G       GR       +  P+ LV P+   
Sbjct  18    SRGGDSRGFRASDRN--SYTHQGNGRPYEG-------GRGG-GRPQFSGPQELVKPNWEQ  67

Query  2010  --PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMDSNPAPAPVESFTDMC  1858
               P  P ++ +     F +E  E ++ R   ++A       + +  +  P P+ +F +  
Sbjct  68    ELPNLPTFEKN-----FYVEH-ETVQNRTEAEIAQFRKENEMTISGHDIPKPITTFDEAG  121

Query  1857  LHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQP  1678
                 ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ +P I H  AQP
Sbjct  122   FPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQP  181

Query  1677  PLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVN  1498
              L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V GG   G Q  +L  G  
Sbjct  182   LLAPGDGPIVLVLAPTRELAVQIQKECSKFGHS-SRIRNTCVYGGVPRGQQIRDLSRGSE  240

Query  1497  IVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFS  1318
             IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  +    QTL++S
Sbjct  241   IVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWS  300

Query  1317  ATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQ  1141
             AT P E++ LA +YL DP++V++G++  S + N+ Q++E V E EK DRLL  L   S  
Sbjct  301   ATWPKEVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLETASQD  360

Query  1140  AEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTS  961
              E      S  ++F   K  C+EV + L + G  A A+HG + Q ER+  L +FR G + 
Sbjct  361   QE------SKILIFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSP  414

Query  960   ILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLV  781
             I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+TG A SF+T+ +  L 
Sbjct  415   IMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEGNKSLG  474

Query  780   A  778
             A
Sbjct  475   A  475



>ref|XP_008555060.1| PREDICTED: ATP-dependent RNA helicase p62-like [Microplitis demolitor]
Length=561

 Score =   349 bits (895),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 175/372 (47%), Positives = 243/372 (65%), Gaps = 6/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P P+++F +      +M+ I    +T PT++Q+Q  P+A+SGR+++G A+TG
Sbjct  118   ITLKGEKIPHPIQTFDEGNFPDYVMEGIKKQGFTEPTAIQSQGWPIAMSGRNMVGIAQTG  177

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT  + +P I H   Q PL RGDGP+ALVLAPTRELAQQI+T    F  SL   +   
Sbjct  178   SGKTLGYILPAIVHINNQQPLNRGDGPIALVLAPTRELAQQIQTVANDFG-SLSYVRNTC  236

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  237   IFGGAPKGAQARDLERGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEP  296

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E+  LA+EYL D  ++ +G++S S   N+ QI++  
Sbjct  297   QIRKIIEQIRPDRQVLMWSATWPKEVRMLAEEYLVDYTQLNIGSLSLSANHNILQIVDVC  356

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E     +  G     TI+FVE K K E +   + + G  A  +HG 
Sbjct  357   QEHEKEAKLGTLLQEIGNVNDDGGK----TIIFVETKKKVENITRNIRRYGWPAVCMHGD  412

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  LR+FR    SILVATDVA+RGLDV+ V +VIN D P + EDY+HRIGRTGR
Sbjct  413   KSQQERDYVLREFRNKKGSILVATDVAARGLDVDDVKYVINFDYPSSSEDYIHRIGRTGR  472

Query  837   AGSTGQATSFYT  802
             + STG + +F+T
Sbjct  473   SQSTGTSYAFFT  484



>ref|XP_010101088.1| DEAD-box ATP-dependent RNA helicase 37 [Morus notabilis]
 gb|EXB86900.1| DEAD-box ATP-dependent RNA helicase 37 [Morus notabilis]
Length=612

 Score =   350 bits (899),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 210/507 (41%), Positives = 287/507 (57%), Gaps = 43/507 (8%)
 Frame = -3

Query  2232  SYVPPHLRNSTTATTV-----------VSNGGDHLHSELNSRQLPSFTQSKNGFISNGEY  2086
             SYVPPHLRN   ++                GG    S  N    P F +S  G++S G +
Sbjct  31    SYVPPHLRNRPPSSDPPAPSNSVPGDRAGYGGPSSGSRWNGGSRPDFGRS--GYVSGGGW  88

Query  2085  CSNDAGRNSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAM  1906
              S   G +          RG    +  F     +E    F  ++   I      D+ V  
Sbjct  89    SSRSKGWD----------RGRDREENPFENDDGAEPS--FSEQENTGINFDAYEDIPVET  136

Query  1905  DSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGK  1726
               N  P PV +F ++ L   + ++I    Y  PT VQ  A+P++L+GRDL+ CA+TGSGK
Sbjct  137   SGNNVPPPVNTFAEIDLGEELNQNIRRCKYLKPTPVQRHAIPISLAGRDLMACAQTGSGK  196

Query  1725  TAAFTIPMIQHCLAQPPLRRGDG-----PLALVLAPTRELAQQIETEVKAFSRSLDSFKT  1561
             TAAF  P+I   +    ++R  G     PLAL+L+PTREL+ QI  E + FS      + 
Sbjct  197   TAAFCFPIISGIMRGQNVQRPRGTRTVFPLALILSPTRELSSQIHDEARKFSYQT-GVRV  255

Query  1560  AIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGF  1381
              +  GG  I  Q  EL  GV+I+VATPGRL+D L++   SL  I ++ LDEADRMLDMGF
Sbjct  256   VVAYGGAPINQQLRELERGVDILVATPGRLVDLLERARVSLQMIRYLALDEADRMLDMGF  315

Query  1380  EPQIREVMHNL----PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQ  1213
             EPQIR+++  +        QT+LFSAT P EI+ +A ++L++ + + VG V S T  + Q
Sbjct  316   EPQIRKIVEQMDMPPAGARQTMLFSATFPKEIQRMASDFLSEYIFLAVGRVGSSTDLIVQ  375

Query  1212  ILEKVPENEKIDRLLDLL---VEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGL  1042
              +E V E +K   L+DLL    E +AQ +++     LT+VFVE K   + +   L   G 
Sbjct  376   RVEFVHEADKRSHLMDLLHAQKETTAQGKQA-----LTLVFVETKKGADSLEYWLTSSGF  430

Query  1041  LATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYV  862
              AT++HG RSQ ERE ALR F+ G T ILVATDVA+RGLD+  VAHVIN DLP  ++DYV
Sbjct  431   PATSIHGDRSQQEREYALRSFKSGKTPILVATDVAARGLDIPHVAHVINFDLPNDIDDYV  490

Query  861   HRIGRTGRAGSTGQATSFYTDRDMYLV  781
             HRIGRTGRAG TG AT+F+ + ++ L 
Sbjct  491   HRIGRTGRAGKTGLATAFFNENNLSLA  517



>ref|XP_002046853.1| GJ12262 [Drosophila virilis]
 gb|EDW69195.1| GJ12262 [Drosophila virilis]
Length=778

 Score =   355 bits (912),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/402 (47%), Positives = 257/402 (64%), Gaps = 12/402 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP E VL  + +   E  L  N    + +  N  P P   F +      +M +I    +
Sbjct  107   YKPCESVLA-RTQGETETFLSSN---EITIKGNEVPTPSIEFEEGGFPDYVMNEIRKQGF  162

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
             T PT++QAQ MP+ALSGRDL+  A+TGSGKT A+ +P + H   QP L RGDGP+ALVLA
Sbjct  163   TKPTAIQAQGMPIALSGRDLVAVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLA  222

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  S    +   + GG   G Q  +L  GV IV+ATPGRLID L+
Sbjct  223   PTRELAQQIQQVASEFG-SNTQVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLE  281

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR++M  +    Q L++SAT P E+  LA+E+
Sbjct  282   RGTTTLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEF  341

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L + ++V +G++S S   N+ QI++   E+EKI +L+ LL + S + E      + TI+F
Sbjct  342   LNNYIQVNIGSLSLSANHNILQIVDVCDESEKIVKLIQLLTQISGENE------TKTIIF  395

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K + +E+   + +QG  A A+HG +SQ ER+  L  FR G  SILVATDVA+RGLDV
Sbjct  396   VETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDV  455

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRD  793
             + V  VIN D P   EDYVHRIGRTGR+ +TG A + +T+ +
Sbjct  456   DDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTNSN  497



>gb|EFX78251.1| hypothetical protein DAPPUDRAFT_213150 [Daphnia pulex]
Length=487

 Score =   346 bits (888),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 180/399 (45%), Positives = 251/399 (63%), Gaps = 12/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP   + +  +  IE+ R   ++ +         P P+ SF +      +M +I    +
Sbjct  25    YKPHPNLTVKSVHDIEQYRASKDITIR----GRDVPFPITSFDEASFPDYVMTEIRRQGF  80

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PTS+QAQ  P+ALSG +++G A+TGSGKT A+T+P I H   QP L  GDGP+AL+LA
Sbjct  81    KEPTSIQAQGWPIALSGSNMVGIAQTGSGKTLAYTLPAIVHINHQPYLEPGDGPIALILA  140

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI +  K F  S    +   V GG   G Q  ++  GV I++ATPGRLID L+
Sbjct  141   PTRELAQQISSTAKDFGSS-SRIRNTCVFGGAPKGPQLRDIERGVEIMIATPGRLIDFLE  199

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
              G T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+E+
Sbjct  200   AGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVRQLAEEF  259

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             LTD +++ VG+++ S   N+ QI++   E+EK  +L+ LL E  A+ E        TI+F
Sbjct  260   LTDYIQINVGSLTLSANHNILQIIDVCQEHEKETKLMTLLQEIGAEDENK------TIIF  313

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
              E K K + +  A+ + G  A  +HG ++Q ER+  L +FR G   ILVATDVA+RGLDV
Sbjct  314   AETKRKVDSITRAMRRDGWPAMCIHGDKAQPERDWVLNEFRSGKAPILVATDVAARGLDV  373

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             + V  VIN D P   EDYVHRIGRTGR+  TG A +F+T
Sbjct  374   DDVKFVINFDYPNCSEDYVHRIGRTGRSQRTGTAYTFFT  412



>ref|NP_001166829.1| DEAD box polypeptide 5 isoform 2 [Bombyx mori]
 gb|ABF51313.1| DEAD box polypeptide 5 isoform 2 [Bombyx mori]
Length=512

 Score =   347 bits (890),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 256/386 (66%), Gaps = 10/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R    V V+     NP    ++ F +      + + +    Y  PT +QAQ  P+
Sbjct  58    EVEEYRNNHEVTVSGVEVHNP----IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI  113

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             A+SG++L+G A+TGSGKT A+ +P I H   QPP+RRGDGP+ALVLAPTRELAQQI+   
Sbjct  114   AMSGKNLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVA  173

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  +    +   V GG    +Q  +L  GV IV+ATPGRLID L++G T+L R +++V
Sbjct  174   ADFGHT-SYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLEKGTTNLQRCTYLV  232

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E++ LA++YL D +++ +G++ 
Sbjct  233   LDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQ  292

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   E+EK ++ L++L++E  Q+++ G   + TI+FVE K K E ++  
Sbjct  293   LSANHNILQIVDICQEHEKENK-LNVLLQEIGQSQEPG---AKTIIFVETKRKAENISRN  348

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG ++Q ER+  L  F+ G  SILVATDVA+RGLDV+G+ +VIN D P 
Sbjct  349   IRRYGWPAVCMHGDKTQQERDEVLYQFKEGRASILVATDVAARGLDVDGIKYVINFDYPN  408

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             + EDY+HRIGRTGR+ S G + +F+T
Sbjct  409   SSEDYIHRIGRTGRSKSKGTSYAFFT  434



>gb|KHC61282.1| ATP-dependent RNA helicase DBP2 [Candida albicans P75016]
Length=561

 Score =   348 bits (893),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  123   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  182

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  183   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  241

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  242   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  301

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  302   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  361

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  362   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  415

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  416   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  475

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  476   SFFTEGNSKLGGDLCKIM  493



>gb|EFZ12253.1| hypothetical protein SINV_05205 [Solenopsis invicta]
Length=725

 Score =   353 bits (906),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/390 (45%), Positives = 253/390 (65%), Gaps = 9/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P PV++F +      +M +I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  97    ITVKGNNTPFPVQAFEESNFPDYVMNEIKKQGFAEPTAIQAQGWPIALSGRDLVGIAQTG  156

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P I H   QP L RGDGP+ L+LAPTRELAQQI+T  + F  S    +   
Sbjct  157   SGKTLAYILPAIVHINNQPRLSRGDGPIVLILAPTRELAQQIQTVARDFGSS-SCIRNTC  215

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  216   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEP  275

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++LTD +++ +G+++ +   N+ QI+E  
Sbjct  276   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLTDYIQINIGSLTLAANHNIRQIIEIC  335

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E  A+  K        I+FVE K K +++ + + + G  A ++HG 
Sbjct  336   QEHEKETKLSQLLREIGAERSK-------MIIFVETKKKVDDITKTIKRDGWPAISIHGD  388

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR
Sbjct  389   KSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGR  448

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  449   CQSAGTAYAYFTPNNARQAKELIAVLEEAG  478



>gb|KGQ83987.1| ATP-dependent RNA helicase DBP2 [Candida albicans GC75]
 gb|KGU02086.1| ATP-dependent RNA helicase DBP2 [Candida albicans P87]
Length=562

 Score =   348 bits (893),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  124   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  183

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  184   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  242

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  243   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  302

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  303   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  362

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  363   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  416

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  417   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  476

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  477   SFFTEGNSKLGGDLCKIM  494



>gb|KGR07069.1| ATP-dependent RNA helicase DBP2 [Candida albicans P37037]
 gb|KGT64351.1| ATP-dependent RNA helicase DBP2 [Candida albicans 12C]
 gb|KGU21829.1| ATP-dependent RNA helicase DBP2 [Candida albicans P57055]
 gb|KGU23548.1| ATP-dependent RNA helicase DBP2 [Candida albicans P75063]
 gb|KHC46335.1| ATP-dependent RNA helicase DBP2 [Candida albicans P37039]
Length=561

 Score =   348 bits (893),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  123   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  182

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  183   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  241

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  242   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  301

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  302   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  361

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  362   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  415

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  416   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  475

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  476   SFFTEGNSKLGGDLCKIM  493



>gb|KHC54337.1| ATP-dependent RNA helicase DBP2 [Candida albicans P75010]
Length=562

 Score =   348 bits (893),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  124   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  183

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  184   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  242

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  243   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  302

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  303   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  362

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  363   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  416

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  417   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  476

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  477   SFFTEGNSKLGGDLCKIM  494



>gb|KGQ81587.1| ATP-dependent RNA helicase DBP2 [Candida albicans P94015]
 gb|KGR01727.1| ATP-dependent RNA helicase DBP2 [Candida albicans P57072]
 gb|KHC29621.1| ATP-dependent RNA helicase DBP2 [Candida albicans P76055]
 gb|KHC30051.1| ATP-dependent RNA helicase DBP2 [Candida albicans P76067]
 gb|KHC45014.1| ATP-dependent RNA helicase DBP2 [Candida albicans P60002]
Length=562

 Score =   348 bits (893),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  124   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  183

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  184   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  242

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  243   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  302

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  303   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  362

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  363   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  416

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  417   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  476

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  477   SFFTEGNSKLGGDLCKIM  494



>sp|Q59LU0.2|DBP2_CANAL RecName: Full=ATP-dependent RNA helicase DBP2 [Candida albicans 
SC5314]
 gb|KGQ82851.1| ATP-dependent RNA helicase DBP2 [Candida albicans P37005]
 gb|KGR04494.1| ATP-dependent RNA helicase DBP2 [Candida albicans P78048]
 gb|KGU03327.1| ATP-dependent RNA helicase DBP2 [Candida albicans L26]
 gb|KGU03592.1| ATP-dependent RNA helicase DBP2 [Candida albicans 19F]
 gb|KHC71213.1| ATP-dependent RNA helicase DBP2 [Candida albicans SC5314]
 gb|KHC78195.1| ATP-dependent RNA helicase DBP2 [Candida albicans SC5314]
Length=562

 Score =   348 bits (893),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  123   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  182

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  183   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  241

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  242   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  301

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  302   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  361

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  362   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  415

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  416   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  475

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  476   SFFTEGNSKLGGDLCKIM  493



>ref|NP_001037582.1| DEAD box polypeptide 5 isoform 1 [Bombyx mori]
 gb|ABF51312.1| DEAD box polypeptide 5 isoform 1 [Bombyx mori]
Length=539

 Score =   347 bits (891),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 177/399 (44%), Positives = 260/399 (65%), Gaps = 10/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P   VL     ++EE R    V V+     NP    ++ F +      + + +    Y
Sbjct  72    YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNP----IQYFEEANFPDYVQQGVKTMGY  127

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT +QAQ  P+A+SG++L+G A+TGSGKT A+ +P I H   QPP+RRGDGP+ALVLA
Sbjct  128   KEPTPIQAQGWPIAMSGKNLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLA  187

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  +    +   V GG    +Q  +L  GV IV+ATPGRLID L+
Sbjct  188   PTRELAQQIQQVAADFGHT-SYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLE  246

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E++ LA++Y
Sbjct  247   KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDY  306

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L D +++ +G++  S   N+ QI++   E+EK ++ L++L++E  Q+++ G   + TI+F
Sbjct  307   LGDYIQINIGSLQLSANHNILQIVDICQEHEKENK-LNVLLQEIGQSQEPG---AKTIIF  362

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K K E ++  + + G  A  +HG ++Q ER+  L  F+ G  SILVATDVA+RGLDV
Sbjct  363   VETKRKAENISRNIRRYGWPAVCMHGDKTQQERDEVLYQFKEGRASILVATDVAARGLDV  422

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             +G+ +VIN D P + EDY+HRIGRTGR+ S G + +F+T
Sbjct  423   DGIKYVINFDYPNSSEDYIHRIGRTGRSKSKGTSYAFFT  461



>gb|KHC67218.1| ATP-dependent RNA helicase DBP2 [Candida albicans P78042]
Length=563

 Score =   348 bits (893),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  124   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  183

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  184   LPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECSKFGKS-SRIRNTCVYGGAPKG  242

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  243   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  302

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  303   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  362

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  363   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  416

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  417   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  476

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  477   SFFTEGNSKLGGDLCKIM  494



>ref|XP_002067737.1| GK12550 [Drosophila willistoni]
 gb|EDW78723.1| GK12550 [Drosophila willistoni]
Length=800

 Score =   355 bits (910),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 244/364 (67%), Gaps = 8/364 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P  +F +      +M ++    +  PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ 
Sbjct  130   PTPSIAFEEGGFPDYVMNEVRKQGFAKPTAIQAQGWPIALSGRDLVGVAQTGSGKTLAYI  189

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P + H   QP L RGDGP+ALVLAPTRELAQQI+     F  S    +   + GG   G
Sbjct  190   LPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVASEFG-SNTQVRNTCIFGGAPKG  248

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV IV+ATPGRLID L++G TSL R +++VLDEADRMLDMGFEPQIR++M  
Sbjct  249   QQARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQ  308

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    Q L++SAT P E+  LA+E+L + ++V +G++S S   N+ QI++   E+EKI +
Sbjct  309   IRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNIRQIVDVCDESEKIVK  368

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L++LL + SA++E      + TI+FVE K + +E+   + +QG  A A+HG +SQ ER+ 
Sbjct  369   LINLLTDISAESE------TKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDF  422

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L  FR G  SILVATDVA+RGLDV+ V  VIN D P   EDYVHRIGRTGR+ +TG A 
Sbjct  423   VLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAY  482

Query  813   SFYT  802
             + +T
Sbjct  483   TLFT  486



>gb|ERL93297.1| hypothetical protein D910_10592 [Dendroctonus ponderosae]
Length=568

 Score =   348 bits (892),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 245/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
             +N  P P+++F +      +++++    Y  PT +Q+Q  P+ALSGRD++G A+TGSGKT
Sbjct  121   TNEVPNPIQNFEEASFPDYVLQEVHNQGYDFPTPIQSQGWPIALSGRDMVGIAQTGSGKT  180

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGG  1543
              A+ +P I H   QP L  G+GP+ALVLAPTRELAQQI+     F RS    +   V GG
Sbjct  181   LAYILPAIVHIKNQPRLSPGEGPIALVLAPTRELAQQIQQVANDFGRS-SYIRNTCVFGG  239

Query  1542  TNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  1363
                G Q  +L  GV I +ATPGRLID L++G+T+L+R +++VLDEADRMLDMGFEPQIR+
Sbjct  240   APKGPQARDLERGVEICIATPGRLIDFLEKGSTNLARCTYLVLDEADRMLDMGFEPQIRK  299

Query  1362  VMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENE  1186
             ++  +    QTL++SAT P E+  LA +++TD + + VG++  S   N+ QI++   E+E
Sbjct  300   IIEQIRPDRQTLMWSATWPKEVMRLASDFMTDFITINVGSLQLSANHNILQIVDVCQEHE  359

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K  +L  LL E    AE    P +  I+FVE K K E++   L + G  A  +HG +SQ 
Sbjct  360   KEFKLNQLLQEIGNNAE----PGAKVIIFVETKKKVEQITRNLKRYGWSALCMHGDKSQQ  415

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             ER+  L+DFR G ++ILVATDVA+RGLDV G+ +VIN D P + EDY+HRIGRT R+ +T
Sbjct  416   ERDYVLKDFRMGKSTILVATDVAARGLDVEGIKYVINYDYPNSSEDYIHRIGRTARSDTT  475

Query  825   GQATSFYT  802
             G + +F+T
Sbjct  476   GTSYAFFT  483



>ref|XP_001997052.1| GH22580 [Drosophila grimshawi]
 gb|EDV90436.1| GH22580 [Drosophila grimshawi]
Length=793

 Score =   354 bits (909),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 243/372 (65%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P P   F +      +M +I    +T PT++QAQ MP+ALSGRDL+  A+TG
Sbjct  134   ITIKGQEVPTPSIEFEEGGFPDYVMNEIRKQGFTKPTAIQAQGMPIALSGRDLVAVAQTG  193

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P + H   QP L RGDGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  194   SGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQAVASEFG-SNTQVRNTC  252

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G TSL R +++VLDEADRMLDMGFEP
Sbjct  253   IFGGAPKGQQARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEP  312

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR++M  +    Q L++SAT P E+  LA+E+L + ++V +G++S S   N+ QI++  
Sbjct  313   QIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVC  372

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EKI +L+ LL + S + E      + TI+FVE K + +E+   + +QG  A A+HG 
Sbjct  373   DESEKIAKLVQLLTQISGENE------TKTIIFVETKKRVDEITRNISRQGWRACAIHGD  426

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L  FR G  SILVATDVA+RGLDV+ V  VIN D P   EDYVHRIGRTGR
Sbjct  427   KSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGR  486

Query  837   AGSTGQATSFYT  802
             + +TG A + +T
Sbjct  487   SNNTGTAYTLFT  498



>ref|XP_004179875.1| hypothetical protein TBLA_0C05580 [Tetrapisispora blattae CBS 
6284]
 emb|CCH60356.1| hypothetical protein TBLA_0C05580 [Tetrapisispora blattae CBS 
6284]
Length=540

 Score =   347 bits (889),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 185/433 (43%), Positives = 272/433 (63%), Gaps = 16/433 (4%)
 Frame = -3

Query  2046  NYLSPRGLVAPD-----PVFPQWKPSERVL--LFKLEQIEEIRLRLNVDVAVAMDSNPAP  1888
             NY  P+ LV PD     P  P ++ +  V   + K    EEI  +   +  + +  +  P
Sbjct  51    NYNQPQELVRPDWDAELPNLPAFEKNFYVEHEVVKNRSDEEIS-KFRKENEMTISGHDIP  109

Query  1887  APVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTI  1708
              P+ +F +      ++ ++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ +
Sbjct  110   KPITNFDEAGFPDYVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCL  169

Query  1707  PMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGD  1528
             P I H  AQP L  GDGP+ LVL+PTRELA QI+ E   F +S    +   V GG   G 
Sbjct  170   PGIVHINAQPLLAPGDGPIVLVLSPTRELAVQIQKECSKFGKS-SRIRNTCVYGGVPKGQ  228

Query  1527  QRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNL  1348
             Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  +
Sbjct  229   QIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQI  288

Query  1347  PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRL  1171
                 QTL++SAT P E++ LA++YL DP++V++G++  + +  + Q++E + + EK DR+
Sbjct  289   RPDRQTLMWSATWPKEVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRDRM  348

Query  1170  LDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAA  991
             +  L  E A  +K     S  +VF   K  C+E+ + L + G  A A+HG + Q ER+  
Sbjct  349   VKHL--EVASQDKE----SKILVFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWV  402

Query  990   LRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATS  811
             L +FR G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+TG A S
Sbjct  403   LAEFREGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAIS  462

Query  810   FYTDRDMYLVAQI  772
             F+T+ +  L A +
Sbjct  463   FFTEENKSLGASL  475



>ref|XP_003955888.1| hypothetical protein KAFR_0B04560 [Kazachstania africana CBS 
2517]
 emb|CCF56753.1| hypothetical protein KAFR_0B04560 [Kazachstania africana CBS 
2517]
Length=543

 Score =   347 bits (889),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 189/434 (44%), Positives = 271/434 (62%), Gaps = 26/434 (6%)
 Frame = -3

Query  2034  PRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMDSNPA  1891
             P+ LVAP+     P  P ++ +     F +E  E++R R + DVA       + +  +  
Sbjct  52    PQELVAPNWEEELPRLPSFEKN-----FYVEH-EDVRNRSDADVAKFRQENEMTISGHDI  105

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      ++K++    +  PTS+Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  106   PKPITNFEEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYC  165

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVL+PTRELA QI+ E   F  S    +   V GG   G
Sbjct  166   LPGIVHINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGHS-SRIRNTCVYGGVPKG  224

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  G  IV+ATPGRLID ++ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  225   QQIRDLVRGAEIVIATPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  284

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E+  LA +YL DP++V+VG++  S + N+ Q++E + + EK DR
Sbjct  285   IRPDRQTLMWSATWPKEVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDR  344

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L   L  E A  +K     S  +VF   K  C+++ + L   G  A A+HG + Q ER+ 
Sbjct  345   LSKHL--EIASEDKD----SKILVFASTKRTCDDITKYLRADGWPALAIHGDKDQKERDW  398

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR G + I+VATDVA+RG+DV G+  VIN D+P  +EDYVHRIGRTGRAG+ G A 
Sbjct  399   VLNEFRCGRSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAI  458

Query  813   SFYTDRDMYLVAQI  772
             SF+T+ +  L A++
Sbjct  459   SFFTEDNKSLGAKL  472



>ref|XP_001604593.1| PREDICTED: ATP-dependent RNA helicase p62 isoform X2 [Nasonia 
vitripennis]
Length=551

 Score =   347 bits (890),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 242/372 (65%), Gaps = 6/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  +  P P++ F +      +M+ I    Y+ PT +QAQ  P+A+SG++++G A+TG
Sbjct  113   ITLKGDKVPNPIQFFEEGNFPDYVMQGIKKQGYSEPTPIQAQGWPIAMSGKNMVGIAQTG  172

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P I H  +Q PL RGDGP+AL+LAPTRELAQQI+T    F  SL   +   
Sbjct  173   SGKTLAYILPAIVHINSQQPLNRGDGPIALILAPTRELAQQIQTVASDFG-SLSYVRNTC  231

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  232   IFGGAPKGGQARDLERGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEP  291

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E+  LA+EYL D  ++ +G++  +   N+ QI++  
Sbjct  292   QIRKIIEQIRPDRQVLMWSATWPKEVRMLAEEYLVDYTQLNIGSLQLAANHNILQIIDVC  351

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E EK  +L  LL E     +  G     TI+FVE K K E +   + + G  A  +HG 
Sbjct  352   QEQEKETKLGTLLQEIGNVNDDGGK----TIIFVETKKKVENITRNIRRYGWPAVCMHGD  407

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  LR+FR    SILVATDVA+RGLDV+ V +VIN D P + EDY+HRIGRTGR
Sbjct  408   KSQQERDYVLREFRNKKGSILVATDVAARGLDVDDVRYVINFDYPSSSEDYIHRIGRTGR  467

Query  837   AGSTGQATSFYT  802
             + S+G + +F+T
Sbjct  468   SQSSGTSYAFFT  479



>ref|XP_003745440.1| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Metaseiulus 
occidentalis]
Length=510

 Score =   345 bits (886),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/410 (44%), Positives = 253/410 (62%), Gaps = 17/410 (4%)
 Frame = -3

Query  2001  PQWK----PSERVLLFKLEQIEEIRLRLNVDV-----AVAMDSNPAPAPVESFTDMCLHP  1849
             P+W     P  +   ++  +I + R   +VD+      + +     P P+ +F ++ L P
Sbjct  39    PRWDMERLPPFQKDFYRENEITQSRSSADVDLFLQNNEITLSGRGVPKPILTFQEIELPP  98

Query  1848  SIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLR  1669
              ++  I    Y  PT +QAQ  P+ALSGRDL+G A+TGSGKT AF +P I H   QP L+
Sbjct  99    DVVVVIQEQKYQAPTCIQAQGWPIALSGRDLVGIAQTGSGKTLAFILPAIIHIQNQPRLQ  158

Query  1668  RGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVV  1489
             RGDGP+ALVLAPTRELAQQI+T    F R     +   V GG   G Q  +L  GV I +
Sbjct  159   RGDGPIALVLAPTRELAQQIQTVADTFGRPA-GVRNTCVFGGAPKGPQLRDLERGVEICI  217

Query  1488  ATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATM  1309
             ATPGRLID L+ G T L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT 
Sbjct  218   ATPGRLIDFLEAGKTDLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATW  277

Query  1308  PAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEK  1132
             P E+++LA+++L D +++ +G +  S    + QI++   E+EK  +L++LL E   + E 
Sbjct  278   PKEVKSLAEDFLKDYIQINIGALQLSANHRILQIIDVCSESEKDSKLINLLEEIMNEKEN  337

Query  1131  SGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
                    TIVF E K K +E+   + + G  A  +HG ++Q ER+  L +FR G + ILV
Sbjct  338   K------TIVFAETKRKVDEITRRMRRDGWPAMCIHGDKAQQERDWVLHEFRSGKSPILV  391

Query  951   ATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             ATDVA+RGLDV+ V  VIN D P   EDYVHRIGRT R+  TG A +F+T
Sbjct  392   ATDVAARGLDVDDVKFVINYDYPNCSEDYVHRIGRTARSNKTGTAYTFFT  441



>ref|XP_456137.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 sp|Q6CIV2.1|DBP2_KLULA RecName: Full=ATP-dependent RNA helicase DBP2 [Kluyveromyces 
lactis NRRL Y-1140]
 emb|CAG98845.1| KLLA0F23716p [Kluyveromyces lactis]
Length=554

 Score =   347 bits (890),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/431 (43%), Positives = 271/431 (63%), Gaps = 18/431 (4%)
 Frame = -3

Query  2025  LVAPD--------PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESF  1870
             LVAP+        PVF +    E   + ++ + E I  R   ++ ++   +  P P+ SF
Sbjct  58    LVAPNWDEELPNLPVFEKNFYQEHPDVAQMSESEVIEFRKENEMTIS--GHDVPKPIRSF  115

Query  1869  TDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC  1690
              +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ +P I H 
Sbjct  116   DEAGFPSYVLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHI  175

Query  1689  LAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELR  1510
              AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V GG     Q  +L+
Sbjct  176   NAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGAS-SRIRNTCVYGGVPKSQQIRDLQ  234

Query  1509  AGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQT  1330
              GV I++ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  +    QT
Sbjct  235   RGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQT  294

Query  1329  LLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVE  1153
             L++SAT P E++ LA +YL DP++V++G++  S +  + QI+E + + EK DRL   L  
Sbjct  295   LMWSATWPKEVKQLASDYLHDPIQVQIGSLELSASHTITQIVEVLTDFEKRDRLAKHL--  352

Query  1152  ESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRR  973
             E+A  ++     S  I+F   K  C+E+   L  +G  A A+HG ++Q+ER+  L +FR 
Sbjct  353   ETASQDQD----SKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRS  408

Query  972   GPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRD  793
             G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAGSTG A SF+T+ +
Sbjct  409   GRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFTEGN  468

Query  792   MYLVAQIRKAI  760
               L A + K +
Sbjct  469   KSLGAALIKIM  479



>ref|XP_001862487.1| ATP-dependent RNA helicase p62 [Culex quinquefasciatus]
 gb|EDS37092.1| ATP-dependent RNA helicase p62 [Culex quinquefasciatus]
Length=935

 Score =   357 bits (917),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 263/387 (68%), Gaps = 11/387 (3%)
 Frame = -3

Query  1953  IEEIRL-RLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++E++L R N+ V V    N  P P ++F +      ++ +I    +  PT++QAQ  P+
Sbjct  229   VDEVQLFRENMQVTVM--GNTVPHPTQTFDEGNFPEFVINEINKQGFPSPTAIQAQGWPI  286

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSGRD++G A+TGSGKT A+ +P I H   Q PL+RGDGP+ LVLAPTRELAQQI+T V
Sbjct  287   ALSGRDMVGIAQTGSGKTLAYMLPAIVHIAHQKPLQRGDGPIVLVLAPTRELAQQIQTVV  346

Query  1596  KAF-SRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
             + F + S  + +   + GG   G Q  +L  GV +V+ATPGRLID L++G T+L R +++
Sbjct  347   RDFGTHSKPNIRYTCIFGGALKGPQVRDLERGVEVVIATPGRLIDFLERGITNLRRCTYL  406

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGFEPQIR+++  +    Q L++SAT P E++ALA+++L D +++ VG++
Sbjct  407   VLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLHDYIQINVGSL  466

Query  1239  S-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
             + S   N+ QI++   ENEK  +LL LL E ++            I+FVE K K E++ +
Sbjct  467   NLSANHNIHQIVDICEENEKEGKLLSLLKEIASDVNNK------IIIFVETKKKVEDLLK  520

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              +++ G  AT++HG +SQSER+  L+DFR G ++ILVATDVA+RGLDV  V +VIN D P
Sbjct  521   NIVRDGYGATSIHGDKSQSERDYVLQDFRHGKSTILVATDVAARGLDVEDVKYVINFDYP  580

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              + EDY+HRIGRTGR  S G A +F+T
Sbjct  581   NSSEDYIHRIGRTGRCSSFGTAYTFFT  607



>ref|XP_005189172.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Musca 
domestica]
Length=927

 Score =   357 bits (916),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/400 (45%), Positives = 265/400 (66%), Gaps = 6/400 (2%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P +  L    +Q+ E+R  L + V+     N  P P+ SF +  L    ++++    +
Sbjct  177   YNPHQNTLNMSEQQVAEMRAELQITVS----GNEIPHPIGSFEECTLPEYTIEEMKRQGF  232

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
             T PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P + H   QPPL+RG+GP+ALVLA
Sbjct  233   TKPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYMLPAMVHIANQPPLQRGEGPIALVLA  292

Query  1635  PTRELAQQIETEVKAFSR-SLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHL  1459
             PTRELAQQI++ V+ F        +   + GG++   Q  +L  GV +++ATPGRLID L
Sbjct  293   PTRELAQQIQSVVRDFGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFL  352

Query  1458  QQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQE  1279
             +   T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA +
Sbjct  353   ENRTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGD  412

Query  1278  YLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIV  1102
             +L D +++ +G+++ S   N+ QI+E   ENEK  R++ LL E       + +  +  I+
Sbjct  413   FLNDYIQINIGSMNLSANHNIRQIVEVCQENEKPQRIVKLLNEILPTTNNAANNSNKIII  472

Query  1101  FVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLD  922
             FVE K K EE+ + +  +G  AT++HG +SQ+ER++ L+DFR G ++IL+ATDVASRGLD
Sbjct  473   FVETKIKVEEILQIIRNEGYTATSIHGDKSQAERDSTLKDFRNGKSNILIATDVASRGLD  532

Query  921   VNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             V  + +VIN D P + E+YVHRIGRTGR    G A +F+T
Sbjct  533   VEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFT  572



>ref|XP_002135340.1| GA28491 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY73967.1| GA28491 [Drosophila pseudoobscura pseudoobscura]
Length=537

 Score =   346 bits (887),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 185/417 (44%), Positives = 263/417 (63%), Gaps = 23/417 (6%)
 Frame = -3

Query  1998  QWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHD  1819
             Q +PS  V LF+ +    IR               AP P++ F ++C     M++I    
Sbjct  76    QSRPSHEVELFRRQHQIAIR-------------GQAPNPIQFFEEVCFPDYCMEEIRRQR  122

Query  1818  YTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVL  1639
             Y+ PT +QAQA P+ALSG +L+G A+TGSGKT AF +P I H   Q PL+RG+GP+ALVL
Sbjct  123   YSEPTPIQAQAWPIALSGHNLVGIAKTGSGKTLAFILPAILHINGQQPLQRGEGPIALVL  182

Query  1638  APTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHL  1459
             APTRELAQQI++    F  S    +   V GG     Q S+L+ GV I++ATPGRL+D L
Sbjct  183   APTRELAQQIQSVANDFGSSA-FVRNTCVFGGAPRSKQASDLKRGVEIIIATPGRLLDFL  241

Query  1458  QQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQE  1279
             Q G T+L R +++VLDEADRMLDMGFEPQIR+V+  +    Q L++SAT P E+  LA++
Sbjct  242   QSGATNLRRCTYLVLDEADRMLDMGFEPQIRKVLGQIRPDRQILMWSATWPKEVRQLAED  301

Query  1278  YLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIV  1102
             +L   +++ +G++  S   N+ Q +E   E+EK  +L DLL     QA   G      I+
Sbjct  302   FLGSYIQINIGSLELSANHNIRQYVEVCGEHEKSAKLKDLLSHIYDQAHAPGK----III  357

Query  1101  FVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLD  922
             FV  K K +E+A  +   G+   ++HG +SQ +R++ L DFR G  +ILVATDVA+RGLD
Sbjct  358   FVATKKKTDELARFINAFGVSVGSIHGDKSQMDRDSVLNDFRSGRANILVATDVAARGLD  417

Query  921   VNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADV  751
             V+G+ +VIN D P++ EDY+HRIGRTGR  S G + +F+T ++    A+  +A+ D+
Sbjct  418   VDGIKYVINFDYPQSSEDYIHRIGRTGRKLSKGTSYAFFTRKN----ARCARALIDI  470



>sp|Q0DB53.2|RH52A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52A [Oryza 
sativa Japonica Group]
 dbj|BAD35456.1| putative DEAD-box protein 3 [Oryza sativa Japonica Group]
 gb|EEE65977.1| hypothetical protein OsJ_21891 [Oryza sativa Japonica Group]
Length=602

 Score =   348 bits (893),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 188/395 (48%), Positives = 253/395 (64%), Gaps = 16/395 (4%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V +     P P + F    L  ++++++A   Y  PT VQ  +MP+AL+GRDL+ CA
Sbjct  69    DIPVEVSGEDVPPPADGFEAAGLVEAVLRNVARCGYESPTPVQRYSMPIALAGRDLMACA  128

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPL-----------RRGDGPLALVLAPTRELAQQIETEV  1597
             +TGSGKTAAF +P++   +A               R    P ALVLAPTRELA QI  E 
Sbjct  129   QTGSGKTAAFCLPVVSGLVAAGGSGIGHRERSSFNRAAAKPRALVLAPTRELAAQINEEA  188

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
             K FS      +  +  GGT + +Q  +L  G +I+VATPGRL+D +++   SL  I ++V
Sbjct  189   KKFSFQT-GLRVVVAYGGTPMYNQLRDLERGADILVATPGRLVDMVERSKVSLEAIKYLV  247

Query  1416  LDEADRMLDMGFEPQIREVMH--NLPKK--HQTLLFSATMPAEIEALAQEYLTDPVRVKV  1249
             +DEADRMLDMGFEPQIR+++   N+P+K   QT+LFSAT P EI+ LA ++L++ + + V
Sbjct  248   MDEADRMLDMGFEPQIRKIVERMNMPRKSVRQTMLFSATFPPEIQRLASDFLSNYIFITV  307

Query  1248  GNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEV  1069
             G V S T  + Q +E + + EK   LLDLL  +S     S     LT+VFVE K + + +
Sbjct  308   GRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKREADSL  367

Query  1068  AEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLD  889
                L  +G  ATA+HG R+Q ERE+ALR F+ G T I+VATDVASRGLDV  VAHVIN D
Sbjct  368   RYWLYSKGFPATAIHGDRTQQERESALRSFKTGLTPIMVATDVASRGLDVPNVAHVINYD  427

Query  888   LPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYL  784
             LPK++EDYVHRIGRTGRAG  G AT+F+T+ D  L
Sbjct  428   LPKSIEDYVHRIGRTGRAGKAGSATAFFTESDHSL  462



>gb|KDR17554.1| ATP-dependent RNA helicase p62 [Zootermopsis nevadensis]
Length=560

 Score =   347 bits (889),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/407 (44%), Positives = 260/407 (64%), Gaps = 17/407 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R    + V        AP P++ F ++     ++ +I    +  PT++Q Q  P+
Sbjct  111   EVEEFRATHQITV-----KGDAPNPIQCFEEVNFPEYVVDEIRKSGFETPTAIQCQGWPI  165

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             A+SG D++G A+TGSGKT A+ +P   H   Q  L RGDGP+ALVLAPTRELAQQI+T  
Sbjct  166   AMSGHDMVGIAQTGSGKTLAYILPATVHINNQEQLSRGDGPIALVLAPTRELAQQIQTIT  225

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
             +AF  S    +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++V
Sbjct  226   QAFGSS-SYIRNTCIFGGAPKGPQARDLERGVEICIATPGRLIDFLERGTTNLKRCTYLV  284

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             +DEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+E+L + V+V VG++ 
Sbjct  285   VDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVRNLAEEFLNNYVQVNVGSLQ  344

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              +   N+ QI++   E+EK  +L  LL E +++ E        TI+FVE K K E +  +
Sbjct  345   LAANHNIMQIVDVCEEHEKEQKLATLLDEIASEEENK------TIIFVETKKKVENITRS  398

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG +SQ ER+  LR+FR G + ILVATDVA+RGLDV+G+ +VIN D P 
Sbjct  399   IRRYGYPAVCMHGDKSQHERDYVLREFRNGKSPILVATDVAARGLDVDGIKYVINFDYPN  458

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYTDRDMY----LVAQIRKAIADV  751
             + EDY+HRIGRTGR  +TG + +F+T  +      LV+ +R+A  +V
Sbjct  459   SSEDYIHRIGRTGRRNTTGTSYAFFTPNNSRQAKDLVSVLREANQEV  505



>ref|XP_002010212.1| GI14822 [Drosophila mojavensis]
 gb|EDW07529.1| GI14822 [Drosophila mojavensis]
Length=963

 Score =   357 bits (917),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/409 (44%), Positives = 270/409 (66%), Gaps = 11/409 (3%)
 Frame = -3

Query  2001  PQWK---PSERVLLF----KLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSI  1843
             PQW+   P ++         + + E+    +  ++ + +  N  P PV +F +  L P I
Sbjct  188   PQWENLAPFQKDFYIMHPNTMNRSEQAVAEMRHELEITVSGNELPHPVANFEESSLPPHI  247

Query  1842  MKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRG  1663
             + ++    +T PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P I H   QPPL RG
Sbjct  248   IDEMKRQGFTKPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHISNQPPLMRG  307

Query  1662  DGPLALVLAPTRELAQQIETEVKAFSRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVA  1486
             +GP+ALVLAPTRELAQQI++ V+ +        +   + GG++   Q  +L  GV +++A
Sbjct  308   EGPIALVLAPTRELAQQIQSVVRDYGHLCKPEIRHTCIFGGSSKVPQARDLERGVEVIIA  367

Query  1485  TPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMP  1306
             TPGRLID L+  NT+L R +++VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P
Sbjct  368   TPGRLIDFLENRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWP  427

Query  1305  AEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKS  1129
              E++ALA ++L D +++ +G+++ S   N+ QI+E   ENEK   L+ LL E ++ +   
Sbjct  428   KEVQALAGDFLNDYIQINIGSMNLSANHNIRQIVEICNENEKPQLLVRLLKEITSPSNNG  487

Query  1128  GHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVA  949
             G   +  I+FVE K K E++ + +  +G +AT++HG +SQSER++ L+DFR G ++IL+A
Sbjct  488   GS--NKIIIFVETKIKVEDILQIIRNEGYVATSIHGDKSQSERDSVLKDFRNGKSNILIA  545

Query  948   TDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             TDVASRGLDV  + +VIN D P + E+YVHRIGRTGR    G A +F+T
Sbjct  546   TDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFT  594



>emb|CAA93395.1| RNA elicase [Saccharomyces cerevisiae]
Length=547

 Score =   346 bits (888),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/439 (43%), Positives = 273/439 (62%), Gaps = 27/439 (6%)
 Frame = -3

Query  2046  NYLSPRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMD  1903
             NY  P+ L+ P+     P  P ++ +     F +E  E +R R + ++A       + + 
Sbjct  51    NYNQPQELIKPNWDEELPKLPTFEKN-----FYVEH-ESVRDRSDSEIAQFRKENEMTIS  104

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
              +  P P+ +F +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT
Sbjct  105   GHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKT  164

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGG  1543
              ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+TE   F  S    +   V GG
Sbjct  165   LSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHS-SRIRNTCVYGG  223

Query  1542  TNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  1363
                  Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+
Sbjct  224   VPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRK  283

Query  1362  VMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENE  1186
             ++  +    QTL++SAT P E++ LA +YL DP++V+VG++  S + N+ QI+E V + E
Sbjct  284   IVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFE  343

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K DRL   L   S   E        T++F   K  C+++ + L + G  A A+HG + Q 
Sbjct  344   KRDRLNKYLETASQDNEYK------TLIFASTKRMCDDITKYLREDGWPALAIHGDKDQR  397

Query  1005  EREAALRDFRRGPTSILVATDVASRGL-DVNGVAHVINLDLPKTMEDYVHRIGRTGRAGS  829
             ER+  L++FR G + I+VATDVA+RG+ +V G+ +VIN D+P  +EDYVHRIGRTGRAG+
Sbjct  398   ERDWVLQEFRNGRSPIMVATDVAARGIGNVKGINYVINYDMPGNIEDYVHRIGRTGRAGA  457

Query  828   TGQATSFYTDRDMYLVAQI  772
             TG A SF+T+++  L A++
Sbjct  458   TGTAISFFTEQNKGLGAKL  476



>gb|EEQ43358.1| hypothetical protein CAWG_01593 [Candida albicans WO-1]
Length=562

 Score =   347 bits (889),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 247/378 (65%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      +++++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  124   PHPITTFDEAGFPDYVLQEVKDQGFPKPTPIQCQGWPMALSGRDMIGIAATGSGKTLSYC  183

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ LVLAPTREL  QI+TE   F +S    +   V GG   G
Sbjct  184   LPSIVHINAQPQLQYGDGPIVLVLAPTRELTVQIQTECSKFGKS-SRIRNTCVYGGAPKG  242

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  243   PQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  302

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + Q++E + E  K DR
Sbjct  303   IRPDRQTLMWSATWPKEVQQLTRDYLNDPIQVTIGSLELAASHTITQLVEVIDEFSKRDR  362

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  ESA  EK        +VF   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  363   LVKHL--ESALNEKDNK----ILVFASTKRTCDEITTYLRSDGWPALAIHGDKEQNERDW  416

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR+G TSI+VATDVA+RG+DV G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  417   VLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVHRIGRTGRGGASGTAI  476

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  477   SFFTEGNSKLGGDLCKIM  494



>gb|EEU08734.1| Dbp2p [Saccharomyces cerevisiae JAY291]
Length=547

 Score =   346 bits (887),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/439 (43%), Positives = 273/439 (62%), Gaps = 27/439 (6%)
 Frame = -3

Query  2046  NYLSPRGLVAPD-----PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVA-------VAMD  1903
             NY  P+ L+ P+     P  P ++ +     F +E  E +R R + ++A       + + 
Sbjct  51    NYNQPQELIKPNWDEELPKLPTFEKN-----FYVEH-ESVRDRSDSEIAQFRKENEMTIS  104

Query  1902  SNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKT  1723
              +  P P+ +F +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT
Sbjct  105   GHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKT  164

Query  1722  AAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGG  1543
              ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+TE   F  S    +   V GG
Sbjct  165   LSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHS-SRIRNTCVYGG  223

Query  1542  TNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIRE  1363
                  Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+
Sbjct  224   VPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRK  283

Query  1362  VMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENE  1186
             ++  +    QTL++SAT P E++ LA +YL DP++V+VG++  S + N+ QI+E V + E
Sbjct  284   IVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFE  343

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K DRL   L   S   E        T++F   K  C+++ + L + G  A A+HG + Q 
Sbjct  344   KRDRLNKYLETASQDNEYK------TLIFASTKRMCDDITKYLREDGWPALAIHGDKDQR  397

Query  1005  EREAALRDFRRGPTSILVATDVASRGL-DVNGVAHVINLDLPKTMEDYVHRIGRTGRAGS  829
             ER+  L++FR G + I+VATDVA+RG+ +V G+ +VIN D+P  +EDYVHRIGRTGRAG+
Sbjct  398   ERDWVLQEFRNGRSPIMVATDVAARGIGNVKGINYVINYDMPGNIEDYVHRIGRTGRAGA  457

Query  828   TGQATSFYTDRDMYLVAQI  772
             TG A SF+T+++  L A++
Sbjct  458   TGTAISFFTEQNKGLGAKL  476



>ref|XP_002007182.1| GI12524 [Drosophila mojavensis]
 gb|EDW17658.1| GI12524 [Drosophila mojavensis]
Length=602

 Score =   347 bits (891),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/368 (48%), Positives = 246/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
             AP P+ SF + C     M +I    Y  PT +QAQA P+ LSG +L+G A+TGSGKT AF
Sbjct  104   APNPIRSFDETCFPDYCMNEIRRQRYIEPTPIQAQAWPIVLSGNNLVGIAKTGSGKTLAF  163

Query  1713  TIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNI  1534
              +P I H   QP L+RGDGP+ALV+APTRELAQQI+T    F  S    +   + GG   
Sbjct  164   ILPAIVHINGQPTLKRGDGPIALVVAPTRELAQQIQTVANDFGSS-SYVRNTCIFGGAPR  222

Query  1533  GDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMH  1354
               Q S+L+ GV IV+ATPGRL+D LQ G T+L R +++VLDEADRMLDMGFEPQIR+++ 
Sbjct  223   SKQASDLQNGVEIVIATPGRLLDFLQSGTTNLRRCTYLVLDEADRMLDMGFEPQIRKILS  282

Query  1353  NLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKID  1177
              +    Q L++SAT P E+  LA+++L + +++ +G++  S   N+ Q ++   E+EK  
Sbjct  283   QIRPDRQILMWSATWPKEVRQLAEDFLGNYIQINIGSLELSANHNIRQYVDVCAEHEKGS  342

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
             +L DLL   S   ++SG P  + I+FV  K K +E+A  +   G+   ++HG +SQ +R+
Sbjct  343   KLKDLL---SHIYDQSGMPGKI-IIFVATKKKVDELARFINAFGVGVGSIHGDKSQMDRD  398

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
               L DFR G  +ILVATDVA+RGLDV+G+ +VIN D P++ EDY+HRIGRTGR  STG +
Sbjct  399   NVLNDFRSGRANILVATDVAARGLDVDGIKYVINFDFPQSSEDYIHRIGRTGRKHSTGTS  458

Query  816   TSFYTDRD  793
              +F+T ++
Sbjct  459   YAFFTRKN  466



>ref|NP_985329.2| AFL221Cp [Ashbya gossypii ATCC 10895]
 sp|Q755N4.2|DBP2_ASHGO RecName: Full=ATP-dependent RNA helicase DBP2 [Ashbya gossypii 
ATCC 10895]
 gb|AAS53153.2| AFL221Cp [Ashbya gossypii ATCC 10895]
 gb|AEY97463.1| FAFL221Cp [Ashbya gossypii FDAG1]
Length=557

 Score =   346 bits (887),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 248/374 (66%), Gaps = 8/374 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      ++K++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  110   PKPIRTFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYC  169

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F RS    +   V GG    
Sbjct  170   LPGIVHINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKFGRS-SRIRNTCVYGGVPKS  228

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L+ GV I++ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  229   QQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  288

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA++YL DP++V +G++  + +  + Q++E V + +K DR
Sbjct  289   IRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQLVEVVSDFDKRDR  348

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  E A  +K     S  I+F   K  C+E+   L + G  A A+HG + Q ER+ 
Sbjct  349   LVKHL--EIASKDKD----SKIIIFASTKRTCDEITSYLRQDGWPALAIHGDKQQQERDW  402

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR G + I+VATDVA+RG+DV G+  VIN D+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  403   VLNEFRTGRSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAI  462

Query  813   SFYTDRDMYLVAQI  772
             SF+T+ +  L AQ+
Sbjct  463   SFFTEANKTLGAQL  476



>ref|XP_002108975.1| hypothetical protein TRIADDRAFT_63563 [Trichoplax adhaerens]
 gb|EDV29773.1| hypothetical protein TRIADDRAFT_63563 [Trichoplax adhaerens]
Length=654

 Score =   349 bits (895),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/381 (48%), Positives = 247/381 (65%), Gaps = 12/381 (3%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P PV SF++      +M +I    + +PT +QAQ+ PV LSGRD++G A+TGSGKT A+ 
Sbjct  75    PKPVLSFSEASFPDYVMSEINNQGFKLPTPIQAQSWPVGLSGRDVVGIAQTGSGKTLAYV  134

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H   QPPLR GDGP+AL+L PTRELAQQ+ +    F R L     A + GG+  G
Sbjct  135   LPSIIHIKNQPPLRHGDGPIALILCPTRELAQQVHSVSTTFGR-LARINCACIYGGSPKG  193

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  EL  GV I VATPGRL+D L+   T+L+R S++VLDEADRMLDMGFEPQI++++ +
Sbjct  194   PQLRELSRGVEICVATPGRLLDFLESRRTNLNRCSYLVLDEADRMLDMGFEPQIKQIIGS  253

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTA-NVAQILEKVPENEKIDR  1174
             +    QT+++SAT P EI  LA+E+L D V++ +G+    T  N+ QI+E   E EK D+
Sbjct  254   IKCPRQTVMWSATWPKEIRTLAREFLRDYVQINIGSSDLTTNHNIKQIVEVCREEEKEDK  313

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L  LL +   Q EK       TIVFVE K K + ++  L++ G     +HG + QSER+ 
Sbjct  314   LCKLLSDILRQDEKK------TIVFVETKKKSDYLSRRLVRSGWPVLCIHGDKCQSERDR  367

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR G   +L+ATDVA+RGLD++ V  VIN D P   EDYVHRIGRT R+G TG A 
Sbjct  368   VLSEFRSGRIPVLIATDVAARGLDISDVKLVINYDFPNNSEDYVHRIGRTARSGKTGTAY  427

Query  813   SFYTDRDMY----LVAQIRKA  763
             +F+T  ++     L+A +R+A
Sbjct  428   TFFTASNIRQSPNLIALLREA  448



>ref|XP_003682141.1| hypothetical protein TDEL_0F01190 [Torulaspora delbrueckii]
 emb|CCE92930.1| hypothetical protein TDEL_0F01190 [Torulaspora delbrueckii]
Length=549

 Score =   345 bits (886),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 172/365 (47%), Positives = 240/365 (66%), Gaps = 8/365 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ SF +      ++K++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  105   PKPITSFDEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYC  164

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F +S    +   V GG   G
Sbjct  165   LPSIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGKS-SRIRNTCVYGGVPRG  223

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  224   QQIRDLARGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  283

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA +YL DP++V++G++  + + N+ Q++E + + EK DR
Sbjct  284   IRPDRQTLMWSATWPKEVKQLASDYLHDPIQVQIGSLELAASHNIKQVVEVITDFEKRDR  343

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L   +   S   E      S  +VF   K  C+E+ + L   G  A A+HG + Q ER+ 
Sbjct  344   LTKHMDIASQDKE------SKILVFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDW  397

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  398   VLNEFRTGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAI  457

Query  813   SFYTD  799
             SF+T+
Sbjct  458   SFFTE  462



>ref|XP_006392681.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 ref|XP_006392682.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29967.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29968.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=429

 Score =   341 bits (875),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 256/387 (66%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             Q+EE R RL     + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P+
Sbjct  5     QVEEYR-RLR---EITVEGRDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWPM  60

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  61    ALKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAHGDGPIVLVLAPTRELAVQIQQEA  120

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++V
Sbjct  121   SKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLV  179

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ S
Sbjct  180   LDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-S  238

Query  1236  SPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN  + QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++  
Sbjct  239   DLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQITR  290

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  291   QLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFP  350

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  351   GSLEDYVHRIGRTGRAGAKGTAYTFFT  377



>gb|EFN70084.1| Probable ATP-dependent RNA helicase DDX17 [Camponotus floridanus]
Length=705

 Score =   350 bits (898),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/390 (44%), Positives = 253/390 (65%), Gaps = 8/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  97    ITVKGNNTPSPIQAFEESNFPDYVMEEIKKQGFAEPTAIQAQGWPIALSGRDLVGIAQTG  156

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RGDGP+ L+LAPTRELAQQI+T  + F  S    +   
Sbjct  157   SGKTLAYILPATVHINHQPRLNRGDGPIVLILAPTRELAQQIQTVARDFGSS-SCIRNTC  215

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  216   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEP  275

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++LTD +++ +G++S +   N+ QI+E  
Sbjct  276   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLTDYIQINIGSLSLAANHNIRQIIEIC  335

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E   +        S  I+FVE K K +++ + + + G  A ++HG 
Sbjct  336   QEHEKEYKLSQLLREIGTERG------SKMIIFVETKKKVDDITKTIKRDGWSAISIHGD  389

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR
Sbjct  390   KSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGR  449

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  450   CQSAGTAYAYFTPNNARQAKELIAVLEEAG  479



>ref|XP_004198636.1| Piso0_002019 [Millerozyma farinosa CBS 7064]
 emb|CCE82299.1| Piso0_002019 [Millerozyma farinosa CBS 7064]
Length=534

 Score =   345 bits (884),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 249/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      ++ ++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  97    PKPITTFDEASFPDYVLTEVKKQGFPSPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYC  156

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F R+    +   + GG   G
Sbjct  157   LPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQQECSKFGRT-SRIRNTCIYGGAPKG  215

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+   T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  216   PQIRDLARGVEICIATPGRLIDMLEMNKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQ  275

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA++YL DP++V+VG++  + +  + Q++E V E EK DR
Sbjct  276   IRPDRQTLMWSATWPKEVQNLARDYLNDPIQVRVGSLELAASHTITQLVEVVSEFEKRDR  335

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  E+A  +         ++F   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  336   LIKHL--ETATTDNEAK----VLIFASTKKTCDEITRYLRSDGWPALAIHGDKQQAERDW  389

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L++F+ G + I+VATDVA+RG+DV G+++VINLD+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  390   VLKEFKTGKSPIMVATDVAARGIDVKGISYVINLDMPGNIEDYVHRIGRTGRAGTTGTAV  449

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+T+ +  L   + K +
Sbjct  450   SFFTEANSKLGGDLCKIM  467



>ref|XP_008209140.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nasonia vitripennis]
Length=775

 Score =   352 bits (903),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 255/390 (65%), Gaps = 8/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P P+++F +      +M++I    +  PT++QAQ  P+ALSGRD++G A+TG
Sbjct  99    ITVKGNNTPFPIQAFEESNFPDYVMEEIRKQGFLEPTAIQAQGWPIALSGRDMVGIAQTG  158

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RGDGP+ LVLAPTRELAQQI++  + F  S    +   
Sbjct  159   SGKTLAYILPATVHINNQPRLSRGDGPIVLVLAPTRELAQQIQSVARDFGSS-SCIRNTC  217

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  218   IFGGSPKGPQARDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEP  277

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++LTD +++ +G+++ +   N+ QI+E  
Sbjct  278   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLTDYIQINIGSLNLAANHNIRQIIEIC  337

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK ++L  LL E   +          TI+FVE K K +++ +A+ + G  A A+HG 
Sbjct  338   QEHEKENKLAVLLREIGCERGNK------TIIFVETKKKVDDITKAIKRNGWPAIAIHGD  391

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T+ILVATDVA+RGLDV  V +V+N D P + EDY+HRIGRTGR
Sbjct  392   KSQPERDYVLSEFRNGKTAILVATDVAARGLDVEDVKYVVNFDYPNSSEDYIHRIGRTGR  451

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  452   CQSAGTAYAYFTPNNARQAKELISVLEEAG  481



>ref|XP_011062219.1| PREDICTED: ATP-dependent RNA helicase dbp2-like [Acromyrmex echinatior]
Length=616

 Score =   347 bits (891),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 174/402 (43%), Positives = 253/402 (63%), Gaps = 10/402 (2%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             E    R N ++ V  D+   P P++ F +    P +M+ I    Y+ PT +QAQ  P+AL
Sbjct  92    EVYHFRENAEITVKGDN--IPNPIQYFEEGNFPPYVMEGIRREGYSQPTPIQAQGWPIAL  149

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+  A+TGSGKT  + +P I H + QP +  GDGP+ L+LAPTRELAQQI+    +
Sbjct  150   SGRDLVAIAQTGSGKTLGYILPAIVHIIHQPRINTGDGPIVLILAPTRELAQQIQEVANS  209

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             F  +  + +   + GG   G Q  +L  G+ I +ATPGRLID L++G T+L R +++VLD
Sbjct  210   FGETA-AVRNTCIFGGAPKGPQAHDLERGIEICIATPGRLIDFLEKGTTNLCRCTYLVLD  268

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++LTD V + +G+++ S
Sbjct  269   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYVHLNIGSLTLS  328

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   + 
Sbjct  329   ANHNITQIIDVCQEYEKDSKLYRLLQEIDTEKENK------TIIFVETKRKVDDLTRNIR  382

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             ++G  A  +HG ++Q ER+  L++FR G   ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  383   REGWQAVCIHGDKNQQERDHVLQEFRSGRAPILVATDVAARGLDVDDVKYVINFDYPSSS  442

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  443   EDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  484



>ref|XP_001605420.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nasonia vitripennis]
Length=777

 Score =   352 bits (903),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 255/390 (65%), Gaps = 8/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P P+++F +      +M++I    +  PT++QAQ  P+ALSGRD++G A+TG
Sbjct  101   ITVKGNNTPFPIQAFEESNFPDYVMEEIRKQGFLEPTAIQAQGWPIALSGRDMVGIAQTG  160

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RGDGP+ LVLAPTRELAQQI++  + F  S    +   
Sbjct  161   SGKTLAYILPATVHINNQPRLSRGDGPIVLVLAPTRELAQQIQSVARDFGSS-SCIRNTC  219

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  220   IFGGSPKGPQARDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEP  279

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++LTD +++ +G+++ +   N+ QI+E  
Sbjct  280   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLTDYIQINIGSLNLAANHNIRQIIEIC  339

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK ++L  LL E   +          TI+FVE K K +++ +A+ + G  A A+HG 
Sbjct  340   QEHEKENKLAVLLREIGCERGNK------TIIFVETKKKVDDITKAIKRNGWPAIAIHGD  393

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T+ILVATDVA+RGLDV  V +V+N D P + EDY+HRIGRTGR
Sbjct  394   KSQPERDYVLSEFRNGKTAILVATDVAARGLDVEDVKYVVNFDYPNSSEDYIHRIGRTGR  453

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  454   CQSAGTAYAYFTPNNARQAKELISVLEEAG  483



>ref|XP_008555058.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Microplitis demolitor]
Length=740

 Score =   350 bits (899),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 170/390 (44%), Positives = 256/390 (66%), Gaps = 8/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P P+++F +      +M++I    +  PT++QAQ  P+ALSGRD++G A+TG
Sbjct  116   ITVKGNNTPLPIQAFEESNFPEYVMQEICKQGFQEPTAIQAQGWPIALSGRDMVGIAQTG  175

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RG+GP+ LVLAPTRELAQQI++  + F  S    +   
Sbjct  176   SGKTLAYILPATVHINHQPRLTRGEGPIVLVLAPTRELAQQIQSVARDFGSS-SCIRNTC  234

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  235   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLKRCTYLVLDEADRMLDMGFEP  294

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+ QI+E  
Sbjct  295   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIIEIC  354

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L +LL E   +          TI+FVE K K +++ +A+ ++G  A A+HG 
Sbjct  355   QEHEKESKLTNLLREIGCERGNK------TIIFVETKKKVDDITKAIKREGWSAIAIHGD  408

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T+ILVATDVA+RGLDV  V +V+N D P + EDY+HRIGRTGR
Sbjct  409   KSQPERDFVLSEFRTGKTAILVATDVAARGLDVEDVKYVVNFDYPNSSEDYIHRIGRTGR  468

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  469   CQSAGTAYAYFTPNNARQAKELISVLEEAG  498



>ref|NP_648062.2| CG10077, isoform A [Drosophila melanogaster]
 ref|NP_001261491.1| CG10077, isoform D [Drosophila melanogaster]
 gb|AAM27489.1| GH10652p [Drosophila melanogaster]
 gb|AAF50635.2| CG10077, isoform A [Drosophila melanogaster]
 gb|ACL86078.1| CG10077-PA, partial [synthetic construct]
 gb|ACL92746.1| CG10077-PA [synthetic construct]
 gb|AGB94186.1| CG10077, isoform D [Drosophila melanogaster]
Length=818

 Score =   353 bits (905),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 186/399 (47%), Positives = 255/399 (64%), Gaps = 12/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP + VL   + + E   L  N    + +  +  P P   F +      +M +I    +
Sbjct  122   YKPCDSVLARTVGETETF-LTSN---EITIKGDQVPTPSIEFEEGGFPDYVMNEIRKQGF  177

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT++QAQ  P+A+SGRDL+G A+TGSGKT A+ +P + H   QP L RGDGP+ALVLA
Sbjct  178   AKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLA  237

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  S    +   + GG   G Q  +L  GV IV+ATPGRLID L+
Sbjct  238   PTRELAQQIQQVAIEFG-SNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLE  296

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G TSL R +++VLDEADRMLDMGFEPQIR++M  +    Q L++SAT P E+  LA+E+
Sbjct  297   RGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEF  356

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L + ++V +G++S S   N+ QI++   ENEK+ +L+ LL + SA+ E      + TI+F
Sbjct  357   LNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKLIKLLTDISAENE------TKTIIF  410

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K + +E+   + +QG  A A+HG +SQ ER+  L  FR G  SILVATDVA+RGLDV
Sbjct  411   VETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDV  470

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             + V  VIN D P   EDYVHRIGRTGR+ +TG A + +T
Sbjct  471   DDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFT  509



>ref|XP_008209141.1| PREDICTED: ATP-dependent RNA helicase p62 isoform X1 [Nasonia 
vitripennis]
Length=591

 Score =   346 bits (888),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 242/372 (65%), Gaps = 6/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  +  P P++ F +      +M+ I    Y+ PT +QAQ  P+A+SG++++G A+TG
Sbjct  153   ITLKGDKVPNPIQFFEEGNFPDYVMQGIKKQGYSEPTPIQAQGWPIAMSGKNMVGIAQTG  212

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P I H  +Q PL RGDGP+AL+LAPTRELAQQI+T    F  SL   +   
Sbjct  213   SGKTLAYILPAIVHINSQQPLNRGDGPIALILAPTRELAQQIQTVASDFG-SLSYVRNTC  271

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  272   IFGGAPKGGQARDLERGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEP  331

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E+  LA+EYL D  ++ +G++  +   N+ QI++  
Sbjct  332   QIRKIIEQIRPDRQVLMWSATWPKEVRMLAEEYLVDYTQLNIGSLQLAANHNILQIIDVC  391

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E EK  +L  LL E     +  G     TI+FVE K K E +   + + G  A  +HG 
Sbjct  392   QEQEKETKLGTLLQEIGNVNDDGGK----TIIFVETKKKVENITRNIRRYGWPAVCMHGD  447

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  LR+FR    SILVATDVA+RGLDV+ V +VIN D P + EDY+HRIGRTGR
Sbjct  448   KSQQERDYVLREFRNKKGSILVATDVAARGLDVDDVRYVINFDYPSSSEDYIHRIGRTGR  507

Query  837   AGSTGQATSFYT  802
             + S+G + +F+T
Sbjct  508   SQSSGTSYAFFT  519



>gb|EFN81574.1| Probable ATP-dependent RNA helicase DDX17 [Harpegnathos saltator]
Length=724

 Score =   350 bits (898),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 249/372 (67%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  96    ITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTG  155

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RGDGP+ L+LAPTRELAQQI+T  + F  S    +   
Sbjct  156   SGKTLAYILPATVHINHQPRLSRGDGPIVLILAPTRELAQQIQTVARDFGSS-SCIRNTC  214

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  215   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEP  274

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++LTD +++ +G+++ +   N+ QI+E  
Sbjct  275   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLTDYIQINIGSLTLAANHNIRQIVEIC  334

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E   +        S  I+FVE K K +++ +A+ ++G  A ++HG 
Sbjct  335   QEHEKETKLSQLLREIGTERG------SKMIIFVETKKKVDDITKAIKREGWSAISIHGD  388

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR
Sbjct  389   KSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGR  448

Query  837   AGSTGQATSFYT  802
               S G A +++T
Sbjct  449   CQSAGTAYAYFT  460



>ref|XP_008555059.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Microplitis demolitor]
Length=738

 Score =   350 bits (899),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 170/390 (44%), Positives = 256/390 (66%), Gaps = 8/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P P+++F +      +M++I    +  PT++QAQ  P+ALSGRD++G A+TG
Sbjct  114   ITVKGNNTPLPIQAFEESNFPEYVMQEICKQGFQEPTAIQAQGWPIALSGRDMVGIAQTG  173

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RG+GP+ LVLAPTRELAQQI++  + F  S    +   
Sbjct  174   SGKTLAYILPATVHINHQPRLTRGEGPIVLVLAPTRELAQQIQSVARDFGSS-SCIRNTC  232

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  233   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLKRCTYLVLDEADRMLDMGFEP  292

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+ QI+E  
Sbjct  293   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIIEIC  352

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L +LL E   +          TI+FVE K K +++ +A+ ++G  A A+HG 
Sbjct  353   QEHEKESKLTNLLREIGCERGNK------TIIFVETKKKVDDITKAIKREGWSAIAIHGD  406

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T+ILVATDVA+RGLDV  V +V+N D P + EDY+HRIGRTGR
Sbjct  407   KSQPERDFVLSEFRTGKTAILVATDVAARGLDVEDVKYVVNFDYPNSSEDYIHRIGRTGR  466

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  467   CQSAGTAYAYFTPNNARQAKELISVLEEAG  496



>ref|XP_001971526.1| GG15018 [Drosophila erecta]
 gb|EDV50552.1| GG15018 [Drosophila erecta]
Length=824

 Score =   353 bits (905),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 244/372 (66%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  +  P P   F +      +M +I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  145   ITIKGDQVPTPSIEFEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIALSGRDLVGVAQTG  204

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P + H   QP L RGDGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  205   SGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFG-SNTHVRNTC  263

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G TSL R +++VLDEADRMLDMGFEP
Sbjct  264   IFGGAPKGQQARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEP  323

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR++M  +    Q L++SAT P E+  LA+E+L + ++V +G++S S   N+ QI++  
Sbjct  324   QIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVC  383

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              ENEK+ +L+ LL + SA+ E      + TI+FVE K + +E+   + +QG  A A+HG 
Sbjct  384   DENEKLMKLIKLLTDISAENE------TKTIIFVETKKRVDEITRNISRQGWRACAIHGD  437

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L  FR G  SILVATDVA+RGLDV+ V  VIN D P   EDYVHRIGRTGR
Sbjct  438   KSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGR  497

Query  837   AGSTGQATSFYT  802
             + +TG A + +T
Sbjct  498   SNNTGTAYTLFT  509



>ref|XP_002093968.1| GE20460 [Drosophila yakuba]
 gb|EDW93680.1| GE20460 [Drosophila yakuba]
Length=818

 Score =   352 bits (904),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 244/372 (66%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  +  P P   F +      +M +I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  144   ITIKGDQVPTPSIEFEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIALSGRDLVGVAQTG  203

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P + H   QP L RGDGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  204   SGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFG-SNTHVRNTC  262

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G TSL R +++VLDEADRMLDMGFEP
Sbjct  263   IFGGAPKGQQARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEP  322

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR++M  +    Q L++SAT P E+  LA+E+L + ++V +G++S S   N+ QI++  
Sbjct  323   QIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVC  382

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              ENEK+ +L+ LL + SA+ E      + TI+FVE K + +E+   + +QG  A A+HG 
Sbjct  383   DENEKLMKLIKLLTDISAENE------TKTIIFVETKKRVDEITRNISRQGWRACAIHGD  436

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L  FR G  SILVATDVA+RGLDV+ V  VIN D P   EDYVHRIGRTGR
Sbjct  437   KSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGR  496

Query  837   AGSTGQATSFYT  802
             + +TG A + +T
Sbjct  497   SNNTGTAYTLFT  508



>ref|XP_002426835.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus 
corporis]
 gb|EEB14097.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus 
corporis]
Length=678

 Score =   348 bits (894),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 246/375 (66%), Gaps = 8/375 (2%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+A+ +     P P+  F +      IM  I    +T+PT +QAQ  P+ALSG+D++G A
Sbjct  112   DMAMTIIGKDIPYPITRFQEANFPDYIMNVIRKQGFTVPTPIQAQGWPIALSGKDIVGIA  171

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFK  1564
             +TGSGKT A+ +P I H   QPPL   DGP+AL+LAPTRELAQQI++    F  +    +
Sbjct  172   KTGSGKTIAYMLPAIVHIHNQPPLELNDGPIALILAPTRELAQQIQSVANDFGEAT-RIR  230

Query  1563  TAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMG  1384
              + + GG   G Q  +L +GV IV+ATPGRLID L++G T+L R +++VLDEADRMLDMG
Sbjct  231   NSCIFGGAPKGPQFRDLESGVEIVIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMG  290

Query  1383  FEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQIL  1207
             FEPQIR+++  +    Q L++SAT P E+ ALA++YLTD +++ +G++  S   N+ QI+
Sbjct  291   FEPQIRKIVEQIRPDRQVLMWSATWPKEVRALAEDYLTDYIQLNIGSLQLSANHNILQIV  350

Query  1206  EKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATAL  1027
             +   E+EK ++L  LL E  ++ E        TI+FVE K K + + + L K G  A ++
Sbjct  351   DVCQEHEKENKLRQLLHEIGSEKENK------TIIFVETKRKVDNITQILRKDGWPALSI  404

Query  1026  HGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGR  847
             HG ++Q ER+  L  FR G  SILVATDVA+RGLDV  V  VI  D P ++EDY+HRIGR
Sbjct  405   HGDKNQQERDHVLTQFRNGRASILVATDVAARGLDVEDVKFVIIFDYPSSLEDYIHRIGR  464

Query  846   TGRAGSTGQATSFYT  802
             TGR+  TG A +F+T
Sbjct  465   TGRSEQTGTAYAFFT  479



>ref|XP_001778715.1| predicted protein [Physcomitrella patens]
 gb|EDQ56508.1| predicted protein [Physcomitrella patens]
Length=579

 Score =   345 bits (886),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 208/504 (41%), Positives = 283/504 (56%), Gaps = 46/504 (9%)
 Frame = -3

Query  2232  SYVPPHLRNSTTATTVVSNGGDHLHSELNSRQLPSFTQSKNGFISNGEYCSNDAGRNSCA  2053
             SYVPPHLRN   A +VV+  G+                     + NG       G N  A
Sbjct  22    SYVPPHLRNRPQAGSVVNGAGE---------------------VGNGSAWGASTGVNHSA  60

Query  2052  TVNYLSPRGLVAPDPVFPQWKPSERVL------------LFKLEQIEEIRLRLNVDVAVA  1909
             +    +  G         Q    ER              +F+ E    I      D+ V 
Sbjct  61    SWGNSNGSGRSYGGGGRGQRVGWEREANPFANDEPVSEAIFEAENTG-INFDAYEDIPVE  119

Query  1908  MDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSG  1729
                N  P PV +F ++ L P++ ++I    YT PT VQ  A+P++L GRDL+ CA+TGSG
Sbjct  120   TSGNNVPPPVNTFAEIDLGPALNENIRRCKYTKPTPVQKYAIPISLHGRDLMACAQTGSG  179

Query  1728  KTAAFTIPMIQHCLAQPPLRRGDG-----PLALVLAPTRELAQQIETEVKAFSRSLDSFK  1564
             KTAAF  P+I   +   P  R  G     PLAL+L+PTREL+ QI  E K F+      +
Sbjct  180   KTAAFCFPIIAGIMRNTPPGRPRGGRKALPLALILSPTRELSCQISDEAKKFAYQT-GIR  238

Query  1563  TAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMG  1384
               +  GG  + +Q  E+  GV+I+VATPGRL D L++   SLS + ++ LDEADRMLDMG
Sbjct  239   VVVAYGGAPVHNQLREMERGVDILVATPGRLSDLLERARVSLSMVRYLALDEADRMLDMG  298

Query  1383  FEPQIREVMHNL----PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVA  1216
             FEPQIR ++  +      + QT+LFSAT P EI+ LA ++L++ + + VG V S T  + 
Sbjct  299   FEPQIRRIVEQMDMPPAGERQTMLFSATFPREIQRLASDFLSNYIFLAVGRVGSSTDLIV  358

Query  1215  QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLA  1036
             Q +E V + +K   L+DL+  +SA A       +LT+VFVE K   + + + L + G  A
Sbjct  359   QRVEFVQDADKRSMLMDLIHAQSALAPPGQQ--TLTLVFVETKKGADSLEDWLCRMGFPA  416

Query  1035  TALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHR  856
             T +HG RSQ ERE ALR FR G T ILVATDVA+RGLD+  VAHV+N DLP  ++DYVHR
Sbjct  417   TTIHGDRSQQEREHALRSFRTGVTPILVATDVAARGLDIPHVAHVVNFDLPSDIDDYVHR  476

Query  855   IGRTGRAGSTGQATSFYTDRDMYL  784
             IGRTGRAG +G AT+F+ ++D  L
Sbjct  477   IGRTGRAGKSGVATAFFNEKDQSL  500



>gb|EZA62252.1| putative ATP-dependent RNA helicase DDX5 [Cerapachys biroi]
Length=546

 Score =   345 bits (884),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/403 (43%), Positives = 255/403 (63%), Gaps = 11/403 (3%)
 Frame = -3

Query  1950  EEI-RLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVA  1774
             EE+ + R + ++ V  D+   P P++ F +    P +M+ I    Y+ PT +QAQ  P+A
Sbjct  22    EEVSQFRESAEITVKGDN--VPNPIQFFEEGNFPPYVMEGIRRQGYSQPTPIQAQGWPIA  79

Query  1773  LSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVK  1594
             LSGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+ L+LAPTRELAQQI+    
Sbjct  80    LSGRDLVAIAQTGSGKTLGYILPAIVHIIHQPHLSSGDGPIVLILAPTRELAQQIQEVAN  139

Query  1593  AFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVL  1414
              F  S  + + + + GG   G Q  +L  G+ I +ATPGRLID L++G T+L R +++VL
Sbjct  140   CFGESA-AVRNSCIFGGAPKGPQAHDLERGIEICIATPGRLIDFLERGTTNLRRCTYLVL  198

Query  1413  DEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-  1237
             DEADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++LTD   + +G+++ 
Sbjct  199   DEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYAHLNIGSLTL  258

Query  1236  SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEAL  1057
             S   N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   +
Sbjct  259   SANHNITQIIDVCQEYEKDSKLCRLLQEIGTEKENK------TIIFVETKRKVDDITRNI  312

Query  1056  MKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKT  877
              + G  A ++HG ++Q ER+  L++FR G   ILVATDVA+RGLDV+ V +VIN D P +
Sbjct  313   RRDGWQAVSIHGDKNQQERDHVLQEFRSGRAPILVATDVAARGLDVDDVKYVINFDYPSS  372

Query  876   MEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
              EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  373   SEDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  415



>emb|CDO96429.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=550

 Score =   345 bits (884),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/418 (43%), Positives = 263/418 (63%), Gaps = 18/418 (4%)
 Frame = -3

Query  2025  LVAPD--------PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESF  1870
             L+AP+        PVF +    E   + ++ + E ++ R   ++ ++   +  P P+ SF
Sbjct  58    LIAPNWDEELPNLPVFEKNFYQEHPDVAQMSESEVVQFRKENEMTIS--GHDVPKPIRSF  115

Query  1869  TDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC  1690
              +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ +P I H 
Sbjct  116   DEAGFPSYVLDEVKQEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHI  175

Query  1689  LAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELR  1510
              AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V GG     Q  +L+
Sbjct  176   NAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGAS-SRIRNTCVYGGVPKSQQIRDLQ  234

Query  1509  AGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQT  1330
              GV I++ATPGRLID L+ G T+L RI+++VLDEADRMLDMGFEPQIR+++  +    QT
Sbjct  235   RGVEILIATPGRLIDMLEIGKTNLKRITYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQT  294

Query  1329  LLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVE  1153
             L++SAT P E++ LA +YL DP++V++G++  S +  + Q++E + + EK DRL   L  
Sbjct  295   LMWSATWPKEVQQLASDYLHDPIQVQIGSLELSASHTITQLVEVITDFEKRDRLAKHLET  354

Query  1152  ESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRR  973
              S   E      S  I+F   K  C+E+   L  +G  A A+HG ++Q+ER+  L +FR 
Sbjct  355   ASQDQE------SKIIIFASTKRTCDEITTYLRAEGWPALAIHGDKAQNERDWVLAEFRS  408

Query  972   GPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTD  799
             G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAG+TG A SF+T+
Sbjct  409   GRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE  466



>ref|XP_002135506.1| GA28589 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY74133.1| GA28589 [Drosophila pseudoobscura pseudoobscura]
Length=799

 Score =   352 bits (902),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 186/399 (47%), Positives = 255/399 (64%), Gaps = 12/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP + VL     Q E      N ++ +  D    P P   F +      +M +I    +
Sbjct  107   YKPCDTVL--ARTQGETESFLTNNEITIKGDQ--VPTPSIDFEEGGFPDYVMNEIRKQGF  162

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P + H   QP L RGDGP+ALVLA
Sbjct  163   AKPTAIQAQGWPIALSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLA  222

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  S    +   + GG   G Q  +L  GV IV+ATPGRLID L+
Sbjct  223   PTRELAQQIQQVAIEFG-SNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLE  281

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G T+L R +++VLDEADRMLDMGFEPQIR++M  +    Q L++SAT P E+  LA+E+
Sbjct  282   RGTTTLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEF  341

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             LT+ ++V +G+++ S   N+ QI++   E+EK+ +L+ LL + SA+ E      + TI+F
Sbjct  342   LTNYIQVNIGSLTLSANHNILQIVDVCDESEKLGKLIKLLSDISAENE------TKTIIF  395

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K + +E+   + +QG  A A+HG +SQ ER+  L  FR G  SILVATDVA+RGLDV
Sbjct  396   VETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDV  455

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             + V  VIN D P   EDYVHRIGRTGR+ +TG A + +T
Sbjct  456   DDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFT  494



>gb|EFN64357.1| Probable ATP-dependent RNA helicase DDX5 [Camponotus floridanus]
Length=639

 Score =   347 bits (890),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/403 (44%), Positives = 255/403 (63%), Gaps = 11/403 (3%)
 Frame = -3

Query  1950  EEI-RLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVA  1774
             EE+ + R N ++ V  ++   P P++ F +    P +M+ I    Y+ PT +QAQ  P+A
Sbjct  115   EEVSQFRENAEITVKGEN--VPNPIQYFEEGNFPPYVMEGIRRQGYSQPTPIQAQGWPIA  172

Query  1773  LSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVK  1594
             LSGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+ LVLAPTRELAQQI+    
Sbjct  173   LSGRDLVAIAQTGSGKTLGYILPAIVHIIHQPRLSNGDGPIVLVLAPTRELAQQIQEVAN  232

Query  1593  AFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVL  1414
              F  +  + +   + GG   G Q  +L  G+ I +ATPGRLID L++G T+L R +++VL
Sbjct  233   CFGETA-AVRNTCIFGGAPKGPQAHDLERGIEICIATPGRLIDFLERGTTNLRRCTYLVL  291

Query  1413  DEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-  1237
             DEADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++LTD V + +G+++ 
Sbjct  292   DEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYVHLNIGSLTL  351

Query  1236  SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEAL  1057
             S   N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   +
Sbjct  352   SANHNITQIIDVCHEYEKDSKLYRLLQEIGTEKENK------TIIFVETKRKVDDITRNI  405

Query  1056  MKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKT  877
              + G  A ++HG ++Q ER+  L++FR G   ILVATDVA+RGLDV+ V +VIN D P +
Sbjct  406   RRDGWQAVSIHGDKNQQERDHVLQEFRSGRAPILVATDVAARGLDVDDVKYVINFDYPSS  465

Query  876   MEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
              EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  466   SEDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  508



>ref|XP_002083905.1| GD13105 [Drosophila simulans]
 gb|EDX09490.1| GD13105 [Drosophila simulans]
Length=814

 Score =   352 bits (902),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 244/372 (66%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  +  P P   F +      +M +I    +  PT++QAQ  P+A+SGRDL+G A+TG
Sbjct  142   ITIKGDQVPTPSIEFEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTG  201

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P + H   QP L RGDGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  202   SGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFG-SNTHVRNTC  260

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L++G TSL R +++VLDEADRMLDMGFEP
Sbjct  261   IFGGAPKGQQARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEP  320

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR++M  +    Q L++SAT P E+  LA+E+L + ++V +G++S S   N+ QI++  
Sbjct  321   QIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVC  380

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              ENEK+ +L+ LL + SA+ E      + TI+FVE K + +E+   + +QG  A A+HG 
Sbjct  381   DENEKLMKLIKLLTDISAENE------TKTIIFVETKKRVDEITRNISRQGWRACAIHGD  434

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L  FR G  SILVATDVA+RGLDV+ V  VIN D P   EDYVHRIGRTGR
Sbjct  435   KSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGR  494

Query  837   AGSTGQATSFYT  802
             + +TG A + +T
Sbjct  495   SNNTGTAYTLFT  506



>ref|XP_003706564.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Megachile 
rotundata]
Length=713

 Score =   349 bits (895),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/397 (43%), Positives = 259/397 (65%), Gaps = 8/397 (2%)
 Frame = -3

Query  1935  RLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDL  1756
             + ++   + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL
Sbjct  87    KYHIGKEITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDL  146

Query  1755  LGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSL  1576
             +G A+TGSGKT A+ +P   H   QP L RGDGP+ L+LAPTRELAQQI++  + F  S 
Sbjct  147   VGIAQTGSGKTLAYILPATVHINNQPRLSRGDGPIVLILAPTRELAQQIQSVARDFGSS-  205

Query  1575  DSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRM  1396
                +   + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRM
Sbjct  206   SCIRNTCIFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRM  265

Query  1395  LDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANV  1219
             LDMGFEPQIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+
Sbjct  266   LDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNI  325

Query  1218  AQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLL  1039
              QI+E   E+EK  +L  LL E     ++ G      I+FVE K K +++ +A+ ++G  
Sbjct  326   RQIIEICQEHEKETKLSGLLRE--IGKDRGGK----MIIFVETKKKVDDITKAIKREGWP  379

Query  1038  ATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVH  859
             A ++HG +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+H
Sbjct  380   AISIHGDKSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIH  439

Query  858   RIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             RIGRTGR  S G A +++T  +     ++   + + G
Sbjct  440   RIGRTGRCQSAGTAYAYFTPNNARQAKELISVLEEAG  476



>sp|A5DL80.3|DBP2_PICGU RecName: Full=ATP-dependent RNA helicase DBP2 [Meyerozyma guilliermondii 
ATCC 6260]
Length=554

 Score =   344 bits (882),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 247/378 (65%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ SF +      ++ ++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  121   PKPITSFDEAGFPDYVLNEVKQQGFPKPTAIQCQGWPMALSGRDMIGIAATGSGKTLSYC  180

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   + GG   G
Sbjct  181   LPSIVHINAQPLLGPGDGPIVLVLAPTRELAVQIQQECSKFGAS-SRIRNTCIYGGAPKG  239

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  240   QQIRDLARGVEICIATPGRLIDMLETGKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQ  299

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ L ++YL DP++V +G++  + +  + QI+E + E EK DR
Sbjct  300   IRPDRQTLMWSATWPKEVQTLTRDYLNDPIQVTIGSLELAASHTITQIVEVLSEFEKRDR  359

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  E+A A+K        ++F   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  360   LVKHL--ETATADKEAK----VLIFSSTKRACDEITSYLRADGWPALAIHGDKQQNERDW  413

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              LR+F+ G + I+VATDVA+RG+DV G+++VIN D+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  414   VLREFKTGKSPIMVATDVAARGIDVKGISYVINYDMPGNIEDYVHRIGRTGRAGTTGTAV  473

Query  813   SFYTDRDMYLVAQIRKAI  760
             S +T+ +  L   + K +
Sbjct  474   SLFTEANSKLGGDLCKIM  491



>ref|XP_006615333.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X2 [Apis dorsata]
Length=718

 Score =   349 bits (895),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/428 (42%), Positives = 270/428 (63%), Gaps = 17/428 (4%)
 Frame = -3

Query  2001  PQWKPSERVLLFKLEQIEEIRL---------RLNVDVAVAMDSNPAPAPVESFTDMCLHP  1849
             P W  S+  ++ K   I  I +         + ++   + +  N  P+P+++F +     
Sbjct  58    PSWDLSKLPVITKNLYIPHINILKRSSDEVNKYHIGKEITVKGNNTPSPIQAFEESNFPD  117

Query  1848  SIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLR  1669
              +M++I    +  PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P   H   QP L 
Sbjct  118   YVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYILPATVHINHQPRLS  177

Query  1668  RGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVV  1489
             RGDGP+ L+LAPTRELAQQI++  + F  S    +   + GG+  G Q  +L  GV I +
Sbjct  178   RGDGPIVLILAPTRELAQQIQSVARDFGSS-SCIRNTCIFGGSPKGPQARDLERGVEICI  236

Query  1488  ATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATM  1309
             ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT 
Sbjct  237   ATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATW  296

Query  1308  PAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEK  1132
             P E++ALA+++L+D +++ +G+++ +   N+ QI+E   E+EK  +L +LL E     + 
Sbjct  297   PKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIVEICQEHEKEMKLSNLLREI---GKD  353

Query  1131  SGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
              G   S  I+FVE K K +++ +A+ ++G  A ++HG +SQ ER+  L +FR G T ILV
Sbjct  354   RG---SKMIIFVETKKKVDDITKAIKREGWPAISIHGDKSQPERDYVLSEFRNGKTMILV  410

Query  951   ATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             ATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR  S G A +++T  +     ++
Sbjct  411   ATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGRCQSAGTAYAYFTPNNARQAKEL  470

Query  771   RKAIADVG  748
                + + G
Sbjct  471   ISVLEEAG  478



>ref|XP_003691490.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis 
florea]
 ref|XP_006561513.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis 
mellifera]
Length=728

 Score =   349 bits (896),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/428 (42%), Positives = 270/428 (63%), Gaps = 17/428 (4%)
 Frame = -3

Query  2001  PQWKPSERVLLFKLEQIEEIRL---------RLNVDVAVAMDSNPAPAPVESFTDMCLHP  1849
             P W  S+  ++ K   I  I +         + ++   + +  N  P+P+++F +     
Sbjct  58    PSWDLSKLPVITKNLYIPHINILKRSSDEVNKYHIGKEITVKGNNTPSPIQAFEESNFPD  117

Query  1848  SIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLR  1669
              +M++I    +  PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P   H   QP L 
Sbjct  118   YVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYILPATVHINHQPRLS  177

Query  1668  RGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVV  1489
             RGDGP+ L+LAPTRELAQQI++  + F  S    +   + GG+  G Q  +L  GV I +
Sbjct  178   RGDGPIVLILAPTRELAQQIQSVARDFGSS-SCIRNTCIFGGSPKGPQARDLERGVEICI  236

Query  1488  ATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATM  1309
             ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT 
Sbjct  237   ATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATW  296

Query  1308  PAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEK  1132
             P E++ALA+++L+D +++ +G+++ +   N+ QI+E   E+EK  +L +LL E     + 
Sbjct  297   PKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIVEICQEHEKEMKLSNLLREI---GKD  353

Query  1131  SGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
              G   S  I+FVE K K +++ +A+ ++G  A ++HG +SQ ER+  L +FR G T ILV
Sbjct  354   RG---SKMIIFVETKKKVDDITKAIKREGWPAISIHGDKSQPERDYVLSEFRNGKTMILV  410

Query  951   ATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             ATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR  S G A +++T  +     ++
Sbjct  411   ATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGRCQSAGTAYAYFTPNNARQAKEL  470

Query  771   RKAIADVG  748
                + + G
Sbjct  471   ISVLEEAG  478



>ref|XP_006615332.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Apis dorsata]
Length=728

 Score =   349 bits (896),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/428 (42%), Positives = 270/428 (63%), Gaps = 17/428 (4%)
 Frame = -3

Query  2001  PQWKPSERVLLFKLEQIEEIRL---------RLNVDVAVAMDSNPAPAPVESFTDMCLHP  1849
             P W  S+  ++ K   I  I +         + ++   + +  N  P+P+++F +     
Sbjct  58    PSWDLSKLPVITKNLYIPHINILKRSSDEVNKYHIGKEITVKGNNTPSPIQAFEESNFPD  117

Query  1848  SIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLR  1669
              +M++I    +  PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P   H   QP L 
Sbjct  118   YVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYILPATVHINHQPRLS  177

Query  1668  RGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVV  1489
             RGDGP+ L+LAPTRELAQQI++  + F  S    +   + GG+  G Q  +L  GV I +
Sbjct  178   RGDGPIVLILAPTRELAQQIQSVARDFGSS-SCIRNTCIFGGSPKGPQARDLERGVEICI  236

Query  1488  ATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATM  1309
             ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT 
Sbjct  237   ATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATW  296

Query  1308  PAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEK  1132
             P E++ALA+++L+D +++ +G+++ +   N+ QI+E   E+EK  +L +LL E     + 
Sbjct  297   PKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIVEICQEHEKEMKLSNLLREI---GKD  353

Query  1131  SGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILV  952
              G   S  I+FVE K K +++ +A+ ++G  A ++HG +SQ ER+  L +FR G T ILV
Sbjct  354   RG---SKMIIFVETKKKVDDITKAIKREGWPAISIHGDKSQPERDYVLSEFRNGKTMILV  410

Query  951   ATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             ATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR  S G A +++T  +     ++
Sbjct  411   ATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGRCQSAGTAYAYFTPNNARQAKEL  470

Query  771   RKAIADVG  748
                + + G
Sbjct  471   ISVLEEAG  478



>ref|XP_011054428.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Acromyrmex 
echinatior]
Length=643

 Score =   347 bits (889),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 248/372 (67%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  32    ITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTG  91

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RGDGP+ L+LAPTRELAQQI+T  + F  S    +   
Sbjct  92    SGKTLAYILPATVHINHQPRLSRGDGPIVLILAPTRELAQQIQTVARDFGSS-SCIRNTC  150

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  151   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEP  210

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+ QI+E  
Sbjct  211   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIVEIC  270

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E   +        S  I+FVE K K +++ + + ++G  A ++HG 
Sbjct  271   QEHEKEMKLSQLLREIGTERG------SKMIIFVETKKKVDDITKTIKREGWSAISIHGD  324

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR
Sbjct  325   KSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGR  384

Query  837   AGSTGQATSFYT  802
               S G A +++T
Sbjct  385   CQSAGTAYAYFT  396



>dbj|BAO41526.1| ATP-dependent RNA helicase DBP2 [Kluyveromyces marxianus DMKU3-1042]
Length=544

 Score =   343 bits (881),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/418 (44%), Positives = 260/418 (62%), Gaps = 18/418 (4%)
 Frame = -3

Query  2025  LVAPD--------PVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESF  1870
             LVAP+        PVF +    E   + K+   E  + R   ++ +    +  P P+ +F
Sbjct  59    LVAPNWDEELPNLPVFEKNFYQEHPDVTKMSDAEVAQFRKENEMTIT--GHDVPKPIRTF  116

Query  1869  TDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHC  1690
              +      ++ ++    +  PT +Q Q  P+ALSGRD++G A TGSGKT ++ +P I H 
Sbjct  117   DEAGFPSYVLDEVKQEGFDKPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPGIVHI  176

Query  1689  LAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELR  1510
              AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V GG     Q  +L+
Sbjct  177   NAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGAS-SRIRNTCVYGGVPKSQQIRDLQ  235

Query  1509  AGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQT  1330
              GV I++ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  +    QT
Sbjct  236   RGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQT  295

Query  1329  LLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVE  1153
             L++SAT P E++ LA +YL DP++V++G++  + +  + QI+E V + EK DRL   L  
Sbjct  296   LMWSATWPKEVKQLAADYLNDPIQVQIGSLELAASHTITQIVEVVTDFEKRDRLAKHLET  355

Query  1152  ESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRR  973
              S   E      S  I+F   K  C+E+   L  +G  A A+HG ++Q+ER+  L +FR 
Sbjct  356   ASQDQE------SKIIIFASTKRTCDEITSYLRAEGWPALAIHGDKAQNERDWVLAEFRS  409

Query  972   GPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTD  799
             G + I+VATDVA+RG+DV G+ +VIN D+P  +EDYVHRIGRTGRAGSTG A SF+T+
Sbjct  410   GRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFTE  467



>gb|EMG48788.1| ATP-dependent RNA helicase DBP2 [Candida maltosa Xu316]
Length=550

 Score =   343 bits (881),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 247/378 (65%), Gaps = 9/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      ++ ++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  112   PHPITTFDEAGFPDYVLDEVKQLGFPKPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYC  171

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P + H  AQP L+RGDGP+ LVLAPTRELA QI+TE   F +S    +   V GG   G
Sbjct  172   LPAMVHINAQPQLQRGDGPIVLVLAPTRELAVQIQTECSKFGQS-SRIRNTCVYGGAPKG  230

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  231   AQIRDLARGVEICIATPGRLIDMLEGGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  290

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA +YL DP++V +G++  + +  + QI+E + E  K DR
Sbjct  291   IRPDRQTLMWSATWPKEVKRLADDYLVDPIQVNIGSLELAASHTITQIVEVIDEYSKRDR  350

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             ++  L  ESA  +K     S  ++F   K  C+E+   L   G  A A+HG + Q ER+ 
Sbjct  351   VVKHL--ESALNDKE----SKVLIFASTKRTCDEITTYLRSDGWPALAIHGDKDQRERDW  404

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR G TSI+VATDVA+RG+ V G+ HVIN D+P  +EDYVHRIGRTGR G++G A 
Sbjct  405   VLNEFREGRTSIMVATDVAARGI-VKGITHVINFDMPGNIEDYVHRIGRTGRGGASGTAI  463

Query  813   SFYTDRDMYLVAQIRKAI  760
             SF+TD +  L   + K +
Sbjct  464   SFFTDSNSKLGGDLCKIM  481



>ref|XP_001653435.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti]
 gb|EAT39469.1| AAEL008738-PA [Aedes aegypti]
Length=911

 Score =   353 bits (907),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 184/400 (46%), Positives = 263/400 (66%), Gaps = 12/400 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P   V+    E+++  R R+ + V      N  P P + F +      +M +I    +
Sbjct  194   YVPHPNVMARTPEEVQAFRERMQITVM----GNSVPHPSQDFEEGNFPDFVMNEINKMGF  249

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P I H   Q PL+RG+GP+ LVLA
Sbjct  250   PNPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYMLPGIVHIAHQKPLQRGEGPVVLVLA  309

Query  1635  PTRELAQQIETEVKAF-SRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHL  1459
             PTRELAQQI+T V+ F + S    +   + GG   G Q  +L  GV +V+ATPGRLID L
Sbjct  310   PTRELAQQIQTVVRDFGTHSKPLIRYTCIFGGALKGPQVRDLERGVEVVIATPGRLIDFL  369

Query  1458  QQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQE  1279
             ++G T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT P E++ALA++
Sbjct  370   ERGITNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAED  429

Query  1278  YLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIV  1102
             +L D +++ +G+++ S   N+ QI++   E EK  +LL LL E S+         S  I+
Sbjct  430   FLHDYIQINIGSLNLSANHNIHQIVDVCEEGEKEGKLLSLLKEISSDVN------SKIII  483

Query  1101  FVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLD  922
             FVE K K E++ + +++ G  AT++HG +SQSER+  L+DFR G ++ILVATDVA+RGLD
Sbjct  484   FVETKKKVEDLLKNIVRDGYGATSIHGDKSQSERDYVLQDFRHGKSTILVATDVAARGLD  543

Query  921   VNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             V  V +VIN D P + EDY+HRIGRTGR  S G A +F+T
Sbjct  544   VEDVKYVINFDYPNSSEDYIHRIGRTGRCSSYGTAYTFFT  583



>gb|EFN75298.1| Probable ATP-dependent RNA helicase DDX5 [Harpegnathos saltator]
Length=627

 Score =   346 bits (887),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 255/403 (63%), Gaps = 11/403 (3%)
 Frame = -3

Query  1950  EEI-RLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVA  1774
             EE+ + R N ++ V  ++   P P++ F +    P +M+ I    Y+ PT +QAQ  P+A
Sbjct  102   EEVSQFRENTEITVKGEN--VPNPIQYFEEGNFPPYVMEGIRRQGYSQPTPIQAQGWPIA  159

Query  1773  LSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVK  1594
             LSGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+AL+LAPTRELAQQI+    
Sbjct  160   LSGRDLVAIAQTGSGKTLGYILPAIVHIIHQPRLSNGDGPIALILAPTRELAQQIQEVAN  219

Query  1593  AFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVL  1414
              F  S  + +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VL
Sbjct  220   CFGESA-AVRNTCIFGGAPKGPQAHDLDRGVEICIATPGRLIDFLEKGTTNLRRCTYLVL  278

Query  1413  DEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-  1237
             DEADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++LTD   + +G+++ 
Sbjct  279   DEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYTHLNIGSLTL  338

Query  1236  SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEAL  1057
             S   N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   +
Sbjct  339   SANHNITQIIDVCQEFEKDSKLFRLLQEIGNEKENK------TIIFVETKRKVDDITRNI  392

Query  1056  MKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKT  877
              + G  A ++HG ++Q ER+  L++FR G   ILVATDVA+RGLDV+ V +VIN D P +
Sbjct  393   RRDGWQALSIHGDKNQQERDHVLQEFRSGRAPILVATDVAARGLDVDDVKYVINFDYPSS  452

Query  876   MEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
              EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  453   SEDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  495



>ref|XP_001956121.1| GF24750 [Drosophila ananassae]
 gb|EDV38927.1| GF24750 [Drosophila ananassae]
Length=613

 Score =   345 bits (886),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 245/368 (67%), Gaps = 6/368 (2%)
 Frame = -3

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
             AP PV+SF ++C     M +I    YT PT +QAQA P+A+SG +++G A+TGSGKT AF
Sbjct  111   APNPVQSFDEVCFPDYCMNEIRRQRYTEPTPIQAQAWPIAMSGHNMVGIAKTGSGKTLAF  170

Query  1713  TIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNI  1534
              +P I H   Q PL+RGDGP+ALVLAPTRELAQQI++    F  S    +   + GG   
Sbjct  171   ILPAILHINGQQPLQRGDGPIALVLAPTRELAQQIQSVANDFGSSA-YVRNTCIFGGAPR  229

Query  1533  GDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMH  1354
               Q ++L  GV IV+ATPGRL+D LQ G T+L R +++VLDEADRMLDMGFE QIR+++ 
Sbjct  230   SRQANDLERGVQIVIATPGRLLDFLQGGATNLKRCTYLVLDEADRMLDMGFEQQIRKILG  289

Query  1353  NLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKID  1177
              +    Q L++SAT P E+  LA+++L + +++ +G++  S   N+ Q +E   E+EK  
Sbjct  290   QIRPDRQILMWSATWPKEVRKLAEDFLGNYIQINIGSLELSANHNIRQFVEVCAEHEKGG  349

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
             +L DLL     Q+   G      I+FV  K K +E+A  +   G+   ++HG +SQ +R+
Sbjct  350   KLKDLLSHIYDQSTSPGK----IIIFVATKKKVDELARFINAFGVGVGSIHGDKSQMDRD  405

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
             + L DFR G  +ILVATDVA+RGLDV+G+ +VIN D P++ EDYVHRIGRTGR  STG +
Sbjct  406   SVLNDFRNGRHNILVATDVAARGLDVDGIKYVINFDFPQSSEDYVHRIGRTGRKHSTGTS  465

Query  816   TSFYTDRD  793
              +F+T ++
Sbjct  466   YAFFTRKN  473



>ref|XP_001958367.1| GF10884 [Drosophila ananassae]
 gb|EDV41173.1| GF10884 [Drosophila ananassae]
Length=822

 Score =   351 bits (901),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 256/399 (64%), Gaps = 12/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             +KP + VL     Q E      N ++ +  D  P P+ +E F +      +M +I    +
Sbjct  116   YKPCDSVL--ARTQGETDTFLANNEITIKGDQVPTPS-IE-FEEGGFPDYVMNEIRKQGF  171

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
               PT++QAQ  P+A+SGRDL+G A+TGSGKT A+ +P + H   QP L RGDGP+ALVLA
Sbjct  172   AKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLA  231

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI+     F  S    +   + GG   G Q  +L  GV IV+ATPGRLID L+
Sbjct  232   PTRELAQQIQQVAIEFG-SNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLE  290

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
             +G TSL R +++VLDEADRMLDMGFEPQIR++M  +    Q L++SAT P E+  LA+E+
Sbjct  291   RGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEF  350

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L + ++V +G++S S   N+ QI++   ENEK+ +L+ LL + SA+ E      + TI+F
Sbjct  351   LNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKLVKLLTDISAENE------TKTIIF  404

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             VE K + +E+   + +QG  A A+HG +SQ ER+  L  FR G  SILVATDVA+RGLDV
Sbjct  405   VETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDV  464

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             + V  VIN D P   EDYVHRIGRTGR+ + G A + +T
Sbjct  465   DDVKFVINYDYPSNSEDYVHRIGRTGRSNNRGTAYTLFT  503



>gb|KDR12221.1| putative ATP-dependent RNA helicase DDX5 [Zootermopsis nevadensis]
Length=676

 Score =   347 bits (890),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 269/435 (62%), Gaps = 33/435 (8%)
 Frame = -3

Query  2007  VFPQWK-------------PSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFT  1867
             V PQW+             P + V      ++E  R++  + V      N  P P++ F 
Sbjct  83    VKPQWEMHNLRPFTKNFYVPHQDVSNRTRHEVESYRVKNEITVK----GNNMPNPIQFFE  138

Query  1866  DMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCL  1687
             +      +M++I    +  PTS+QAQ  P+A+SGRD++G A+TGSGKT A+ +P   H  
Sbjct  139   ESNFPDYVMREIRNSGFNEPTSIQAQGWPIAMSGRDMVGIAQTGSGKTLAYVLPATVHIN  198

Query  1686  AQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRA  1507
              Q  L RG+GP+AL+LAPTRELAQQI++  + F  S    +   + GG   G Q  +L  
Sbjct  199   NQERLSRGEGPIALILAPTRELAQQIQSVAREFGSST-YVRNTCIFGGAPKGPQARDLER  257

Query  1506  GVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTL  1327
             GV IV+ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL
Sbjct  258   GVEIVIATPGRLIDFLERGITNLRRCTYLVLDEADRMLDMGFEPQIRKILEQIRPDRQTL  317

Query  1326  LFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEE  1150
             ++SAT P E+  LA+E+L D V++ +G++  +   N+ QI++   E+EK D+L  LL E 
Sbjct  318   MWSATWPKEVRNLAEEFLKDYVQINIGSLQLAANHNILQIVDVCQEHEKSDKLNALLQEI  377

Query  1149  SAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRG  970
               + E        TI+FVE K K E++  ++ + G  A  +HG +SQ ER+  LR+FR G
Sbjct  378   GCEQEGK------TIIFVETKRKVEDITRSIRRFGYPAVCMHGDKSQQERDHVLREFRGG  431

Query  969   PTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTD---  799
              ++ILVATDVA+RGLDV+G+  VIN D P + EDY+HRIGRTGR   TG + +F+T    
Sbjct  432   KSNILVATDVAARGLDVDGIKFVINFDYPNSSEDYIHRIGRTGRCQMTGTSYAFFTPSNS  491

Query  798   ---RDMYLVAQIRKA  763
                RD  LVA +R+A
Sbjct  492   RQARD--LVAVLREA  504



>ref|XP_002106416.1| GD16140 [Drosophila simulans]
 gb|EDX17368.1| GD16140 [Drosophila simulans]
Length=800

 Score =   350 bits (899),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/388 (46%), Positives = 263/388 (68%), Gaps = 7/388 (2%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             +Q+ +IR  L + V+     N  P PV SF +  L   +++++    +T PT++Q+Q  P
Sbjct  215   QQVADIRRELEITVS----GNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWP  270

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +ALSGRDL+G A+TGSGKT A+ +P I H   QPP+ RG+GP+ALVLAPTRELAQQI++ 
Sbjct  271   IALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSV  330

Query  1599  VKAFSRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISF  1423
             V+ +        +   + GG++   Q  +L  GV +++ATPGRLID L+  NT+L R ++
Sbjct  331   VRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENRNTNLQRCTY  390

Query  1422  VVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGN  1243
             +VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA ++L D +++ +G+
Sbjct  391   LVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGS  450

Query  1242  VS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             ++ S   N+ QI+E   E EK  RL+ LL E S   + SG   +  IVFVE K K E++ 
Sbjct  451   MNLSANHNIRQIVEICTEIEKPQRLVCLLNEISP-IKNSGSNGNKIIVFVETKIKVEDIL  509

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
             + +  +G  AT++HG ++Q+ER++ L+DFR G ++IL+ATDVASRGLDV  + +VIN D 
Sbjct  510   QIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDY  569

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P + E+YVHRIGRTGR    G A +F+T
Sbjct  570   PNSSENYVHRIGRTGRCQQLGTAYTFFT  597



>ref|XP_005993826.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Latimeria 
chalumnae]
Length=554

 Score =   343 bits (880),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 177/393 (45%), Positives = 250/393 (64%), Gaps = 11/393 (3%)
 Frame = -3

Query  1977  VLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSV  1798
             + LF++EQ  E+ L  N    +++  +  P P+ SF +      +M  I   ++T PT++
Sbjct  1     MWLFQMEQ--EVELYRNSK-EISVKGHGCPKPIVSFNEASFPTYVMDVIVRQNFTEPTAI  57

Query  1797  QAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELA  1618
             QAQ  PVALSG+DL+G A+TGSGKT ++ +P I H   QP L RGDGP+ LVLAPTRELA
Sbjct  58    QAQGWPVALSGKDLVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA  117

Query  1617  QQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSL  1438
             QQ++     + R+    K+  + GG   G Q  +L  GV I +ATPGRLID L+ G T+L
Sbjct  118   QQVQQVAAEYGRA-SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNL  176

Query  1437  SRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVR  1258
              R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L + V 
Sbjct  177   RRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVH  236

Query  1257  VKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTK  1081
             + +G +  S   N+ QI++   + EK D+L+ L+ E  ++ E        TIVFVE K +
Sbjct  237   INIGALELSANHNILQIVDVCQDLEKDDKLVRLMEEIMSEKENK------TIVFVETKRR  290

Query  1080  CEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHV  901
             C+++   L + G  A  +HG +SQ ER+  L  F+ G   IL+ATDVASRGLDV  V  V
Sbjct  291   CDDLTRRLRRDGWPAMGIHGDKSQQERDWVLDQFKHGKAPILIATDVASRGLDVEDVKFV  350

Query  900   INLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             IN D P + EDY+HRIGRT R+  TG A +F+T
Sbjct  351   INYDYPNSSEDYIHRIGRTARSSKTGTAYTFFT  383



>ref|XP_004201815.1| Piso0_002019 [Millerozyma farinosa CBS 7064]
 emb|CCE88509.1| Piso0_002019 [Millerozyma farinosa CBS 7064]
Length=561

 Score =   343 bits (881),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 249/378 (66%), Gaps = 8/378 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      ++ ++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  124   PKPITTFDEAGFPDYVLTEVKKQGFPSPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYC  183

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F R+    +   + GG   G
Sbjct  184   LPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQQECSKFGRT-SRIRNTCIYGGAPKG  242

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV I +ATPGRLID L+   T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  243   PQIRDLARGVEICIATPGRLIDMLEMNKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQ  302

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA++YL DP++V+VG++  + +  + Q++E V E EK DR
Sbjct  303   IRPDRQTLMWSATWPKEVQNLARDYLNDPIQVRVGSLELAASHTITQLVEVVSEFEKRDR  362

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L  E+A  +K        ++F   K  C+E+   L   G  A A+HG + Q+ER+ 
Sbjct  363   LIKHL--ETATTDKEAK----VLIFASTKKTCDEITRYLRSDGWPALAIHGDKQQAERDW  416

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L++F+ G + I+VATDVA+RG+DV G+++VINLD+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  417   VLKEFKTGKSPIMVATDVAARGIDVKGISYVINLDMPGNIEDYVHRIGRTGRAGTTGTAV  476

Query  813   SFYTDRDMYLVAQIRKAI  760
             S +T+ +  L   + K +
Sbjct  477   SLFTEANSKLGGDLCKIM  494



>ref|XP_008209138.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Nasonia vitripennis]
Length=577

 Score =   344 bits (882),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 237/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      +M++I   ++  PTS+QAQ  P+ALSGRD++G A TG
Sbjct  97    ITLKGKGIPNPVFTFEEAGFPEYVMREIKRQNFKEPTSIQAQGWPIALSGRDMVGIASTG  156

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    K   
Sbjct  157   SGKTLSYILPAIVHINSQPKLCRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIKNTC  215

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  216   LYGGAPKGSQARDLDNGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  275

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+E+L D  ++ VG++  S   N+ QI++  
Sbjct  276   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEEFLKDYAQINVGSLQLSANHNILQIIDVC  335

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E EK  +L  LL E  A+ E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  336   QEYEKEIKLSTLLKEIMAEKENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  389

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  390   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  449

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  450   RQKTGTAYTFFT  461



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score =   342 bits (876),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 256/387 (66%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             Q+EE R RL     + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P+
Sbjct  77    QVEEYR-RLR---EITVEGRDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWPM  132

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  133   ALKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAHGDGPIVLVLAPTRELAVQIQQEA  192

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++V
Sbjct  193   SKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLV  251

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ S
Sbjct  252   LDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-S  310

Query  1236  SPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++  
Sbjct  311   DLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQITR  362

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  363   QLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFP  422

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  423   GSLEDYVHRIGRTGRAGAKGTAYTFFT  449



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score =   342 bits (877),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 253/406 (62%), Gaps = 14/406 (3%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             E++E+ R    + V      +  P PV++F +      +++++    +  PT +Q Q  P
Sbjct  86    EEVEQYRREKQIHVY----GDGVPKPVKTFEEASFPEYVLEEVLRAGFKEPTPIQCQGWP  141

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +AL GRDL+G AETGSGKT A+ +P + H  AQP L+ GDGP+ LVLAPTRELA QI+ E
Sbjct  142   MALLGRDLIGLAETGSGKTLAYLLPAVVHINAQPYLQSGDGPIVLVLAPTRELAVQIQQE  201

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
              + F  S    K  +V GG   G Q  +LR GV IV+ATPGRLID L    T+L R++++
Sbjct  202   CQRFGAS-SRIKNTVVYGGAPKGPQARDLRGGVEIVIATPGRLIDMLDSRITNLRRVTYL  260

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGFEPQIR+++  +    QTLL+SAT P E++A+A+++L DP +V +G+ 
Sbjct  261   VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLLWSATWPKEVQAIARDFLKDPYQVIIGSP  320

Query  1239  S-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                   N+ Q++E V    K  RL  LL       E  G      ++FVE K  C+E+  
Sbjct  321   DLKANHNIRQVVEMVEGFAKYPRLRKLL-----DGEMDGR---RILIFVETKRGCDELVR  372

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A  LHG +SQ ER+  L++F+ G   I++ATDVA+RGLDV  +  V+N D+P
Sbjct  373   QLRTDGYPALGLHGDKSQQERDWVLQEFKNGTHPIMLATDVAARGLDVKDIKVVVNYDMP  432

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVGS  745
             KT EDYVHRIGRTGRAG+TG A SF+T+ D  L  Q+   + + G 
Sbjct  433   KTAEDYVHRIGRTGRAGATGTAYSFFTNGDARLARQVVDVMQEAGQ  478



>ref|XP_004518941.1| PREDICTED: ATP-dependent RNA helicase p62-like isoform X2 [Ceratitis 
capitata]
 ref|XP_004525160.1| PREDICTED: ATP-dependent RNA helicase p62-like isoform X2 [Ceratitis 
capitata]
Length=518

 Score =   342 bits (877),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 174/383 (45%), Positives = 252/383 (66%), Gaps = 10/383 (3%)
 Frame = -3

Query  1896  PAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAA  1717
             PAP P++ F + C     + +I    YT PT +QAQ+ P+A+SG +L+G A+TGSGKT A
Sbjct  39    PAPNPIQYFDEACFPDYCLHEIRHQRYTEPTPIQAQSWPIAMSGSNLVGIAKTGSGKTLA  98

Query  1716  FTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTN  1537
             F +P I H   Q PL+RGDGP+ALVLAPTRELAQQI+T    F  S+   +   + GGT 
Sbjct  99    FILPAIVHINNQTPLQRGDGPIALVLAPTRELAQQIQTVANDFGSSV-YVRNTCIFGGTP  157

Query  1536  IGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  1357
              G Q ++L  GV IV+ATPGRL+D L  G T+L R +++VLDEADRMLDMGFEPQIR+++
Sbjct  158   KGKQANDLERGVEIVIATPGRLLDFLSNGVTNLRRCTYLVLDEADRMLDMGFEPQIRKIL  217

Query  1356  HNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKI  1180
               +    Q L++SAT P E+  LA+++L   ++V +G++  S   N+ Q ++   E++K 
Sbjct  218   GQIRPDRQILMWSATWPKEVRQLAEDFLGSYIQVNIGSLELSANHNIRQYVDVCNEHDKG  277

Query  1179  DRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSER  1000
              +L DLL     Q+   G      I+FV  K K +E++  +   G+   ++HG +SQ +R
Sbjct  278   AKLKDLLSHIYDQSHSPGK----IIIFVATKKKVDELSRFINGFGVRVGSIHGDKSQIDR  333

Query  999   EAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQ  820
             +  L +FR G  +ILVATDVA+RGLDV+G+ +VIN D P++ EDY+HRIGRTGR  STG 
Sbjct  334   DNVLAEFRSGRANILVATDVAARGLDVDGIKYVINFDFPQSSEDYIHRIGRTGRKHSTGT  393

Query  819   ATSFYTDRDMYLVAQIRKAIADV  751
             + +F+T ++    A+  +A+ D+
Sbjct  394   SYAFFTRKN----AKCARALIDI  412



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score =   344 bits (882),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 254/391 (65%), Gaps = 12/391 (3%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + ++    P P++ F D     +I++ IA   +T PT +QAQ  P+AL GRDL+G AETG
Sbjct  147   ITVEGRDVPKPIKMFHDANFPDNILEAIAKLGFTEPTPIQAQGWPMALKGRDLIGIAETG  206

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFS-RSLDSFKTA  1558
             SGKT A+ +P + H  AQP L + DGP+ LVLAPTRELA QI+ E + F  RS    ++ 
Sbjct  207   SGKTLAYLLPALVHVSAQPRLGQDDGPIVLVLAPTRELAVQIQEESRKFGLRS--GVRST  264

Query  1557  IVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFE  1378
              + GG   G Q  +LR GV IV+ATPGRLID L+  +T+L R++++VLDEADRMLDMGFE
Sbjct  265   CIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVLDEADRMLDMGFE  324

Query  1377  PQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEK  1201
             PQIR+++  +    QTLL+SAT P E+E+LA+++L DP +  +G+       ++ Q++E 
Sbjct  325   PQIRKIISQIRPDRQTLLWSATWPREVESLARQFLRDPYKAIIGSTDLKANQSINQVIEI  384

Query  1200  VPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHG  1021
             VP  EK DRLL LL + S  ++         ++FVE K  C++V   L   G  A A+HG
Sbjct  385   VPTPEKYDRLLKLLKQLSDGSK--------ILIFVETKRGCDQVTRQLRMDGWPALAIHG  436

Query  1020  GRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTG  841
              ++QSER+  L +F+ G + I+ ATDVA+RGLDV  +  V+N D P ++EDY+HRIGRTG
Sbjct  437   DKTQSERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTG  496

Query  840   RAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             RAG+ G A +F+T  +     ++ K + + G
Sbjct  497   RAGAKGMAFTFFTHDNAKFARELIKILQEAG  527



>gb|ERL94437.1| hypothetical protein D910_11714, partial [Dendroctonus ponderosae]
Length=522

 Score =   342 bits (877),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 181/422 (43%), Positives = 266/422 (63%), Gaps = 17/422 (4%)
 Frame = -3

Query  1989  PSERVLLFK---LEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHD  1819
             P  R+ +     L++ EE++ +  ++  + +    AP P++SF +      ++  +    
Sbjct  56    PLRRIFMLNMISLDKDEEVK-KYCLEKGITVQGK-APKPIQSFHEANFPDYVLDAVVAQG  113

Query  1818  YTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVL  1639
             Y  PTS+QAQ  P+ALSG+D++G A+TGSGKT A+ +P I H   Q  ++RG+GP+ L+L
Sbjct  114   YEYPTSIQAQGWPIALSGQDMVGIAQTGSGKTLAYILPAIVHINNQCDVQRGEGPIVLIL  173

Query  1638  APTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHL  1459
             APTRELAQQI+    AF ++    +   V GG   G Q  +L  GV I +ATPGRLID L
Sbjct  174   APTRELAQQIQQVAHAFGKT-SRIRNTCVFGGAPKGPQARDLERGVEICIATPGRLIDFL  232

Query  1458  QQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQE  1279
             ++G T+L R +++VLDEADRMLDMGFEPQIR+V+  +    QTL++SAT P E++ LA +
Sbjct  233   ERGTTNLERCTYLVLDEADRMLDMGFEPQIRKVLSQIRPDRQTLMWSATWPKEVKKLALD  292

Query  1278  YLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIV  1102
             ++   V++ VG++  S   N+ QI++   E+EK  +L +LL E +   +    P S  I+
Sbjct  293   FMKSYVQLNVGSLELSANHNIMQIVDVCQEHEKDIKLNNLLQEIAITLD----PASKIII  348

Query  1101  FVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLD  922
             FVE K K E V   +   G  A ++HG +SQ +R+  L++FR G  SILVATDVA+RGLD
Sbjct  349   FVETKKKVEGVTRNIRGSGWRAVSMHGDKSQDQRDYVLKEFRNGKASILVATDVAARGLD  408

Query  921   VNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT------DRDMYLVAQIRKAI  760
             V+G+ +V+N D P + EDY+HRIGRTGR  STG + +F+T       +D+  V Q  K I
Sbjct  409   VDGIKYVVNYDYPHSSEDYIHRIGRTGRCNSTGTSYAFFTPSNSKHAKDLISVLQEAKQI  468

Query  759   AD  754
              D
Sbjct  469   VD  470



>ref|XP_008209139.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Nasonia vitripennis]
Length=576

 Score =   344 bits (882),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 237/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      +M++I   ++  PTS+QAQ  P+ALSGRD++G A TG
Sbjct  97    ITLKGKGIPNPVFTFEEAGFPEYVMREIKRQNFKEPTSIQAQGWPIALSGRDMVGIASTG  156

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    K   
Sbjct  157   SGKTLSYILPAIVHINSQPKLCRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIKNTC  215

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  216   LYGGAPKGSQARDLDNGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  275

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+E+L D  ++ VG++  S   N+ QI++  
Sbjct  276   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEEFLKDYAQINVGSLQLSANHNILQIIDVC  335

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E EK  +L  LL E  A+ E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  336   QEYEKEIKLSTLLKEIMAEKENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  389

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  390   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  449

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  450   RQKTGTAYTFFT  461



>ref|XP_001605403.2| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X3 [Nasonia vitripennis]
Length=574

 Score =   344 bits (882),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 237/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      +M++I   ++  PTS+QAQ  P+ALSGRD++G A TG
Sbjct  97    ITLKGKGIPNPVFTFEEAGFPEYVMREIKRQNFKEPTSIQAQGWPIALSGRDMVGIASTG  156

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    K   
Sbjct  157   SGKTLSYILPAIVHINSQPKLCRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIKNTC  215

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  216   LYGGAPKGSQARDLDNGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  275

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+E+L D  ++ VG++  S   N+ QI++  
Sbjct  276   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEEFLKDYAQINVGSLQLSANHNILQIIDVC  335

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E EK  +L  LL E  A+ E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  336   QEYEKEIKLSTLLKEIMAEKENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  389

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  390   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  449

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  450   RQKTGTAYTFFT  461



>ref|XP_003397328.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus 
terrestris]
Length=713

 Score =   348 bits (892),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/397 (43%), Positives = 259/397 (65%), Gaps = 8/397 (2%)
 Frame = -3

Query  1935  RLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDL  1756
             + ++   + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL
Sbjct  88    KYHIGKEITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDL  147

Query  1755  LGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSL  1576
             +G A+TGSGKT A+ +P   H   QP L RG+GP+ L+LAPTRELAQQI++  + F  S 
Sbjct  148   VGIAQTGSGKTLAYILPATVHINNQPRLNRGEGPIVLILAPTRELAQQIQSVARDFGSS-  206

Query  1575  DSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRM  1396
                +   + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRM
Sbjct  207   SCIRNTCIFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRM  266

Query  1395  LDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANV  1219
             LDMGFEPQIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+
Sbjct  267   LDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNI  326

Query  1218  AQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLL  1039
              QI+E   E+EK  +L  LL E     +  G   S  I+FVE K K +++ +A+ ++G  
Sbjct  327   RQIIEICQEHEKETKLSGLLREI---GKDRG---SKMIIFVETKKKVDDITKAIKREGWP  380

Query  1038  ATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVH  859
             A ++HG +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+H
Sbjct  381   AISIHGDKSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIH  440

Query  858   RIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             RIGRTGR  S G A +++T  +     ++   + + G
Sbjct  441   RIGRTGRCQSAGTAYAYFTPNNARQAKELISVLEEAG  477



>ref|XP_003646993.1| hypothetical protein Ecym_5422 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET40176.1| hypothetical protein Ecym_5422 [Eremothecium cymbalariae DBVPG#7215]
Length=560

 Score =   343 bits (880),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/374 (46%), Positives = 245/374 (66%), Gaps = 8/374 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ +F +      ++K++    +  PT++Q Q  P+ALSGRD++G A TGSGKT ++ 
Sbjct  119   PKPIRTFDEAGFPEYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYC  178

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    +   V GG    
Sbjct  179   LPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHS-SRIRNTCVYGGVPKS  237

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L+ GV I++ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  238   QQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQ  297

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA++YL DP++V +G++  + +  + QI+E + + EK DR
Sbjct  298   IRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQIVEVISDFEKRDR  357

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L+  L   S        P S  I+F   K  C+++   L + G  A A+HG + Q ER+ 
Sbjct  358   LVKHLDIASKD------PESKIIIFASTKRTCDDITSYLRQDGWPALAIHGDKQQQERDW  411

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L +FR G + I+VATDVA+RG+DV G+  VIN D+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  412   VLNEFRCGRSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAI  471

Query  813   SFYTDRDMYLVAQI  772
             SF+T++   L AQ+
Sbjct  472   SFFTEQSKALGAQL  485



>ref|XP_003491789.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus 
impatiens]
Length=712

 Score =   348 bits (892),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/397 (43%), Positives = 259/397 (65%), Gaps = 8/397 (2%)
 Frame = -3

Query  1935  RLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDL  1756
             + ++   + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL
Sbjct  86    KYHIGKEITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDL  145

Query  1755  LGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSL  1576
             +G A+TGSGKT A+ +P   H   QP L RG+GP+ L+LAPTRELAQQI++  + F  S 
Sbjct  146   VGIAQTGSGKTLAYILPATVHINNQPRLNRGEGPIVLILAPTRELAQQIQSVARDFGSS-  204

Query  1575  DSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRM  1396
                +   + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRM
Sbjct  205   SCIRNTCIFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRM  264

Query  1395  LDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANV  1219
             LDMGFEPQIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+
Sbjct  265   LDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNI  324

Query  1218  AQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLL  1039
              QI+E   E+EK  +L  LL E     +  G   S  I+FVE K K +++ +A+ ++G  
Sbjct  325   RQIIEICQEHEKETKLSGLLREI---GKDRG---SKMIIFVETKKKVDDITKAIKREGWP  378

Query  1038  ATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVH  859
             A ++HG +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+H
Sbjct  379   AISIHGDKSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIH  438

Query  858   RIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             RIGRTGR  S G A +++T  +     ++   + + G
Sbjct  439   RIGRTGRCQSAGTAYAYFTPNNARQAKELISVLEEAG  475



>ref|XP_001602045.2| PREDICTED: ATP-dependent RNA helicase dbp2-like isoform X1 [Nasonia 
vitripennis]
 ref|XP_008214328.1| PREDICTED: ATP-dependent RNA helicase dbp2-like isoform X2 [Nasonia 
vitripennis]
Length=634

 Score =   345 bits (886),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 177/375 (47%), Positives = 241/375 (64%), Gaps = 8/375 (2%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D  + +     P P   F +      ++ +I    +  PT++QAQ  P+ALSGRD++G A
Sbjct  110   DKEITIKGTNVPGPNIYFEEGGFPDYVLNEIRRQGFGEPTAIQAQGWPIALSGRDMVGIA  169

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFK  1564
             +TGSGKT A+ +P I H   QP L+RGDGP+ALVLAPTRELAQQI+     F  S    +
Sbjct  170   QTGSGKTLAYILPAIVHINNQPRLQRGDGPIALVLAPTRELAQQIQQVAADFGVS-SQVR  228

Query  1563  TAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMG  1384
                + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMG
Sbjct  229   NTCIFGGAPKGPQARDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLDEADRMLDMG  288

Query  1383  FEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQIL  1207
             FEPQIR+++  +    QTL++SAT P E+  LA+E+LTD +++ +G++  +   N+ QI+
Sbjct  289   FEPQIRKIIEQIRPDRQTLMWSATWPKEVRNLAEEFLTDYIQINIGSLQLAANHNILQIV  348

Query  1206  EKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATAL  1027
             +   E EK  +L+ LL E S +AE        TI+FVE K K +E+  A+ + G  A  +
Sbjct  349   DVCEEYEKEGKLMKLLEEISQEAENK------TIIFVETKRKVDEITRAINRYGWQAIGI  402

Query  1026  HGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGR  847
             HG +SQ ER+  L  FR   ++ILVATDVA+RGLDV  V  VINLD P   EDYVHRIGR
Sbjct  403   HGDKSQQERDYVLNQFRSSRSAILVATDVAARGLDVEDVKFVINLDYPSNSEDYVHRIGR  462

Query  846   TGRAGSTGQATSFYT  802
             TGR+  TG A +F+T
Sbjct  463   TGRSQRTGTAYAFFT  477



>ref|XP_010554902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Tarenaya 
hassleriana]
Length=611

 Score =   344 bits (883),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 217/503 (43%), Positives = 285/503 (57%), Gaps = 31/503 (6%)
 Frame = -3

Query  2232  SYVPPHLRNSTTATTVVSNGGDHLHSELNSR---QLPSFTQSKNGFISNGEYCSNDAGR-  2065
             +YVPPHLRN  T+   V+      H+  N R     PS         + G     DAGR 
Sbjct  29    AYVPPHLRNMQTSAEQVA------HASANGRVGYSGPSGGSRWATGGAGGGGYRTDAGRP  82

Query  2064  -----NSCATVNYLSPRGLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDS  1900
                        N  S         V P    +E    F  ++   I      D+ V    
Sbjct  83    GYGGQQGDGGWNNRSRGWDRREREVNPFGDEAELEQPFTEQENTGINFDAYEDIPVETSG  142

Query  1899  NPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTA  1720
             +  P PV +F ++ L  ++  +I    Y  PT VQ  A+P+ LSGRDL+ CA+TGSGKTA
Sbjct  143   DNVPPPVNTFAEIDLGEALNLNIRRCKYVKPTPVQRNAIPILLSGRDLMACAQTGSGKTA  202

Query  1719  AFTIPMIQHCLAQPPLRRGDG-----PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             AF  P+I   + +P ++R  G     PLAL+L+PTRELA QI  E + FS      K  +
Sbjct  203   AFCFPIISGIMKEPYVQRPRGSRTVYPLALILSPTRELACQIHDEARKFSYQT-GVKVVV  261

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
               GGT I  Q  EL  GV+I+VATPGRL D L++   SL  I F+ LDEADRMLDMGFEP
Sbjct  262   AYGGTPINQQLRELERGVDILVATPGRLNDLLERARISLQMIRFLALDEADRMLDMGFEP  321

Query  1374  QIREVMH--NLPKK--HQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQIL  1207
             QIR+++   ++P     QT+LFSAT P EI+ LA ++L++ + + VG V S T  + Q +
Sbjct  322   QIRKIVEQMDMPPSGVRQTMLFSATFPREIQRLASDFLSNYIFLAVGRVGSSTELIVQRV  381

Query  1206  EKVPENEKIDRLLDLL--VEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLAT  1033
             E V E++K   L+DLL    ES   +K     +LT+VFVE K   + +   L   G  AT
Sbjct  382   EFVHESDKRSHLMDLLHAQRESGIQDKQ----ALTLVFVETKKGADSLEHWLCMNGFPAT  437

Query  1032  ALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRI  853
             ++HG RSQ ERE ALR F+ G T ILVATDVA+RGLD+  VAHV+N DLP  ++DYVHRI
Sbjct  438   SIHGDRSQQEREVALRSFKSGRTPILVATDVAARGLDIPHVAHVVNFDLPNDVDDYVHRI  497

Query  852   GRTGRAGSTGQATSFYTDRDMYL  784
             GRTGRAG TG AT+F+ D +  L
Sbjct  498   GRTGRAGKTGLATAFFNDNNTSL  520



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score =   341 bits (874),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 255/387 (66%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R +  + V    +    P PV+SF D+     +++++    +T PT +Q+Q  P+
Sbjct  75    EVEEYRKKREITV----EGRDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPM  130

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  131   ALKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA  190

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++V
Sbjct  191   SKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLV  249

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ S
Sbjct  250   LDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-S  308

Query  1236  SPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++  
Sbjct  309   DLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQITR  360

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  361   QLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFP  420

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A SF+T
Sbjct  421   GSLEDYVHRIGRTGRAGAKGTAYSFFT  447



>gb|EGI65460.1| Putative ATP-dependent RNA helicase DDX17 [Acromyrmex echinatior]
Length=706

 Score =   347 bits (890),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 248/372 (67%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  95    ITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTG  154

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   QP L RGDGP+ L+LAPTRELAQQI+T  + F  S    +   
Sbjct  155   SGKTLAYILPATVHINHQPRLSRGDGPIVLILAPTRELAQQIQTVARDFGSS-SCIRNTC  213

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  214   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEP  273

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++L+D +++ +G+++ +   N+ QI+E  
Sbjct  274   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLSDYIQINIGSLTLAANHNIRQIVEIC  333

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E   +        S  I+FVE K K +++ + + ++G  A ++HG 
Sbjct  334   QEHEKEMKLSQLLREIGTERG------SKMIIFVETKKKVDDITKTIKREGWSAISIHGD  387

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR
Sbjct  388   KSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGR  447

Query  837   AGSTGQATSFYT  802
               S G A +++T
Sbjct  448   CQSAGTAYAYFT  459



>gb|EZA54645.1| putative ATP-dependent RNA helicase DDX17 [Cerapachys biroi]
Length=706

 Score =   347 bits (890),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 254/390 (65%), Gaps = 8/390 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +  N  P+P+++F +      +M++I    +  PT++QAQ  P+ALSGRDL+G A+TG
Sbjct  96    ITVKGNNTPSPIQAFEESNFPDYVMEEIRKQGFAEPTAIQAQGWPIALSGRDLVGIAQTG  155

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P   H   Q  L RGDGP+ L+LAPTRELAQQI+T  + F  S    +   
Sbjct  156   SGKTLAYILPATVHINHQSRLSRGDGPIVLILAPTRELAQQIQTVARDFGSS-SCIRNTC  214

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG+  G Q  +L  GV I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEP
Sbjct  215   IFGGSPKGPQARDLERGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMGFEP  274

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E++ALA+++LTD +++ +G+++ +   N+ QI+E  
Sbjct  275   QIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLTDYIQINIGSLNLAANHNIRQIIEIC  334

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L  LL E   +        S  I+FVE K K +++ +A+ ++G  A ++HG 
Sbjct  335   QEHEKEMKLSQLLREIGTERG------SKMIIFVETKKKVDDITKAIKREGWPAISIHGD  388

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FR G T ILVATDVA+RGLDV  V +VIN D P + EDY+HRIGRTGR
Sbjct  389   KSQPERDYVLSEFRNGKTMILVATDVAARGLDVEDVKYVINFDYPNSSEDYIHRIGRTGR  448

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
               S G A +++T  +     ++   + + G
Sbjct  449   CQSAGTAYAYFTPNNARQAKELIAVLEEAG  478



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score =   341 bits (874),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 251/387 (65%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++ E RLR  + V    +    P PV+SF+D      +++++    +  PT +Q+Q  P+
Sbjct  75    EVNEYRLRREITV----EGKDVPKPVQSFSDAAFPDYVLQEVKKAGFVEPTPIQSQGWPM  130

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  131   ALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILDPGDGPIVLVLAPTRELAVQIQQEA  190

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID L+  +T+L R++++V
Sbjct  191   TKFGAS-SRIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLV  249

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++  +    QTL +SAT P E+E LA+++L +P +V +G+  
Sbjct  250   LDEADRMLDMGFDPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGS-E  308

Query  1236  SPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN  + Q ++ VPE +K D+L+ LL E+           S  ++F++ K  C+++  
Sbjct  309   ELKANHAIKQYVDIVPEKQKYDKLVKLL-EDIMDG-------SRILIFMDTKKGCDQITR  360

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  361   QLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFP  420

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  421   GSLEDYVHRIGRTGRAGAKGTAYTFFT  447



>ref|XP_007013410.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY31029.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=628

 Score =   345 bits (884),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 185/394 (47%), Positives = 251/394 (64%), Gaps = 13/394 (3%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V       P PV++F ++ L   + ++I    +  PT +Q  A+P+ ++GRDL+ CA
Sbjct  108   DIPVQASGENIPPPVQTFAEIDLGHVLKQNIKRCKFLKPTPIQRHAIPIVIAGRDLMACA  167

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPLRRGDG------PLALVLAPTRELAQQIETEVKAFSR  1582
             +TGSGKTAAF  P+I   L    L    G      PLAL+LAPTREL+ QI  E K F+ 
Sbjct  168   QTGSGKTAAFCFPIICGVLKDRLLLSIPGGSQVACPLALILAPTRELSCQIHEEAKKFAY  227

Query  1581  SLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEAD  1402
                  K  +  GGT I  Q   +  GV+I+VATPGRL+D +++   SL  I ++ LDEAD
Sbjct  228   RT-GVKIVVAYGGTPISQQFRNIEKGVDILVATPGRLVDMIERARVSLRMIKYLALDEAD  286

Query  1401  RMLDMGFEPQIREVMHNL----PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSS  1234
             RMLDMGFEPQIR+++  +    P   QT+LFSAT P EI+ LA ++L+D V + VG V S
Sbjct  287   RMLDMGFEPQIRKIVEKMDMPPPGTRQTMLFSATFPDEIQKLASDFLSDYVFLAVGRVGS  346

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
              T  + Q +E V + +K + LL+LL  +     +S HP  LT+VFVE K   +E+   L 
Sbjct  347   STDLIVQRVEIVQDMDKRNHLLNLLHAQKYNGSRSKHP--LTLVFVETKRGADELEHWLS  404

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             + G  A A+HGG+ Q ERE ALR F+ G T ILVATDVASRGLD+  VAHVIN DLPK +
Sbjct  405   RNGFPAIAIHGGKVQMERELALRSFKSGATPILVATDVASRGLDIPHVAHVINFDLPKNI  464

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             +DYVHRIGRTGRAG+ G AT+F++D+++ L   +
Sbjct  465   DDYVHRIGRTGRAGNCGLATAFFSDKNLPLAKSL  498



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 ref|XP_004154799.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score =   341 bits (874),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 181/389 (47%), Positives = 253/389 (65%), Gaps = 20/389 (5%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R R  + V    +    P PV+SF D+     +M++IA   +T PT +Q+Q  P+
Sbjct  77    EVEEYRQRREITV----EGRDVPKPVKSFRDVGFPDYVMQEIAKAGFTEPTPIQSQGWPM  132

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  133   ALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILSPGDGPIVLVLAPTRELAVQIQQEA  192

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K   V GG   G Q  +L+ GV IV+ATPGRLID ++  +T+L R++++V
Sbjct  193   TKFGAS-SKIKNTCVYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESHHTNLRRVTYLV  251

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++  +    QTL +SAT P E+E LA+++L +P +V +G   
Sbjct  252   LDEADRMLDMGFDPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIG---  308

Query  1236  SP--TAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEV  1069
             SP   AN  + Q ++ V EN+K ++L+ LL E+           S  ++F++ K  C+++
Sbjct  309   SPDLKANHAIRQHVDIVSENQKYNKLVKLL-EDIMDG-------SRILIFMDTKKGCDQI  360

Query  1068  AEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLD  889
                L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D
Sbjct  361   TRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYD  420

Query  888   LPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
              P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  421   FPGSLEDYVHRIGRTGRAGAKGTAYTFFT  449



>ref|XP_003493914.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus 
impatiens]
Length=566

 Score =   342 bits (878),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/397 (45%), Positives = 248/397 (62%), Gaps = 12/397 (3%)
 Frame = -3

Query  1989  PSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTI  1810
             P E V    L  +E+ R     +  + +     P PV +F +      ++K+I    +T 
Sbjct  74    PHEAVQNRDLRIVEQYR----SEKEITLKGKNIPNPVFTFEETGFPDYVLKEIKRQGFTE  129

Query  1809  PTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPT  1630
             PTS+QAQ  P+ALSGRD++G A TGSGKT ++ +P I H  +QP L R DGP+ALVLAPT
Sbjct  130   PTSIQAQGWPIALSGRDMVGIASTGSGKTLSYILPAIVHINSQPKLGRKDGPIALVLAPT  189

Query  1629  RELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQG  1450
             RELAQQI+     F  S    +   + GG   G Q  +L  GV IV+ATPGRL+D L+ G
Sbjct  190   RELAQQIQQVADDFGHS-SGIRNTCLYGGAPKGAQARDLDGGVEIVIATPGRLLDFLESG  248

Query  1449  NTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLT  1270
              T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E++ LA+++L 
Sbjct  249   RTNLKRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKNLAEDFLK  308

Query  1269  DPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVE  1093
             D  ++ VG++  +   N+ QI++   + EK ++L  LL E  A++E        TIVF+E
Sbjct  309   DYAQINVGSLQLAANHNILQIIDVCQDYEKENKLSTLLKEIMAESENK------TIVFIE  362

Query  1092  RKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNG  913
              K + +E+   + + G  A  +HG ++Q ER+  L+DFR G   ILVATDVA+RGLDV  
Sbjct  363   TKRRVDEITRKMKRDGWPAVCIHGDKTQQERDWVLQDFRSGKAPILVATDVAARGLDVED  422

Query  912   VAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             V  VIN D P   EDYVHRIGRTGR   TG A +F+T
Sbjct  423   VKFVINFDYPSCSEDYVHRIGRTGRRQKTGTAYTFFT  459



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score =   340 bits (873),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 255/387 (66%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R +  + V    +    P PV+SF D+     +++++    +T PT +Q+Q  P+
Sbjct  75    EVEEYRKKREITV----EGRDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPM  130

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  131   ALKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA  190

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++V
Sbjct  191   SKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLV  249

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ S
Sbjct  250   LDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-S  308

Query  1236  SPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++  
Sbjct  309   DLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQITR  360

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  361   QLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFP  420

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A SF+T
Sbjct  421   GSLEDYVHRIGRTGRAGAKGTAYSFFT  447



>ref|XP_395774.2| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X4 [Apis mellifera]
 ref|XP_006619256.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X3 [Apis dorsata]
Length=566

 Score =   342 bits (878),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 239/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      ++K+I    +T PTS+QAQ  P+ALSGRD++G A TG
Sbjct  95    ITLKGKNIPNPVFTFEETGFPDYVLKEIKRQGFTEPTSIQAQGWPIALSGRDMVGIASTG  154

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  155   SGKTLSYILPAIVHINSQPKLGRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTC  213

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  214   LYGGAPKGAQARDLDGGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  273

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+++L D  ++ VG++  +   N+ QI++  
Sbjct  274   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLAANHNILQIIDVC  333

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              + EK ++L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  334   QDYEKENKLSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  387

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  388   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  447

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  448   RQKTGTAYTFFT  459



>ref|XP_003690078.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis 
florea]
Length=566

 Score =   342 bits (878),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 239/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      ++K+I    +T PTS+QAQ  P+ALSGRD++G A TG
Sbjct  95    ITLKGKNIPNPVFTFEETGFPDYVLKEIKRQGFTEPTSIQAQGWPIALSGRDMVGIASTG  154

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  155   SGKTLSYILPAIVHINSQPKLGRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTC  213

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  214   LYGGAPKGAQARDLDGGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  273

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+++L D  ++ VG++  +   N+ QI++  
Sbjct  274   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLAANHNILQIIDVC  333

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              + EK ++L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  334   QDYEKENKLSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  387

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  388   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  447

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  448   RQKTGTAYTFFT  459



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score =   340 bits (873),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 253/389 (65%), Gaps = 20/389 (5%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R R  + V    +    P PV+SF D+     +M++IA   +T PT +Q+Q  P+
Sbjct  77    EVEEYRQRREITV----EGRDVPKPVKSFRDVGFPDYVMQEIAKAGFTEPTPIQSQGWPM  132

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  133   ALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILSPGDGPIVLVLAPTRELAVQIQQEA  192

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K   + GG   G Q  +L+ GV IV+ATPGRLID ++  +T+L R++++V
Sbjct  193   TKFGAS-SKIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESHHTNLRRVTYLV  251

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++  +    QTL +SAT P E+E LA+++L +P +V +G   
Sbjct  252   LDEADRMLDMGFDPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIG---  308

Query  1236  SP--TAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEV  1069
             SP   AN  + Q ++ V EN+K ++L+ LL E+           S  ++F++ K  C+++
Sbjct  309   SPDLKANHAIRQHVDIVSENQKYNKLVKLL-EDIMDG-------SRILIFMDTKKGCDQI  360

Query  1068  AEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLD  889
                L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D
Sbjct  361   TRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYD  420

Query  888   LPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
              P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  421   FPGSLEDYVHRIGRTGRAGAKGTAYTFFT  449



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score =   340 bits (873),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/389 (47%), Positives = 252/389 (65%), Gaps = 20/389 (5%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE RLR  + V    +    P PV+SF D+     +M+++    +T PT +QAQ  P+
Sbjct  81    EVEEYRLRREITV----EGKDVPKPVKSFDDVGFPDYVMQEVVKAGFTEPTPIQAQGWPM  136

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  137   ALKGRDLIGIAETGSGKTIAYLLPAIVHVNAQPFLAPGDGPIVLVLAPTRELAVQIQQEA  196

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV +V+ATPGRLID L+  +T+L R++++V
Sbjct  197   TKFGAS-SKIKSTCIYGGVPKGPQVRDLQKGVEVVIATPGRLIDMLESHHTNLRRVTYLV  255

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL +SAT P E+E LA+  L +P +V +G   
Sbjct  256   LDEADRMLDMGFEPQIRKIVDQIRPDRQTLYWSATWPKEVEQLARRSLFNPYKVTIG---  312

Query  1236  SP--TAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEV  1069
             SP   AN  + Q +E V EN+K ++L+ LL E+           S  ++F++ K  C+++
Sbjct  313   SPDLKANHAIRQHVEIVSENQKYNKLVKLL-EDIMDG-------SRILIFMDTKKGCDQI  364

Query  1068  AEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLD  889
                L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D
Sbjct  365   TRQLRMDGWPALSIHGDKSQAERDWVLSEFRAGKSPIMTATDVAARGLDVKDVKYVINYD  424

Query  888   LPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
              P ++EDYVHRIGRTGRAG+ G A +++T
Sbjct  425   FPGSLEDYVHRIGRTGRAGAKGTAYTYFT  453



>ref|XP_006560268.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Apis mellifera]
 ref|XP_006619254.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Apis dorsata]
Length=576

 Score =   343 bits (879),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 239/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      ++K+I    +T PTS+QAQ  P+ALSGRD++G A TG
Sbjct  105   ITLKGKNIPNPVFTFEETGFPDYVLKEIKRQGFTEPTSIQAQGWPIALSGRDMVGIASTG  164

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  165   SGKTLSYILPAIVHINSQPKLGRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTC  223

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  224   LYGGAPKGAQARDLDGGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  283

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+++L D  ++ VG++  +   N+ QI++  
Sbjct  284   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLAANHNILQIIDVC  343

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              + EK ++L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  344   QDYEKENKLSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  397

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  398   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  457

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  458   RQKTGTAYTFFT  469



>emb|CCE27540.1| probable RNA helicase dbp2 (DEAD box protein) [Claviceps purpurea 
20.1]
Length=562

 Score =   342 bits (877),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/386 (45%), Positives = 246/386 (64%), Gaps = 12/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R +  + +A     +  P PVE+F +      +M ++    +  PT++Q+Q  P+
Sbjct  129   EVEEFRRKHKMTIA----GSDVPKPVETFDEAAFPRYVMDEVKAQGFPAPTAIQSQGWPM  184

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSGRD++G AETGSGKT  + +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E+
Sbjct  185   ALSGRDMVGIAETGSGKTLTYCLPSIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQQEI  244

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F RS    +   V GG   G Q  +L  GV + +ATPGRLID L+ G T+L R++++V
Sbjct  245   TKFGRS-SRIRNTCVYGGVPKGPQIRDLSRGVEVCIATPGRLIDMLEAGKTNLRRVTYLV  303

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+ A+A ++LTD ++V +G++ 
Sbjct  304   LDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVRAMASDFLTDFIQVNIGSMD  363

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S    + QI+E V ENEK D+++  L +     E         ++FV  K   +E+   
Sbjct  364   LSANHRITQIVEVVSENEKRDKMIQHLEKTMENKENK------ILIFVGTKRVADEITRF  417

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             L + G  A ++HG + Q+ER+  L  F+ G + I+VATDVASRG+DV  + HV+N D P 
Sbjct  418   LRQDGWPALSIHGDKQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPN  477

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
               EDY+HRIGRTGRAG+ G A +F+T
Sbjct  478   NSEDYIHRIGRTGRAGANGTAITFFT  503



>ref|XP_006621258.1| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Apis 
dorsata]
Length=607

 Score =   343 bits (881),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/402 (43%), Positives = 255/402 (63%), Gaps = 10/402 (2%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             E  + R N ++ +  D+   P P++ F +    P ++++I    Y+ PT++QAQ  P+AL
Sbjct  91    EVCQFRENAEITIKGDN--IPNPIQYFEEGNFPPYVLEEIHKQGYSQPTAIQAQGWPIAL  148

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+AL+LAPTRELAQQI+     
Sbjct  149   SGRDLVAIAQTGSGKTLGYVLPAIVHIIHQPRLSNGDGPIALILAPTRELAQQIQEVANC  208

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             F  +    +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VLD
Sbjct  209   FGEAA-GVRNTCIFGGAPKGPQAHDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLD  267

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++L+D + + +G+++ S
Sbjct  268   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLSDYMHLNIGSLTLS  327

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   + 
Sbjct  328   ANHNIIQIVDVCQEFEKDLKLYRLLQEIGNEKENK------TIIFVETKRKVDDITRNIR  381

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             + G  A ++HG ++Q ER+  L++F+ G   ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  382   RDGWQALSIHGDKNQQERDHVLQEFKSGRAPILVATDVAARGLDVDDVKYVINFDYPSSS  441

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  442   EDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  483



>ref|XP_002055665.1| GJ19487 [Drosophila virilis]
 gb|EDW65866.1| GJ19487 [Drosophila virilis]
Length=953

 Score =   352 bits (904),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 261/388 (67%), Gaps = 6/388 (2%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             + + E+R  L + V+     N  P PV +F +  L P I+ ++    +T PT++QAQ  P
Sbjct  214   QAVAEMRHELEITVS----GNELPHPVANFEESSLPPHIIDEMKRQGFTKPTAIQAQGWP  269

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +ALSGRDL+G A+TGSGKT A+ +P I H   QPP+ RG+GP+ALVLAPTRELAQQI++ 
Sbjct  270   IALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIMRGEGPIALVLAPTRELAQQIQSV  329

Query  1599  VKAFSRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISF  1423
             V+ +        +   + GG++   Q  +L  GV +++ATPGRLID L+  NT+L R ++
Sbjct  330   VRDYGHLCKPEIRHTCIFGGSSKVPQARDLERGVEVIIATPGRLIDFLENRNTNLQRCTY  389

Query  1422  VVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGN  1243
             +VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA ++L D +++ +G+
Sbjct  390   LVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGS  449

Query  1242  VS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             ++ S   N+ QI+E   ENEK  R++ LL + +     + +  +  I+FVE K K E++ 
Sbjct  450   MNLSANHNIRQIVEICNENEKPQRMVRLLKDIAPTTNNAANNGNKIIIFVETKIKVEDIL  509

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
             + +  +G  AT++HG +SQSER++ L+DFR G ++IL+ATDVASRGLDV  +  VIN D 
Sbjct  510   QIIRSEGYTATSIHGDKSQSERDSVLKDFRNGKSNILIATDVASRGLDVEDLQFVINYDY  569

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P + E+YVHRIGRTGR    G A +F+T
Sbjct  570   PNSSENYVHRIGRTGRCQQLGTAYTFFT  597



>ref|XP_006560269.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Apis mellifera]
 ref|XP_006619255.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X2 [Apis dorsata]
Length=573

 Score =   342 bits (878),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 239/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      ++K+I    +T PTS+QAQ  P+ALSGRD++G A TG
Sbjct  105   ITLKGKNIPNPVFTFEETGFPDYVLKEIKRQGFTEPTSIQAQGWPIALSGRDMVGIASTG  164

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   
Sbjct  165   SGKTLSYILPAIVHINSQPKLGRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTC  223

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  224   LYGGAPKGAQARDLDGGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  283

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+++L D  ++ VG++  +   N+ QI++  
Sbjct  284   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLAANHNILQIIDVC  343

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              + EK ++L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  344   QDYEKENKLSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  397

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  398   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  457

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  458   RQKTGTAYTFFT  469



>gb|KHG00046.1| DEAD-box ATP-dependent RNA helicase 52B [Gossypium arboreum]
Length=624

 Score =   344 bits (882),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 190/402 (47%), Positives = 254/402 (63%), Gaps = 21/402 (5%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V    +  P PV +F ++ L   + K+I   +Y  PT +Q  A+P+A++GRDL+ CA
Sbjct  109   DIPVQASGDNIPPPVATFAEIGLGDGLKKNIRRCNYLKPTPIQRYAIPIAVAGRDLMACA  168

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPLRRGDG-------------PLALVLAPTRELAQQIET  1603
             +TGSGKTAAF  P+I   L  P L  G G             PLAL+LAPTREL+ QI  
Sbjct  169   QTGSGKTAAFCFPIISGVLKDPSLVSGHGDGGGVGGSAAVACPLALILAPTRELSCQIFE  228

Query  1602  EVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISF  1423
             E K F+  +   K ++  GGT I  Q   L  GV+I+VATPGRL+D +++   SL  I +
Sbjct  229   EAKKFA-YMTGVKISVAYGGTPIYQQLRSLEKGVDILVATPGRLVDMIERARVSLGMIKY  287

Query  1422  VVLDEADRMLDMGFEPQIREVMHNL----PKKHQTLLFSATMPAEIEALAQEYLTDPVRV  1255
             + LDEADRMLDMGFEPQIR+++  +    P   QT+LFSAT P +I+ LA ++L+D + +
Sbjct  288   LALDEADRMLDMGFEPQIRKIVEQMDMPPPGTRQTMLFSATFPDDIQRLASDFLSDYIFL  347

Query  1254  KVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAE-KSGHPFSLTIVFVERKTKC  1078
              VG V S T  + Q +E V E +K   LLDLL  + + A   S H  +LT+VFVE K   
Sbjct  348   AVGRVGSSTDLIVQRVELVQEMDKRSHLLDLLRSQRSNATPHSKH--ALTLVFVETKRGA  405

Query  1077  EEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVI  898
              E+   L + G  A A+HG + Q ERE ALR F+ G T ILVATDVASRGLD+  VAHVI
Sbjct  406   NELERWLSRNGFPAIAMHGDKVQMEREQALRSFKSGATPILVATDVASRGLDIPHVAHVI  465

Query  897   NLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             N D+PK ++DYVHRIGRTGRAG  G AT+F++D++M L   +
Sbjct  466   NFDMPKNIDDYVHRIGRTGRAGKCGLATAFFSDKNMPLAKSL  507



>dbj|BAN20948.1| DEAD box ATP-dependent RNA helicase [Riptortus pedestris]
Length=776

 Score =   348 bits (893),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 251/395 (64%), Gaps = 20/395 (5%)
 Frame = -3

Query  1983  ERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPT  1804
             E V+LF+L +             + +  N  PAP + F +      +M +I    +  PT
Sbjct  143   EEVVLFRLSR------------EITVKGNRVPAPSQIFEEGNFPDYLMTEILRQGFNRPT  190

Query  1803  SVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRE  1624
             ++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P   H   Q  + RGDGP+AL+LAPTRE
Sbjct  191   AIQAQGWPIALSGRDLVGIAQTGSGKTLAYILPAAVHINHQERIARGDGPIALILAPTRE  250

Query  1623  LAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNT  1444
             LAQQI+T  + F  S    +   + GG   G Q  +L  GV IV+ATPGRLID L++G T
Sbjct  251   LAQQIQTVAQDFG-SPSMIRNTCIFGGAPKGPQARDLERGVEIVIATPGRLIDFLEKGIT  309

Query  1443  SLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDP  1264
             +L R +++VLDEADRMLDMGFEPQIR+++  +    Q L++SAT P E++ALA+++L D 
Sbjct  310   NLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVQALAEDFLNDY  369

Query  1263  VRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERK  1087
             V+V +G++  +   N+ QI+E V E+EK  RL  LL E   Q      P    I+FVE K
Sbjct  370   VQVNIGSLELAANHNIRQIIEIVEESEKESRLSSLLRELGQQ------PGFKAIIFVETK  423

Query  1086  TKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVA  907
              K +++ +A+  +  +A A+HG +SQ ER+  L +FR G + ILVATDVA+RGLDV  V 
Sbjct  424   KKVDDITKAIRSENWMAIAIHGDKSQQERDYVLTEFRNGKSPILVATDVAARGLDVEDVK  483

Query  906   HVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
              VIN D P T EDY+HRIGRTGR   +G A +F+T
Sbjct  484   FVINYDYPNTSEDYIHRIGRTGRCSQSGTAYTFFT  518



>ref|XP_004529456.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Ceratitis 
capitata]
Length=919

 Score =   352 bits (902),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 264/400 (66%), Gaps = 6/400 (2%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             + P +  L    + + E+R  L + V+     N  P PV +F +  L    ++++    +
Sbjct  167   YAPHQNTLNMSEQAVAELRNELEITVS----GNGIPHPVSTFEECSLPEYTIEEMKRQGF  222

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
             T PT++QAQ  P+ALSGRDL+G A+TGSGKT A+ +P + H   QPPL+RG+GP+ALVLA
Sbjct  223   TKPTAIQAQGWPIALSGRDLVGIAQTGSGKTLAYMLPAMVHIANQPPLQRGEGPIALVLA  282

Query  1635  PTRELAQQIETEVKAFSR-SLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHL  1459
             PTRELAQQI++ V+ +   S    +   + GG++   Q  +L  GV +++ATPGRLID L
Sbjct  283   PTRELAQQIQSVVRDYGHLSKPEIRHTCIFGGSSKIPQARDLERGVEVIIATPGRLIDFL  342

Query  1458  QQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQE  1279
             +  NT+L R +++VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA +
Sbjct  343   ENRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGD  402

Query  1278  YLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIV  1102
             +L D + + +G+++ S   N+ Q++E   E EK  R++ LL E +     + +  +  I+
Sbjct  403   FLKDYISINIGSMNLSANHNIRQMVEICQEVEKPQRIVKLLQEIAPTTNNAANNNNKIII  462

Query  1101  FVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLD  922
             FVE K K EE+ + +  +G  AT++HG +SQ ER++ L+DFR G ++IL+ATDVASRGLD
Sbjct  463   FVETKIKVEEILQIIRNEGYTATSIHGDKSQPERDSVLKDFRNGKSNILIATDVASRGLD  522

Query  921   VNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             V  + +VIN D P + E+YVHRIGRTGR    G A +F+T
Sbjct  523   VEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFT  562



>ref|XP_010534903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   337 bits (865),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 253/387 (65%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++E  R R  + V    +    P PV++F D+     +M++I    ++ PT++Q+Q  P+
Sbjct  5     EVENYRQRREITV----EGRDIPKPVKNFHDVGFPDYVMEEIVKAGFSEPTAIQSQGWPM  60

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  61    ALKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA  120

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID L+  +T+L R++++V
Sbjct  121   SKFGSS-SRIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLV  179

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL +SAT P E+E LA+++L +  +V +G+ S
Sbjct  180   LDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARKFLYNAYKVIIGS-S  238

Query  1236  SPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN  + QI++ + EN+K ++L+ LL E+           S  ++F++ K  C+++  
Sbjct  239   DLKANRAIRQIVDVISENQKYNKLVKLL-EDIMDG-------SRILIFLDTKKGCDQITR  290

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  291   QLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFP  350

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  351   GSLEDYVHRIGRTGRAGAKGTAYTFFT  377



>gb|EZA62386.1| putative ATP-dependent RNA helicase DDX17, partial [Cerapachys 
biroi]
Length=550

 Score =   342 bits (876),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/422 (43%), Positives = 256/422 (61%), Gaps = 17/422 (4%)
 Frame = -3

Query  2037  SPRGLVAPDPVFPQW-----KPSERVLLFKLEQIEEIRLRL----NVDVAVAMDSNPAPA  1885
             S RG    +   P+W     +P ++      + ++   LR+     V+  + +     P 
Sbjct  17    SSRGQPGANLRKPRWDLSRLEPFKKDFYIPHDAVQNRDLRIVEQYRVEKEITLRGKNIPN  76

Query  1884  PVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIP  1705
             PV  F +      ++K+I    ++ PTS+QAQ  P+ALSGRD++G A TGSGKT ++ +P
Sbjct  77    PVFDFDEAGFPDYVLKEIKRQGFSEPTSIQAQGWPIALSGRDMVGIASTGSGKTLSYILP  136

Query  1704  MIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQ  1525
              I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   + GG   G Q
Sbjct  137   AIVHINSQPKLSRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTCLYGGAPKGAQ  195

Query  1524  RSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLP  1345
               +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEPQIR+++  + 
Sbjct  196   ARDLDGGVEIVIATPGRLLDFLESGKTNLKRCTYLVLDEADRMLDMGFEPQIRKIIEQIR  255

Query  1344  KKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLL  1168
                QTL++SAT P E++ LA+++L D  ++ VG++  S   N+ QI++   + EK  +L 
Sbjct  256   PDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLSANHNILQIIDVCQDYEKETKLS  315

Query  1167  DLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAAL  988
              LL E  A++E        TIVF+E K + +E+   + + G  A  +HG ++Q ER+  L
Sbjct  316   TLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGDKTQQERDWVL  369

Query  987   RDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSF  808
             +DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR   TG A +F
Sbjct  370   QDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGRRQKTGTAYTF  429

Query  807   YT  802
             +T
Sbjct  430   FT  431



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score =   340 bits (871),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 249/373 (67%), Gaps = 12/373 (3%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P+AL GRDL+G AETG
Sbjct  85    ITVEGRDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWPMALRGRDLIGIAETG  144

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    K+  
Sbjct  145   SGKTLSYLLPAIVHVNAQPILSHGDGPIVLVLAPTRELAVQIQQEASKFGSS-SKIKSTC  203

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++VLDEADRMLDMGF+P
Sbjct  204   IYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESHNTNLRRVTYLVLDEADRMLDMGFDP  263

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVA--QILEK  1201
             QIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ S   AN A  QI+E 
Sbjct  264   QIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-SDLKANRAIRQIVEV  322

Query  1200  VPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHG  1021
             + E++K ++L+ LL E+           S  +VF++ K  C+++   L   G  A ++HG
Sbjct  323   ISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQITRQLRMDGWPALSIHG  374

Query  1020  GRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTG  841
              +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P ++EDYVHRIGRTG
Sbjct  375   DKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVMYVINYDFPGSLEDYVHRIGRTG  434

Query  840   RAGSTGQATSFYT  802
             RAG+ G A +F+T
Sbjct  435   RAGAKGTAYTFFT  447



>ref|XP_006656210.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 52A-like [Oryza 
brachyantha]
Length=603

 Score =   343 bits (880),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/395 (48%), Positives = 252/395 (64%), Gaps = 16/395 (4%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V +     P P   F    L  ++++++A   Y  PT VQ  A+P+AL+GRDL+ CA
Sbjct  65    DIPVEVSGEGVPPPAVGFEGAGLVEAVLRNVARCGYESPTPVQRYAIPIALAGRDLMACA  124

Query  1743  ETGSGKTAAFTIPMIQHCLAQP-----PLRRGD------GPLALVLAPTRELAQQIETEV  1597
             +TGSGKTAAF +P++   LA       P  R         P ALVLAPTRELA QI  E 
Sbjct  125   QTGSGKTAAFCLPVVSGLLAAGGSGIGPRERSSFNRAAAKPRALVLAPTRELAAQINEEA  184

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
             K FS      +  +  GGT + +Q  +L  G +I+VATPGRL+D +++   SL  I ++V
Sbjct  185   KKFSLQT-GLRVVVAYGGTPMYNQLRDLERGADILVATPGRLVDMVERSRLSLEAIKYLV  243

Query  1416  LDEADRMLDMGFEPQIREVMH--NLPKK--HQTLLFSATMPAEIEALAQEYLTDPVRVKV  1249
             +DEADRMLDMGFEPQIR ++   N+P+K   QT+LFSAT P EI+ LA ++L++ + + V
Sbjct  244   MDEADRMLDMGFEPQIRMIVERMNMPRKPMRQTMLFSATFPPEIQRLALDFLSNYIFITV  303

Query  1248  GNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEV  1069
             G V S T  + Q +E + + EK   LLDLL  +S     S     LT+VFVE K + + +
Sbjct  304   GRVGSSTDLIMQKVELLSDGEKRGYLLDLLQRQSVGVANSKLQQPLTLVFVETKREADSL  363

Query  1068  AEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLD  889
                L  +G   T++HGGR+Q ERE+ALR F+ G T I+VATDVASRGLDV  VAHVIN D
Sbjct  364   RYWLYSKGFPTTSIHGGRTQQERESALRSFKTGHTPIMVATDVASRGLDVPNVAHVINYD  423

Query  888   LPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYL  784
             LPK++EDYVHRIGRTGRAG  G AT+F+T+ D  L
Sbjct  424   LPKSIEDYVHRIGRTGRAGMAGSATAFFTESDHSL  458



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score =   339 bits (870),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/388 (46%), Positives = 253/388 (65%), Gaps = 16/388 (4%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             + +E+ R R  + V    +    P PV+SF D+     +M++IA   +  PT +Q+Q  P
Sbjct  76    KDVEDYRKRREITV----EGQDVPKPVKSFEDVGFPDYVMQEIAKAGFVEPTPIQSQGWP  131

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  132   MALKGRDLIGIAETGSGKTIAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  191

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    K   + GG   G Q  +L+ GV IV+ATPGRLID L+  +T+L R++++
Sbjct  192   ATKFGAS-SRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYL  250

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGFEPQIR+++  +    QTL +SAT P E+E LA+++L +  +V +G+ 
Sbjct  251   VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEHLARQFLYNAYKVIIGS-  309

Query  1239  SSPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
                 AN  + QI++ VPEN+K ++L++LL E+           S  ++F++ K  C+++ 
Sbjct  310   EDLKANHAIRQIVDIVPENKKYNKLVNLL-EDIMDG-------SRILIFMDTKKGCDQIT  361

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  362   RQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDF  421

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  422   PGSLEDYVHRIGRTGRAGAKGTAYTFFT  449



>gb|KFP69316.1| putative ATP-dependent RNA helicase DDX17, partial [Acanthisitta 
chloris]
Length=415

 Score =   337 bits (864),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 245/386 (63%), Gaps = 11/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE+R +  + +   M+    P PV +F        +M  +   ++T PT +Q Q  P+
Sbjct  1     EVEELRRKKEITIR-GMEG--CPKPVFAFHQCSFPQYVMDALMDQNFTEPTPIQCQGFPL  57

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSGRD++G A+TGSGKT A+ +P I H   QP L RGDGP+ LVLAPTRELAQQ++   
Sbjct  58    ALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVA  117

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               + +     K+  + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++V
Sbjct  118   DDYGKC-SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLV  176

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L D V++ VGN+ 
Sbjct  177   LDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINVGNLE  236

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   E+EK  +L+ L+ E  A+ E        TI+FVE K +C+++   
Sbjct  237   LSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK------TIIFVETKRRCDDLTRR  290

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG +SQ ER+  L +FR G   IL+ATDVASRGLDV  V  VIN D P 
Sbjct  291   MRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPN  350

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             + EDYVHRIGRT R+ + G A +F+T
Sbjct  351   SSEDYVHRIGRTARSTNKGTAYTFFT  376



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score =   340 bits (871),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/387 (45%), Positives = 251/387 (65%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++ E RLR  + V    +    P PV+SF+D      +++++    +  PT +Q+Q  P+
Sbjct  73    EVTEYRLRREITV----EGKDVPKPVKSFSDAAFPDYVLEEVKKAGFVEPTPIQSQGWPM  128

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  129   ALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILDPGDGPIVLVLAPTRELAVQIQQEA  188

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV I++ATPGRLID L+  +T+L R++++V
Sbjct  189   TKFGAS-SRIKSTCIYGGVPKGPQVRDLQKGVEIIIATPGRLIDMLESNHTNLRRVTYLV  247

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++  +    QTL +SAT P E+E LA+++L +P +V +G+  
Sbjct  248   LDEADRMLDMGFDPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGS-E  306

Query  1236  SPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN  + Q ++ VPE +K D+L+ LL E+           S  ++F++ K  C+++  
Sbjct  307   DLKANHAIKQYVDIVPEKQKYDKLVKLL-EDIMDG-------SRILIFMDTKKGCDQITR  358

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  359   QLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFP  418

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  419   GSLEDYVHRIGRTGRAGAKGTAYTFFT  445



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score =   340 bits (872),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/388 (46%), Positives = 253/388 (65%), Gaps = 16/388 (4%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             + +E+ R R  + V    +    P PV+SF D+     +M++IA   +  PT +Q+Q  P
Sbjct  76    KDVEDYRKRREITV----EGQDVPKPVKSFEDVGFPDYVMQEIAKAGFVEPTPIQSQGWP  131

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  132   MALKGRDLIGIAETGSGKTIAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  191

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    K   + GG   G Q  +L+ GV IV+ATPGRLID L+  +T+L R++++
Sbjct  192   ATKFGAS-SRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYL  250

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGFEPQIR+++  +    QTL +SAT P E+E LA+++L +  +V +G+ 
Sbjct  251   VLDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEHLARQFLYNAYKVIIGS-  309

Query  1239  SSPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
                 AN  + QI++ VPEN+K ++L++LL E+           S  ++F++ K  C+++ 
Sbjct  310   EDLKANHAIRQIVDIVPENKKYNKLVNLL-EDIMDG-------SRILIFMDTKKGCDQIT  361

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  362   RQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDF  421

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  422   PGSLEDYVHRIGRTGRAGAKGTAYTFFT  449



>ref|NP_572424.1| CG10777, isoform B [Drosophila melanogaster]
 ref|NP_001284994.1| CG10777, isoform C [Drosophila melanogaster]
 gb|AAF46295.1| CG10777, isoform B [Drosophila melanogaster]
 gb|AAL25443.1| LD32873p [Drosophila melanogaster]
 gb|ACL86342.1| CG10777-PB, partial [synthetic construct]
 gb|AHN59465.1| CG10777, isoform C [Drosophila melanogaster]
Length=945

 Score =   352 bits (903),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 264/388 (68%), Gaps = 7/388 (2%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             +Q+ EIR  L + V+     N  P PV SF +  L   +++++    +T PT++Q+Q  P
Sbjct  214   QQVAEIRRELEITVS----GNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWP  269

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +ALSGRDL+G A+TGSGKT A+ +P I H   QPP+ RG+GP+ALVLAPTRELAQQI++ 
Sbjct  270   IALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSV  329

Query  1599  VKAFSRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISF  1423
             V+ +        +   + GG++   Q  +L  GV +++ATPGRLID L+  NT+L R ++
Sbjct  330   VRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENRNTNLQRCTY  389

Query  1422  VVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGN  1243
             +VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA ++L D +++ +G+
Sbjct  390   LVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGS  449

Query  1242  VS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             ++ S   N+ QI+E   E EK  RL+ LL E S   + SG+  +  IVFVE K K E++ 
Sbjct  450   MNLSANHNIRQIVEICTEIEKPQRLVCLLNEISP-IKNSGNNGNKIIVFVETKIKVEDIL  508

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
             + +  +G  AT++HG ++Q+ER++ L+DFR G ++IL+ATDVASRGLDV  + +VIN D 
Sbjct  509   QIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDY  568

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P + E+YVHRIGRTGR    G A +F+T
Sbjct  569   PNSSENYVHRIGRTGRCQQLGTAYTFFT  596



>gb|AHG63129.1| ATP-dependent RNA helicase RhlE [Advenella mimigardefordensis 
DPN7]
Length=473

 Score =   339 bits (869),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 243/382 (64%), Gaps = 25/382 (7%)
 Frame = -3

Query  1878  ESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMI  1699
             ESFT++ LHP ++K +    YT PT +QAQAMP+ + GRD++G A+TG+GKTAAFT+P++
Sbjct  16    ESFTEVGLHPDLLKAVMASGYTKPTPIQAQAMPLIMDGRDIMGAAQTGTGKTAAFTLPLL  75

Query  1698  QHCL---------AQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVG  1546
                +         A+ P+R      AL+LAPTRELA Q+   VK +S S    + A+V G
Sbjct  76    HRLMPTANSSMSPARHPVR------ALILAPTRELADQVAESVKRYSHS-SPLRVAVVFG  128

Query  1545  GTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIR  1366
             G ++  QR +LR G  +++ATPGRL+DH++Q N SLS++S +VLDEADRMLDMGF P + 
Sbjct  129   GVDMNAQRDQLRKGCELLIATPGRLLDHIEQKNVSLSQVSVLVLDEADRMLDMGFMPDLE  188

Query  1365  EVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILEKVPENE  1186
              ++  LPK  Q+LLFSAT   EI  LA+ +L +PV + V   ++    V QI   V  NE
Sbjct  189   RIVRLLPKPRQSLLFSATFSNEIRKLARSFLNNPVEINVAPRNATAETVTQIAYPVAPNE  248

Query  1185  KIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQS  1006
             K   +L  L   +          S  IVFV  K     VA  L+ +G+ A ++HG RSQ+
Sbjct  249   KKAAVLYTLKSRN---------LSQVIVFVNTKIGASRVARELVSEGINAESIHGDRSQA  299

Query  1005  EREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGST  826
             ER  AL  F+ G  S+LVATDVA+RGLDV G+  VIN+DLP   EDYVHRIGRTGRAG+ 
Sbjct  300   ERIKALEGFKSGEISVLVATDVAARGLDVAGLPCVINMDLPFNAEDYVHRIGRTGRAGAK  359

Query  825   GQATSFYTDRDMYLVAQIRKAI  760
             G+A +FYT  D  L+  I K I
Sbjct  360   GEAIAFYTQSDERLLEDIEKLI  381



>gb|EQK99950.1| ATP-dependent RNA helicase dbp-2 [Ophiocordyceps sinensis CO18]
Length=440

 Score =   338 bits (866),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 236/364 (65%), Gaps = 8/364 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P PVE+F +      +M ++    +  PT++Q+Q  P+AL+GRD++G AETGSGKT  + 
Sbjct  9     PKPVETFDEAGFPRYVMDEVKAQGFPAPTAIQSQGWPMALTGRDVVGIAETGSGKTLTYC  68

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L +GDGP+ LVLAPTRELA QI+ E+  F RS    +   V GG   G
Sbjct  69    LPAIVHINAQPLLAQGDGPIVLVLAPTRELAVQIQQEITKFGRS-SRIRNTCVYGGVPKG  127

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV + +ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  128   PQIRDLSRGVEVCIATPGRLIDMLEAGKTNLRRVTYLVLDEADRMLDMGFEPQIRKIIEQ  187

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E+ ALA E+L D ++V +G++  S    + QI+E V ENEK DR
Sbjct  188   IRPDRQTLMWSATWPKEVRALASEFLNDFLQVNIGSMDLSANHRITQIVEVVSENEKRDR  247

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             ++  L  E     K        ++FV  K   +E+   L + G  A ++HG + Q+ER+ 
Sbjct  248   MIKHL--EKVMDNKDNK----ILLFVGTKRVADEITRFLRQDGWPALSIHGDKQQNERDW  301

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L  F+ G + I+VATDVASRG+DV  + HV+N D P   EDY+HRIGRTGRAG+ G A 
Sbjct  302   VLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPNNSEDYIHRIGRTGRAGAKGTAI  361

Query  813   SFYT  802
             +F+T
Sbjct  362   TFFT  365



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score =   340 bits (871),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 255/387 (66%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R +  + V    +    P PV+SF D+     +++++    +T PT +Q+Q  P+
Sbjct  75    EVEEYRNKREITV----EGRDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWPM  130

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  131   ALKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA  190

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++V
Sbjct  191   SKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYLV  249

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ S
Sbjct  250   LDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-S  308

Query  1236  SPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++  
Sbjct  309   DLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQITR  360

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  361   QLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFP  420

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A SF+T
Sbjct  421   GSLEDYVHRIGRTGRAGAKGTAYSFFT  447



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score =   340 bits (871),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 256/388 (66%), Gaps = 18/388 (5%)
 Frame = -3

Query  1956  QIEEIR-LRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             ++EE R LR      + ++    P PV+SF D+     +++++    +T PT +Q+Q  P
Sbjct  77    EVEEYRKLR-----EITVEGKDIPKPVKSFRDVGFPDYVLEEVKKAGFTEPTPIQSQGWP  131

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +A+ GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  132   MAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPMLAHGDGPIVLVLAPTRELAVQIQQE  191

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    KT  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++
Sbjct  192   ASKFGSS-SKIKTTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYL  250

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ 
Sbjct  251   VLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-  309

Query  1239  SSPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             S   AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++ 
Sbjct  310   SDLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQIT  361

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  362   RQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDF  421

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  422   PGSLEDYVHRIGRTGRAGAKGTAYTFFT  449



>ref|XP_003489670.1| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Bombus 
impatiens]
Length=605

 Score =   343 bits (880),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 253/402 (63%), Gaps = 10/402 (2%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             E  + R N ++ +  D+   P P++ F +    P ++ +I    Y+ PT++QAQ  P+AL
Sbjct  91    EVCQFRENAEITIKGDN--IPNPIQYFEEGNFPPYVLDEIHKQGYSQPTAIQAQGWPIAL  148

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+AL+LAPTRELAQQI+     
Sbjct  149   SGRDLVAIAQTGSGKTLGYVLPAIVHIIHQPRLGNGDGPIALILAPTRELAQQIQEVANC  208

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             F  +    +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VLD
Sbjct  209   FGEAA-GVRNTCIFGGAPKGPQAHDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLD  267

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++LTD   + +G+++ S
Sbjct  268   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYTHLNIGSLTLS  327

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   + 
Sbjct  328   ANHNIIQIVDVCQEFEKDLKLYRLLQEIGNEKENK------TIIFVETKRKVDDITRNIR  381

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             + G  A ++HG ++Q ER+  L++F+ G   ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  382   RDGWQALSIHGDKNQQERDHVLQEFKSGRAPILVATDVAARGLDVDDVKYVINFDYPSSS  441

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  442   EDYIHRIGRTGRRRQTGTAYAFFTTHNMKHAGDLIEVLREAG  483



>gb|EMT09661.1| DEAD-box ATP-dependent RNA helicase 20 [Aegilops tauschii]
Length=431

 Score =   337 bits (865),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 252/388 (65%), Gaps = 16/388 (4%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             E++E  R R  + V    + N  P PV  F D+     ++++I    +T PT +Q+Q  P
Sbjct  4     EEVEAYRRRREITV----EGNDVPKPVRDFRDVGFPEYVLQEITKAGFTEPTPIQSQGWP  59

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  60    MALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  119

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    K+  + GG   G Q  +L+ GV I++ATPGRLID ++  +T+L R++++
Sbjct  120   TTKFGAS-SKIKSTCIYGGVPKGPQVRDLQKGVEIIIATPGRLIDMMESHHTNLRRVTYL  178

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGFEPQI++++  +    QTL +SAT P E+E LA+ +L DP +V +G+ 
Sbjct  179   VLDEADRMLDMGFEPQIKKIVSQIRPDRQTLYWSATWPKEVELLARTFLFDPYKVIIGS-  237

Query  1239  SSPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
                 AN  + Q +E + E++K ++L++LL E+           S  ++F++ K  C+++ 
Sbjct  238   EELKANHAICQHVEILSESQKYNKLVNLL-EDIMDG-------SRILIFMDTKKGCDQIT  289

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  290   RQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDF  349

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+TG A SF+T
Sbjct  350   PGSLEDYVHRIGRTGRAGATGTAYSFFT  377



>ref|XP_003400944.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus 
terrestris]
Length=605

 Score =   343 bits (880),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 253/402 (63%), Gaps = 10/402 (2%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             E  + R N ++ +  D+   P P++ F +    P ++ +I    Y+ PT++QAQ  P+AL
Sbjct  91    EVCQFRENAEITIKGDN--IPNPIQYFEEGNFPPYVLDEIHKQGYSQPTAIQAQGWPIAL  148

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+AL+LAPTRELAQQI+     
Sbjct  149   SGRDLVAIAQTGSGKTLGYVLPAIVHIIHQPRLGNGDGPIALILAPTRELAQQIQEVANC  208

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             F  +    +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VLD
Sbjct  209   FGEAA-GVRNTCIFGGAPKGPQAHDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLD  267

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++LTD   + +G+++ S
Sbjct  268   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYTHLNIGSLTLS  327

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   + 
Sbjct  328   ANHNIIQIVDVCQEFEKDLKLYRLLQEIGNEKENK------TIIFVETKRKVDDITRNIR  381

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             + G  A ++HG ++Q ER+  L++F+ G   ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  382   RDGWQALSIHGDKNQQERDHVLQEFKSGRAPILVATDVAARGLDVDDVKYVINFDYPSSS  441

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  442   EDYIHRIGRTGRRRQTGTAYAFFTTHNMKHAGDLIEVLREAG  483



>gb|EFN89962.1| Probable ATP-dependent RNA helicase DDX17 [Harpegnathos saltator]
Length=540

 Score =   341 bits (874),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 237/364 (65%), Gaps = 8/364 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P PV +F +      ++K+I    +  PTS+QAQ  P+ALSGRD++G A TGSGKT ++ 
Sbjct  78    PNPVFNFGEAGFPEYVLKEITKQGFNEPTSIQAQGWPIALSGRDMVGIASTGSGKTLSYI  137

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   + GG   G
Sbjct  138   LPAIVHINSQPKLSRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTCLYGGAPKG  196

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L +GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEPQIR+++  
Sbjct  197   AQARDLDSGVEIVIATPGRLLDFLESGKTNLKRCTYLVLDEADRMLDMGFEPQIRKIIEQ  256

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA+++L D  ++ VG++  +   N+ QI++   + EK ++
Sbjct  257   IRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLAANHNILQIIDVCQDYEKENK  316

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG ++Q ER+ 
Sbjct  317   LSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGDKTQQERDW  370

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR   TG A 
Sbjct  371   VLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGRRQKTGTAY  430

Query  813   SFYT  802
             +F+T
Sbjct  431   TFFT  434



>ref|XP_002493605.1| Essential ATP-dependent RNA helicase of the DEAD-box protein 
family [Komagataella pastoris GS115]
 emb|CAY71426.1| Essential ATP-dependent RNA helicase of the DEAD-box protein 
family [Komagataella pastoris GS115]
 emb|CCA40962.1| ATP-dependent RNA helicase DDX5/DBP2 [Komagataella pastoris CBS 
7435]
Length=537

 Score =   341 bits (874),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/365 (47%), Positives = 240/365 (66%), Gaps = 8/365 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P P+ SF +      ++  +    +  PT++Q Q  P+AL G+D++G A TGSGKT ++ 
Sbjct  96    PKPITSFDEAGFPDYVLTAVKAQGFPSPTAIQCQGWPMALGGKDMVGIAATGSGKTLSYC  155

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L+ GDGP+ALVLAPTRELA QI+ E   F  S    +   V GG   G
Sbjct  156   LPAIVHINAQPLLKPGDGPVALVLAPTRELAVQIQKECSKFGSS-SRIRNTCVYGGVPKG  214

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  G  IV+ATPGRLID L+ G T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  215   QQIRDLARGAEIVIATPGRLIDMLETGKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQ  274

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P  ++ALA++YL D ++V VG++  + + N+ Q++E + E EK DR
Sbjct  275   IRPDRQTLMWSATWPKSVQALARDYLHDYIQVNVGSLELAASHNIKQVIEVLSEYEKRDR  334

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L   L  E A  +K+    S  +VF   K  C+E+   L   G  A A+HG + Q ER+ 
Sbjct  335   LTKYL--EQASEDKT----SKILVFASTKRTCDELTTYLRSDGWPALAIHGDKEQRERDW  388

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L++FR G + I+VATDVA+RG+DV G+  V+N D+P  +EDYVHRIGRTGRAG+TG A 
Sbjct  389   VLQEFRSGKSPIMVATDVAARGIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAV  448

Query  813   SFYTD  799
             SF+T+
Sbjct  449   SFFTN  453



>ref|NP_001130628.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACF78925.1| unknown [Zea mays]
 gb|AFW76420.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=614

 Score =   343 bits (880),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 257/403 (64%), Gaps = 24/403 (6%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V +    AP P + F    L  ++++++A   Y  PT VQ  AMP+ ++GRDL+ CA
Sbjct  65    DMPVDVSGKGAPGPADGFEAAGLAEAVLRNVARCGYESPTPVQRYAMPIVMAGRDLMACA  124

Query  1743  ETGSGKTAAFTIPMIQHCLAQPPLRRGDG---------------PLALVLAPTRELAQQI  1609
             +TGSGKTAAF +P++   +A  P   G+G               P ALVLAPTRELA QI
Sbjct  125   QTGSGKTAAFCLPVVSGLVA--PAGGGNGHGPRDRGSFDRVAAKPRALVLAPTRELAAQI  182

Query  1608  ETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRI  1429
               E K FS      +  +  GGT +  Q  +L  GV+++VATPGRL+D +++   SL  I
Sbjct  183   NEEAKKFSFQT-GLRVVVAYGGTPMFSQLRDLEKGVDLLVATPGRLVDLVERSRISLEAI  241

Query  1428  SFVVLDEADRMLDMGFEPQIREV--MHNLPKK--HQTLLFSATMPAEIEALAQEYLTDPV  1261
              ++V+DEADRML+MGFEPQIR++  M N+PKK   QT+LFSAT P EI+ LA ++L + +
Sbjct  242   KYLVMDEADRMLNMGFEPQIRKIVDMMNMPKKSVRQTMLFSATFPPEIQRLATDFLHNYI  301

Query  1260  RVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTK  1081
              V VG V S T  + Q +E V   EK   LLD+L ++S    K+  P  LT+VFVE K +
Sbjct  302   FVTVGRVGSSTDLIDQKIEFVNGGEKRGFLLDILQKQSVGLSKNKQP--LTLVFVETKRE  359

Query  1080  CEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHV  901
              + +   L   G  AT++HG R+Q ERE AL+ F+ G T ILVATDVASRGLDV  VAHV
Sbjct  360   ADSLQYCLQSNGFSATSIHGDRTQQERERALKSFKSGATPILVATDVASRGLDVPNVAHV  419

Query  900   INLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQI  772
             IN DLPK+++DYVHRIGRTGRAG  G+AT+ +T+ + +L   +
Sbjct  420   INYDLPKSIDDYVHRIGRTGRAGKAGKATALFTESNHHLAKDL  462



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score =   341 bits (874),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/387 (45%), Positives = 251/387 (65%), Gaps = 16/387 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++ E RLR  + V    +    P PV+SF+D      +++++    +  PT +Q+Q  P+
Sbjct  75    EVNEYRLRREITV----EGKDVPKPVQSFSDAAFPDYVLQEVKKAGFVEPTPIQSQGWPM  130

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  131   ALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILDPGDGPIVLVLAPTRELAVQIQQEA  190

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID L+  +T+L R++++V
Sbjct  191   TKFGAS-SRIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLV  249

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGF+PQIR+++  +    QTL +SAT P E+E LA+++L +P +V +G+  
Sbjct  250   LDEADRMLDMGFDPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGS-E  308

Query  1236  SPTAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAE  1063
                AN  + Q ++ VPE +K D+L+ LL E+           S  ++F++ K  C+++  
Sbjct  309   ELKANHAIKQYVDIVPEKQKYDKLVKLL-EDIMDG-------SRILIFMDTKKGCDQITR  360

Query  1062  ALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLP  883
              L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D P
Sbjct  361   QLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFP  420

Query  882   KTMEDYVHRIGRTGRAGSTGQATSFYT  802
              ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  421   GSLEDYVHRIGRTGRAGAKGTAYTFFT  447



>ref|XP_001867417.1| ATP-dependent RNA helicase p62 [Culex quinquefasciatus]
 gb|EDS44941.1| ATP-dependent RNA helicase p62 [Culex quinquefasciatus]
Length=663

 Score =   344 bits (883),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 235/364 (65%), Gaps = 8/364 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             PAP+  F +     SI+ +I    Y  PT +QA    +A SGRD++G A+TGSGKT A+ 
Sbjct  74    PAPILYFEEGGFPSSILAEITRQGYKEPTQIQAVGWSIATSGRDMVGIAKTGSGKTLAYI  133

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P + H   QP L RGDGP+ALVLAPTRELAQQI+     F R +    T I  G + +G
Sbjct  134   LPALIHISNQPRLMRGDGPIALVLAPTRELAQQIQQVCDDFGRRMSVMNTCIFGGASKMG  193

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q ++LR GV IV+ATPGRLID L+ G T+L R +++VLDEADRMLDMGFEPQIR+++  
Sbjct  194   -QANDLRRGVEIVIATPGRLIDFLESGTTNLRRTTYLVLDEADRMLDMGFEPQIRKIISQ  252

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    Q L++SAT P EI  LA+E+L D +++ +G+++ +   N+ QI+E   E EK  R
Sbjct  253   IRPDRQVLMWSATWPKEIRKLAEEFLRDYIQINIGSLNLAANENILQIIECCQEYEKESR  312

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L  LL E   Q +         IVFVE K K +++A  + + G  A  +HG ++Q +R+ 
Sbjct  313   LFKLLAEIGKQGDNK------AIVFVETKRKVDQIAGIIKRNGWRADGIHGDKTQKDRDY  366

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L  FRR    ILVATDVASRGLDV+ V +VIN D P   EDY+HRIGRTGR+ + G A 
Sbjct  367   VLNTFRRMNNGILVATDVASRGLDVDDVKYVINFDFPNNTEDYIHRIGRTGRSTNKGTAY  426

Query  813   SFYT  802
             +F+T
Sbjct  427   TFFT  430



>ref|XP_003697465.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis 
florea]
Length=607

 Score =   343 bits (879),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/402 (43%), Positives = 255/402 (63%), Gaps = 10/402 (2%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             E  + R N ++ +  D+   P P++ F +    P ++++I    Y+ PT++QAQ  P+AL
Sbjct  91    EVCQFRENAEITIKGDN--IPNPIQYFEEGNFPPYVLEEIHKQGYSQPTAIQAQGWPIAL  148

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+AL+LAPTRELAQQI+     
Sbjct  149   SGRDLVAIAQTGSGKTLGYVLPAIVHIIHQPRLSNGDGPIALILAPTRELAQQIQEVANC  208

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             F  +    +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VLD
Sbjct  209   FGEAA-GVRNTCIFGGAPKGPQAHDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLD  267

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++L+D + + +G+++ S
Sbjct  268   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLSDYMHLNIGSLTLS  327

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   + 
Sbjct  328   ANHNIIQIVDVCQEFEKDLKLYRLLQEIGNEKENK------TIIFVETKRKVDDITRNIR  381

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             + G  A ++HG ++Q ER+  L++F+ G   ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  382   RDGWQALSIHGDKNQQERDHVLQEFKSGRAPILVATDVAARGLDVDDVKYVINFDYPSSS  441

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  442   EDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  483



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Fragaria 
vesca subsp. vesca]
Length=606

 Score =   343 bits (879),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/390 (45%), Positives = 252/390 (65%), Gaps = 10/390 (3%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + ++ +  P P+++F D       +  IA   +  PT +QAQ  P+AL GRDL+G AETG
Sbjct  178   ITVEGHDVPKPIQTFRDASFPGYCLDAIAKLGFVEPTPIQAQGWPMALKGRDLVGIAETG  237

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P + H  AQP L  GDGP+ALVLAPTRELA QI+ E   F  S +  K+  
Sbjct  238   SGKTLSYLLPALVHISAQPRLDSGDGPIALVLAPTRELAVQIQQEAVKFC-SQNYIKSTC  296

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +LR GV IV+ATPGRLID L+  +T+L R++++VLDEADRMLDMGFEP
Sbjct  297   IYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLEAQHTNLRRVTYLVLDEADRMLDMGFEP  356

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++       QTL +SAT P E+E+LA+++L +P +V +G+ S     ++ Q++E V
Sbjct  357   QIRKIVSQTRPDRQTLYWSATWPREVESLARQFLRNPYKVIIGSASLKANQSIKQVVEVV  416

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E EK +RLL LL +            S  ++FVE K  C+ V + L   G  A ++HG 
Sbjct  417   TEFEKYNRLLKLLKDSIVG--------SRILIFVETKKGCDHVTKQLRMDGWPALSIHGD  468

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q+ER+  L +F+ G + I+ ATDVA+RGLDV  +  VIN D P ++EDYVHRIGRTGR
Sbjct  469   KNQAERDWVLSEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGR  528

Query  837   AGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             AG+TG A +F+T+ +     ++ K + + G
Sbjct  529   AGATGTALTFFTESNGKFARELIKILQEAG  558



>ref|XP_010768436.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 [Notothenia 
coriiceps]
Length=629

 Score =   343 bits (880),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 255/403 (63%), Gaps = 15/403 (4%)
 Frame = -3

Query  1953  IEEI-RLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EI + R N +V V       P P+  F +      +M+ I  H++T PT +Q+Q  PV
Sbjct  75    VQEIEQYRRNKEVTVK--GRDCPKPIIKFHEAEFPNYVMEVIVNHNWTDPTPIQSQGWPV  132

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSG+D++G A+TGSGKT A+ +P I H   QP L  GDGP+ LVLAPTRELAQQ++   
Sbjct  133   ALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPFLEHGDGPICLVLAPTRELAQQVQQVA  192

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               + R+    K+  + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++V
Sbjct  193   AEYGRA-SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRCTYLV  251

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L D V++ VG + 
Sbjct  252   LDEADRMLDMGFEPQIRKIVEQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINVGALQ  311

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   + EK D+L+ LL E  ++ E        TI+FVE K +C+E+   
Sbjct  312   LSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENK------TIIFVETKRRCDELTRR  365

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG +SQ ER+  L +FR G   IL+ATDVASRGLDV  V  VIN D P 
Sbjct  366   MRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLDVEDVKFVINYDYPN  425

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYTDRDMY----LVAQIRKA  763
             + EDY+HRIGRT R+  TG A +F+T  +M     L+A +R+A
Sbjct  426   SSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQASDLIAVLREA  468



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score =   341 bits (875),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 252/391 (64%), Gaps = 12/391 (3%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             ++++    P P++ F D     +I++ IA   +T PT +QAQ  P+AL GRDL+G AETG
Sbjct  126   ISVEGRDVPKPMKMFQDANFPDNILEAIAKLGFTEPTPIQAQGWPMALKGRDLIGIAETG  185

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFS-RSLDSFKTA  1558
             SGKT A+ +P + H  AQP L + DGP+ L+LAPTRELA QI+ E + F  RS    ++ 
Sbjct  186   SGKTLAYLLPALVHVSAQPRLGQDDGPIVLILAPTRELAVQIQEESRKFGLRS--GVRST  243

Query  1557  IVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFE  1378
              + GG   G Q  +LR GV IV+ATPGRLID L+  +T+L R++++VLDEADRMLDMGFE
Sbjct  244   CIYGGAPKGPQIRDLRRGVEIVIATPGRLIDMLECQHTNLKRVTYLVLDEADRMLDMGFE  303

Query  1377  PQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEK  1201
             PQIR+++  +    QTLL+SAT P E+E LA+++L DP +  +G+       ++ Q++E 
Sbjct  304   PQIRKIVSQIRPDRQTLLWSATWPREVETLARQFLRDPYKAIIGSTDLKANQSINQVIEI  363

Query  1200  VPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHG  1021
             VP  EK +RLL LL        K     S  ++FVE K  C++V   L   G  A A+HG
Sbjct  364   VPTPEKYNRLLTLL--------KQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHG  415

Query  1020  GRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTG  841
              ++QSER+  L +F+ G + I+ ATDVA+RGLDV  +  V+N D P T+EDY+HRIGRTG
Sbjct  416   DKTQSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTG  475

Query  840   RAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             RAG+ G A +F+T  +     ++ K + + G
Sbjct  476   RAGAKGMAFTFFTHDNAKFARELVKILQEAG  506



>ref|XP_623193.4| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Apis 
mellifera]
Length=560

 Score =   341 bits (875),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 172/402 (43%), Positives = 255/402 (63%), Gaps = 10/402 (2%)
 Frame = -3

Query  1950  EEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVAL  1771
             E  + R N ++ +  D+   P P++ F +    P ++++I    Y+ PT++QAQ  P+AL
Sbjct  91    EVCQFRENAEITIKGDN--IPNPIQYFEEGNFPPYVLEEIHKQGYSQPTAIQAQGWPIAL  148

Query  1770  SGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKA  1591
             SGRDL+  A+TGSGKT  + +P I H + QP L  GDGP+AL+LAPTRELAQQI+     
Sbjct  149   SGRDLVAIAQTGSGKTLGYVLPAIVHIIHQPRLSNGDGPIALILAPTRELAQQIQEVANC  208

Query  1590  FSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLD  1411
             F  +    +   + GG   G Q  +L  GV I +ATPGRLID L++G T+L R +++VLD
Sbjct  209   FGEAA-GVRNTCIFGGAPKGPQAHDLERGVEICIATPGRLIDFLERGTTNLRRCTYLVLD  267

Query  1410  EADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-S  1234
             EADRMLDMGFEPQIR+++  +    Q L++SAT P E+ ALA+++L+D + + +G+++ S
Sbjct  268   EADRMLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLSDYMHLNIGSLTLS  327

Query  1233  PTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALM  1054
                N+ QI++   E EK  +L  LL E   + E        TI+FVE K K +++   + 
Sbjct  328   ANHNIIQIVDVCQEFEKDLKLYRLLQEIGNEKENK------TIIFVETKRKVDDITRNIR  381

Query  1053  KQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTM  874
             + G  A ++HG ++Q ER+  L++F+ G   ILVATDVA+RGLDV+ V +VIN D P + 
Sbjct  382   RDGWQALSIHGDKNQQERDHVLQEFKSGRAPILVATDVAARGLDVDDVKYVINFDYPSSS  441

Query  873   EDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             EDY+HRIGRTGR   TG A +F+T  +M     + + + + G
Sbjct  442   EDYIHRIGRTGRRRQTGTAYAFFTSHNMKHAGDLIEVLREAG  483



>gb|EPS58220.1| hypothetical protein M569_16595, partial [Genlisea aurea]
Length=545

 Score =   341 bits (874),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 218/513 (42%), Positives = 299/513 (58%), Gaps = 32/513 (6%)
 Frame = -3

Query  2232  SYVPPHLRNS--TTATTVVSNGGDHL--HSELNSRQLPS--FTQSKNGFISNGEYCSNDA  2071
             +YVPPHLRN   ++++   ++  D +   S  N  QLP   F    N ++  G   S   
Sbjct  6     AYVPPHLRNQRASSSSNAPASSNDRVGQSSFTNVSQLPGPRFDYGNNRYVGGGHGRSGGG  65

Query  2070  GRNSCATVNYLSPRGL-VAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNP  1894
             G           PR L V P   F     +E    F+ ++   +      D+ V      
Sbjct  66    GGGWPNRGG-RGPRDLEVNP---FANGADAEIEQAFEAQENTGLNFDAYEDIPVETSGKD  121

Query  1893  APAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAF  1714
              P PV +F ++ L  ++  +I    Y  PT VQ  A+P++L+GRDL+ CA+TGSGKTAAF
Sbjct  122   VPPPVITFAEIDLGDALNLNIQRCKYVKPTPVQRYAIPISLAGRDLMACAQTGSGKTAAF  181

Query  1713  TIPMIQHCLAQPPLRRGDG------PLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIV  1552
               P+I   +  PP  R  G      PLAL+LAPTREL+ QI  E + F+   +  +  +V
Sbjct  182   CFPIISGIMRGPPPMRPRGARSAVYPLALILAPTRELSMQIHDEARKFAYQTN-VRVVVV  240

Query  1551  VGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQ  1372
              GG  I  Q  EL+ GV+I+VATPGRL+D L++   SL  I ++ LDEADRMLDMGFEPQ
Sbjct  241   YGGAPINQQLYELQRGVDILVATPGRLVDLLERAKVSLQAIRYLALDEADRMLDMGFEPQ  300

Query  1371  IREVMH--NLPKK--HQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVAQILE  1204
             IR+++   ++P +   QTLLFSAT P EI+ +A ++L++ + + VG V S T  + Q +E
Sbjct  301   IRKIVEQMDMPARGERQTLLFSATFPKEIQRMAADFLSNYIFLAVGRVGSSTDLIVQRVE  360

Query  1203  KVPENEKIDRLLDLLVEESAQAEKS--GHPFSLTIVFVERKTKCEEVAEALMKQGLLATA  1030
              V E++K   L+DLL    AQ E    G+  SLT+VFVE K   + +   L   G  AT 
Sbjct  361   YVLESDKRSHLMDLL---HAQRENDIVGNQ-SLTLVFVETKKGADSLENWLYHNGFPATT  416

Query  1029  LHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIG  850
             +HG R+Q ERE ALR F+ G T ILVATDVA+RGLD+  V+HVIN DLP  ++DYVHRIG
Sbjct  417   IHGDRTQQEREIALRSFKTGKTPILVATDVAARGLDIPHVSHVINFDLPNDIDDYVHRIG  476

Query  849   RTGRAGSTGQATSFYTDRDMYLVAQIRKAIADV  751
             RTGRAG TG AT+F+ D +  L     K +AD+
Sbjct  477   RTGRAGKTGLATAFFNDNNTSLA----KPLADL  505



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score =   338 bits (866),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 257/388 (66%), Gaps = 18/388 (5%)
 Frame = -3

Query  1956  QIEEIR-LRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             ++EE R LR      + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P
Sbjct  40    EVEEYRKLR-----EITVEGRDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWP  94

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +A+ GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  95    MAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  154

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    KT+ + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++
Sbjct  155   ASKFGSS-SKIKTSCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYL  213

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ 
Sbjct  214   VLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-  272

Query  1239  SSPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             S   AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++ 
Sbjct  273   SDLKANRAIRQIVDVITESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQIT  324

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  325   RQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDF  384

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  385   PGSLEDYVHRIGRTGRAGAKGTAYTFFT  412



>ref|XP_002044465.1| GM11962 [Drosophila sechellia]
 gb|EDW53672.1| GM11962 [Drosophila sechellia]
Length=946

 Score =   351 bits (901),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 264/388 (68%), Gaps = 7/388 (2%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             +Q+ +IR  L + V+     N  P PV SF +  L   +++++    +T PT++Q+Q  P
Sbjct  215   QQVADIRRELEITVS----GNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWP  270

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +ALSGRDL+G A+TGSGKT A+ +P I H   QPP+ RG+GP+ALVLAPTRELAQQI++ 
Sbjct  271   IALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSV  330

Query  1599  VKAFSRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISF  1423
             V+ +        +   + GG++   Q  +L  GV +++ATPGRLID L+  NT+L R ++
Sbjct  331   VRDYGHLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENRNTNLQRCTY  390

Query  1422  VVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGN  1243
             +VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA ++L D +++ +G+
Sbjct  391   LVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGS  450

Query  1242  VS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             ++ S   N+ QI+E   E EK  RL+ LL E S   +KSG   +  IVFVE K K E++ 
Sbjct  451   MNLSANHNIRQIVEICTEIEKPQRLVCLLNEISP-IKKSGSNGNKIIVFVETKIKVEDIL  509

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
             + +  +G  AT++HG ++Q+ER++ L+DFR G ++IL+ATDVASRGLDV  + +VIN D 
Sbjct  510   QIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDY  569

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P + E+YVHRIGRTGR    G A +F+T
Sbjct  570   PNSSENYVHRIGRTGRCQQLGTAYTFFT  597



>ref|XP_003399019.1| PREDICTED: ATP-dependent RNA helicase p62-like [Bombus terrestris]
Length=533

 Score =   340 bits (872),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 177/415 (43%), Positives = 259/415 (62%), Gaps = 15/415 (4%)
 Frame = -3

Query  2028  GLVAPDPVFPQWKPSERVLLFKLEQIEEIRLRLNVDV-----AVAMDSNPAPAPVESFTD  1864
             GL  P+  F   KP ++        ++  R    +D       + +     P P++ F +
Sbjct  60    GLKKPNWSFENLKPFKKDFYIPHPNVQS-RHPQEIDTFRQENQITLKGEKIPNPIQHFEE  118

Query  1863  MCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLA  1684
                   +M+ I    ++ PT++QAQ  P+A+SG++++G A+TGSGKT  + +P I H  +
Sbjct  119   GNFPDHVMQCIRKQGFSEPTAIQAQGWPIAMSGQNMVGIAQTGSGKTLGYILPAIVHISS  178

Query  1683  QPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAG  1504
             Q PL RGDGP+ALVLAPTRELAQQI+     F       ++  + GG   G+Q  +L  G
Sbjct  179   QQPLNRGDGPIALVLAPTRELAQQIQKVTYNFG----YVRSTCIFGGAPKGNQARDLEHG  234

Query  1503  VNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLL  1324
             V I +ATPGRLID L++G T+L R +++VLDEADRMLDMGFEPQIR+++  +    Q L+
Sbjct  235   VEICIATPGRLIDFLERGITNLRRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVLM  294

Query  1323  FSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEES  1147
             +SAT P E+  LA+EYL D  ++ +G+++ S   N+ QI++   E+EK  +L DLL E S
Sbjct  295   WSATWPKEVRNLAEEYLVDYTQLNIGSLTLSANHNILQIVDVCEEHEKQAKLQDLLQEIS  354

Query  1146  AQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGP  967
               + + G     TI+FVE K K E + + + + G  A  +HG +SQ ER+  L +FRR  
Sbjct  355   NVSPEGGK----TIIFVETKKKVESITKTIRRCGWPAVCIHGDKSQLERDFVLTEFRRNK  410

Query  966   TSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
              SILVATDVA+RGLDV+ V +VIN D P + EDY+HRIGRTGR+ ++G + +F+T
Sbjct  411   DSILVATDVAARGLDVDDVKYVINFDYPTSSEDYIHRIGRTGRSNNSGTSYAFFT  465



>ref|XP_009073300.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Acanthisitta chloris]
Length=476

 Score =   338 bits (867),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 245/386 (63%), Gaps = 11/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE+R +  + +   M+    P PV +F        +M  +   ++T PT +Q Q  P+
Sbjct  2     EVEELRRKKEITIR-GMEG--CPKPVFAFHQCSFPQYVMDALMDQNFTEPTPIQCQGFPL  58

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSGRD++G A+TGSGKT A+ +P I H   QP L RGDGP+ LVLAPTRELAQQ++   
Sbjct  59    ALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVA  118

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               + +     K+  + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++V
Sbjct  119   DDYGKC-SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLV  177

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L D V++ VGN+ 
Sbjct  178   LDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINVGNLE  237

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   E+EK  +L+ L+ E  A+ E        TI+FVE K +C+++   
Sbjct  238   LSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK------TIIFVETKRRCDDLTRR  291

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG +SQ ER+  L +FR G   IL+ATDVASRGLDV  V  VIN D P 
Sbjct  292   MRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPN  351

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             + EDYVHRIGRT R+ + G A +F+T
Sbjct  352   SSEDYVHRIGRTARSTNKGTAYTFFT  377



>ref|XP_003699317.1| PREDICTED: ATP-dependent RNA helicase p62-like [Megachile rotundata]
Length=524

 Score =   340 bits (871),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 243/372 (65%), Gaps = 6/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P P++ F +      +M+ I    ++ PT++QAQ  P+A+SG++++G A+TG
Sbjct  90    ITLKGEKIPNPIQHFEEGNFPDHVMQCIRKQGFSEPTAIQAQGWPIAMSGQNMVGIAQTG  149

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT  + +P + H  +Q PL RGDGP+AL+L PTRELAQQI+     FS SL   K+  
Sbjct  150   SGKTLGYILPALVHISSQQPLNRGDGPIALILVPTRELAQQIQDVAHNFS-SLSYAKSTC  208

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  209   IFGGAPKGKQARDLEQGVEICIATPGRLIDFLEHGTTNLRRCTYLVLDEADRMLDMGFEP  268

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    Q L++SAT P E+  LA+EYL D  ++ +G+++ S   N+ QI++  
Sbjct  269   QIRKIIEQIRPDRQVLMWSATWPKEVRNLAEEYLVDYTQLNIGSLTLSANHNILQIIDVC  328

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              E+EK  +L +LL E S+     G     TI+FVE K K E +A  + + G  A  +HG 
Sbjct  329   EEHEKQTKLENLLQEISSVNPNDGK----TIIFVETKKKVENIARNIRRYGWPAVCIHGD  384

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +FRR   +ILVATDVA+RGLDV+ V  VIN D P + E+Y+HRIGRTGR
Sbjct  385   KSQGERDHVLTEFRRKRNAILVATDVAARGLDVDDVKFVINFDYPTSSENYIHRIGRTGR  444

Query  837   AGSTGQATSFYT  802
             + ++G + +F+T
Sbjct  445   SNNSGTSYAFFT  456



>ref|XP_006354152.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006354153.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 11-like isoform 
X2 [Solanum tuberosum]
Length=604

 Score =   342 bits (878),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 247/389 (63%), Gaps = 13/389 (3%)
 Frame = -3

Query  1923  DVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCA  1744
             D+ V    +  P PV +F D+ L  ++ ++I    Y  PT VQ  A+P++L+GRDL+ CA
Sbjct  129   DIPVETSGDNVPPPVNTFADIDLGEAVNENIRRCKYVRPTPVQRHAIPISLAGRDLMACA  188

Query  1743  ETGSGKTAAFTIPMIQHCL----AQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSL  1576
             +TGSGKTAAF  P+I   +     +PP  R   PLAL+L+PTREL+ QI  E K FS   
Sbjct  189   QTGSGKTAAFCFPIISGIMRGQFPRPPRPRMAFPLALILSPTRELSCQIHDEAKKFSYQT  248

Query  1575  DSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRM  1396
                +  +  GG  I  Q  EL  GV+I+VATPGRL+D L++   SL  I ++ LDEADRM
Sbjct  249   -GVRVVVAYGGAPINQQLRELERGVHILVATPGRLVDLLERARVSLQMIRYLALDEADRM  307

Query  1395  LDMGFEPQIREVMHNL----PKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPT  1228
             LDMGFEPQIR+++  +    P   QT+LFSAT P EI+ LA ++L+  + + VG V S T
Sbjct  308   LDMGFEPQIRKIVQQMDMPPPGVRQTMLFSATFPKEIQRLASDFLSTYIFLAVGRVGSST  367

Query  1227  ANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGH-PFSLTIVFVERKTKCEEVAEALMK  1051
               + Q +E V E +K   L+DLL    AQ E   H   SLT+VFVE K   + +   L  
Sbjct  368   DLIVQRVEYVQETDKRSHLMDLL---HAQKENGVHGKQSLTLVFVETKKGADALEHWLCM  424

Query  1050  QGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTME  871
              G  ATA+HG R+Q ERE ALR F+ G T ILVATDVA+RGLD+  VAHV+N DLP  ++
Sbjct  425   NGFPATAIHGDRTQQEREHALRSFKTGHTPILVATDVAARGLDIPHVAHVVNFDLPNDID  484

Query  870   DYVHRIGRTGRAGSTGQATSFYTDRDMYL  784
             DYVHRIGRTGRAG TG AT+F+ + +  L
Sbjct  485   DYVHRIGRTGRAGKTGLATAFFNENNSSL  513



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score =   339 bits (869),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 197/456 (43%), Positives = 277/456 (61%), Gaps = 32/456 (7%)
 Frame = -3

Query  2133  PSFTQSKNGFISNGEYCSNDAGRNSCATVNY---LSPR-----GLVAPDPVFPQWKPSER  1978
             P+ T +  GF     Y S+   R S +  +Y    SPR     GL   +  F    PS  
Sbjct  8     PALTVTAEGFGGASSYGSSV--RTSSSKRDYDGAESPRKLDLDGLTPFEKNFYVESPS--  63

Query  1977  VLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSV  1798
             V      ++EE R +  + V    +    P PV+SF D+     +M++I+   +  PT +
Sbjct  64    VAAMSEREVEEYRQQREITV----EGRDVPKPVKSFRDVGFPDYVMQEISKAGFFEPTPI  119

Query  1797  QAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELA  1618
             QAQ  P+AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA
Sbjct  120   QAQGWPMALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPFLAPGDGPIVLVLAPTRELA  179

Query  1617  QQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSL  1438
              QI+ E   F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID L+  NT+L
Sbjct  180   VQIQQESTKFGAS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHNTNL  238

Query  1437  SRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVR  1258
              R++++VLDEADRMLDMGFEPQI++++  +    QTL +SAT P E+E LA++YL +P +
Sbjct  239   RRVTYLVLDEADRMLDMGFEPQIKKILSQIRPDRQTLYWSATWPKEVEHLARQYLYNPYK  298

Query  1257  VKVGNVSSP--TAN--VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVER  1090
             V +G   SP   AN  + Q ++ V E++K ++L+ LL E+           S  ++F++ 
Sbjct  299   VIIG---SPDLKANHAIRQHVDIVSESQKYNKLVKLL-EDIMDG-------SRILIFMDT  347

Query  1089  KTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGV  910
             K  C+++   L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V
Sbjct  348   KKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDV  407

Query  909   AHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
              +VIN D P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  408   KYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFT  443



>ref|XP_001992482.1| GH24775 [Drosophila grimshawi]
 gb|EDV92189.1| GH24775 [Drosophila grimshawi]
Length=977

 Score =   352 bits (903),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/390 (46%), Positives = 262/390 (67%), Gaps = 11/390 (3%)
 Frame = -3

Query  1959  EQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             + + E+R  L + V+     N  P PV +F +  L   ++ ++    +T PT++Q+Q  P
Sbjct  216   QAVAEMRHELEITVS----GNDLPHPVANFEESSLPTHVIDEMKRQGFTKPTAIQSQGWP  271

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +ALSGRDL+G A+TGSGKT A+ +P I H   QPP+ RG+GP+ALVLAPTRELAQQI++ 
Sbjct  272   IALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIMRGEGPIALVLAPTRELAQQIQSV  331

Query  1599  VKAFSRSLD-SFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISF  1423
             V+ +        +   + GG++   Q  +L  GV +++ATPGRLID L+  NT+L R ++
Sbjct  332   VRDYGHLCKPEIRHTCIFGGSSKVPQVRDLERGVEVIIATPGRLIDFLENRNTNLQRCTY  391

Query  1422  VVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGN  1243
             +VLDEADRMLDMGFEPQIR+++  +    Q +++SAT P E++ALA ++L D +++ +G+
Sbjct  392   LVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGS  451

Query  1242  VS-SPTANVAQILEKVPENEKIDRLLDLLVE--ESAQAEKSGHPFSLTIVFVERKTKCEE  1072
             ++ S   N+ QI+E   ENEK  R++ LL E   S  A  +G+     I+FVE K K E+
Sbjct  452   MNLSANHNIRQIVEICNENEKPQRMMRLLKEITPSNNAANAGNKI---IIFVETKIKVED  508

Query  1071  VAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINL  892
             + + +  +G  AT++HG +SQSER++ LRDFR G ++IL+ATDVASRGLDV  + +VIN 
Sbjct  509   ILQIIRNEGYTATSIHGDKSQSERDSVLRDFRNGKSNILIATDVASRGLDVEDLQYVINY  568

Query  891   DLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             D P + E+YVHRIGRTGR    G A +F+T
Sbjct  569   DYPNSSENYVHRIGRTGRCQQLGTAYTFFT  598



>ref|XP_004518940.1| PREDICTED: ATP-dependent RNA helicase p62-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004525159.1| PREDICTED: ATP-dependent RNA helicase p62-like isoform X1 [Ceratitis 
capitata]
Length=603

 Score =   342 bits (877),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/383 (45%), Positives = 252/383 (66%), Gaps = 10/383 (3%)
 Frame = -3

Query  1896  PAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAA  1717
             PAP P++ F + C     + +I    YT PT +QAQ+ P+A+SG +L+G A+TGSGKT A
Sbjct  124   PAPNPIQYFDEACFPDYCLHEIRHQRYTEPTPIQAQSWPIAMSGSNLVGIAKTGSGKTLA  183

Query  1716  FTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTN  1537
             F +P I H   Q PL+RGDGP+ALVLAPTRELAQQI+T    F  S+   +   + GGT 
Sbjct  184   FILPAIVHINNQTPLQRGDGPIALVLAPTRELAQQIQTVANDFGSSV-YVRNTCIFGGTP  242

Query  1536  IGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVM  1357
              G Q ++L  GV IV+ATPGRL+D L  G T+L R +++VLDEADRMLDMGFEPQIR+++
Sbjct  243   KGKQANDLERGVEIVIATPGRLLDFLSNGVTNLRRCTYLVLDEADRMLDMGFEPQIRKIL  302

Query  1356  HNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKI  1180
               +    Q L++SAT P E+  LA+++L   ++V +G++  S   N+ Q ++   E++K 
Sbjct  303   GQIRPDRQILMWSATWPKEVRQLAEDFLGSYIQVNIGSLELSANHNIRQYVDVCNEHDKG  362

Query  1179  DRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSER  1000
              +L DLL     Q+   G      I+FV  K K +E++  +   G+   ++HG +SQ +R
Sbjct  363   AKLKDLLSHIYDQSHSPGK----IIIFVATKKKVDELSRFINGFGVRVGSIHGDKSQIDR  418

Query  999   EAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQ  820
             +  L +FR G  +ILVATDVA+RGLDV+G+ +VIN D P++ EDY+HRIGRTGR  STG 
Sbjct  419   DNVLAEFRSGRANILVATDVAARGLDVDGIKYVINFDFPQSSEDYIHRIGRTGRKHSTGT  478

Query  819   ATSFYTDRDMYLVAQIRKAIADV  751
             + +F+T ++    A+  +A+ D+
Sbjct  479   SYAFFTRKN----AKCARALIDI  497



>ref|XP_003707128.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Megachile 
rotundata]
Length=566

 Score =   341 bits (874),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 239/372 (64%), Gaps = 8/372 (2%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + +     P PV +F +      ++K+I    +T PTS+QAQ  P+ALSGRD++G A TG
Sbjct  95    ITLKGKNIPNPVFTFEETGFPDYVLKEIKRQGFTEPTSIQAQGWPIALSGRDMVGIASTG  154

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  +    +   
Sbjct  155   SGKTLSYILPAIVHINSQPKLGRKDGPIALVLAPTRELAQQIQQVADDFGHT-SGIRNTC  213

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  214   LYGGAPKGAQARDLDGGVEIVIATPGRLLDFLESGRTNLKRCTYLVLDEADRMLDMGFEP  273

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E++ LA+++L D  ++ VG++  +   N+ QI++  
Sbjct  274   QIRKIIEQIRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLAANHNILQIIDVC  333

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              + EK ++L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG 
Sbjct  334   QDYEKENKLSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGD  387

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             ++Q ER+  L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR
Sbjct  388   KTQQERDWVLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGR  447

Query  837   AGSTGQATSFYT  802
                TG A +F+T
Sbjct  448   RQKTGTAYTFFT  459



>ref|XP_004931451.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Bombyx mori]
Length=823

 Score =   348 bits (893),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 179/383 (47%), Positives = 253/383 (66%), Gaps = 9/383 (2%)
 Frame = -3

Query  1935  RLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTI-PTSVQAQAMPVALSGRD  1759
             R  V   + +  N  P P + F +      IM  I      I PT +QAQ  P+ALSGRD
Sbjct  213   RFRVTKEITVSGNNIPRPNQLFEEGNFPDHIMSTIKEQPNLIEPTGIQAQGWPIALSGRD  272

Query  1758  LLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRS  1579
             ++G A TGSGKT A+ +P   H + Q  ++RGDGP+AL+LAPTRELAQQI++  +A+S +
Sbjct  273   MVGIASTGSGKTLAYMLPAAVHIVHQQRIQRGDGPIALILAPTRELAQQIQSVAQAYS-A  331

Query  1578  LDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADR  1399
                 +   + GG+  G Q  +L  GV IV+ATPGRLID L++G T+L R +++VLDEADR
Sbjct  332   RGCIRNTCLFGGSPKGPQARDLERGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADR  391

Query  1398  MLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTAN  1222
             MLDMGFEPQIR+++  +    Q L++SAT P EI+ALA+++LTD ++V +G+++ S   N
Sbjct  392   MLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEIQALAEDFLTDYIKVNIGSLNLSANNN  451

Query  1221  VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGL  1042
             + QI+E   E+EK  +L +LL E +++ E         IVFVE K K +++A A+ + G 
Sbjct  452   IKQIIEICEEHEKEVKLTNLLKEIASEKENK------VIVFVETKKKVDDIARAVRRGGY  505

Query  1041  LATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYV  862
              A A+HG +SQ ER+A L +FR G T+IL+ATDVA+RGLDV  V  V+N D P + EDY+
Sbjct  506   KALAIHGDKSQPERDAVLTEFRNGSTTILIATDVAARGLDVEDVKFVVNFDYPNSSEDYI  565

Query  861   HRIGRTGRAGSTGQATSFYTDRD  793
             HRIGRTGR   +G A +++T  D
Sbjct  566   HRIGRTGRCQQSGTAYTYFTSGD  588



>gb|AAI34864.1| LOC556764 protein [Danio rerio]
Length=519

 Score =   339 bits (870),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 177/385 (46%), Positives = 244/385 (63%), Gaps = 12/385 (3%)
 Frame = -3

Query  1953  IEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVA  1774
             +EE R +  + V      +  P PV SF        +M  +   ++  PT++QAQ  P+A
Sbjct  74    VEEYRRKREITVR----GSGCPKPVTSFHQAQFPQYVMDVLLQQNFKEPTAIQAQGFPLA  129

Query  1773  LSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVK  1594
             LSGRD++G A+TGSGKT A+ +P I H   QP L RGDGP+ LVLAPTRELAQQ++    
Sbjct  130   LSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAF  189

Query  1593  AFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVL  1414
              + +S    K+  V GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++VL
Sbjct  190   DYGKS-SRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVL  248

Query  1413  DEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-  1237
             DEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L D V++ +G +  
Sbjct  249   DEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALEL  308

Query  1236  SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEAL  1057
             S   N+ QI++   ENEK ++L+ L+ E  A+ E        TI+FVE K +C+E+   +
Sbjct  309   SANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENK------TIIFVETKKRCDELTRRM  362

Query  1056  MKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKT  877
              + G  A  +HG +SQ ER+  L +FR G   IL+ATDVASRGLDV  V  VIN D P +
Sbjct  363   RRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNS  422

Query  876   MEDYVHRIGRTGRAGSTGQATSFYT  802
              EDYVHRIGRT R+ + G A +F+T
Sbjct  423   SEDYVHRIGRTARSTNKGTAYTFFT  447



>gb|ADB44900.1| DEAD(Asp-Glu-Ala-Asp) box polypeptide 5 [Macrobrachium nipponense]
Length=540

 Score =   340 bits (872),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 186/399 (47%), Positives = 249/399 (62%), Gaps = 12/399 (3%)
 Frame = -3

Query  1995  WKPSERVLLFKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDY  1816
             ++P+ +VL     ++E+ R     +  + +     P P++ FTD      +M +I    Y
Sbjct  65    YQPTPQVLNRSPYEVEQYR----NEKEITLRGKNIPNPIQYFTDYNFPDYVMAEIRRQGY  120

Query  1815  TIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLA  1636
              IPT +QAQ  P++L GRD +G A+TGSGKT  + +P I H   QP L RGDGP+ALVLA
Sbjct  121   EIPTPIQAQGWPISLQGRDFVGIAQTGSGKTLGYILPAIVHINHQPYLERGDGPIALVLA  180

Query  1635  PTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQ  1456
             PTRELAQQI T  + F  S    ++  V GG   G Q  +L  GV I +A PGRLID L+
Sbjct  181   PTRELAQQILTVSQDFGTS-SKIRSTCVFGGAPKGPQIRDLERGVEICIAIPGRLIDFLE  239

Query  1455  QGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEY  1276
                T+L R +++VLDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++
Sbjct  240   ASKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRNLAEDF  299

Query  1275  LTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVF  1099
             L D +++ VG++S S   N+ QI++   E EK  +L  LL  E AQ EK+      TI+F
Sbjct  300   LKDYIQLNVGSLSLSANHNILQIVDVCQEIEKDTKLRQLL-NEMAQ-EKAYK----TIIF  353

Query  1098  VERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDV  919
             +E K K EEV   L   G  A  +HG +SQ ER+  L +FR G   ILVATDVA+RGLDV
Sbjct  354   IETKRKVEEVTRGLRSTGWPAMCIHGDKSQQERDWVLSEFRSGRAPILVATDVAARGLDV  413

Query  918   NGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             + V  VIN D P   EDYVHRIGRTGR+  TG A +F+T
Sbjct  414   DDVKFVINYDYPSCSEDYVHRIGRTGRSDKTGTAYTFFT  452



>ref|XP_004981371.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 37-like [Setaria 
italica]
Length=640

 Score =   343 bits (880),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 255/404 (63%), Gaps = 12/404 (3%)
 Frame = -3

Query  1968  FKLEQIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQ  1789
             F+ ++   I      D+ V    +  P PV +F ++ L  ++ ++I    Y  PT VQ  
Sbjct  146   FEAQENTGINFDAYEDIPVETSGHDVPPPVNTFAEIDLGDALNENIRRCKYVKPTPVQRH  205

Query  1788  AMPVALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDG-----PLALVLAPTRE  1624
             A+P+A+ GRDL+ CA+TGSGKTAAF  P+I   L   P +R  G     PLAL+L+PTRE
Sbjct  206   AIPIAIGGRDLMACAQTGSGKTAAFCFPIISGILKSRPPQRQRGSRTACPLALILSPTRE  265

Query  1623  LAQQIETEVKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNT  1444
             L+ QI  E + FS      +  +  GG  I  Q  EL  GV I+VATPGRL+D L++   
Sbjct  266   LSMQIHEEARKFSYQT-GVRVVVAYGGAPIHQQLRELERGVEILVATPGRLMDLLERARV  324

Query  1443  SLSRISFVVLDEADRMLDMGFEPQIREVMH--NLPKK--HQTLLFSATMPAEIEALAQEY  1276
             SL  I ++ LDEADRMLDMGFEPQIR+++   ++P +   QT+LFSAT P EI+ LA ++
Sbjct  325   SLQMIKYLALDEADRMLDMGFEPQIRKIVDQMDMPPRGVRQTMLFSATFPKEIQRLASDF  384

Query  1275  LTDPVRVKVGNVSSPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFV  1096
             L D + + VG V S T  +AQ +E V E +K   L+DLL  + A A       +LT+VFV
Sbjct  385   LADYIFLAVGRVGSSTDLIAQRVEFVLEADKRSYLMDLLHAQKANAAHGKQ--ALTLVFV  442

Query  1095  ERKTKCEEVAEALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVN  916
             E K   + + + L K G  AT++HG R+Q ERE ALR F+ G T ILVATDVA+RGLD+ 
Sbjct  443   ETKRGADALEDWLYKNGFPATSIHGDRTQQEREYALRSFKSGATPILVATDVAARGLDIP  502

Query  915   GVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYL  784
              VAHVIN DLP  ++DYVHRIGRTGRAG +G AT+F+ + ++ L
Sbjct  503   HVAHVINFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNEGNLSL  546



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score =   338 bits (868),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 245/365 (67%), Gaps = 12/365 (3%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P PV++F D+     +M++I    ++ PT +Q+Q  P+AL GRDL+G AETGSGKT ++ 
Sbjct  95    PKPVKTFHDVGFPDYVMEEIVKAGFSEPTPIQSQGWPMALKGRDLIGIAETGSGKTISYL  154

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    K+  + GG   G
Sbjct  155   LPAIVHVNAQPILALGDGPIVLVLAPTRELAVQIQQEASKFGSS-SKIKSTCIYGGVPKG  213

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L+ GV IV+ATPGRLID L+  +T+L R++++VLDEADRMLDMGFEPQIR+++  
Sbjct  214   PQVRDLQKGVEIVIATPGRLIDMLESNHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQ  273

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSPTANVA--QILEKVPENEKID  1177
             +    QTL +SAT P E+E LA+++L +P +V +G+ S   AN A  Q+++ V EN+K +
Sbjct  274   IRPDRQTLYWSATWPKEVEQLAKKFLYNPYKVLIGS-SDLKANRAIRQLVDVVSENQKYN  332

Query  1176  RLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSERE  997
             +L+ LL E+           S  ++F++ K  C+++   L   G  A ++HG +SQ+ER+
Sbjct  333   KLVKLL-EDIMDG-------SRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERD  384

Query  996   AALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQA  817
               L +FR G + I+ ATDVA+RGLDV  V +VIN D P ++EDYVHRIGRTGRAG+ G A
Sbjct  385   WVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTA  444

Query  816   TSFYT  802
              +F+T
Sbjct  445   YTFFT  449



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score =   338 bits (868),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 190/448 (42%), Positives = 276/448 (62%), Gaps = 26/448 (6%)
 Frame = -3

Query  2121  QSKNGFISNGEYCSNDAGRNSCATVNYLSPR-----GLVAPDPVFPQWKPSERVLLFKLE  1957
             +S +GF     Y S+     SC      SPR     GL   +  F    P+  V      
Sbjct  18    RSDSGFGGTSAYGSS-GSHTSCKKDTDGSPRKLDLDGLTPFEKNFYVESPA--VAAMTDS  74

Query  1956  QIEEIR-LRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             +++E R LR      + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P
Sbjct  75    EVDEYRKLR-----EITVEGRDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWP  129

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +A+ GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  130   MAMKGRDLIGIAETGSGKTISYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  189

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++
Sbjct  190   ASKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYL  248

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ 
Sbjct  249   VLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-  307

Query  1239  SSPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             S   AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++ 
Sbjct  308   SDLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQIT  359

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  360   RQLRMDGWPALSIHGDKSQAERDWVLAEFRSGKSPIMTATDVAARGLDVKDVKYVINYDF  419

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  420   PGSLEDYVHRIGRTGRAGAKGTAYTFFT  447



>ref|XP_008328999.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X2 
[Cynoglossus semilaevis]
Length=498

 Score =   338 bits (868),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 172/389 (44%), Positives = 245/389 (63%), Gaps = 12/389 (3%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             +       P P+  F +      +M+ I   ++T PT +QAQ  P+ALSG+D++G A+TG
Sbjct  88    ITFKGRECPNPITQFQEAAFPSYVMEVIDKQNWTEPTPIQAQGWPLALSGKDMVGIAQTG  147

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT ++ +P I H   QP L RGDGP+ LVLAPTRELAQQ++     + R+    K+  
Sbjct  148   SGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYGRA-SRLKSTC  206

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++VLDEADRMLDMGFEP
Sbjct  207   IYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEP  266

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKV  1198
             QIR+++  +    QTL++SAT P E+  LA+++L D V++ VG +  S   N+ QI++  
Sbjct  267   QIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINVGALQLSANHNILQIVDVC  326

Query  1197  PENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGG  1018
              + EK ++L+ LL E  ++ E        TI+FVE K KC+++   + + G  A  +HG 
Sbjct  327   NDGEKENKLIRLLEEIMSEKENK------TIIFVETKRKCDDLTRRMRRDGWPAMGIHGD  380

Query  1017  RSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGR  838
             +SQ ER+  L +F+ G   IL+ATDVASRGLDV  V  VIN D P   EDY+HRIGRT R
Sbjct  381   KSQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTAR  440

Query  837   AGSTGQATSFYTDRDMY----LVAQIRKA  763
             +  TG A +F+T  +M     L++ +R+A
Sbjct  441   SQKTGTAYTFFTPNNMRQARDLISVLREA  469



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   338 bits (868),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 177/406 (44%), Positives = 262/406 (65%), Gaps = 18/406 (4%)
 Frame = -3

Query  1956  QIEEIR-LRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             ++EE R LR      + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P
Sbjct  77    EVEEYRKLR-----EITVEGKDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWP  131

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +A+ GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  132   MAMKGRDLIGIAETGSGKTISYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  191

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    K+  + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++
Sbjct  192   ASKFGSS-SKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYL  250

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ 
Sbjct  251   VLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-  309

Query  1239  SSPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             S   AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++ 
Sbjct  310   SDLKANRAIRQIVDVISESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQIT  361

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +FR G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  362   RQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDF  421

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYTDRDMYLVAQIRKAIADVG  748
             P ++EDYVHRIGRTGRAG+ G A +F+T  +     ++   + + G
Sbjct  422   PGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELSNILEEAG  467



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score =   338 bits (868),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 176/386 (46%), Positives = 248/386 (64%), Gaps = 14/386 (4%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE R R  + V    +    P PV+SF DM     ++++I    +  PT +QAQ  P+
Sbjct  77    EVEEYRQRREITV----EGRDVPKPVKSFRDMGFPEYVLQEITKAGFVEPTPIQAQGWPM  132

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             AL GRDL+G AETGSGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E 
Sbjct  133   ALKGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEA  192

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               F  S    K   + GG   G Q  +L+ GV IV+ATPGRLID L+  +T+L R++++V
Sbjct  193   AKFGAS-SRIKNTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMLESHHTNLRRVTYLV  251

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL +SAT P E+E LA+++L +P +V +G+  
Sbjct  252   LDEADRMLDMGFEPQIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLYNPYKVIIGSAD  311

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
                   + Q ++ VPE++K  +L+ LL E+           S  ++F++ K  C+++   
Sbjct  312   LKANHAIRQHVDIVPESQKYSKLVKLL-EDIMDG-------SRILIFMDTKKGCDQITRR  363

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D P 
Sbjct  364   LRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPG  423

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  424   SLEDYVHRIGRTGRAGAKGTAYTFFT  449



>ref|XP_004931452.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X2 [Bombyx mori]
Length=821

 Score =   348 bits (892),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 179/383 (47%), Positives = 253/383 (66%), Gaps = 9/383 (2%)
 Frame = -3

Query  1935  RLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTI-PTSVQAQAMPVALSGRD  1759
             R  V   + +  N  P P + F +      IM  I      I PT +QAQ  P+ALSGRD
Sbjct  211   RFRVTKEITVSGNNIPRPNQLFEEGNFPDHIMSTIKEQPNLIEPTGIQAQGWPIALSGRD  270

Query  1758  LLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRS  1579
             ++G A TGSGKT A+ +P   H + Q  ++RGDGP+AL+LAPTRELAQQI++  +A+S +
Sbjct  271   MVGIASTGSGKTLAYMLPAAVHIVHQQRIQRGDGPIALILAPTRELAQQIQSVAQAYS-A  329

Query  1578  LDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADR  1399
                 +   + GG+  G Q  +L  GV IV+ATPGRLID L++G T+L R +++VLDEADR
Sbjct  330   RGCIRNTCLFGGSPKGPQARDLERGVEIVIATPGRLIDFLERGTTNLRRCTYLVLDEADR  389

Query  1398  MLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTAN  1222
             MLDMGFEPQIR+++  +    Q L++SAT P EI+ALA+++LTD ++V +G+++ S   N
Sbjct  390   MLDMGFEPQIRKIIEQIRPDRQVLMWSATWPKEIQALAEDFLTDYIKVNIGSLNLSANNN  449

Query  1221  VAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGL  1042
             + QI+E   E+EK  +L +LL E +++ E         IVFVE K K +++A A+ + G 
Sbjct  450   IKQIIEICEEHEKEVKLTNLLKEIASEKENK------VIVFVETKKKVDDIARAVRRGGY  503

Query  1041  LATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYV  862
              A A+HG +SQ ER+A L +FR G T+IL+ATDVA+RGLDV  V  V+N D P + EDY+
Sbjct  504   KALAIHGDKSQPERDAVLTEFRNGSTTILIATDVAARGLDVEDVKFVVNFDYPNSSEDYI  563

Query  861   HRIGRTGRAGSTGQATSFYTDRD  793
             HRIGRTGR   +G A +++T  D
Sbjct  564   HRIGRTGRCQQSGTAYTYFTSGD  586



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score =   338 bits (868),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 257/388 (66%), Gaps = 18/388 (5%)
 Frame = -3

Query  1956  QIEEIR-LRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMP  1780
             ++EE R LR      + ++    P PV+SF D+     ++++I    +T PT +Q+Q  P
Sbjct  78    EVEEYRKLR-----EITVEGRDIPKPVKSFRDVGFPDYVLEEIKKAGFTEPTPIQSQGWP  132

Query  1779  VALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETE  1600
             +A+ GRDL+G AETGSGKT ++ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E
Sbjct  133   MAMKGRDLIGIAETGSGKTLSYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQE  192

Query  1599  VKAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFV  1420
                F  S    KT+ + GG   G Q  +L+ GV IV+ATPGRLID ++  NT+L R++++
Sbjct  193   ASKFGSS-SKIKTSCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMMESNNTNLRRVTYL  251

Query  1419  VLDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNV  1240
             VLDEADRMLDMGF+PQIR+++ ++    QTL +SAT P E+E L++++L +P +V +G+ 
Sbjct  252   VLDEADRMLDMGFDPQIRKIVSHIRPDRQTLYWSATWPKEVEQLSKKFLYNPYKVIIGS-  310

Query  1239  SSPTANVA--QILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVA  1066
             S   AN A  QI++ + E++K ++L+ LL E+           S  +VF++ K  C+++ 
Sbjct  311   SDLKANRAIRQIVDVITESQKYNKLVKLL-EDIMDG-------SRILVFLDTKKGCDQIT  362

Query  1065  EALMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDL  886
               L   G  A ++HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V +VIN D 
Sbjct  363   RQLRMDGWPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDF  422

Query  885   PKTMEDYVHRIGRTGRAGSTGQATSFYT  802
             P ++EDYVHRIGRTGRAG+ G A +F+T
Sbjct  423   PGSLEDYVHRIGRTGRAGAKGTAYTFFT  450



>ref|XP_011068510.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Acromyrmex echinatior]
Length=574

 Score =   341 bits (874),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 236/364 (65%), Gaps = 8/364 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P PV  F +      ++++I    ++ PTS+QAQ  P+ALSGRD++G A TGSGKT ++ 
Sbjct  104   PNPVFDFDEAGFPDYVLREIKRQGFSEPTSIQAQGWPIALSGRDMVGIASTGSGKTLSYI  163

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   + GG   G
Sbjct  164   LPAIVHINSQPKLSRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTCLYGGAPKG  222

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEPQIR+++  
Sbjct  223   AQARDLDGGVEIVIATPGRLLDFLESGKTNLKRCTYLVLDEADRMLDMGFEPQIRKIIEQ  282

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA+++L D  ++ VG++  S   N+ QI++   + EK ++
Sbjct  283   IRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLSANHNILQIIDVCQDYEKENK  342

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG ++Q ER+ 
Sbjct  343   LSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGDKTQQERDW  396

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR   TG A 
Sbjct  397   VLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGRRQKTGTAY  456

Query  813   SFYT  802
             +F+T
Sbjct  457   TFFT  460



>gb|KFV68880.1| putative ATP-dependent RNA helicase DDX17, partial [Picoides 
pubescens]
Length=473

 Score =   337 bits (865),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 245/386 (63%), Gaps = 11/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE+R +  + +   M+    P PV +F        +M  +   ++T PT +Q Q  P+
Sbjct  53    EVEELRRKKEITIR-GMEG--CPKPVFAFHQCSFPQYVMDALMDQNFTEPTPIQCQGFPL  109

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSGRD++G A+TGSGKT A+ +P I H   QP L RGDGP+ LVLAPTRELAQQ++   
Sbjct  110   ALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVA  169

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               + +     K+  + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++V
Sbjct  170   DDYGKC-SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLV  228

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L D V++ VGN+ 
Sbjct  229   LDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINVGNLE  288

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   E+EK  +L+ L+ E  A+ E        TI+FVE K +C+++   
Sbjct  289   LSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK------TIIFVETKRRCDDLTRR  342

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG +SQ ER+  L +FR G   IL+ATDVASRGLDV  V  VIN D P 
Sbjct  343   MRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPN  402

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             + EDYVHRIGRT R+ + G A +F+T
Sbjct  403   SSEDYVHRIGRTARSTNKGTAYTFFT  428



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   338 bits (868),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 176/375 (47%), Positives = 246/375 (66%), Gaps = 16/375 (4%)
 Frame = -3

Query  1914  VAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETG  1735
             + ++    P PV++F+D+     +++++    +  PT++QAQ  P+AL GRDL+G AETG
Sbjct  86    ITIEGRDVPKPVKTFSDVGFPEYVLEEVKKAGFVEPTAIQAQGWPMALKGRDLIGLAETG  145

Query  1734  SGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAI  1555
             SGKT A+ +P I H  AQP L  GDGP+ LVLAPTRELA QI+ E   F  S    K   
Sbjct  146   SGKTLAYLLPAIVHVNAQPILSHGDGPIVLVLAPTRELAVQIQQEATKFGAS-SRIKNTC  204

Query  1554  VVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEP  1375
             + GG   G Q  +L  GV IV+ATPGRLID L+  +T+L R++++VLDEADRMLDMGFEP
Sbjct  205   IYGGVPKGPQVRDLNKGVEIVIATPGRLIDMLESNHTNLRRVTYLVLDEADRMLDMGFEP  264

Query  1374  QIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVSSP--TAN--VAQIL  1207
             QIR+++  +    QTL +SAT P E+E LA+++L +  +V +G   SP   AN  + QI+
Sbjct  265   QIRKIVSQIRPDRQTLYWSATWPKEVEQLARQFLHNAYKVIIG---SPDLKANHAIRQIV  321

Query  1206  EKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATAL  1027
             E V EN+K  +L+DLL E+           S  +VF++ K  C+++   L   G  A ++
Sbjct  322   EIVSENQKYKKLVDLL-EDIMDG-------SRILVFMDTKKGCDQITRQLRMDGWPALSI  373

Query  1026  HGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGR  847
             HG +SQ+ER+  L +F+ G + I+ ATDVA+RGLDV  V  VIN D P ++EDYVHRIGR
Sbjct  374   HGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGR  433

Query  846   TGRAGSTGQATSFYT  802
             TGRAG+TG A +F+T
Sbjct  434   TGRAGATGTAYTFFT  448



>gb|EMC76814.1| putative ATP-dependent RNA helicase DDX17, partial [Columba livia]
Length=481

 Score =   338 bits (866),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 174/386 (45%), Positives = 245/386 (63%), Gaps = 11/386 (3%)
 Frame = -3

Query  1956  QIEEIRLRLNVDVAVAMDSNPAPAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPV  1777
             ++EE+R +  + +   M+    P PV +F        +M  +   ++T PT +Q Q  P+
Sbjct  52    EVEELRRKKEITIR-GMEG--CPKPVFAFHQCSFPQYVMDALMDQNFTEPTPIQCQGFPL  108

Query  1776  ALSGRDLLGCAETGSGKTAAFTIPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEV  1597
             ALSGRD++G A+TGSGKT A+ +P I H   QP L RGDGP+ LVLAPTRELAQQ++   
Sbjct  109   ALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVA  168

Query  1596  KAFSRSLDSFKTAIVVGGTNIGDQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVV  1417
               + +     K+  + GG   G Q  +L  GV I +ATPGRLID L+ G T+L R +++V
Sbjct  169   DDYGKC-SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLV  227

Query  1416  LDEADRMLDMGFEPQIREVMHNLPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS  1237
             LDEADRMLDMGFEPQIR+++  +    QTL++SAT P E+  LA+++L D V++ VGN+ 
Sbjct  228   LDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINVGNLE  287

Query  1236  -SPTANVAQILEKVPENEKIDRLLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEA  1060
              S   N+ QI++   E+EK  +L+ L+ E  A+ E        TI+FVE K +C+++   
Sbjct  288   LSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK------TIIFVETKRRCDDLTRR  341

Query  1059  LMKQGLLATALHGGRSQSEREAALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPK  880
             + + G  A  +HG +SQ ER+  L +FR G   IL+ATDVASRGLDV  V  VIN D P 
Sbjct  342   MRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPN  401

Query  879   TMEDYVHRIGRTGRAGSTGQATSFYT  802
             + EDYVHRIGRT R+ + G A +F+T
Sbjct  402   SSEDYVHRIGRTARSTNKGTAYTFFT  427



>ref|XP_011068511.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Acromyrmex echinatior]
Length=582

 Score =   341 bits (875),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 236/364 (65%), Gaps = 8/364 (2%)
 Frame = -3

Query  1890  PAPVESFTDMCLHPSIMKDIALHDYTIPTSVQAQAMPVALSGRDLLGCAETGSGKTAAFT  1711
             P PV  F +      ++++I    ++ PTS+QAQ  P+ALSGRD++G A TGSGKT ++ 
Sbjct  112   PNPVFDFDEAGFPDYVLREIKRQGFSEPTSIQAQGWPIALSGRDMVGIASTGSGKTLSYI  171

Query  1710  IPMIQHCLAQPPLRRGDGPLALVLAPTRELAQQIETEVKAFSRSLDSFKTAIVVGGTNIG  1531
             +P I H  +QP L R DGP+ALVLAPTRELAQQI+     F  S    +   + GG   G
Sbjct  172   LPAIVHINSQPKLSRKDGPIALVLAPTRELAQQIQQVADDFGHS-SGIRNTCLYGGAPKG  230

Query  1530  DQRSELRAGVNIVVATPGRLIDHLQQGNTSLSRISFVVLDEADRMLDMGFEPQIREVMHN  1351
              Q  +L  GV IV+ATPGRL+D L+ G T+L R +++VLDEADRMLDMGFEPQIR+++  
Sbjct  231   AQARDLDGGVEIVIATPGRLLDFLESGKTNLKRCTYLVLDEADRMLDMGFEPQIRKIIEQ  290

Query  1350  LPKKHQTLLFSATMPAEIEALAQEYLTDPVRVKVGNVS-SPTANVAQILEKVPENEKIDR  1174
             +    QTL++SAT P E++ LA+++L D  ++ VG++  S   N+ QI++   + EK ++
Sbjct  291   IRPDRQTLMWSATWPKEVKNLAEDFLKDYAQINVGSLQLSANHNILQIIDVCQDYEKENK  350

Query  1173  LLDLLVEESAQAEKSGHPFSLTIVFVERKTKCEEVAEALMKQGLLATALHGGRSQSEREA  994
             L  LL E  A++E        TIVF+E K + +E+   + + G  A  +HG ++Q ER+ 
Sbjct  351   LSTLLKEIMAESENK------TIVFIETKRRVDEITRKMKRDGWPAVCIHGDKTQQERDW  404

Query  993   ALRDFRRGPTSILVATDVASRGLDVNGVAHVINLDLPKTMEDYVHRIGRTGRAGSTGQAT  814
              L+DFR G   ILVATDVA+RGLDV  V  VIN D P   EDYVHRIGRTGR   TG A 
Sbjct  405   VLQDFRSGKAPILVATDVAARGLDVEDVKFVINFDYPSCSEDYVHRIGRTGRRQKTGTAY  464

Query  813   SFYT  802
             +F+T
Sbjct  465   TFFT  468



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7470104780096