BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20916_g1_i2 len=1433 path=[1411:0-732 2144:733-743 2155:744-770
2182:771-853 2265:854-912 2324:913-1432]

Length=1433
                                                                      Score     E

ref|XP_009771846.1|  PREDICTED: exopolygalacturonase clone GBGE184      471   5e-160   
ref|XP_009597284.1|  PREDICTED: exopolygalacturonase clone GBGE18...    471   5e-160   
ref|XP_004240551.1|  PREDICTED: polygalacturonase                       444   2e-149   
ref|XP_006355817.1|  PREDICTED: exopolygalacturonase clone GBGE18...    442   2e-148   
gb|AHL24656.1|  Ole e 13.01 allergen                                    440   4e-148   
gb|EYU42229.1|  hypothetical protein MIMGU_mgv1a007314mg                429   2e-143   
emb|CDP17107.1|  unnamed protein product                                421   4e-140   
ref|XP_011082446.1|  PREDICTED: exopolygalacturonase clone GBGE18...    421   5e-140   
ref|XP_011079627.1|  PREDICTED: exopolygalacturonase-like               407   7e-135   
ref|XP_011086597.1|  PREDICTED: exopolygalacturonase-like               397   9e-131   
gb|EYU46750.1|  hypothetical protein MIMGU_mgv1a007104mg                392   6e-129   
gb|KDP24950.1|  hypothetical protein JCGZ_24417                         366   1e-118   
ref|XP_011015579.1|  PREDICTED: exopolygalacturonase clone GBGE184      367   9e-118   
gb|KDP27317.1|  hypothetical protein JCGZ_21001                         361   2e-116   
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               362   3e-116   
ref|XP_007050989.1|  Polygalacturonase 4, putative                      358   2e-115   
ref|XP_002301489.1|  Exopolygalacturonase clone GBGE184 precursor...    353   8e-114   Populus trichocarpa [western balsam poplar]
ref|XP_002301488.2|  hypothetical protein POPTR_0002s20330g             353   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010026119.1|  PREDICTED: exopolygalacturonase-like               350   3e-112   
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    350   3e-112   Vitis vinifera
ref|XP_006480116.1|  PREDICTED: exopolygalacturonase clone GBGE18...    348   6e-112   
ref|XP_006444403.1|  hypothetical protein CICLE_v10023712mg             348   1e-111   
gb|KGN44972.1|  hypothetical protein Csa_7G404800                       348   1e-111   
ref|XP_010652203.1|  PREDICTED: exopolygalacturonase                    346   5e-111   
emb|CBI36886.3|  unnamed protein product                                347   7e-111   
ref|XP_008451547.1|  PREDICTED: exopolygalacturonase clone GBGE184      343   2e-109   
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               343   4e-109   
emb|CAN69218.1|  hypothetical protein VITISV_012014                     351   1e-107   Vitis vinifera
gb|EPS59866.1|  hypothetical protein M569_14940                         335   2e-107   
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               336   6e-107   
ref|XP_004161540.1|  PREDICTED: polygalacturonase-like                  337   7e-107   
ref|XP_004148972.1|  PREDICTED: polygalacturonase-like                  335   4e-106   
ref|XP_008438909.1|  PREDICTED: exopolygalacturonase-like               334   6e-106   
ref|XP_008451635.1|  PREDICTED: exopolygalacturonase-like               333   2e-105   
emb|CDO98830.1|  unnamed protein product                                331   3e-105   
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               333   4e-105   
ref|XP_004495937.1|  PREDICTED: exopolygalacturonase clone GBGE18...    330   2e-104   
ref|XP_010088309.1|  Exopolygalacturonase clone GBGE184                 328   1e-103   
ref|XP_010321891.1|  PREDICTED: exopolygalacturonase-like               325   5e-103   
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          325   6e-103   
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               327   1e-102   
ref|XP_003591491.1|  Polygalacturonase                                  324   1e-102   
ref|XP_010938370.1|  PREDICTED: exopolygalacturonase-like               324   2e-102   
ref|XP_003519756.1|  PREDICTED: exopolygalacturonase clone GBGE18...    324   2e-102   
gb|KGN44733.1|  hypothetical protein Csa_7G375750                       333   3e-102   
ref|XP_004167141.1|  PREDICTED: exopolygalacturonase clone GBGE18...    325   3e-102   
ref|XP_004292668.1|  PREDICTED: exopolygalacturonase clone GBGE18...    323   2e-101   
ref|XP_002314373.2|  hypothetical protein POPTR_0010s01470g             321   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    320   5e-101   
ref|XP_007145196.1|  hypothetical protein PHAVU_007G218300g             320   1e-100   
gb|KHN08670.1|  Galacturan 1,4-alpha-galacturonidase4                   319   2e-100   
ref|XP_004298148.1|  PREDICTED: exopolygalacturonase clone GBGE18...    320   2e-100   
ref|XP_008353213.1|  PREDICTED: exopolygalacturonase-like               319   4e-100   
ref|XP_004161670.1|  PREDICTED: polygalacturonase-like                  320   4e-100   
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    318   1e-99    
gb|AAX45476.1|  polygalacturonase                                       316   3e-99    Lilium longiflorum [Easter lily]
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          314   6e-99    
ref|XP_010556723.1|  PREDICTED: exopolygalacturonase clone GBGE18...    315   6e-99    
gb|KGN50738.1|  hypothetical protein Csa_5G222970                       314   2e-98    
ref|XP_011091008.1|  PREDICTED: exopolygalacturonase-like               313   3e-98    
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             313   4e-98    
ref|XP_007224043.1|  hypothetical protein PRUPE_ppa015208mg             311   5e-98    
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               312   7e-98    
ref|XP_008235125.1|  PREDICTED: exopolygalacturonase-like               314   1e-97    
ref|XP_006489253.1|  PREDICTED: polygalacturonase-like                  313   1e-97    
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               311   1e-97    
ref|XP_009109724.1|  PREDICTED: exopolygalacturonase clone GBGE18...    312   2e-97    
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               312   2e-97    
ref|XP_008386673.1|  PREDICTED: exopolygalacturonase-like isoform X2    313   3e-97    
ref|XP_002314372.2|  hypothetical protein POPTR_0010s01460g             311   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    311   4e-97    
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               310   7e-97    
ref|XP_009417454.1|  PREDICTED: exopolygalacturonase-like               309   7e-97    
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               309   8e-97    
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               309   8e-97    
ref|XP_007224662.1|  hypothetical protein PRUPE_ppa026115mg             308   8e-97    
ref|XP_011006455.1|  PREDICTED: exopolygalacturonase-like               309   1e-96    
ref|XP_002315493.2|  hypothetical protein POPTR_0010s00940g             309   1e-96    Populus trichocarpa [western balsam poplar]
gb|EPS67111.1|  hypothetical protein M569_07664                         306   1e-96    
gb|ABY21306.1|  pollen allergen Pla o 2                                 308   1e-96    Platanus orientalis
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  308   1e-96    
emb|CDY35744.1|  BnaC03g58650D                                          309   1e-96    
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               308   2e-96    
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    308   2e-96    
ref|XP_006418305.1|  hypothetical protein EUTSA_v10007721mg             308   3e-96    
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               308   3e-96    
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative    308   3e-96    
ref|XP_007200668.1|  hypothetical protein PRUPE_ppa015568mg             310   5e-96    
ref|XP_009109723.1|  PREDICTED: exopolygalacturonase clone GBGE18...    308   6e-96    
ref|XP_011010959.1|  PREDICTED: exopolygalacturonase-like               307   9e-96    
ref|XP_010522804.1|  PREDICTED: exopolygalacturonase clone GBGE18...    308   1e-95    
emb|CDX90152.1|  BnaA08g18320D                                          307   1e-95    
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               305   2e-95    
ref|XP_006845393.1|  hypothetical protein AMTR_s00019p00058670          305   2e-95    
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             305   3e-95    
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    305   3e-95    
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               305   4e-95    
gb|EMT18530.1|  Exopolygalacturonase                                    305   5e-95    
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               305   5e-95    
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               305   6e-95    
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               305   6e-95    
emb|CDP18013.1|  unnamed protein product                                305   7e-95    
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               305   8e-95    
emb|CDX90415.1|  BnaA03g43660D                                          305   8e-95    
ref|XP_010109588.1|  hypothetical protein L484_005247                   307   1e-94    
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    304   1e-94    
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               304   2e-94    
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               303   2e-94    
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               306   2e-94    
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    303   2e-94    
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               304   2e-94    
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               303   2e-94    
gb|EMS56561.1|  Exopolygalacturonase                                    303   2e-94    
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    303   2e-94    Vitis vinifera
emb|CDY01524.1|  BnaC07g35140D                                          303   3e-94    
gb|AEW90949.1|  polygalacturonase R2-7                                  303   4e-94    
dbj|BAK06865.1|  predicted protein                                      303   5e-94    
ref|XP_007035658.1|  Pectin lyase-like superfamily protein, putative    303   5e-94    
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     304   6e-94    
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               303   8e-94    
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             303   9e-94    Elaeis guineensis
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               303   9e-94    
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  301   1e-93    
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               301   1e-93    
ref|XP_002516967.1|  Exopolygalacturonase clone GBGE184 precursor...    301   1e-93    Ricinus communis
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    301   1e-93    Gossypium barbadense [Egyptian cotton]
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    301   1e-93    
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               301   1e-93    
ref|XP_008223247.1|  PREDICTED: exopolygalacturonase-like               302   1e-93    
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    301   1e-93    Gossypium hirsutum [American cotton]
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               301   2e-93    
ref|NP_171778.1|  polygalacturonase 4                                   301   2e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDP04348.1|  unnamed protein product                                300   3e-93    
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             301   3e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               300   4e-93    
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          300   5e-93    
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    299   5e-93    Vitis vinifera
emb|CDP04343.1|  unnamed protein product                                300   5e-93    
ref|XP_009111183.1|  PREDICTED: exopolygalacturonase clone GBGE18...    300   6e-93    
emb|CBI22963.3|  unnamed protein product                                299   9e-93    
emb|CDY35745.1|  BnaC03g58660D                                          299   1e-92    
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    303   1e-92    
ref|XP_004487822.1|  PREDICTED: polygalacturonase-like                  299   1e-92    
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             298   1e-92    
emb|CDY65794.1|  BnaCnng48740D                                          299   1e-92    
ref|XP_006419502.1|  hypothetical protein CICLE_v10004345mg             309   2e-92    
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               299   2e-92    
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               298   2e-92    
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               298   2e-92    
ref|XP_004160573.1|  PREDICTED: exopolygalacturonase clone GBGE18...    299   3e-92    
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    297   3e-92    Vitis vinifera
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    297   3e-92 
emb|CDY15264.1|  BnaC05g01430D                                          298   3e-92    
emb|CBI28390.3|  unnamed protein product                                299   3e-92    
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    297   3e-92    
emb|CDP06168.1|  unnamed protein product                                297   4e-92    
ref|XP_004292314.1|  PREDICTED: exopolygalacturonase-like               298   4e-92    
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       297   4e-92    
ref|XP_010649600.1|  PREDICTED: exopolygalacturonase-like               298   4e-92    
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               297   4e-92    
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               298   4e-92    
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    297   5e-92    
ref|XP_010112808.1|  hypothetical protein L484_020040                   297   5e-92    
ref|XP_002892124.1|  hypothetical protein ARALYDRAFT_887420             298   5e-92    
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    296   5e-92    Vitis vinifera
ref|XP_007049259.1|  Polygalacturonase                                  297   5e-92    
ref|XP_006303792.1|  hypothetical protein CARUB_v10012094mg             298   5e-92    
dbj|BAK05779.1|  predicted protein                                      297   5e-92    
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       297   6e-92    
gb|KEH33414.1|  polygalacturonase/glycoside hydrolase family protein    296   6e-92    
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               296   8e-92    
emb|CDX88444.1|  BnaC06g38880D                                          296   8e-92    
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              297   9e-92    
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               296   9e-92    
ref|XP_003528630.1|  PREDICTED: polygalacturonase                       297   9e-92    
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   296   9e-92    
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         296   1e-91    
ref|XP_009136909.1|  PREDICTED: exopolygalacturonase                    297   1e-91    
ref|XP_010413907.1|  PREDICTED: exopolygalacturonase-like               295   1e-91    
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         296   1e-91    
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
emb|CBI22050.3|  unnamed protein product                                296   1e-91    
gb|KHN02943.1|  Polygalacturonase                                       297   1e-91    
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
ref|XP_008645431.1|  PREDICTED: exopolygalacturonase-like               296   1e-91    
ref|XP_009118746.1|  PREDICTED: exopolygalacturonase clone GBGE18...    296   1e-91    
ref|XP_010439893.1|  PREDICTED: exopolygalacturonase                    296   2e-91    
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               296   2e-91    
ref|XP_003534833.2|  PREDICTED: exopolygalacturonase clone GBGE18...    296   2e-91    
gb|KDP27841.1|  hypothetical protein JCGZ_18921                         296   2e-91    
ref|XP_010457266.1|  PREDICTED: exopolygalacturonase clone GBGE184      296   2e-91    
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    295   2e-91    
ref|XP_008645416.1|  PREDICTED: exopolygalacturonase-like               296   2e-91    
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    299   2e-91    
ref|XP_003565790.1|  PREDICTED: exopolygalacturonase-like               296   2e-91    
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    295   3e-91 
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               295   3e-91    
ref|XP_004508193.1|  PREDICTED: polygalacturonase-like                  296   3e-91    
emb|CDP18456.1|  unnamed protein product                                295   3e-91    
emb|CAA50335.1|  polygalacturonase                                      294   3e-91    Nicotiana tabacum [American tobacco]
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          296   4e-91    
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
emb|CAN65676.1|  hypothetical protein VITISV_002011                     300   5e-91    Vitis vinifera
ref|XP_010480327.1|  PREDICTED: exopolygalacturonase clone GBGE18...    293   5e-91    
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               295   6e-91    
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                293   6e-91    
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               295   7e-91    
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      294   1e-90    
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  293   1e-90    
ref|XP_010093135.1|  hypothetical protein L484_009327                   293   1e-90    
ref|XP_006647023.1|  PREDICTED: exopolygalacturonase-like               293   1e-90    
ref|XP_010667119.1|  PREDICTED: exopolygalacturonase-like               294   1e-90    
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               294   1e-90    
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  299   1e-90    
emb|CDY32479.1|  BnaA09g51170D                                          294   2e-90    
ref|XP_007138946.1|  hypothetical protein PHAVU_009G251500g             293   2e-90    
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       294   2e-90    
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               293   2e-90    
gb|KDP29567.1|  hypothetical protein JCGZ_19280                         291   3e-90    
gb|KEH37190.1|  polygalacturonase                                       293   3e-90    
ref|XP_010434565.1|  PREDICTED: exopolygalacturonase-like               293   3e-90    
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    292   3e-90    Nicotiana tabacum [American tobacco]
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         291   3e-90    
ref|XP_008340787.1|  PREDICTED: exopolygalacturonase clone GBGE18...    291   4e-90    
ref|XP_004170505.1|  PREDICTED: exopolygalacturonase clone GBGE18...    292   4e-90    
ref|NP_001241738.1|  exopolygalacturonase precursor                     293   4e-90    
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    291   4e-90    Platanus x hispanica [London plane tree]
emb|CDP04350.1|  unnamed protein product                                292   4e-90    
ref|XP_006656242.1|  PREDICTED: exopolygalacturonase-like               292   4e-90    
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    292   4e-90    
ref|XP_010099972.1|  hypothetical protein L484_014009                   292   4e-90    
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               292   5e-90    
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               292   5e-90    
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  291   6e-90    
gb|ADC53480.1|  polygalacturonase                                       292   6e-90    Gossypium hirsutum [American cotton]
ref|XP_009793307.1|  PREDICTED: exopolygalacturonase-like               292   7e-90    
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    291   7e-90    
ref|XP_009411633.1|  PREDICTED: exopolygalacturonase-like               291   7e-90    
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     291   7e-90    
ref|XP_009119612.1|  PREDICTED: exopolygalacturonase clone GBGE18...    292   8e-90    
ref|NP_001141594.1|  exopolygalacturonase precursor                     292   8e-90    Zea mays [maize]
ref|XP_009618497.1|  PREDICTED: exopolygalacturonase-like               291   9e-90    
ref|XP_002437276.1|  hypothetical protein SORBIDRAFT_10g024020          291   9e-90    Sorghum bicolor [broomcorn]
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               291   1e-89    
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    291   1e-89    
dbj|BAK04982.1|  predicted protein                                      291   1e-89    
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               291   1e-89    
emb|CDY37460.1|  BnaC08g45980D                                          291   1e-89    
ref|XP_003547392.1|  PREDICTED: polygalacturonase-like                  301   1e-89    
ref|NP_001130136.1|  exopolygalacturonase precursor                     291   2e-89    Zea mays [maize]
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               290   2e-89    
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  290   2e-89    
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  291   2e-89    
gb|ADK92878.1|  polygalacturonase                                       290   2e-89    
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  290   2e-89    
emb|CDP16134.1|  unnamed protein product                                290   2e-89    
emb|CDY52447.1|  BnaA07g39240D                                          290   3e-89    
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               291   3e-89    
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    290   3e-89    
ref|NP_001141808.1|  uncharacterized protein LOC100273946 precursor     290   3e-89    Zea mays [maize]
ref|NP_193552.1|  glycoside hydrolase family 28 protein / polygal...    290   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472056.1|  PREDICTED: exopolygalacturonase-like               290   4e-89    
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  289   4e-89    Ricinus communis
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               289   5e-89    
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  289   5e-89    
ref|XP_004968842.1|  PREDICTED: exopolygalacturonase-like               290   5e-89    
ref|NP_001152243.1|  polygalacturonase precursor                        289   6e-89    Zea mays [maize]
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               289   6e-89    
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  289   6e-89    
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     289   6e-89    
ref|XP_003563631.1|  PREDICTED: exopolygalacturonase-like               289   7e-89    
gb|EMS53068.1|  Polygalacturonase                                       289   8e-89    
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               292   8e-89    
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           289   9e-89    
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  288   1e-88    
gb|KHN24677.1|  Polygalacturonase                                       288   1e-88    
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  288   1e-88    
ref|XP_006285299.1|  hypothetical protein CARUB_v10006680mg             288   1e-88    
emb|CDY22137.1|  BnaC01g39640D                                          288   1e-88    
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                287   1e-88    
gb|KEH32303.1|  polygalacturonase                                       288   2e-88    
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             288   2e-88    
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             288   2e-88    
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  288   2e-88    
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               288   2e-88    
ref|NP_001057815.1|  Os06g0545400                                       288   2e-88    
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               288   2e-88    
gb|EMT33862.1|  putative Exopolygalacturonase                           288   2e-88    
gb|EAZ01276.1|  hypothetical protein OsI_23299                          288   2e-88    
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          288   2e-88    
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               288   2e-88    
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             287   2e-88    
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               287   3e-88    
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like               288   3e-88    
ref|XP_010509923.1|  PREDICTED: exopolygalacturonase-like               287   3e-88    
gb|EMT33861.1|  Exopolygalacturonase                                    289   3e-88    
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               288   4e-88    
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               287   4e-88    
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  286   5e-88    
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               286   6e-88    
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               286   6e-88    
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  286   6e-88    
gb|KCW80886.1|  hypothetical protein EUGRSUZ_C02249                     286   7e-88    
gb|ADP09681.1|  polygalacturonase                                       287   7e-88    
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               286   7e-88    
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  286   8e-88    
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like               286   9e-88    
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               286   1e-87    
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               285   1e-87    
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               285   1e-87    
ref|XP_003571072.1|  PREDICTED: exopolygalacturonase-like               286   1e-87    
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                285   1e-87    
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  285   2e-87    
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               285   2e-87    
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  285   2e-87    
ref|XP_004967187.1|  PREDICTED: polygalacturonase-like                  285   2e-87    
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                285   2e-87    
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                285   2e-87    
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          285   2e-87    
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       284   3e-87    
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  285   3e-87    
emb|CBI22052.3|  unnamed protein product                                300   3e-87    
ref|XP_002451722.1|  hypothetical protein SORBIDRAFT_04g006610          286   3e-87    
ref|XP_010908569.1|  PREDICTED: polygalacturonase-like                  284   4e-87    
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               284   4e-87    
ref|XP_010908556.1|  PREDICTED: polygalacturonase-like                  284   4e-87    
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like               284   4e-87    
emb|CDX85399.1|  BnaC07g27100D                                          285   5e-87    
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    283   6e-87    
emb|CAB42886.1|  polygalacturonase                                      283   6e-87    
ref|XP_008649072.1|  PREDICTED: exopolygalacturonase-like               284   7e-87    
ref|NP_001105862.1|  exopolygalacturonase precursor                     284   7e-87    
ref|XP_007154306.1|  hypothetical protein PHAVU_003G107500g             284   9e-87    
emb|CBM42662.1|  group 13 grass pollen allergen                         283   1e-86    
ref|XP_006644231.1|  PREDICTED: exopolygalacturonase-like               283   1e-86    
dbj|BAA89479.1|  polygalacturonase                                      283   1e-86    
emb|CBM42663.1|  group 13 grass pollen allergen                         283   1e-86    
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               283   1e-86    
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  282   2e-86    
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     282   2e-86    
dbj|BAD25264.1|  putative exopolygalacturonase precursor                283   2e-86    
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           283   2e-86    
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    283   2e-86    
ref|XP_009151716.1|  PREDICTED: exopolygalacturonase-like               283   2e-86    
ref|XP_008349920.1|  PREDICTED: exopolygalacturonase-like               282   2e-86    
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  282   2e-86    
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  282   2e-86    
ref|NP_001046194.1|  Os02g0196700                                       284   2e-86    
ref|XP_010547006.1|  PREDICTED: exopolygalacturonase-like               284   2e-86    
gb|ACG32118.1|  exopolygalacturonase precursor                          283   2e-86    
ref|XP_006395086.1|  hypothetical protein EUTSA_v10005587mg             283   2e-86    
sp|P35339.1|PGLR3_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    283   2e-86    
emb|CDX89943.1|  BnaA10g01390D                                          284   2e-86    
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                282   3e-86    
gb|AFK41055.1|  unknown                                                 282   3e-86    
ref|XP_010469513.1|  PREDICTED: exopolygalacturonase-like               282   3e-86    
emb|CAA40910.1|  polygalacturonase                                      282   4e-86    
gb|ABD79097.1|  Zea m 13 allergen                                       282   4e-86    
ref|XP_006353088.1|  PREDICTED: exopolygalacturonase-like               281   4e-86    
ref|NP_001105432.1|  exopolygalacturonase precursor                     282   4e-86    
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    281   5e-86    
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    281   5e-86    
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               281   5e-86    
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               281   6e-86    
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               281   6e-86    
emb|CBM42660.1|  group 13 grass pollen allergen                         281   6e-86    
ref|XP_008366452.1|  PREDICTED: exopolygalacturonase-like               280   6e-86    
gb|KHN15656.1|  Polygalacturonase                                       280   6e-86    
emb|CBM42661.1|  group 13 grass pollen allergen                         281   6e-86    
ref|XP_002889191.1|  predicted protein                                  281   6e-86    
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               281   6e-86    
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                281   7e-86    
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               281   7e-86    
gb|EMT24271.1|  Polygalacturonase                                       281   7e-86    
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               281   9e-86    
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             280   1e-85    
ref|XP_008788256.1|  PREDICTED: polygalacturonase-like                  280   1e-85    
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               279   1e-85    
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             280   1e-85    
ref|XP_010317352.1|  PREDICTED: exopolygalacturonase-like               280   1e-85    
gb|ABD79098.1|  Zea m 13 allergen                                       281   1e-85    
gb|ACN85237.1|  exopolygalacturonase precursor                          281   1e-85    
dbj|BAA89478.1|  polygalacturonase                                      280   2e-85    
ref|XP_002884668.1|  polygalacturonase 3                                280   2e-85    
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  280   2e-85    
dbj|BAA89476.1|  polygalacturonase                                      280   2e-85    
emb|CAA40851.1|  polygalacturonase                                      280   2e-85    
sp|P35338.1|PGLR2_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    280   2e-85    
emb|CAA46680.1|  polygalacturonase                                      280   2e-85    
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             279   3e-85    
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  280   3e-85    
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             279   3e-85    
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  279   3e-85    
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               280   3e-85    
ref|XP_006664897.1|  PREDICTED: polygalacturonase-like                  280   3e-85    
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               279   3e-85    
gb|KHN20792.1|  Galacturan 1,4-alpha-galacturonidase4                   277   4e-85    
emb|CAA16789.1|  polygalacturonase-like protein                         278   4e-85    
gb|EAZ01274.1|  hypothetical protein OsI_23298                          278   4e-85    
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             278   5e-85    
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               279   6e-85    
ref|XP_009383385.1|  PREDICTED: polygalacturonase-like                  278   7e-85    
ref|NP_187439.1|  polygalacturonase-like protein                        278   7e-85    
ref|XP_002455693.1|  hypothetical protein SORBIDRAFT_03g021050          279   7e-85    
ref|NP_187440.1|  polygalacturonase-like protein                        278   8e-85    
ref|XP_009354960.1|  PREDICTED: exopolygalacturonase-like               278   8e-85    
ref|XP_008452143.1|  PREDICTED: exopolygalacturonase                    278   9e-85    
ref|XP_010540121.1|  PREDICTED: exopolygalacturonase                    278   1e-84    
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               278   1e-84    
emb|CAA05892.1|  polygalacturonase                                      278   1e-84    
ref|XP_008226319.1|  PREDICTED: exopolygalacturonase                    278   1e-84    
gb|KDP33149.1|  hypothetical protein JCGZ_13541                         278   1e-84    
ref|XP_002529092.1|  Polygalacturonase precursor, putative              278   1e-84    
ref|NP_180874.1|  protein NIMNA                                         285   1e-84    
ref|NP_177961.2|  pectin lyase-like superfamily protein                 278   1e-84    
ref|XP_010112807.1|  hypothetical protein L484_020039                   278   1e-84    
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  278   1e-84    
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             277   1e-84    
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               279   1e-84    
gb|ACN85300.1|  exopolygalacturonase precursor                          278   2e-84    
ref|XP_002529091.1|  Polygalacturonase precursor, putative              277   2e-84    
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  277   2e-84    
gb|AES65915.2|  polygalacturonase 11c, putative                         278   2e-84    
ref|XP_004156544.1|  PREDICTED: exopolygalacturonase-like               277   2e-84    
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               277   3e-84    
ref|XP_008788254.1|  PREDICTED: polygalacturonase-like                  276   3e-84    
gb|KDP29569.1|  hypothetical protein JCGZ_19282                         276   3e-84    
ref|XP_004306136.1|  PREDICTED: exopolygalacturonase-like               276   3e-84    
ref|XP_010027086.1|  PREDICTED: exopolygalacturonase-like               277   3e-84    
ref|XP_006410452.1|  hypothetical protein EUTSA_v10017763mg             277   3e-84    
ref|XP_011083297.1|  PREDICTED: exopolygalacturonase-like               277   4e-84    
ref|XP_004289111.1|  PREDICTED: exopolygalacturonase-like               277   5e-84    
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               276   5e-84    
ref|XP_003559272.2|  PREDICTED: polygalacturonase ADPG1-like            276   5e-84    
gb|AAF71796.1|AC013430_5  F3F9.9                                        276   5e-84    
ref|XP_009132913.1|  PREDICTED: exopolygalacturonase-like               276   6e-84    
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  276   6e-84    
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    276   6e-84    
ref|XP_006301427.1|  hypothetical protein CARUB_v10021845mg             276   7e-84    
gb|KHN26522.1|  Galacturan 1,4-alpha-galacturonidase4                   274   7e-84    
ref|XP_010064300.1|  PREDICTED: exopolygalacturonase-like               275   9e-84    
emb|CDX84700.1|  BnaA03g15300D                                          276   9e-84    
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  275   9e-84    
ref|XP_010112809.1|  hypothetical protein L484_020041                   275   9e-84    
ref|XP_006295486.1|  hypothetical protein CARUB_v10024590mg             276   1e-83    
ref|XP_004967084.1|  PREDICTED: exopolygalacturonase-like               276   1e-83    
gb|ABN13878.1|  polygalacturonase                                       275   1e-83    
gb|AHL24657.1|  Sal k 6.01 allergen                                     275   1e-83    
dbj|BAA89477.1|  polygalacturonase                                      275   1e-83    
ref|XP_006493154.1|  PREDICTED: polygalacturonase-like                  275   2e-83    
emb|CDY47808.1|  BnaC07g07010D                                          275   2e-83    
ref|XP_002874576.1|  predicted protein                                  275   2e-83    
gb|AFW76314.1|  hypothetical protein ZEAMMB73_313945                    275   2e-83    
emb|CDY07609.1|  BnaA03g19020D                                          275   2e-83    
gb|ABE77145.1|  putative polygalacturonase                              275   2e-83    
emb|CDX79512.1|  BnaC03g18480D                                          275   2e-83    
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             275   2e-83    
ref|NP_001043199.1|  Os01g0517500                                       275   2e-83    
gb|KHN40047.1|  Polygalacturonase                                       274   2e-83    
gb|KHN10402.1|  Polygalacturonase                                       273   2e-83    
ref|XP_006478559.1|  PREDICTED: polygalacturonase-like                  274   3e-83    
gb|EEC81719.1|  hypothetical protein OsI_25337                          275   3e-83    
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    274   3e-83    
dbj|BAC57279.1|  putative polygalacturonase PG1                         275   3e-83    
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  274   3e-83    
ref|XP_006478561.1|  PREDICTED: polygalacturonase-like                  274   3e-83    
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    277   3e-83    
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               273   3e-83    
ref|XP_010064302.1|  PREDICTED: exopolygalacturonase-like               274   3e-83    
gb|KDP33146.1|  hypothetical protein JCGZ_13538                         274   3e-83    
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    274   4e-83    
ref|XP_006493141.1|  PREDICTED: polygalacturonase-like                  274   4e-83    
emb|CDY24912.1|  BnaC03g22600D                                          274   4e-83    
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    274   4e-83    
ref|XP_011005268.1|  PREDICTED: polygalacturonase-like isoform X1       273   4e-83    
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  274   4e-83    
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               275   5e-83    
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               274   5e-83    
ref|XP_011073040.1|  PREDICTED: exopolygalacturonase-like               277   5e-83    
gb|ABG38468.1|  pollen-expressed protein MF9c                           273   5e-83    
ref|XP_003563839.1|  PREDICTED: exopolygalacturonase-like               275   5e-83    
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  273   5e-83    
ref|XP_003566989.1|  PREDICTED: polygalacturonase-like                  274   6e-83    
ref|NP_187441.1|  polygalacturonase-like protein                        273   6e-83    
gb|ABR26683.1|  polygalacturonase                                       273   7e-83    
emb|CDX83138.1|  BnaA03g23680D                                          273   7e-83    
ref|XP_010046006.1|  PREDICTED: exopolygalacturonase clone GBGE18...    271   7e-83    
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             274   8e-83    
gb|KCW66880.1|  hypothetical protein EUGRSUZ_F00634                     273   8e-83    
ref|XP_003595656.1|  Polygalactorunase PG11                             273   8e-83    
emb|CDY07974.1|  BnaC03g35490D                                          273   8e-83    
gb|ABL63521.1|  pollen-specific protein MF9l                            273   1e-82    
emb|CDY22140.1|  BnaC01g39610D                                          273   1e-82    
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             273   1e-82    
gb|EYU35786.1|  hypothetical protein MIMGU_mgv1a026431mg                273   1e-82    
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       273   1e-82    
ref|XP_006838947.1|  hypothetical protein AMTR_s00002p00270640          272   1e-82    
ref|XP_010526674.1|  PREDICTED: polygalacturonase                       272   1e-82    



>ref|XP_009771846.1| PREDICTED: exopolygalacturonase clone GBGE184 [Nicotiana sylvestris]
Length=401

 Score =   471 bits (1213),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 297/402 (74%), Gaps = 7/402 (2%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRG--RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAW  1182
             M I   + V+LLGIA+LS   EC   G  RG   T+FDVT+FGA+P+   DST  ++ AW
Sbjct  1     MAIPKELLVLLLGIAILSKVAECASFGSRRGLVETVFDVTRFGARPNTPADSTRGLMMAW  60

Query  1181  NKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFI  1005
               AC S G AKVVIP GTF  GE++FQGPCT+ R I IEI+GT+++++D+S+YT + W  
Sbjct  61    RSACQSPGPAKVVIPPGTFTTGEIIFQGPCTSPRPITIEIQGTLLSNTDMSLYTRSAWIS  120

Query  1004  IEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSK  825
             IEHV G+ +TGGGT+NG+G+  WQF   +K  + P LP SL+FQ V  S I ++ FV++K
Sbjct  121   IEHVDGIVITGGGTLNGQGKSCWQFA--DKSGSTPPLPSSLVFQTVRSSSIKNLNFVDAK  178

Query  824   GFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTT  645
             G H+K++D +D +VS ++ITAPGDSPNTDG+HIS + NVNVTD  + TGDDC+SIGDG +
Sbjct  179   GVHLKITDSSDISVSNVKITAPGDSPNTDGLHISETINVNVTDSTIRTGDDCISIGDGNS  238

Query  644   NLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKAS  465
             N+ ++ + CGPGHGISIGSLGKR  ETDVKGVTVRNCT  GTTNGARIKTY  SP L+ S
Sbjct  239   NVYISNINCGPGHGISIGSLGKRLDETDVKGVTVRNCTFRGTTNGARIKTYMGSPSLQVS  298

Query  464   GIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQ  285
             G+I+EDI+L NV  PI+IDQ Y+SKNR E S+VKL D+ F+NIRGT + K P ++L CS+
Sbjct  299   GVIYEDIILDNVKNPIVIDQHYHSKNRNEPSRVKLVDIHFKNIRGTTTSKIP-VALNCSE  357

Query  284   TVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              +PCE +EL DID+V     G  L P  C NA+TI+ GK NP
Sbjct  358   ALPCEGIELVDIDLVPVGSIG-PLLPATCQNAKTILNGKNNP  398



>ref|XP_009597284.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Nicotiana 
tomentosiformis]
 gb|AAG14416.1|AF248538_1 NTS1 protein [Nicotiana tabacum]
Length=401

 Score =   471 bits (1213),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 294/402 (73%), Gaps = 7/402 (2%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRG--RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAW  1182
             M I   + V+LLGIA+LS   EC   G  RG   T+FDVT+FGA+P+   DST  ++ AW
Sbjct  1     MAIPKELLVLLLGIAILSKVAECAAFGSRRGLVETVFDVTRFGARPNTPADSTRGLMMAW  60

Query  1181  NKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFI  1005
               AC S G AKVVIP GT+  GE +FQGPCT+ R I IEI+GT+++++D+S+YT   W  
Sbjct  61    RSACQSPGPAKVVIPPGTYTTGETIFQGPCTSPRPITIEIQGTLLSNTDMSLYTRAAWIS  120

Query  1004  IEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSK  825
             IEHV G+ +TGGGT+NG+G+  WQF   +K  + P LP SL+FQ V  S I ++ FV++K
Sbjct  121   IEHVDGIVITGGGTLNGQGKSSWQFA--DKSGSTPPLPSSLVFQTVRSSSIKNLNFVDAK  178

Query  824   GFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTT  645
             G H+K++D +D +VS ++ITAPGDSPNTDG+HIS + NVNVTD  +GTGDDC+SIGDG +
Sbjct  179   GVHLKITDSSDISVSNIKITAPGDSPNTDGLHISDTINVNVTDSTIGTGDDCISIGDGNS  238

Query  644   NLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKAS  465
             N+ ++ + CGPGHGISIGSLGKR  ETDVKGVTVRNCT  GTTNGARIKTY  SP L+ S
Sbjct  239   NVYISNINCGPGHGISIGSLGKRLDETDVKGVTVRNCTFRGTTNGARIKTYMGSPSLQVS  298

Query  464   GIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQ  285
             G+++EDI+L NV  PI+IDQ Y+SKNR E S+VKL D+ FRNIRGT + K P + L CS+
Sbjct  299   GVVYEDIILDNVKNPIVIDQHYHSKNRNEPSRVKLVDIHFRNIRGTTTSKIPVL-LNCSE  357

Query  284   TVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              +PCE VEL DID+      G  L P  C NA+TI+ GK NP
Sbjct  358   ALPCEGVELVDIDLAPVGSIG-PLLPATCQNAKTILNGKNNP  398



>ref|XP_004240551.1| PREDICTED: polygalacturonase [Solanum lycopersicum]
Length=410

 Score =   444 bits (1143),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 285/397 (72%), Gaps = 9/397 (2%)
 Frame = -1

Query  1340  GIFVILLGIALLSTGV-ECIPRG--RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC  1170
             G+F +LLGIA+LS+ V EC P G  RG   T+FDVTK GA+PD   DST   + AW  AC
Sbjct  14    GLF-LLLGIAILSSKVAECAPFGSRRGLMETVFDVTKHGARPDPTADSTRGFMMAWRAAC  72

Query  1169  HSRGAAKVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSNYWFIIEHV  993
              S G AKVVIP GTF  GE +FQGPCT  K I+IEI+GT+++++D+S+Y+   W  +EHV
Sbjct  73    QSTGPAKVVIPPGTFTTGETIFQGPCTCPKPIIIEIQGTVLSNTDISLYSRASWISLEHV  132

Query  992   AGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHM  813
              GV +TGGGT+NG+G   WQ+   +K  N+P LP SL+FQ V  S I+ I FV+SKG H+
Sbjct  133   DGVVITGGGTLNGQGNASWQYA--DKSGNSPPLPTSLVFQTVKSSSINGINFVDSKGVHL  190

Query  812   KVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLV  633
             KV+D ND  VSK++ITAP  SPNTDGIHIS + N+NVTD  +GTGDDC+S+G GTTN+ V
Sbjct  191   KVTDSNDITVSKIKITAPATSPNTDGIHISETININVTDSNIGTGDDCISVGHGTTNIFV  250

Query  632   TRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIF  453
               + CGPGHGISIGSLGKR  E DV  V ++NCT   TTNGARIKTY  S  L+ S +++
Sbjct  251   NNIHCGPGHGISIGSLGKRPDEKDVTKVYIKNCTFHSTTNGARIKTYMDSSPLQVSDVVY  310

Query  452   EDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPC  273
             EDI+L +V  PI+IDQ YNSKN+ E SKVKLKD+ F+NIRGT + K P +SL CS+  PC
Sbjct  311   EDIVLEDVKNPILIDQHYNSKNKVEPSKVKLKDIHFKNIRGTTNTKAP-VSLNCSEAAPC  369

Query  272   EDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRN  162
             E VELADIDI  +   G  L+   C NA+T+  GK N
Sbjct  370   EGVELADIDIAPSGTTG-PLQGATCQNAKTVFNGKTN  405



>ref|XP_006355817.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Solanum tuberosum]
Length=409

 Score =   442 bits (1137),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/400 (56%), Positives = 284/400 (71%), Gaps = 8/400 (2%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGV-ECIPRG--RGHTHTIFDVTKFGAKPDGKGDSTMAMIRA  1185
             +EI      +LLGIA+LS+ V EC P G  RG   T+FDVTK+GA+PD   DST   + A
Sbjct  7     LEITTIGLFLLLGIAILSSKVAECAPFGSRRGLMETVFDVTKYGARPDPTADSTRGFMMA  66

Query  1184  WNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA-KRIVIEIKGTMVADSDLSVYTSNYWF  1008
             W  AC S G+AKVVIP GTF  GE +FQGPCT  K I IEI+GT+++++D+S+Y+   W 
Sbjct  67    WRSACQSTGSAKVVIPPGTFTTGETIFQGPCTCPKPITIEIQGTVLSNTDISLYSRASWI  126

Query  1007  IIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNS  828
              +EHV GV +TGGGT+NG+G   WQ+   +K  + P LP SL+FQ V  S I+ I FV+S
Sbjct  127   SLEHVDGVVITGGGTLNGQGNASWQYA--DKTGSTPPLPTSLVFQTVKSSSINGINFVDS  184

Query  827   KGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGT  648
             KG H+K++D ND  V+K++ITAPG SPNTDGIHIS + N+N+TD  +GTGDDC+S+G GT
Sbjct  185   KGVHLKITDSNDITVTKIKITAPGTSPNTDGIHISETININITDSNIGTGDDCISVGHGT  244

Query  647   TNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKA  468
             TN+ V  + CGPGHGISIGSLGKR  E DV  V ++NCT   TTNGARIKTY AS  L+ 
Sbjct  245   TNIFVNNIHCGPGHGISIGSLGKRPDEKDVTKVYIKNCTFHSTTNGARIKTYMASSPLQV  304

Query  467   SGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICS  288
             S +++EDI+L +V  PI+IDQ YNSKN+ E SKVKL D+ F+NIRGT + K P ++L CS
Sbjct  305   SDVVYEDIVLDDVKNPILIDQHYNSKNKNEPSKVKLTDIHFKNIRGTTNTKAP-VALNCS  363

Query  287   QTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGK  168
             +  PCE VELADIDI  +   G  L    C NA+T+  GK
Sbjct  364   EAAPCEGVELADIDITPSDSTGPLLGAT-CQNAKTVFSGK  402



>gb|AHL24656.1| Ole e 13.01 allergen, partial [Olea europaea]
Length=379

 Score =   440 bits (1132),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 220/371 (59%), Positives = 279/371 (75%), Gaps = 6/371 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA-  1086
              TIFDV K+GAK DG+ D+  A I+AW  AC S G AKVVIP+G F+AGEVVFQGPCTA 
Sbjct  13    ETIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAP  72

Query  1085  KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
             K I IEI+G ++A +D+S YTS  W ++E + G+ + GGGTINGRG+  WQF        
Sbjct  73    KPITIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSWQFAGANN--E  130

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
              PLLPVSL F+ V  S +HD+ FV+S GFH KV+D  +  +SKL+I+APGDSPNTDG+HI
Sbjct  131   GPLLPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHI  190

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S STNVNVTD ++GTGDDCVSIG GTT++LV+ +TCGPGHGIS+GSLGKR  ETDVKG++
Sbjct  191   SCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGIS  250

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V NCTL GTTNGARIKTY ASP ++AS I+++DI++ +V  PI+IDQ Y+SK + E SKV
Sbjct  251   VINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHYDSKKKPEQSKV  310

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F NI+GT   + P ++L CS+ VPCEDVELADID+  +   G  LK + C NA+
Sbjct  311   KISGVHFVNIKGTTVSEIP-VALNCSEAVPCEDVELADIDLAPSGAAG-SLK-SVCANAK  367

Query  185   TIVKGKRNPGG  153
              ++KGK  P G
Sbjct  368   FVLKGKPIPPG  378



>gb|EYU42229.1| hypothetical protein MIMGU_mgv1a007314mg [Erythranthe guttata]
Length=411

 Score =   429 bits (1104),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/369 (59%), Positives = 272/369 (74%), Gaps = 8/369 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              TIFDVTKFGAK DG  D  MA+I+AW  AC + GAAKV+IPRG F+AGEVV  GPCTA+
Sbjct  43    ETIFDVTKFGAKGDGITDDAMAIIKAWRAACTTVGAAKVLIPRGDFVAGEVVMAGPCTAQ  102

Query  1082  R-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
             + I IEI+G ++A  D+SVYT   W +IE V G+ VTGGGTINGRG++VWQ+      K 
Sbjct  103   KPITIEIQGNLLAYDDMSVYTRGAWIMIEKVDGLVVTGGGTINGRGKEVWQYFT----KG  158

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
             +P LPVSLI Q V    ++++  V+S GFH KV+D  +  +S ++ITAPG SPNTDG H+
Sbjct  159   SPPLPVSLILQSVQNVKMYNLNLVDSMGFHSKVTDSTNVAISNMKITAPGKSPNTDGCHM  218

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S N+N+TD V+GTGDDC+SIG G  N+LV RVTCGPGHG+SIGSLGKR  ET +KGVT
Sbjct  219   SSSRNINITDTVIGTGDDCISIGHGNYNILVARVTCGPGHGLSIGSLGKRPNETSMKGVT  278

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             + NCTL+GTTNGARIKTY ASPQ++AS I F+DI++  V  PIIIDQ Y+SK ++E SKV
Sbjct  279   ITNCTLVGTTNGARIKTYHASPQIEASSIYFQDIVMDRVKNPIIIDQHYDSKRKREPSKV  338

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+ DV FRNIRGT S    +ISL CS T PC+ +EL++ID+   A  G  L+ + C NA 
Sbjct  339   KISDVHFRNIRGT-SISAVSISLNCSSTFPCQGIELSNIDLQPIAPIG-PLR-SSCSNAR  395

Query  185   TIVKGKRNP  159
               V GK NP
Sbjct  396   FFVTGKINP  404



>emb|CDP17107.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   421 bits (1082),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 214/374 (57%), Positives = 268/374 (72%), Gaps = 8/374 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              T+FDVTKFGA+PDG+ D ++ MIRAWN AC S   AK+V P G F+AGEVVFQGPCT  
Sbjct  40    ETVFDVTKFGARPDGRTDGSLQMIRAWNAACKSGAPAKLVFPPGKFVAGEVVFQGPCTTP  99

Query  1082  R-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I IEI+GT+++ +DLSV+T   W  IE+V GV VTGGGT++GRG   W++   +    
Sbjct  100   TPITIEIQGTILSSTDLSVFTQGVWISIENVNGVIVTGGGTLDGRGASAWEYAGGD---G  156

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
             A LLPVSL    V    I +I  +NSKGFH KV+   +  VS L ITAP DSPNTDG+HI
Sbjct  157   AGLLPVSLQMLKVQNGVIQNINLLNSKGFHSKVTWSANITVSDLTITAPADSPNTDGLHI  216

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S NVNVT+L + TGDDC+S+G+G TN+ +++VTCGPGHGISIGSLGKR  E DV GVT
Sbjct  217   SSSQNVNVTNLTIATGDDCISVGEGNTNIAISKVTCGPGHGISIGSLGKRPAEKDVNGVT  276

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V NCTL GTTNGARIKTY ASP ++ASGI++EDI+++ V  PIIIDQ YNS  + + S+V
Sbjct  277   VTNCTLTGTTNGARIKTYHASPPMRASGIVYEDIIMNGVRNPIIIDQHYNSGKKDQPSRV  336

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             ++ DV FRNIRGT S    A++L CSQ VPC+ VELADID+  A   GV    + C+N +
Sbjct  337   QITDVHFRNIRGT-SASPVAVNLDCSQAVPCQGVELADIDLAPA--PGVAAISSACINTK  393

Query  185   TIVKGKRNPG-GSC  147
               + GK + G G C
Sbjct  394   PTLGGKLSLGQGGC  407



>ref|XP_011082446.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Sesamum indicum]
Length=411

 Score =   421 bits (1081),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 211/397 (53%), Positives = 280/397 (71%), Gaps = 13/397 (3%)
 Frame = -1

Query  1328  ILLGIALLS--TGVEC----IPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACH  1167
             ++LGIA L   +GV C     P  R     +FDVTKFGA  DG  DS +A+IRAW  AC+
Sbjct  15    LVLGIACLLALSGVRCDQLLHPPRRLGGEAVFDVTKFGAVADGSTDSAIALIRAWKAACN  74

Query  1166  SRGAAKVVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVA  990
             S GAAK++IPRG F AGEV+F GPC AK+ I IEI+G ++A  D S YT   W ++E V 
Sbjct  75    SNGAAKLLIPRGEFAAGEVLFTGPCIAKKPITIEIQGNLLAYEDPSAYTGGAWIMLEKVD  134

Query  989   GVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMK  810
             G  + GGGTINGRG+ +WQ+    + K+ P LPVS +FQ V  + + ++ FV+S GFH+K
Sbjct  135   GAVLKGGGTINGRGKMLWQY---AETKDGPPLPVSFVFQTVQNAQMSNLNFVDSMGFHVK  191

Query  809   VSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVT  630
             V+D ++ ++  ++I APG SPNTDGIH+S + NVN+TD ++GTGDDCVSIG GT N+LV 
Sbjct  192   VTDSSNVDIKNIKIRAPGKSPNTDGIHLSSAINVNITDSIIGTGDDCVSIGHGTYNILVA  251

Query  629   RVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFE  450
             R+ CGPGHG+S+GSLGKR  ET++KG+T+ NCTL+GTTNGARIKTY ASP+++A+ I+F+
Sbjct  252   RIICGPGHGLSVGSLGKRPTETNLKGLTIINCTLVGTTNGARIKTYHASPRIQATSILFQ  311

Query  449   DIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCE  270
             DI++  V  PIIIDQ Y+SK R E S VKL D+ FRNIRG+   K P + L CS   PC+
Sbjct  312   DILMERVKNPIIIDQHYDSKRRPEQSSVKLSDIHFRNIRGSTISKVP-VKLNCSSMFPCQ  370

Query  269   DVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              VELADI++      G     + C NA+  ++GK NP
Sbjct  371   GVELADINLTPFGPIGPLT--SACSNAKFFIRGKLNP  405



>ref|XP_011079627.1| PREDICTED: exopolygalacturonase-like [Sesamum indicum]
Length=403

 Score =   407 bits (1046),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 216/405 (53%), Positives = 283/405 (70%), Gaps = 15/405 (4%)
 Frame = -1

Query  1355  MEIKAGI-FVILLGIALLST--GVECIPRGRGHT---HTIFDVTKFGAKPDGKGDSTMAM  1194
             M I AG   ++LLGIA   T  GV   P G   +     IFD+TKF AK DG  D+ + +
Sbjct  1     MAIPAGTRLILLLGIACFITINGVVANPLGARRSLLGGAIFDITKFEAKADGITDNAIPI  60

Query  1193  IRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNY  1014
             IRAW  AC SRGAAKVVIPRG F+AGE+V  GPC  +  V EI+GT++A+ D S YT   
Sbjct  61    IRAWKAACESRGAAKVVIPRGNFMAGEIVLGGPCVGQTTV-EIQGTLLANPDPSAYTGGS  119

Query  1013  WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFV  834
             W +++ V  V VTGGGTING+G++VWQ+   +    +PL  VSL+FQ V    +H+++FV
Sbjct  120   WIMLQRVDNVVVTGGGTINGQGKNVWQYAGGD----SPL-SVSLVFQTVGNGKLHNLRFV  174

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             +S GFH+KV+D +D  V +L ITAP +SPNTDGIH+S S NV +TD V+GTGDDCVSIG 
Sbjct  175   DSMGFHIKVTDSHDVIVQQLTITAPANSPNTDGIHLSSSKNVKITDCVIGTGDDCVSIGH  234

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             GT N  V R+TCGPGHGISIGSLGKR  ETD+KGV++ NCTLIGTTNG RIKTY  SPQ+
Sbjct  235   GTLNTAVARITCGPGHGISIGSLGKREDETDLKGVSITNCTLIGTTNGVRIKTYHDSPQM  294

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
              AS I+F+DI + +V  PI+IDQ YNSK++   SKVK+++ RF NI+G+ S    A++L 
Sbjct  295   TASDIVFQDIKMIDVKNPIMIDQHYNSKSKPVQSKVKIRNARFINIKGS-SISPVAVTLN  353

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             CS  VPCE ++L +ID+V +   G     + C +A+ ++KG + P
Sbjct  354   CSSAVPCEGIQLENIDLVPSGKTGPLT--SACSHAKFLLKGIQKP  396



>ref|XP_011086597.1| PREDICTED: exopolygalacturonase-like [Sesamum indicum]
Length=400

 Score =   397 bits (1019),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 209/407 (51%), Positives = 273/407 (67%), Gaps = 18/407 (4%)
 Frame = -1

Query  1355  MEIKAG--IFVILLGIALLS----TGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAM  1194
             M I AG  + V LLGI +       GVE  P     +  +FD+  +GAK + K D+  A+
Sbjct  1     MAIPAGTRLIVQLLGICIACFLSINGVESNPS----SEAVFDIFNYGAKTEPKFDNAQAI  56

Query  1193  IRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNY  1014
             I+AW  AC S G AKVVIP G F+AGEVVF GPC A    +EI+G ++A+ D S YTS  
Sbjct  57    IKAWKAACESSGPAKVVIPAGDFMAGEVVFSGPCKAHTTTVEIQGHLLANIDPSTYTSGA  116

Query  1013  WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFV  834
             W +++ V  V +TGGG ING G+  W++ AD        LPVSLIFQ V  S  H++KFV
Sbjct  117   WIMVQRVDNVVLTGGGIINGEGKYDWKY-AD----GVSPLPVSLIFQEVGNSKAHNLKFV  171

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             +S GFH++V D ++ ++  L ITAPGDSP TDG+H++ + NVNVTD V+ TGDDCVSIG 
Sbjct  172   DSMGFHIEVMDSHEIDLFNLTITAPGDSPYTDGVHLTNNINVNVTDSVIATGDDCVSIGH  231

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             G  N++V R+TCGPGHGI +G+LGK+A E D+KGVT+ NCTL GTTNGARIKTY  S Q+
Sbjct  232   GNQNIVVARITCGPGHGICVGNLGKQADEKDLKGVTISNCTLTGTTNGARIKTYHDSAQI  291

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
              AS I+F+DI ++NV  PI+IDQ YNS      SKVK+ + RF NI+G+ S    A+SL 
Sbjct  292   TASDIVFQDIQMNNVQNPIMIDQHYNSTTTTAQSKVKISNARFVNIKGS-SASAVAVSLN  350

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPGG  153
             CS  VPCE +ELADID+  A   G     + C NA+T++KG ++P G
Sbjct  351   CSSAVPCEGIELADIDLKPAGSTGPLT--SACSNAKTVLKGTQSPPG  395



>gb|EYU46750.1| hypothetical protein MIMGU_mgv1a007104mg [Erythranthe guttata]
Length=419

 Score =   392 bits (1008),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 209/407 (51%), Positives = 271/407 (67%), Gaps = 17/407 (4%)
 Frame = -1

Query  1346  KAGIFVILLGIALLSTGVEC----IPRGR--GHTHTIFDVTKFGAKPDGKG-DSTMAMIR  1188
             KA + + +  + +++  VEC    + R    G   T+F+V  +GAK D    D+  A I+
Sbjct  16    KACLAISVACMLMINDSVECSSPVLSRRSLAGEVETVFNVMDYGAKADDDTTDNAPAFIK  75

Query  1187  AWNKACHSRGAAKVVIPRGT-FLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNY  1014
             AW  AC S GA KV+IP G  F +GE+VF GPC  ++ I IEI+G M A  D SVY+   
Sbjct  76    AWRAACDSNGAGKVLIPAGNNFFSGEIVFAGPCAGQQAITIEIQGNMSALPDPSVYSGGA  135

Query  1013  WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFV  834
             W ++E    +EVTG GTIN  GE  WQ+  D        L VSL+FQGV    ++++ FV
Sbjct  136   WIMVERAENIEVTGSGTINAHGEAAWQYADDNN-----HLAVSLVFQGVGNCKLNNLNFV  190

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             NS GFH KV+D +D  V+ L ITAPG SPNTDGIH+S +TNVN+TD V+GTGDDC+SIG 
Sbjct  191   NSMGFHTKVTDSHDVTVTNLTITAPGKSPNTDGIHLSNATNVNITDSVIGTGDDCISIGP  250

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             G+ N++V+R+TCGPGHGISIGSLGKR  ETDV+G+TV NCTLIGTTNGARIKTY  SP+L
Sbjct  251   GSKNVVVSRITCGPGHGISIGSLGKRVDETDVQGITVSNCTLIGTTNGARIKTYHDSPEL  310

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
              AS I F D+++  V  PIIIDQ Y+SK + + S VK+ D  F NI+G+   + P I L 
Sbjct  311   TASKITFVDLVMDQVKNPIIIDQHYDSKKKPKQSSVKISDTHFINIKGSTVSEIP-IVLN  369

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPGG  153
             CS  VPCE +EL+DID+V   G   +L  + C NA+T +KG  NP G
Sbjct  370   CSSLVPCEGIELSDIDLV-PFGTLRNLT-SACSNAQTTLKGTLNPAG  414



>gb|KDP24950.1| hypothetical protein JCGZ_24417 [Jatropha curcas]
Length=421

 Score =   366 bits (940),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 245/374 (66%), Gaps = 6/374 (2%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FDVT+ GAK D K ++ M +I+ W  AC S   AKVVIP GTFL G  VFQGPC A  
Sbjct  50    TVFDVTEHGAKADDKTNNAMPLIQTWKAACESTAPAKVVIPDGTFLTGPTVFQGPC-AGP  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             ++ E++G + A +DLS YTS  W   E + G+ +TG GT +G+G  VW+++  +  K+  
Sbjct  109   VIFEVQGYVKASTDLSEYTSPEWMAFESIDGLTLTGKGTFDGQGPAVWEYNDCKSNKDCQ  168

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP SL F  VN S +  I  +NS  FH  V  C +     L ITAP DSPNTDGIHISG
Sbjct  169   KLPASLRFHKVNNSEVSGITSLNSMFFHYHVVKCQNVAFHHLTITAPDDSPNTDGIHISG  228

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ ++VTD ++GTGDDCVSIGDGTTNL V++VTCGPGHGIS+GSLGK   E DV G+ V 
Sbjct  229   SSCISVTDSMIGTGDDCVSIGDGTTNLTVSKVTCGPGHGISVGSLGKYPDEDDVSGILVI  288

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SK  369
             NCT   TTNGARIKTY  S    A GI++EDI++ +V  PIIIDQ Y  K+++     SK
Sbjct  289   NCTFSNTTNGARIKTYSDSDPSNACGIVYEDIIMDHVKNPIIIDQKYGIKDKEAQPSNSK  348

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             VK+ DV FRNI+GT S    A+ L CS + PCE VEL+DID+ +  G     +   C NA
Sbjct  349   VKVSDVHFRNIKGT-SVSAVAVDLQCSSSFPCEGVELSDIDL-TYIGDKPSTESASCSNA  406

Query  188   ETIVKGKRNPGGSC  147
             +    GK+NP  +C
Sbjct  407   KVTCGGKQNPAITC  420



>ref|XP_011015579.1| PREDICTED: exopolygalacturonase clone GBGE184, partial [Populus 
euphratica]
Length=494

 Score =   367 bits (941),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 257/414 (62%), Gaps = 17/414 (4%)
 Frame = -1

Query  1358  TMEIKAGIFVILLGIALLSTGVECIPR-------------GRGHTHTIFDVTKFGAKPDG  1218
             TM I   I  + LG+ALLS   +   R             G G   T+FDVTK GAK D 
Sbjct  85    TMTIAGSI--LFLGLALLSCVADGALRHHIGLSDRRSLIDGSGAAVTVFDVTKHGAKADD  142

Query  1217  KGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSD  1038
             K D+  A I+ W  AC S   AKVVIP GTFL   VVFQGPC +K IV E++G + A +D
Sbjct  143   KTDNAQAFIQTWRAACDSGVPAKVVIPGGTFLTSPVVFQGPCKSKPIVFEVQGNVKATTD  202

Query  1037  LSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRS  858
             LS Y+S  W + E + G+ + GGGT +G+G  VW+++   + K    LP S+    VN +
Sbjct  203   LSEYSSEQWILFEIIDGLTLNGGGTFDGQGSAVWKYNDCHENKQCQALPSSIKLSKVNNA  262

Query  857   GIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTG  678
              +H+I  V+SK FHM V+ C+  ++  + +TAP +SPNTDGIHIS S  V VT   +GTG
Sbjct  263   FVHEISSVDSKYFHMHVTSCHGISIHNINLTAPANSPNTDGIHISHSDGVQVTSSKIGTG  322

Query  677   DDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIK  498
             DDCVSIG G+TN+L+++V CGPGHG+S+GSLGK   E DV G+ V NCTL  TTNG RIK
Sbjct  323   DDCVSIGQGSTNILISQVFCGPGHGLSVGSLGKYKNEEDVSGIVVTNCTLFNTTNGVRIK  382

Query  497   TYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASK  318
             +Y AS   +A  I F+DI + +V  PIIIDQ Y S+N    S+VK+ +V ++NI+GT S 
Sbjct  383   SYAASDPSQALNITFKDITMDSVKNPIIIDQKYGSRN-GAPSRVKISNVHYQNIKGT-ST  440

Query  317   KHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPG  156
              + A+S +CS  VPC+ VEL DID+     K        C+NA     GK+NPG
Sbjct  441   SNVAVSFLCSSLVPCQGVELVDIDLAYIGQKANMPLSASCLNANVKSGGKQNPG  494



>gb|KDP27317.1| hypothetical protein JCGZ_21001 [Jatropha curcas]
Length=421

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/374 (51%), Positives = 243/374 (65%), Gaps = 6/374 (2%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FDVT+ GAK D K ++ M  IR W  AC S   AKVVIP GTFL G  VFQGPC A  
Sbjct  50    TVFDVTEHGAKADDKTNNAMPFIRTWKAACESTAPAKVVIPDGTFLTGPTVFQGPC-AGP  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             ++ E++G + A +DLS YTS  W   E + G+ +T  GT +G+G  VW+++  +  K+  
Sbjct  109   VIFEVQGCVKASTDLSEYTSPEWMAFESIDGLTLTDKGTFDGQGPAVWEYNDCKSNKDCQ  168

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP SL F  VN S +  I  +NS  FH  V  C +     L ITAP DSPNTDGIHISG
Sbjct  169   KLPASLRFHKVNNSEVSGITSLNSMFFHYHVVKCQNVAFHHLTITAPDDSPNTDGIHISG  228

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ ++VTD ++GTG+DCVSIGDGTTNL V++VTCGPGHGIS+GSLGK   E DV G+ V 
Sbjct  229   SSCISVTDSMIGTGNDCVSIGDGTTNLTVSQVTCGPGHGISVGSLGKYPDEDDVSGILVI  288

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SK  369
             NCT   TTNGARIKTY  S    A GI++EDI++ +V  PIIIDQ Y  K+++     SK
Sbjct  289   NCTFSNTTNGARIKTYSDSDPSNACGIVYEDIIMDHVKNPIIIDQKYGIKDKEAQPSNSK  348

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             VK+ DV FRNI+GT S    A+   CS + PCE VEL+DID+ +  G    ++   C NA
Sbjct  349   VKVSDVHFRNIKGT-SVSPVAVDFQCSSSFPCEGVELSDIDL-TYIGDKPSIESASCSNA  406

Query  188   ETIVKGKRNPGGSC  147
             +    GK+NP  +C
Sbjct  407   KVTCGGKQNPTITC  420



>ref|XP_010269646.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=470

 Score =   362 bits (928),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 249/372 (67%), Gaps = 8/372 (2%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
             T ++F+V  FGA P+GK +ST A ++AW  ACH  G A++VIP GTFL G+V F GPC +
Sbjct  102   TTSVFNVVHFGAHPNGKKESTQAFMKAWIAACHWGGKARLVIPTGTFLVGQVFFTGPCNS  161

Query  1085  K-RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
                I++++KGT+ A SD+S Y S  W   E + G+ +TGGGT +G+G  VWQ++  EK  
Sbjct  162   PIPIIVQVKGTVKAVSDVSEYPSAEWISFESLNGLILTGGGTFDGQGAAVWQYNDCEKNP  221

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             +  +LP+S+ F  V  + +  I  VNSK FH+ ++ C +F    L ITAP DSPNTDGIH
Sbjct  222   DCQILPMSIKFSSVKNANVRRINSVNSKSFHIAINHCENFRAHDLHITAPEDSPNTDGIH  281

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             IS S +V ++   + TGDDC+SIG G+TN+ + R+TCGPGHGIS+GSLGK   E DVKG+
Sbjct  282   ISSSIDVRISKSYIATGDDCISIGQGSTNISIARITCGPGHGISVGSLGKYPDEKDVKGI  341

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASK  369
             TV+NCTL  T NG RIKT+  SP  +AS + FEDI+++NV  PIIIDQ Y   +R     
Sbjct  342   TVKNCTLTNTDNGVRIKTWPGSPPSQASKLRFEDIIMNNVRNPIIIDQLYCPPSR-----  396

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP-NKCVN  192
             VK+ DV F+NIRGT++ K  A+++ CS+ +PCEDV+L DID+   + K   L P   C N
Sbjct  397   VKISDVHFKNIRGTSASKV-AVNIACSEQLPCEDVQLFDIDLKYNSTKPDDLAPLALCSN  455

Query  191   AETIVKGKRNPG  156
             A+    G + P 
Sbjct  456   AQPDFGGTQMPA  467



>ref|XP_007050989.1| Polygalacturonase 4, putative [Theobroma cacao]
 gb|EOX95146.1| Polygalacturonase 4, putative [Theobroma cacao]
Length=424

 Score =   358 bits (918),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/411 (46%), Positives = 259/411 (63%), Gaps = 22/411 (5%)
 Frame = -1

Query  1331  VILLGIALLSTGVE-CIPRGRGH-------------THTIFDVTKFGAKPDGKGDSTMAM  1194
             V+LLG+ALLS   E  +P  R H               T+FDV  +GAK DGK D+    
Sbjct  12    VVLLGLALLSFVAEGAVPEVRRHGFRVRRNLADADADATVFDVMTYGAKADGKTDNFEPF  71

Query  1193  IRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTSN  1017
             ++AW  AC +   A +VIPRGT+L G+VVFQGPC ++  + ++I+GT+ A +D+S Y + 
Sbjct  72    VKAWKAACSASAPATLVIPRGTYLTGQVVFQGPCKSSNPVTVKIEGTIKATTDISEYPTA  131

Query  1016  YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKF  837
              W + E + G+ +TG GTI+G+G  VW ++         LLPVS+ F  VN S ++ I  
Sbjct  132   EWILFELIDGLIITGSGTIDGQGASVWGYNDCSHNSGCQLLPVSIKFHRVNNSVVNGISS  191

Query  836   VNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIG  657
             VN+K FHM ++   +  V  L ITAP  SPNTDGIHIS S+ VN+T+  +GTGDDC+SIG
Sbjct  192   VNAKSFHMFITRSANITVHDLNITAPAKSPNTDGIHISSSSFVNITNSNIGTGDDCISIG  251

Query  656   DGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQ  477
              G TN+ ++ V CGPGHGISIGSLGK   E DV G+ V+NCTL  TTNG RIKT+  SP 
Sbjct  252   QGATNISISSVFCGPGHGISIGSLGKYKDEEDVSGIVVKNCTLSNTTNGVRIKTWPGSPP  311

Query  476   LKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISL  297
              +AS I F+DI++  V  PIIIDQ+Y S ++   S+VK+ DV ++NIRGT SK   A+SL
Sbjct  312   SQASSITFQDIVMDMVQNPIIIDQNYGS-HKSAPSRVKVSDVHYKNIRGT-SKSPVAVSL  369

Query  296   ICSQTVPCEDVELADIDIVSAAGKGVHLKPN-----KCVNAETIVKGKRNP  159
              CS  VPC+ V+L DID+   + +      N      C+N +    GK+NP
Sbjct  370   SCSSEVPCQGVQLVDIDLAYKSVRKSKRMQNSTLSASCLNVKVTSGGKQNP  420



>ref|XP_002301489.1| Exopolygalacturonase clone GBGE184 precursor family protein [Populus 
trichocarpa]
 gb|EEE80762.1| Exopolygalacturonase clone GBGE184 precursor family protein [Populus 
trichocarpa]
Length=413

 Score =   353 bits (907),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 191/408 (47%), Positives = 257/408 (63%), Gaps = 19/408 (5%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPR-------------GRGHTHTIFDVTKFGAKPDGKGDSTMAMI  1191
             +++LG+ALLS   +   R             G G   T+FDVTK GAK D K D+  A I
Sbjct  7     ILVLGLALLSCVADGALRHHIGLSDRRSLIDGSGAAVTVFDVTKHGAKADDKTDNAEAFI  66

Query  1190  RAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTSNY  1014
             + W  AC S   AK+VIP GTFL   VVFQGPC + + IV E++G + A +DLS Y+S  
Sbjct  67    QTWRAACDSGAPAKMVIPGGTFLTSPVVFQGPCKSTEPIVFEVQGNVKATTDLSEYSSEQ  126

Query  1013  WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFV  834
             W + E + G+ + GGGT +G+G  VW+++   + K    LP S+    V  + +H+I  V
Sbjct  127   WILFEIIDGLTLNGGGTFDGQGSAVWKYNDCHQNKECQPLPSSIKLSKVKNAFVHEISSV  186

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             +SK FHM V+ CN  ++  + +TAP +SPNTDGIHIS S  V+VT   +GTGDDC+SIG 
Sbjct  187   DSKYFHMHVTSCNSISIHNINLTAPANSPNTDGIHISHSDGVHVTSSKIGTGDDCISIGQ  246

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             G+TN+L+++V CGPGHG+S+GSLGK   E DV+G+ V NCTL  TTNG RIK+Y AS   
Sbjct  247   GSTNILISQVFCGPGHGLSVGSLGKYKNEEDVRGIVVTNCTLFNTTNGVRIKSYAASDPS  306

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
             +A  I F+DI + +V  PIIIDQ Y S+N    S+VK+ +V ++NI+GT S    A+S  
Sbjct  307   QALNITFKDITMDSVKNPIIIDQKYGSRN-GAPSRVKISNVHYQNIKGT-STSDVAVSFS  364

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVK--GKRNPG  156
             CS  VPC+ VEL DID+     K        C+NA  IVK  GK+NPG
Sbjct  365   CSSLVPCQGVELVDIDLAYIGQKANVPLSASCLNAN-IVKSGGKQNPG  411



>ref|XP_002301488.2| hypothetical protein POPTR_0002s20330g [Populus trichocarpa]
 gb|EEE80761.2| hypothetical protein POPTR_0002s20330g [Populus trichocarpa]
Length=414

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/408 (46%), Positives = 255/408 (63%), Gaps = 18/408 (4%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPR-------------GRGHTHTIFDVTKFGAKPDGKGDSTMAMI  1191
             +++LG+ALLS   +   R             G G   T+FDVTK GAK D K D+  A I
Sbjct  7     ILVLGLALLSCVADGALRHHIGLSDRRSLVDGSGAAVTVFDVTKHGAKADDKTDNAEAFI  66

Query  1190  RAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTSNY  1014
             + W  AC S   AK+VIP GTFL   VVFQGPC + + IV E++G + A +DLS Y+S  
Sbjct  67    QTWRAACDSGAPAKMVIPGGTFLTSPVVFQGPCKSTEPIVFEVQGNVKATTDLSEYSSEQ  126

Query  1013  WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFV  834
             W + E + G+ + GGGT +G+G  VW+++   + K    LP S+    V  + +H+I  V
Sbjct  127   WILFEIIDGLTLNGGGTFDGQGSAVWKYNDCHQNKECQPLPSSIKLSKVKNAFVHEISSV  186

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             +SK FHM V+ CN  ++  + +TAP +SPNTDGIHIS S  V+VT   +GTGDDCVSIG 
Sbjct  187   DSKYFHMHVTSCNSISIHNINLTAPANSPNTDGIHISHSDGVHVTSSKIGTGDDCVSIGQ  246

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             G+TN+L+++V CGPGHG+S+GSLGK   E DV+G+ V NCTL  TTNG RIK+Y AS   
Sbjct  247   GSTNILISQVFCGPGHGLSVGSLGKYKNEEDVRGIVVTNCTLFNTTNGVRIKSYAASDPS  306

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
             +A  I F+DI + +V  PIIIDQ Y      + S+VK+ +V ++NI+GT S    A+S  
Sbjct  307   QALNITFKDITMDSVKNPIIIDQKYACSCSVQPSRVKISNVHYQNIKGT-STSDVAVSFS  365

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVK--GKRNPG  156
             CS  VPC+ VE+ DID+     K        C+NA  IVK  GK+NPG
Sbjct  366   CSSLVPCQGVEIVDIDLAYIGQKANIPLSASCLNAN-IVKSGGKQNPG  412



>ref|XP_010026119.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW58402.1| hypothetical protein EUGRSUZ_H01088 [Eucalyptus grandis]
Length=420

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 181/368 (49%), Positives = 240/368 (65%), Gaps = 4/368 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-  1080
             +FDVT++GAK DGK D++MA ++AWN ACH+ G AK+VIP GTFL+G VVFQGPC     
Sbjct  51    VFDVTQYGAKADGKTDNSMAFVKAWNAACHNSGPAKLVIPTGTFLSGPVVFQGPCEGSNP  110

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             I +E+ GT++A +D+S Y+ + WF  E + G+ V  GG  +G+G+  W ++  +  K+  
Sbjct  111   ITVEVNGTIIASTDISEYSEDGWFSFELIDGL-VLKGGIFDGQGQTAWPYNDCKHNKDCQ  169

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LPVSL F  VN + +  +  +NSKGFH  ++   +F    L I+AP +SPNTDGIH+S 
Sbjct  170   HLPVSLKFNKVNNTVVDGVTSLNSKGFHFSITFSENFTGVNLNISAPDESPNTDGIHLSS  229

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S  +N++  V+ TGDDC+ I  G TN+ V  +TCGPGHGISIGSLGK   E DV GV VR
Sbjct  230   SDRINISSSVIATGDDCLGIIQGATNVSVNEITCGPGHGISIGSLGKYPNEKDVIGVHVR  289

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             N TL  TTNG RIK +    QL AS IIFEDI+L+ V  PIIIDQ Y S+   + S VKL
Sbjct  290   NATLTNTTNGVRIKAFPGDRQLLASDIIFEDIVLNYVKNPIIIDQHYGSRKVTKPSSVKL  349

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI-VSAAGKGVHLKPNKCVNAET  183
              DV F+NIRGT +    A+ L CS + PCE VEL+DID+  + A  G     + C N + 
Sbjct  350   SDVHFKNIRGT-TVSEVAVLLQCSSSNPCEQVELSDIDLSFAGAASGSKNVTSLCENTKP  408

Query  182   IVKGKRNP  159
                G +NP
Sbjct  409   TFIGTQNP  416



>ref|XP_002272193.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI22964.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   350 bits (898),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 249/380 (66%), Gaps = 7/380 (2%)
 Frame = -1

Query  1280  RGRGHT--HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             RGRG     TIF+V ++GAKP GK DST A ++AW  ACH RG A+++IP+G FL G+V 
Sbjct  45    RGRGSIPGETIFNVLQYGAKPGGKKDSTEAFMKAWVAACHWRGKARLLIPQGIFLIGQVT  104

Query  1106  FQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQF  930
             FQGPC +   I++++  T+ A +D+S + S  W   E + G+ VTGGGT +G+G+ VW++
Sbjct  105   FQGPCNSPTPIIVQVAATLKAVTDISEFASPEWVTFEDINGLIVTGGGTFDGQGDVVWKY  164

Query  929   DADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDS  750
             +   +  N  LLP S+ F  +    +  I  VN+K FH+ ++ C +F    L ITAP DS
Sbjct  165   NDCRRNSNCQLLPTSIKFNSITNGNLRGINSVNAKSFHIAMNRCQNFRAFGLHITAPEDS  224

Query  749   PNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQ  570
             PNTDGIHIS S  V V+  ++ TGDDC+SIG G+TN+ + +VTCGPGHGISIGSLGK   
Sbjct  225   PNTDGIHISSSNFVKVSKSIISTGDDCISIGQGSTNISINKVTCGPGHGISIGSLGKYPD  284

Query  569   ETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---  399
             E DV G+ V+N TL+ T NG RIKT+  SP  +ASGI+F+DI++ NV  PIIIDQ Y   
Sbjct  285   EKDVIGIIVKNSTLMNTDNGLRIKTWPGSPPSQASGILFQDIIMKNVKNPIIIDQLYCPS  344

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
              S  R + S+V++ ++ +RNIRGT+S     ++L+CS   PC++VEL DI++  +  + V
Sbjct  345   GSSCRTQPSRVRISNIHYRNIRGTSSSPL-GVNLMCSPQFPCQNVELFDINLRYSGKRRV  403

Query  218   HLKPNKCVNAETIVKGKRNP  159
                 + C N +    G + P
Sbjct  404   SALTSSCSNVKAGFGGVQIP  423



>ref|XP_006480116.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Citrus sinensis]
 gb|KDO87149.1| hypothetical protein CISIN_1g043757mg [Citrus sinensis]
Length=407

 Score =   348 bits (894),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 254/399 (64%), Gaps = 14/399 (4%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAA  1152
             V+LLG+  LS+ V+       +    FDVTKFGA+ +G  ++  A    W KAC S   A
Sbjct  12    VLLLGLTFLSSVVQ---GAEPNYSLYFDVTKFGAEANGDKNNAQAFTETWAKACGSGAPA  68

Query  1151  KVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTG  972
             KV+IP GTFL G VVF GPC +  I +E++G + A +DL  Y    W + E++ G+ +TG
Sbjct  69    KVLIPSGTFLTGPVVFSGPCKSA-ITVEVRGIVKATTDLKEYADGDWILFENIDGLLLTG  127

Query  971   GGTINGRGEDVWQFDADEKIKNAP---LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSD  801
             GGT +G+G   W+        +A    LLP+S+ F  VN S +  I  +NSKGFH+ +  
Sbjct  128   GGTFDGQGAASWKLKDSNPQHSATKCDLLPISIKFNHVNNSVVTGINSLNSKGFHILLVF  187

Query  800   CNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVT  621
             C +F  S L ITAP +SPNTDGIH+S S+ VN+T+  +GTGDDCVSIG G+T++ V+R+T
Sbjct  188   CQNFTASNLNITAPDESPNTDGIHLSLSSLVNITNSKIGTGDDCVSIGHGSTDISVSRIT  247

Query  620   CGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIM  441
             CGPGHGIS+GSLG +  E DV G+TV NCTLI TTNG RIKT R S  LKAS I +E+I+
Sbjct  248   CGPGHGISVGSLGNKPDEMDVNGITVFNCTLITTTNGLRIKTKRGSASLKASRIFYENII  307

Query  440   LHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             +  V  PIIIDQ+Y +K + E S+VK+ DV ++NI+GT S  +  ++L CS  VPC+ VE
Sbjct  308   MDKVKNPIIIDQNYGAK-KNEPSRVKITDVHYKNIKGT-SITNVGVNLNCSSVVPCDGVE  365

Query  260   LADIDIVSAAGKGVHLKPN-----KCVNAETIVKGKRNP  159
             L  +D+    G     + N      C NAE   +GK +P
Sbjct  366   LVGVDLAFDVGSAKKAEANLPFSSSCANAEAKFEGKISP  404



>ref|XP_006444403.1| hypothetical protein CICLE_v10023712mg [Citrus clementina]
 gb|ESR57643.1| hypothetical protein CICLE_v10023712mg [Citrus clementina]
Length=407

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/399 (47%), Positives = 254/399 (64%), Gaps = 14/399 (4%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAA  1152
             V+LLG+  LS+ V+       +    FDVTKFGA+ +G  ++  A    W KAC S   A
Sbjct  12    VLLLGLTFLSSVVQ---GAEPNYSLYFDVTKFGAEANGDKNNAQAFTETWAKACGSGAPA  68

Query  1151  KVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTG  972
             KV+IP GTFL G VVF GPC +  I +E++G + A +DL  Y    W + E++ G+ +TG
Sbjct  69    KVLIPSGTFLTGPVVFSGPCKSA-ITVEVRGIVKATTDLKEYADGDWILFENIDGLLLTG  127

Query  971   GGTINGRGEDVWQFDADEKIKNAP---LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSD  801
             GGT +G+G   W+        +A    LLP+S+ F  VN S +  I  +NSKGFH+ +  
Sbjct  128   GGTFDGQGAASWKLKDSNPQHSATKCDLLPISIKFNHVNNSVVTGINSLNSKGFHILLVF  187

Query  800   CNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVT  621
             C +F  S L ITAP +SPNTDGIH+S S+ VN+T+  +GTGDDCVSIG G+T++ V+R+T
Sbjct  188   CQNFTASNLNITAPDESPNTDGIHLSLSSFVNITNSKIGTGDDCVSIGHGSTDISVSRIT  247

Query  620   CGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIM  441
             CGPGHGIS+GSLG +  E DV G+TV NCTLI TTNG RIKT R S  LKAS I +++I+
Sbjct  248   CGPGHGISVGSLGNKPDEMDVNGITVFNCTLINTTNGLRIKTKRGSASLKASRIFYDNII  307

Query  440   LHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             +  V  PIIIDQ+Y +K + E S+VK+ DV ++NI+GT S  +  ++L CS  VPC+ VE
Sbjct  308   MDKVKNPIIIDQNYGAK-KNEPSRVKITDVHYKNIKGT-SITNVGVNLNCSSVVPCDGVE  365

Query  260   LADIDIVSAAGKGVHLKPN-----KCVNAETIVKGKRNP  159
             L  +D+    G     + N      C NAE   +GK +P
Sbjct  366   LVGVDLAFDVGSAKKAEANLPFSSSCANAEAKFEGKISP  404



>gb|KGN44972.1| hypothetical protein Csa_7G404800 [Cucumis sativus]
Length=433

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 247/369 (67%), Gaps = 8/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F++   GAK DG+ DST A ++AW KACHS G AKVV P GTFL G +V+ GPC    +
Sbjct  66    VFNIIAHGAKADGRTDSTQAFMQAWVKACHSSGPAKVVFPPGTFLTGPLVYAGPCDGP-M  124

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +EI+GT+ A +D+S Y+S  W + E V G+ + G GT +G+G D W+++   K     +
Sbjct  125   TVEIQGTVKATTDISQYSSAEWILFESVTGLNLIGRGTFDGQGADTWKYNDCSKHPQCII  184

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P S+ F  V +  +  I  VNSK FH+ V   ++  ++ + I APG+SPNTDG+HIS +
Sbjct  185   PPTSIKFNKVTQGLMEGITSVNSKAFHIFVVLSHNIKINNVHIVAPGNSPNTDGVHISQT  244

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VNVT+ ++GTGDDCVSIG G+TN+ V  +TCGPGHGIS+GSLGK   E +V+G+ V N
Sbjct  245   DVVNVTNSIIGTGDDCVSIGHGSTNINVLNITCGPGHGISVGSLGKYRDEKEVRGIFVSN  304

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLK  357
             CT+  TTNG RIKT+ ASP  +A+ I F++I+L  V  PIIIDQ+Y SK +K  S+VK+ 
Sbjct  305   CTIRNTTNGVRIKTWAASPPGQATRITFQNIVLDKVRNPIIIDQNYGSKTKKSPSQVKVS  364

Query  356   DVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK---PNKCVNAE  186
             DV+F+NIRGT +    A+SL CS  +PC+ ++L  ID+   A  G HLK    N C+NA+
Sbjct  365   DVQFKNIRGT-TISPVAVSLQCSAALPCDGIKLEQIDV---AFSGTHLKQPFANSCLNAK  420

Query  185   TIVKGKRNP  159
                 GK+NP
Sbjct  421   ITTIGKQNP  429



>ref|XP_010652203.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=415

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 184/402 (46%), Positives = 255/402 (63%), Gaps = 13/402 (3%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIP------RGRGHT-HTIFDVTKFGAKPDGKGDSTMAMIRAWNKA  1173
             VILLG+AL+S   +  P      R    T  T+FDVTK+GA  DGK D+  A ++ W  A
Sbjct  12    VILLGLALISCNAQGDPLRDDLRRLLADTGATVFDVTKYGAVADGKTDNVEAFMKTWLAA  71

Query  1172  CHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEH  996
             CH RG + V+IP G FL G+  F+GPC +   IV E +GT++A  DLS Y S  W + E 
Sbjct  72    CHWRGTSTVLIPEGKFLVGQATFEGPCNSPNPIVFEARGTVLAQPDLSEYPSPEWLMFED  131

Query  995   VAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFH  816
             V  + + GGGT +G+G   W+++   +  +  +LP +L F  VN S + DI  ++SK FH
Sbjct  132   VNQLILKGGGTFDGQGVFAWKYNDCHQNADCQMLPTNLKFNKVNNSVVQDITSLDSKSFH  191

Query  815   MKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLL  636
               +++  +F    L ITAPG+SPNTDG+H+S    VN+++  + TGDDC+S+G G+TN+ 
Sbjct  192   YFITNSYNFTAFNLTITAPGNSPNTDGMHLSRCDLVNLSNFTIKTGDDCISVGQGSTNIN  251

Query  635   VTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGII  456
             +T V CGPGHG+SIGSLGK   E DV G+ V NCTL GTTNGARIKT+  SP  +AS II
Sbjct  252   ITNVYCGPGHGLSIGSLGKYPNEKDVVGIHVTNCTLNGTTNGARIKTWPGSPPSQASSII  311

Query  455   FEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVP  276
             F+DI++++V  PI+IDQ Y S   K  S+VK+ DV ++N+RGT   K  A+SL+CS+ VP
Sbjct  312   FQDIVMNSVKNPILIDQKYGSHTGK-PSRVKVSDVLYKNLRGTTISKV-AVSLVCSELVP  369

Query  275   CEDVELADIDIV---SAAGKGVHLKPNKCVNAETIVKGKRNP  159
             C  ++L DID      A  K      + C++A     GK+NP
Sbjct  370   CNGLQLEDIDFTYNGPATFKENLPFSSTCLHANASYVGKQNP  411



>emb|CBI36886.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   347 bits (889),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 184/402 (46%), Positives = 255/402 (63%), Gaps = 13/402 (3%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIP------RGRGHT-HTIFDVTKFGAKPDGKGDSTMAMIRAWNKA  1173
             VILLG+AL+S   +  P      R    T  T+FDVTK+GA  DGK D+  A ++ W  A
Sbjct  12    VILLGLALISCNAQGDPLRDDLRRLLADTGATVFDVTKYGAVADGKTDNVEAFMKTWLAA  71

Query  1172  CHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEH  996
             CH RG + V+IP G FL G+  F+GPC +   IV E +GT++A  DLS Y S  W + E 
Sbjct  72    CHWRGTSTVLIPEGKFLVGQATFEGPCNSPNPIVFEARGTVLAQPDLSEYPSPEWLMFED  131

Query  995   VAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFH  816
             V  + + GGGT +G+G   W+++   +  +  +LP +L F  VN S + DI  ++SK FH
Sbjct  132   VNQLILKGGGTFDGQGVFAWKYNDCHQNADCQMLPTNLKFNKVNNSVVQDITSLDSKSFH  191

Query  815   MKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLL  636
               +++  +F    L ITAPG+SPNTDG+H+S    VN+++  + TGDDC+S+G G+TN+ 
Sbjct  192   YFITNSYNFTAFNLTITAPGNSPNTDGMHLSRCDLVNLSNFTIKTGDDCISVGQGSTNIN  251

Query  635   VTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGII  456
             +T V CGPGHG+SIGSLGK   E DV G+ V NCTL GTTNGARIKT+  SP  +AS II
Sbjct  252   ITNVYCGPGHGLSIGSLGKYPNEKDVVGIHVTNCTLNGTTNGARIKTWPGSPPSQASSII  311

Query  455   FEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVP  276
             F+DI++++V  PI+IDQ Y S   K  S+VK+ DV ++N+RGT   K  A+SL+CS+ VP
Sbjct  312   FQDIVMNSVKNPILIDQKYGSHTGK-PSRVKVSDVLYKNLRGTTISK-VAVSLVCSELVP  369

Query  275   CEDVELADIDIV---SAAGKGVHLKPNKCVNAETIVKGKRNP  159
             C  ++L DID      A  K      + C++A     GK+NP
Sbjct  370   CNGLQLEDIDFTYNGPATFKENLPFSSTCLHANASYVGKQNP  411



>ref|XP_008451547.1| PREDICTED: exopolygalacturonase clone GBGE184 [Cucumis melo]
Length=429

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 239/366 (65%), Gaps = 2/366 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+   GAK DG+ DST A ++ W KACHS G AKVV P GTFL G +V+ GPC    +
Sbjct  62    VFDIIAHGAKADGRTDSTQAFMQTWVKACHSGGPAKVVFPPGTFLTGPLVYAGPCDGP-M  120

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +EI+GT+ A +D++ Y+S  W + E V  + + G GT +G+G + W+++   K     L
Sbjct  121   TVEIQGTVKATTDITEYSSPEWILFESVTKLNLIGKGTFDGQGAEAWKYNDCSKHPQCTL  180

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P S+ F  V    +     VNSK FH+ V   ++  ++ + I APG+SPNTDG+HIS +
Sbjct  181   PPTSIKFNKVTHGSMEGFTSVNSKAFHIFVVLSHNIKINNIHIVAPGNSPNTDGVHISQT  240

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VNVT+ ++GTGDDCVSIG G+TN+ V  +TCGPGHGIS+GSLGK   E +V+G+ V N
Sbjct  241   DVVNVTNSIIGTGDDCVSIGHGSTNINVLNITCGPGHGISVGSLGKYKDEKEVRGIFVSN  300

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLK  357
             CT+  TTNG RIKT+ ASP  +A+ I F+DI+L  V  PIIIDQ Y SK ++  S+VK+ 
Sbjct  301   CTIRNTTNGVRIKTWAASPPGQATRITFQDIVLDKVRNPIIIDQTYGSKKKRSPSQVKIS  360

Query  356   DVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIV  177
             DV+F+NIRGT +    A+SL CS  +PC+ ++L  ID+  +  +      N C+NA+   
Sbjct  361   DVQFKNIRGT-TISPVAVSLQCSAALPCDSIKLEQIDVAFSGSRSKQPFGNSCLNAKITT  419

Query  176   KGKRNP  159
              GK+NP
Sbjct  420   IGKQNP  425



>ref|XP_010259722.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=477

 Score =   343 bits (881),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 179/381 (47%), Positives = 248/381 (65%), Gaps = 12/381 (3%)
 Frame = -1

Query  1283  PRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVF  1104
             PRG      IF+V  FGAKPDG+ D+T A +R W  AC+S+  A+V+IP G +  G V+F
Sbjct  96    PRG-----IIFNVKLFGAKPDGRKDNTQAFMRTWVAACNSKDQARVLIPEGIYRIGPVIF  150

Query  1103  QGPCTAK-RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             QGPC +   I++++KGT+ A  D+S Y S  W   E + GV +TGGGT +G+G+ VWQ++
Sbjct  151   QGPCNSPDPIIVQVKGTVKATDDISEYPSPEWVSFEKLDGVILTGGGTFDGQGQAVWQYN  210

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                      LLP S+    V+ + I  IK +NSK FH+ +++  +  V  + I AP DSP
Sbjct  211   DCSSNAYCQLLPTSIKLSSVSNAIIRRIKSINSKSFHIGITNGKNIKVRSVDIVAPEDSP  270

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIHIS S  V+++  V+GTGDDC+SIG G+ N+ +++VTCGPGHGIS+GSLGK   E
Sbjct  271   NTDGIHISRSFGVSISKAVIGTGDDCISIGQGSNNVTISKVTCGPGHGISVGSLGKYPDE  330

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY----  399
              DV G+TV+NCTL+ T NG RIKT+  SP  +AS I+F+DI++ NV+RPIII+Q Y    
Sbjct  331   QDVNGITVKNCTLVNTDNGLRIKTWPGSPPSQASNIVFQDIIMENVSRPIIINQQYCAST  390

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
             +S   KE S VK+ +V F+NIRGT S    A+ + CS  VPCE ++L DI++V  A    
Sbjct  391   SSCTNKEPSNVKISNVFFQNIRGT-SASDVAVKINCSSAVPCEGLQLFDINLVPIAPTTD  449

Query  218   HLKPNK-CVNAETIVKGKRNP  159
                P+  C NA+    G + P
Sbjct  450   STTPSAVCSNAKISFGGVQVP  470



>emb|CAN69218.1| hypothetical protein VITISV_012014 [Vitis vinifera]
Length=863

 Score =   351 bits (900),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 7/378 (2%)
 Frame = -1

Query  1280  RGRGHT--HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             RGRG     TIF+V ++GAKP GK DST A ++AW  ACH RG A+++IP+G FL G+V 
Sbjct  45    RGRGSIPGETIFNVLQYGAKPGGKKDSTEAFMKAWVAACHWRGKARLLIPQGIFLIGQVT  104

Query  1106  FQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQF  930
             FQGPC +   I++++  T+ A +D+S + S  W   E + G+ VTGGGT +G+G+ VW++
Sbjct  105   FQGPCNSPTPIIVQVAATLKAVTDISEFASPEWVTFEDINGLIVTGGGTFDGQGDVVWKY  164

Query  929   DADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDS  750
             +   +  N  LLP S+ F  +    +  I  VN+K FH+ ++ C +F    L ITAP DS
Sbjct  165   NDCRRNSNCQLLPTSIKFNSITNGNLRGINSVNAKSFHIAMNRCQNFRAFGLXITAPEDS  224

Query  749   PNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQ  570
             PNTDGIHIS S  V V+  ++ TGDDC+SIG G+TN+ + +VTCGPGHGISIGSLGK   
Sbjct  225   PNTDGIHISSSNFVKVSKSIISTGDDCISIGQGSTNISINKVTCGPGHGISIGSLGKYPD  284

Query  569   ETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---  399
             E DV G+ V+N TL+ T NG RIKT+  SP  +ASGI+F+DI++ NV  PIIIDQ Y   
Sbjct  285   EKDVMGIIVKNSTLMNTDNGLRIKTWPGSPPSQASGILFQDIIMKNVKNPIIIDQLYCPS  344

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
              S  R + S+V++ ++ +RNIRGT+S     ++L+CS   PC++VEL DI++  +  + V
Sbjct  345   GSSCRTQPSRVRISNIHYRNIRGTSSSPL-GVNLMCSPQFPCQNVELFDINLRYSGKRRV  403

Query  218   HLKPNKCVNAETIVKGKR  165
                 + C N +    G+ 
Sbjct  404   SALTSSCSNVKAGFGGEE  421


 Score =   298 bits (763),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 219/347 (63%), Gaps = 11/347 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVT +GA  DGK ++ MA + AW+ AC+  G + +++P GTF  G + F GPC   + 
Sbjct  489   IFDVTMYGAVGDGKTENGMAFLAAWDDACNHPGKSTLLVPNGTFFIGPISFIGPCQNNQS  548

Query  1076  V-IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTIN-----GRGEDVWQFDADEK  915
               +EI+GT+ A S L  + +  W +   +  + +TG  T N      +GE+ W+  AD +
Sbjct  549   PKVEIRGTLKAPSSLKAFPTPSWIMFRQLQSLILTGETTTNTSLFDAQGEESWR-HADCR  607

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
              K     P S+I   V    I +I   N KGFHM + + ++  V  + ITAP +SPNTDG
Sbjct  608   HKLKCQFPTSIILVNVTNGNISNITLKNGKGFHMGIINSDNVTVHGVNITAPWNSPNTDG  667

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             +HI  STN+++T   +G GDDCVSIG G+ N+ V    CGPGHGIS+GSLGK + E DV 
Sbjct  668   VHIGYSTNIHITSSTIGVGDDCVSIGPGSINITVFNTKCGPGHGISVGSLGKYSAEKDVV  727

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA  375
             GV V+NCT+ GT NG RIKT+  SP  KAS   FEDI++ NV+ PIIIDQ+Y   +   +
Sbjct  728   GVRVKNCTINGTQNGVRIKTWPGSPASKASSFWFEDIVMINVSNPIIIDQEYCPWSTCTS  787

Query  374   SK---VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             SK   VKL D+ F NIRGT + K  A++L+CS +VPCED++L +I++
Sbjct  788   SKPSLVKLSDIHFTNIRGTFNTKS-AVALMCSSSVPCEDIQLLNINL  833



>gb|EPS59866.1| hypothetical protein M569_14940, partial [Genlisea aurea]
Length=344

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 235/350 (67%), Gaps = 10/350 (3%)
 Frame = -1

Query  1199  AMIRAWNKACHSRGAAKVVIPRG-TFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYT  1023
             ++I+A+  AC SRG+A+V+IPRG +F+ GEV+  GPCTAK I I+I+GT++A  DLSVY 
Sbjct  1     SVIKAFRAACSSRGSARVLIPRGRSFVVGEVLLVGPCTAKPITIDIQGTLLAYEDLSVYM  60

Query  1022  SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDI  843
             +  W ++E V G  VTGGGT+NGRG + WQ+      K+ P LPV+L+FQ V  S I+ +
Sbjct  61    NGAWILVERVDGAVVTGGGTLNGRGMNTWQYHT----KDGPQLPVTLVFQTVTNSKINRL  116

Query  842   KFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVS  663
              F+ S GFH+K++D  +  V  + + AP  SPNTDGIH+S +T+V++TD  +GTGDDC+S
Sbjct  117   SFLYSMGFHIKITDSVNVGVRGVTVRAPRKSPNTDGIHLSNATDVDITDCKIGTGDDCIS  176

Query  662   IGDGTTNLLVTRVTCGPGHGISIG-SLGKRAQETDVKGVTVRNCTLIGTTNGARIKTY-R  489
             IG G  N+LV RV CGPGHGI     + +R  E +V GVTV NCT+ GT+NGARIKTY  
Sbjct  177   IGHGARNVLVARVRCGPGHGIRRAIQIFRRTNELNVNGVTVINCTMSGTSNGARIKTYAN  236

Query  488   ASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHP  309
              SP+L AS IIF+D++++ V  P+IIDQ Y SK +   S VKL D+ FRNI+GT      
Sbjct  237   TSPKLTASTIIFQDLIMNKVRNPVIIDQHYPSKRKGRPSSVKLTDIHFRNIKGTTISPL-  295

Query  308   AISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             +I L CS T PCE VEL++I++      G       C NA    KG  NP
Sbjct  296   SIQLDCSPTNPCEGVELSNINLTPFGQIGALT--TSCSNARFFTKGYLNP  343



>ref|XP_004134494.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004162214.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 gb|KGN57136.1| hypothetical protein Csa_3G164550 [Cucumis sativus]
Length=424

 Score =   336 bits (862),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/373 (44%), Positives = 244/373 (65%), Gaps = 6/373 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              T+F+V  FGAKPDGK D++ + ++ W  ACHS+GAA+VVIPRGTFL  ++ F GPC + 
Sbjct  49    ETVFNVLSFGAKPDGKTDNSESFMKTWVAACHSKGAARVVIPRGTFLINQIAFAGPCAST  108

Query  1082  R-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I+++I  T+    D+S Y S+ W + E + G+ VTG G ++G+G  VW+++      N
Sbjct  109   SPIIVQIDATLKGGVDISNYFSDEWILFEKINGLIVTGRGALDGQGSAVWEYNDCGMNPN  168

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LPV+L    +    +  I  VNSKGFHM V++C +  + KL +TAP DSPNTDGIH+
Sbjct  169   CQKLPVNLKLNNITHGLVKGISSVNSKGFHMFVTNCENVRLRKLHLTAPEDSPNTDGIHL  228

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S N+ ++  V+ TGDDC+S+G G+ N+ + ++TCGPGHGIS+GSLGK   E DV+G+ 
Sbjct  229   SRSNNIKISRSVIATGDDCISLGRGSMNVAINKITCGPGHGISVGSLGKYPNEEDVRGIV  288

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEA  375
             V+NCTL+ T NG RIKT+  SP   ASGI+F+DI + NV  PI+IDQ+Y+      ++  
Sbjct  289   VKNCTLLSTDNGLRIKTWPDSPPSAASGILFQDINMVNVKNPILIDQEYSCSKTNCQRPP  348

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK-PNKC  198
             S+VK+ DV + N++G+ S    A+ L CS+  PC+++E+ +I++  +      L    KC
Sbjct  349   SRVKISDVHYINVKGS-SISPVAVQLKCSKQFPCQNIEMFNINLKYSGPPNKELPFSAKC  407

Query  197   VNAETIVKGKRNP  159
              NA+   +G + P
Sbjct  408   SNAKVGYRGLQFP  420



>ref|XP_004161540.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=458

 Score =   337 bits (865),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 241/370 (65%), Gaps = 4/370 (1%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
              ++FDVTK GAK DGK D   A    W  AC ++ G  K++IP+GT+L G +   GPC +
Sbjct  86    ESVFDVTKHGAKADGKTDDAQAFETTWIAACRNTVGPVKILIPKGTYLVGPMTLAGPCKS  145

Query  1085  KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I IE +GT+ A +DLS Y+S  WF IE + G  +TG G  +G+G  VW ++  +  K+
Sbjct  146   FPITIENQGTVKATTDLSEYSSPEWFSIEDITGFILTGSGVFDGQGTAVWAYNDCKSNKD  205

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
               LLP+S+ F G+N + +  I  +NSKGFHM + +C +F ++ + I AP +SPNTDGIH+
Sbjct  206   CQLLPISIKFSGLNHTIVDGITSLNSKGFHMSLFNCYNFTITNVNIIAPDESPNTDGIHL  265

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S  VN+ + ++GTGDDCVSIG  T  + VT VTCGPGHG+S+GSLGK ++E DV  V 
Sbjct  266   STSELVNIMNSIIGTGDDCVSIGHSTVKITVTNVTCGPGHGLSVGSLGKYSREKDVYDVL  325

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V+NCT+   TNGARIKT+ +     ASGIIFEDI+++NV  PIIIDQ Y++   KE SK 
Sbjct  326   VKNCTIFNATNGARIKTFASPISGLASGIIFEDIIMYNVKYPIIIDQTYSTDENKE-SKW  384

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK-PNKCVNA  189
             K+ DV F+NIRGT S  +  + L CS+ +PCE V L DI++        +    + C+NA
Sbjct  385   KVSDVHFKNIRGT-SATNVGVLLECSKLLPCEGVVLKDINLTYGGTDSKNTTIVSSCLNA  443

Query  188   ETIVKGKRNP  159
             +    G +NP
Sbjct  444   KITTIGVQNP  453



>ref|XP_004148972.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=458

 Score =   335 bits (860),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 240/370 (65%), Gaps = 4/370 (1%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
              ++FDVTK GAK DGK D   A    W  AC ++ G  K++IP+GT+L G +   GPC +
Sbjct  86    ESVFDVTKHGAKADGKTDDAQAFETTWIAACRNTVGPVKILIPKGTYLVGPMTLAGPCKS  145

Query  1085  KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I IE +G + A +DLS Y+S  WF IE + G  +TG G  +G+G  VW ++  +  K+
Sbjct  146   FPITIENQGIVKATTDLSEYSSPEWFSIEDITGFILTGSGVFDGQGTAVWAYNDCKSNKD  205

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
               LLP+S+ F G+N + +  I  +NSKGFHM + +C +F ++ + I AP +SPNTDGIH+
Sbjct  206   CQLLPISIKFSGLNHTIVDGITSLNSKGFHMSLFNCYNFTITNVNIIAPDESPNTDGIHL  265

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S  VN+ + ++GTGDDCVSIG  T  + VT VTCGPGHG+S+GSLGK ++E DV  V 
Sbjct  266   STSELVNIMNSIIGTGDDCVSIGHSTVKITVTNVTCGPGHGLSVGSLGKYSREKDVYDVL  325

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V+NCT+   TNGARIKT+ +     ASGIIFEDI+++NV  PIIIDQ Y++   KE SK 
Sbjct  326   VKNCTIFNATNGARIKTFASPISGLASGIIFEDIIMYNVKYPIIIDQTYSTDENKE-SKW  384

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK-PNKCVNA  189
             K+ DV F+NIRGT S  +  + L CS+ +PCE V L DI++        +    + C+NA
Sbjct  385   KVSDVHFKNIRGT-SATNVGVLLECSKLLPCEGVVLKDINLTYGGTDSKNTTIVSSCLNA  443

Query  188   ETIVKGKRNP  159
             +    G +NP
Sbjct  444   KITTFGVQNP  453



>ref|XP_008438909.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=424

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 243/373 (65%), Gaps = 6/373 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              T+F+V  FGAKPDGK D+T + ++ W  ACHS+GAA+VVIP GTFL  +V F GPC + 
Sbjct  49    ETVFNVLSFGAKPDGKTDNTESFMKTWVAACHSKGAARVVIPSGTFLINQVAFAGPCAST  108

Query  1082  R-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               IV++I  T+    D+S Y S+ W + E + G+ VTG GT++G+G  VW+++      N
Sbjct  109   SPIVVQIDATLKGGIDISNYFSDEWILFEKINGLIVTGRGTLDGQGSAVWEYNDCGMNPN  168

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LPV+L   G+    +  I  VNSKGFHM +++C +  + KL ITAP  SPNTDGIH+
Sbjct  169   CQKLPVNLKLSGITHGLVKGISSVNSKGFHMFITNCENVRLRKLHITAPETSPNTDGIHV  228

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S NV ++  V+ TGDDC+S+G G+ N+ + ++TCGPGHGIS+GSLGK   E DV+G+ 
Sbjct  229   SRSNNVKISRSVIATGDDCISLGRGSMNIAINKITCGPGHGISVGSLGKYQNEEDVRGII  288

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEA  375
             V+NCTL+ T NG RIKT+  SP   ASGI+F+DI + +V  PI+IDQ+Y+      +K  
Sbjct  289   VKNCTLVKTDNGLRIKTWPDSPPSAASGILFQDINMIDVKNPILIDQEYSCSKTNCQKPP  348

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK-PNKC  198
             S+VK+ DV + N++G+ S    A+ L CS+  PC+++E+ +I++         L    +C
Sbjct  349   SRVKISDVHYINVKGS-SISPVAVQLKCSKQFPCQNIEMFNINLKYTGPPNKELPFIAQC  407

Query  197   VNAETIVKGKRNP  159
              NA+   +G + P
Sbjct  408   SNAKVGYRGLQFP  420



>ref|XP_008451635.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=456

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 240/377 (64%), Gaps = 10/377 (3%)
 Frame = -1

Query  1274  RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQG  1098
              G+  ++F VTK GAK DGK D   A +  W +AC ++ G AK++IP GT+L G V   G
Sbjct  80    NGNGGSVFHVTKHGAKADGKTDDAQAFVTTWIEACRNTVGPAKILIPEGTYLVGPVTLAG  139

Query  1097  PCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADE  918
             PC +  I +E +GT+ A +D+S Y+S  WF IE + G  +TG G  +G+G   W ++  +
Sbjct  140   PCKSFPITLENQGTVKATTDISQYSSPEWFSIEDITGFILTGSGVFDGQGVAAWPYNDCK  199

Query  917   KIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTD  738
                   LLP+S+ F  +N + +  +  +NSKGFHM +  C +F  + + I AP DSPNTD
Sbjct  200   NNNICQLLPISIKFSRLNDTIVDRLTSLNSKGFHMSLFSCYNFTATNINIIAPHDSPNTD  259

Query  737   GIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDV  558
             GIH+S S  VN+ + ++GTGDDCVSIG  T  + VT VTCGPGHG+S+GSLGK  +E DV
Sbjct  260   GIHLSTSKLVNIANSIIGTGDDCVSIGHSTEKITVTNVTCGPGHGLSVGSLGKYPEEKDV  319

Query  557   KGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKE  378
               V V+NCT+   TNGARIKT+ +     ASGIIFEDI+++NV  PIIIDQ Y++   KE
Sbjct  320   YDVLVKNCTIFNATNGARIKTFASPISGSASGIIFEDIVMYNVKYPIIIDQTYDTNENKE  379

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP---  207
              SK K+ DV F+NIRGT S  + A+ L CS+ +PCE VEL DID+      G  LK    
Sbjct  380   -SKWKVSDVHFKNIRGT-SATNVAVLLDCSKLLPCEGVELRDIDLTYG---GTDLKNTTI  434

Query  206   -NKCVNAETIVKGKRNP  159
              + C NA+    G +NP
Sbjct  435   VSSCSNAKITTFGVQNP  451



>emb|CDO98830.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 176/391 (45%), Positives = 241/391 (62%), Gaps = 10/391 (3%)
 Frame = -1

Query  1316  IALLSTGVECIPRG---RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGA-AK  1149
             + L S+   C   G   R     IF+V  FGAKP     +  A +RAWN AC   G  A 
Sbjct  15    LVLCSSLASCNAAGGLPRPAPPAIFNVVSFGAKPGNTDSAQQAFMRAWNAACKFVGPRAS  74

Query  1148  VVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTG  972
             + +P G F  GEV F+GPC+++  IV ++ GT+ A SD+S Y+   W   + ++G+ +TG
Sbjct  75    LFVPPGIFTLGEVTFEGPCSSQSPIVFQVAGTLQAVSDVSAYSGQGWISFDTISGLVITG  134

Query  971   GGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCND  792
             GGTI+GRG++VWQ++  +   +   LP S  F GV  + I  +  VN+ GFHM V++   
Sbjct  135   GGTIDGRGQNVWQYNDCKNNGDCVHLPASFHFNGVKNAKIKGVSLVNAMGFHMHVTNSYL  194

Query  791   FNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGP  612
             F    L ITAP DSPNTDG+H+S S  V +   V+ TGDDCVSIG G TN+ + +VTCGP
Sbjct  195   FRAHSLTITAPPDSPNTDGMHVSKSNTVKIARSVIRTGDDCVSIGPGATNVTINKVTCGP  254

Query  611   GHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHN  432
             GHGISIGSLGK   E DV+G+ V+NCTL GTTNG RIKTY  S    A+G+ F DI++ N
Sbjct  255   GHGISIGSLGKYPNELDVRGLIVKNCTLQGTTNGVRIKTYAGSGPSVAAGMRFSDIVMEN  314

Query  431   VTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELAD  252
             V  PIIIDQ+Y   +  + S+V++ DV + NIRGT S +  AISL CS +VPC+++   +
Sbjct  315   VLNPIIIDQNYGGSS-TQPSQVRITDVVYENIRGTTSTES-AISLKCSPSVPCQNMYFTN  372

Query  251   IDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             I++      G     + C NA+ I  G + P
Sbjct  373   INL---RNMGSARLSSICANAQVISSGVQTP  400



>ref|XP_010259724.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=468

 Score =   333 bits (854),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/352 (47%), Positives = 232/352 (66%), Gaps = 6/352 (2%)
 Frame = -1

Query  1271  GHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC  1092
             G   TIF+V  FGAKPDG+ D+  A ++ WN AC S   A V+IP G FL G+V+F+GPC
Sbjct  88    GDAGTIFNVKSFGAKPDGRTDNVQAFMKTWNAACQSGSKATVLIPDGVFLVGQVIFEGPC  147

Query  1091  TAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKI  912
              +  IV+++KG + A  D+S Y S  W   EHV G+ VTGGGT++G+G+  W+++   K 
Sbjct  148   KSP-IVVQVKGYLKAVIDVSDYPSPEWISFEHVNGLTVTGGGTLDGQGKTDWKYNDCSKN  206

Query  911   KNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGI  732
                 LLP SL    V    +  +K ++SK FHM +       V  L+I+AP DSPNTDGI
Sbjct  207   AYCQLLPSSLKLNSVTNGQVGQLKLLDSKAFHMVILKGKSITVQDLQISAPEDSPNTDGI  266

Query  731   HISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKG  552
             H+S S +V ++++++GTGDDC+SIG G+ N+ + +V CGPGHGIS+GSLGK   E DVKG
Sbjct  267   HLSRSIDVTISNVIIGTGDDCISIGQGSNNVNINQVYCGPGHGISVGSLGKYDDEQDVKG  326

Query  551   VTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK----NR  384
             VTV NCTL  T NG RIKT+  SP  +AS I+F+++++ NV  PIIIDQ Y +     + 
Sbjct  327   VTVNNCTLANTQNGLRIKTWPGSPPSQASSILFKNVVMKNVRYPIIIDQQYCASTSHCSN  386

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAG  228
                S VKL D+R++NIRGT+S +  A+ + CS  VPC+ ++L D+++    G
Sbjct  387   TNPSNVKLSDIRYQNIRGTSSSQ-VAVKINCSPAVPCKGIQLFDVNLKYEPG  437



>ref|XP_004495937.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Cicer arietinum]
Length=408

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/397 (45%), Positives = 245/397 (62%), Gaps = 7/397 (2%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPRG--RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSR  1161
             +  LGI  LS  +    R         +F+VT FGA  D K D+  A   AW  AC +S 
Sbjct  7     LFFLGIVFLSFSIIGASRSLLENGDPAVFNVTSFGAVADDKTDNVEAFRAAWMAACKNST  66

Query  1160  GAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGV  984
               A ++IP GTF++G+ +F GPC + K I +E+ GT+ A +DLS Y S  WF    + G+
Sbjct  67    TPATLLIPEGTFVSGQTLFAGPCISPKPITVEVIGTVKATTDLSEYYSPEWFTFLSIDGL  126

Query  983   EVTGGGTINGRGEDVWQFDADEKIK-NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKV  807
              + GGG  +G+G   W F+  +K K N   LP SL F+ VN S + +I  +NS  FH  +
Sbjct  127   VLKGGGIFDGQGAISWPFNDCKKNKGNCVSLPSSLKFEKVNNSIVTNITSLNSMEFHYHL  186

Query  806   SDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTR  627
               CN+ + + L+ITAPG+SPNTDG+HIS S  ++V+D ++GTGDDC+S+G  T+N+ +T 
Sbjct  187   YGCNNISFTNLKITAPGNSPNTDGMHISSSDRISVSDSIIGTGDDCISVGHSTSNITITN  246

Query  626   VTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFED  447
             +TCGPGHGIS+GSLGKR  E  V GV V+NCT   TTNGARIKT+  S   +A  I++ED
Sbjct  247   ITCGPGHGISVGSLGKRPTEKTVDGVIVKNCTFTNTTNGARIKTWLGSTPAEAKNIVYED  306

Query  446   IMLHNVTRPIIIDQDYNSKNRKEASKV-KLKDVRFRNIRGTASKKHPAISLICSQTVPCE  270
             ++++ V  PI+IDQ Y  K R  ++ V K+ DV FRNI GT +  + A+SL CS   PCE
Sbjct  307   LIMNGVQNPIVIDQSYGKKARVASTSVWKISDVHFRNISGT-TVSNIAVSLQCSTKNPCE  365

Query  269   DVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              VE+AD+D+            + C NAE I  GK NP
Sbjct  366   GVEVADVDLSYVGAPYNTTFVSVCANAEAIFGGKLNP  402



>ref|XP_010088309.1| Exopolygalacturonase clone GBGE184 [Morus notabilis]
 gb|EXB33534.1| Exopolygalacturonase clone GBGE184 [Morus notabilis]
Length=436

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 189/430 (44%), Positives = 262/430 (61%), Gaps = 30/430 (7%)
 Frame = -1

Query  1400  DIYRLRYVEHIYVATMEIKAGIFVILLGIALLSTGVECIPRG---------RGHTHT---  1257
             D+ R R ++H             V+LL  A L +      RG         RG T T   
Sbjct  3     DMERRRLIDHFEA----------VLLLCCAFLISSAAGAFRGHVSDDTGLRRGLTETGRQ  52

Query  1256  IFDVTKFGAKPDG-KGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPC-TA  1086
             IFDVTK+GA  +  + D+  A ++ W  AC +S   AK+VIP G FL G VVFQGPC ++
Sbjct  53    IFDVTKYGAVANNERKDNVQAFMKTWVAACRNSNAPAKIVIPTGAFLVGPVVFQGPCKSS  112

Query  1085  KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
             + IVIE++GT+ A +D+S Y+S  WF  E V G+ +TG GT +G+G  VW ++  +   N
Sbjct  113   EPIVIEVQGTVKATTDVSDYSSPEWFSFEFVNGLVLTGKGTFDGQGPKVWHYNDCKTNPN  172

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                L  SL F  VN + +  I  +NSK FH  + +  +  ++ ++ITAP +SPNTDGIHI
Sbjct  173   CQHLASSLRFSNVNNAYVEGITSLNSKWFHFFIYESKNITLNNVKITAPAESPNTDGIHI  232

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S ST+VNVT+  + TGDDC+ I     N+ +T VTCGPGHGIS+GSLGK + +  V  + 
Sbjct  233   SASTSVNVTNTAIATGDDCIGIVQDCHNIYITNVTCGPGHGISVGSLGKWSYDKGVSNIV  292

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             VRNCTL+ TTNGARIKT+  +   +A+GII+E+I++ NV  PIIIDQ+Y  KN  + SK 
Sbjct  293   VRNCTLVNTTNGARIKTWGGTTSGEATGIIYENIIMKNVKNPIIIDQNYGRKN--QPSKW  350

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK-CVNA  189
             K+KDV FRNI+GT++ K  +ISL CS   PCE VE+++I++     K      +  C NA
Sbjct  351   KIKDVHFRNIKGTSASK-VSISLGCSSLFPCEVVEMSNINLSYGGTKFATTATDSVCANA  409

Query  188   ETIVKGKRNP  159
             +    G  NP
Sbjct  410   KVANSGS-NP  418



>ref|XP_010321891.1| PREDICTED: exopolygalacturonase-like [Solanum lycopersicum]
Length=405

 Score =   325 bits (834),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/362 (46%), Positives = 227/362 (63%), Gaps = 5/362 (1%)
 Frame = -1

Query  1316  IALLSTGVECIPRGRG---HTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKV  1146
             I +LST V C     G      TIF+V  F AKP+ +  ST A ++AW  AC   G A+V
Sbjct  12    ILVLSTLVTCKCNAAGVPLADQTIFNVMDFDAKPNSELMSTQAFMKAWRAACDFTGHARV  71

Query  1145  VIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGG  969
              +P G +  GE VF GPC     I++EI GT+ A  D+S Y++  W   E + GV +TGG
Sbjct  72    FVPPGVYTLGETVFAGPCKGTHSIILEIAGTLKAVPDVSEYSNFAWISFESINGVIITGG  131

Query  968   GTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDF  789
             GT++ +G+ VWQF+  +   N   LP +L F  +    I  +K +NS GFH+ ++     
Sbjct  132   GTLDAQGQSVWQFNDCKTNPNCVHLPATLHFNNIRNGKIMRLKLINSMGFHLHITSSYLV  191

Query  788   NVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPG  609
                 L I AP DSPNTDGIHIS S  + ++  V+ TGDDCVS G GT N+ V +VTCGPG
Sbjct  192   RFHGLTIDAPEDSPNTDGIHISKSNTIKLSRSVIRTGDDCVSFGQGTNNVTVNKVTCGPG  251

Query  608   HGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNV  429
             HGIS+GSLGK A E +V+G+ V+NCTL GTTNG RIKTY      +A G++F DI++ NV
Sbjct  252   HGISVGSLGKLAGELEVRGLIVKNCTLRGTTNGIRIKTYAGENANRALGMMFSDIVMENV  311

Query  428   TRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADI  249
               PIIIDQ Y  K+    S+VK+ DV ++NIRGT S + P + L+CS  +PCE+V L +I
Sbjct  312   KNPIIIDQSYGDKSTDSLSQVKISDVVYQNIRGTTSSEIP-VQLLCSSKLPCENVRLTNI  370

Query  248   DI  243
             ++
Sbjct  371   NL  372



>ref|XP_006845389.1| hypothetical protein AMTR_s00019p00055210 [Amborella trichopoda]
 gb|ERN07064.1| hypothetical protein AMTR_s00019p00055210 [Amborella trichopoda]
Length=410

 Score =   325 bits (834),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/396 (43%), Positives = 252/396 (64%), Gaps = 9/396 (2%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGA  1155
             +V+ + IA ++  VE    G   +   F+V +FGA  DG  D++ A   AW  AC  +G 
Sbjct  16    YVVFIAIAYVA-AVEAA-NGNSSSAGEFNVMQFGAIADGTTDNSEAFGAAWKAACEWKGP  73

Query  1154  AKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEV  978
             ++++IP GTFL G V+F+GPC +A  +V+++KG + A +D+S Y S+ W + ++V G+ V
Sbjct  74    SRLLIPEGTFLVGPVLFKGPCPSASPMVVQVKGKVKALTDMSKYPSDEWIVFQYVDGLVV  133

Query  977   TGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDC  798
             TGGGT +G+G   W+ +   K  +  LLP SL F  +    I  I  V+SK FHM +  C
Sbjct  134   TGGGTFDGQGASAWRLNQCPKKAHCKLLPTSLKFNFITNGEIRGIHSVDSKLFHMLLFGC  193

Query  797   NDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTC  618
              + NV  ++I+AP DSPNTDGIH+  S+N+ ++   +GTGDDC+S+G G+T + V  V C
Sbjct  194   KNLNVQSIKISAPADSPNTDGIHVGSSSNITISRSHIGTGDDCISLGPGSTQVTVKNVFC  253

Query  617   GPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIML  438
             GPGHGIS+GSLGK ++E  V+G+ V NCT+  TTNG RIKT+  S    AS   +EDI++
Sbjct  254   GPGHGISVGSLGKFSKEEGVQGLHVENCTISDTTNGLRIKTWAGSDSSSASNFTYEDIVM  313

Query  437   HNVTRPIIIDQD---YNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCED  267
             +NV  PIIIDQ    Y+S  +K  S+VK+ D+ F+NIRGT++ K  A++L+CS+  PC++
Sbjct  314   NNVANPIIIDQQYCPYSSCPQKGPSRVKINDISFKNIRGTSASKI-AVNLLCSEAFPCQN  372

Query  266   VELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             V+L DI +    G+G       C N + +  G + P
Sbjct  373   VQLDDIKL-EYNGQG-EASTASCTNVKGVSTGIQIP  406



>ref|XP_009400098.1| PREDICTED: exopolygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=485

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/351 (47%), Positives = 232/351 (66%), Gaps = 7/351 (2%)
 Frame = -1

Query  1283  PRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVF  1104
             P G      +++V  + A  DG+ D+T A    W+ AC   G A +VIP G +L G ++F
Sbjct  105   PTGADTIVGVYNVKDYAAVGDGQTDNTKAFESTWSAACAVEGTATIVIPEGEYLLGPIIF  164

Query  1103  QGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDA  924
             +GPC  K +V+++KG + A + L  YT N W   +++ G+ ++GGG  +G+G   W ++ 
Sbjct  165   KGPCKGK-MVMQVKGQLSASTHLEAYTQN-WLDFQYINGLVISGGGIFHGQGASAWPYNQ  222

Query  923   DEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPN  744
               K +   LLP +L+F  V  + I  I  ++SK FHM++ +  D  +  ++I+APGDSPN
Sbjct  223   CPKTRKCKLLPANLVFSFVTNATISSISSIDSKLFHMQIFESRDITLDSIKISAPGDSPN  282

Query  743   TDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQET  564
             TDGIHI+ STN+ V++ V+GTGDDC+SIG G TNL +  V CGPGHGIS+GSLGK A E 
Sbjct  283   TDGIHIADSTNIQVSNSVIGTGDDCISIGPGCTNLTIFNVLCGPGHGISVGSLGKNANEK  342

Query  563   DVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQD---YN  396
             DV G+TVR CT  GT+NG RIKT+ +SP  LKA+G +FEDI+++NV  PIIIDQ+   Y 
Sbjct  343   DVSGLTVRQCTFTGTSNGLRIKTWPSSPSSLKATGFVFEDIIMNNVYNPIIIDQNYCPYA  402

Query  395   SKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             +    + S VK+KD++FRNI GT +    AI L+CS+ VPCE VEL DI +
Sbjct  403   NCPETDPSLVKIKDIKFRNITGTTASPE-AIKLVCSKAVPCEGVELNDISL  452



>ref|XP_003591491.1| Polygalacturonase [Medicago truncatula]
 gb|AES61742.1| polygalacturonase [Medicago truncatula]
Length=407

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 233/372 (63%), Gaps = 5/372 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACH-SRGAAKVVIPRGTFLAGEVVFQGPCTA-K  1083
             I+DVTKFGA  DGK D+   +  AW  AC  S   A V+IP GTF+ G+ +F GPCT+ K
Sbjct  34    IYDVTKFGAVADGKTDNVEKIRAAWQAACKTSTVPATVLIPAGTFVTGQTLFAGPCTSPK  93

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQF-DADEKIKN  906
              I +EI G   A +DLS Y S  WF  E++ G+ + G G  +G+G   W   D  +   N
Sbjct  94    PITVEIVGKAQATTDLSEYYSPEWFQFENIDGLVLKGSGVFDGQGSISWPLNDCKQNKGN  153

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP SL F  +  + + D+  +NS  FH  +  C++ + + L ITAPG+SPNTDG+HI
Sbjct  154   CASLPSSLKFDKIKNAIVQDVTSLNSMQFHFHLHGCSNISFTNLHITAPGNSPNTDGMHI  213

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S  + VT+ V+ TGDDC+S+G  T+N+ ++ +TCGPGHGIS+GSLGKR +E  V GV+
Sbjct  214   SSSDFITVTNSVIATGDDCISVGHSTSNITISGITCGPGHGISVGSLGKRPEEKTVNGVS  273

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V+NCT IG+TNGARIKT+  +   +A  I++ED+++ +V  PI+IDQ Y  K R  ++ V
Sbjct  274   VKNCTFIGSTNGARIKTWIGTAPAEAKNIVYEDLIMKDVQNPIVIDQSYGKKERVPSTSV  333

Query  365   -KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
              K+ D  FR I+GT     P +SL CS   PCE++E+AD+++     +      N C+NA
Sbjct  334   WKISDAHFRRIKGTTVSNIP-VSLQCSSKNPCENIEVADVELTYVGPQKSIPFANSCINA  392

Query  188   ETIVKGKRNPGG  153
             + I  GK NP  
Sbjct  393   KAIFGGKLNPAA  404



>ref|XP_010938370.1| PREDICTED: exopolygalacturonase-like [Elaeis guineensis]
Length=414

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 227/341 (67%), Gaps = 4/341 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK-R  1080
             +FDVT++GA  DGK DST A   AW  AC   G+A + IP+GTF  G V+F+GPC     
Sbjct  28    VFDVTQYGAIADGKTDSTQAFSDAWKAACEFNGSASLAIPQGTFFVGPVIFRGPCYNNIS  87

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + ++I+GT+ A S L+ +TS  W    H+  + V GGG ++G+G + W        KN  
Sbjct  88    LSVQIQGTLKAPSRLNNFTSVGWLEFSHLDKLVVDGGGILDGQGAEAWNLTTCPGRKNCK  147

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP+S+ F  ++ + I ++  ++SKGFHM +   ++  V  L I+AP +S NTDGIHISG
Sbjct  148   NLPLSMRFCKISNAKIANLTLLDSKGFHMSIQKSSNVTVRNLNISAPENSHNTDGIHISG  207

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S N+++  L +GTGDDC+SIG G TN+ ++ V CGPGHGISIGSLGK   E +V G+ V+
Sbjct  208   SNNIDLATLTIGTGDDCISIGQGNTNVSISNVACGPGHGISIGSLGKYKNEKNVAGINVK  267

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR--KEASKV  366
             NCT++GT+NG RIKT+  +P  +AS IIFEDI+  NV+  IIIDQ+Y   +    E S V
Sbjct  268   NCTVLGTSNGIRIKTWPGAPPSEASDIIFEDIVTENVSNAIIIDQEYCPGHHCSNEPSGV  327

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             K+++V +R IRGT S K  A++ ICSQ VPCE+V L DI++
Sbjct  328   KIRNVTYRRIRGT-SNKAVAVNFICSQLVPCENVTLHDINL  367



>ref|XP_003519756.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Glycine max]
Length=416

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 239/372 (64%), Gaps = 8/372 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTA-K  1083
             IFDVTKFGA  D + D+  A   AW +AC +S   AKV+IP GTF A + +F GPCT+ K
Sbjct  44    IFDVTKFGAVADDQTDNIDAFRAAWGEACKNSTTQAKVLIPAGTFRAAQTMFAGPCTSPK  103

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN-  906
              I++E+ GT+ A++D S Y +  WF    + G+ +TG G  +G+G   W ++   K K  
Sbjct  104   PIIVEVIGTVKANTDPSEYVTPEWFSFLDIDGLVLTGNGVFDGQGAASWPYNDCAKTKGD  163

Query  905   -APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
              APL P SL F  VN S + DI  +NS  FH  +  C++F++S + ITAPG+SPNTDG+H
Sbjct  164   CAPL-PASLKFAKVNNSIVTDITSLNSMQFHFHIHGCSNFSLSNINITAPGNSPNTDGMH  222

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             IS S ++ V D V+GTGDDC+SIG  TTN+ +T +TCGPGHGIS+GSLGKR +E  V G+
Sbjct  223   ISSSDSIKVFDSVIGTGDDCISIGHSTTNIAITNITCGPGHGISVGSLGKRPEERSVNGI  282

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY--NSKNRKEA  375
             +V NCT + TTNGARIKT+  +   +A+ I +E +++  V  PIIIDQ Y  N K     
Sbjct  283   SVTNCTFVNTTNGARIKTWMGTVPAEATNITYEGLIMKGVQNPIIIDQSYGSNKKTTPST  342

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S  K+ ++ FR I+GT +  + A+SL CS + PCE VE+AD+D+  + G       + C 
Sbjct  343   SVWKISNIHFRKIQGT-TVSNIAVSLQCSTSNPCEGVEIADVDLAYSGGPHNTTFVSSCS  401

Query  194   NAETIVKGKRNP  159
             NA+ +  G  NP
Sbjct  402   NAKAVFGGILNP  413



>gb|KGN44733.1| hypothetical protein Csa_7G375750 [Cucumis sativus]
Length=725

 Score =   333 bits (855),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 240/370 (65%), Gaps = 4/370 (1%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
              ++FDVTK GAK DGK D   A    W  AC ++ G  K++IP+GT+L G +   GPC +
Sbjct  86    ESVFDVTKHGAKADGKTDDAQAFETTWIAACRNTVGPVKILIPKGTYLVGPMTLAGPCKS  145

Query  1085  KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I IE +G + A +DLS Y+S  WF IE + G  +TG G  +G+G  VW ++  +  K+
Sbjct  146   FPITIENQGIVKATTDLSEYSSPEWFSIEDITGFILTGSGVFDGQGTAVWAYNDCKSNKD  205

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
               LLP+S+ F G+N + +  I  +NSKGFHM + +C +F ++ + I AP +SPNTDGIH+
Sbjct  206   CQLLPISIKFSGLNHTIVDGITSLNSKGFHMSLFNCYNFTITNVNIIAPDESPNTDGIHL  265

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S  VN+ + ++GTGDDCVSIG  T  + VT VTCGPGHG+S+GSLGK ++E DV  V 
Sbjct  266   STSELVNIMNSIIGTGDDCVSIGHSTVKITVTNVTCGPGHGLSVGSLGKYSREKDVYDVL  325

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V+NCT+   TNGARIKT+ +     ASGIIFEDI+++NV  PIIIDQ Y++   KE SK 
Sbjct  326   VKNCTIFNATNGARIKTFASPISGLASGIIFEDIIMYNVKYPIIIDQTYSTDENKE-SKW  384

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK-PNKCVNA  189
             K+ DV F+NIRGT S  +  + L CS+ +PCE V L DI++        +    + C+NA
Sbjct  385   KVSDVHFKNIRGT-SATNVGVLLECSKLLPCEGVVLKDINLTYGGTDSKNTTIVSSCLNA  443

Query  188   ETIVKGKRNP  159
             +    G +NP
Sbjct  444   KITTFGVQNP  453



>ref|XP_004167141.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Cucumis sativus]
Length=453

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 240/372 (65%), Gaps = 10/372 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
             ++FDVTK GAK +GK D   A +  W  AC ++ G AK +IP+GTFL G V F GPC + 
Sbjct  82    SVFDVTKHGAKANGKTDDAQAFMTTWIAACRNTVGPAKFLIPQGTFLVGPVTFAGPCKSF  141

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
              I +E +GT+ A +D+S Y+S  WF IE + G  +TG G  +G+G  VW ++  +K    
Sbjct  142   PITLENQGTVKATTDISAYSSPEWFSIEDITGFILTGSGVFDGQGLSVWPYNDCKKNNLC  201

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LLP+S+ F  +N + +  +  VNS GFH  V  C +F  + ++I AP +SPNTDG+H+S
Sbjct  202   QLLPISIKFTRLNHTIVDGLTSVNSMGFHTSVFYCYNFTATNMKIIAPHNSPNTDGMHLS  261

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S  V + + V+GTGDDCVSIG    N+ VT VTCGPGHG+S+GSLGK ++E  V  V V
Sbjct  262   TSKLVTIANSVIGTGDDCVSIGHSAENITVTNVTCGPGHGLSVGSLGKYSKEKGVYDVLV  321

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVK  363
             +NCT+   TNGARIKT+ +     AS IIFEDI+++NV  PIIIDQ Y +K +KE S  K
Sbjct  322   KNCTIFNATNGARIKTWASPVSGLASRIIFEDIVMYNVKNPIIIDQTYGTKKKKE-SNWK  380

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP----NKCV  195
             + +V+F+NIRGT S  + A+ L CS+  PCE VEL DI++   +  G +L+     + C 
Sbjct  381   VSNVQFKNIRGT-STTNVAVLLECSKLFPCEGVELRDINL---SYGGTNLRNTTIVSSCS  436

Query  194   NAETIVKGKRNP  159
             NA+    G +NP
Sbjct  437   NAKIATFGVQNP  448



>ref|XP_004292668.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Fragaria 
vesca subsp. vesca]
Length=465

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 198/444 (45%), Positives = 260/444 (59%), Gaps = 56/444 (13%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPRG---------RGHTHT----IFDVTKFGAKPD----------  1221
             +IL+G+  LS   +   RG         R  T T    +FDVT FGAKP+          
Sbjct  19    IILVGLVFLSCMSDGASRGHLFGAGALRRSLTDTTNRKVFDVTAFGAKPESGKGRQMKEL  78

Query  1220  -GKGDST----------------MAMIRAWNKACHS--RGAAKVVIPRGTFLAGEVVFQG  1098
              G GD T                MA I+ W  AC    +G AKVV+P+GTFL G VVFQG
Sbjct  79    PGGGDPTKPQPDDGGDGDDNDTGMAFIKTWVAACRGEYKGPAKVVVPKGTFLIGPVVFQG  138

Query  1097  PCTAKR--IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDA  924
             PCT+ +  I++EI+G + A +DLS YTS  W   E+V G+ VTG G +NG+GE  W  + 
Sbjct  139   PCTSSKEPIMVEIQGEVKATTDLSDYTSPEWITFENVDGLIVTGDGVMNGQGEKTWNGNG  198

Query  923   DEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPN  744
              +K  + P  P ++ F  V  + I  I  +NSK FH  ++  +   +  + ITAPG+SPN
Sbjct  199   CDK-DDCPHAPSNMKFIKVKNALIEKITSLNSKYFHYHITVSSRVTIDSVHITAPGESPN  257

Query  743   TDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQET  564
             TDG HIS S NV V + ++GTGDDCVSIG G   + V  VTCGPGHGIS+GSLGK   E 
Sbjct  258   TDGCHISDSDNVKVINSIIGTGDDCVSIGKGARQITVNNVTCGPGHGISVGSLGKYKNEQ  317

Query  563   DVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK--  390
              V GVTV NC L+ TTNGARIKT+  +    ASGI F+++++ +V  PI+IDQ Y +K  
Sbjct  318   PVVGVTVTNCKLVNTTNGARIKTWANNYGGDASGITFDNLVMEHVKAPIVIDQSYGTKKD  377

Query  389   ----NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
                 N  + S  KL D+ FRNI+GT+S ++ A+SL CS T PCE VEL++IDI S  G  
Sbjct  378   PKNPNAGKQSLYKLHDIHFRNIKGTSS-QNVAMSLACSATKPCEGVELSEIDI-SYGGAS  435

Query  221   VHLKPN---KCVNAETIVKGKRNP  159
                K +   +C NA+   KGK NP
Sbjct  436   NSKKTDIASECYNAKVTTKGKINP  459



>ref|XP_002314373.2| hypothetical protein POPTR_0010s01470g [Populus trichocarpa]
 gb|EEF00544.2| hypothetical protein POPTR_0010s01470g [Populus trichocarpa]
Length=410

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 238/368 (65%), Gaps = 9/368 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-  1080
             +F+V ++GA P G+ D+ ++ IRAW  AC+ RG A+++IP+GTFL G  +FQGPC     
Sbjct  46    VFNVLRYGAHP-GREDNALSFIRAWKAACNYRGKARLLIPKGTFLIGATIFQGPCQGPAP  104

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             I ++I GT+ A  D S+Y  ++W + E++ G+ VTG GT++G+G  VW+++  +      
Sbjct  105   IKVQIAGTLKAVPDPSMYEEDFWILFENIKGLLVTGTGTVDGQGNAVWKYNVGD---GGA  161

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
               P S+ F  V    I  I  VN  GFH+ +    +     LRI AP DSPNTDGIHIS 
Sbjct  162   KFPSSIKFNHVVNGIIRQITSVNPMGFHISIVLSQNIKAKNLRIFAPSDSPNTDGIHISQ  221

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             +  V V++ V+GTGDDC+ I  G T++ +  VTCGPGHGISIGSLGK   E DV+G+TV+
Sbjct  222   TNQVYVSNSVIGTGDDCIGIIRGCTDVHIRNVTCGPGHGISIGSLGKYQDEEDVRGITVK  281

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCTL  T NG RIKTY  SP  +ASGI+F+DI++  V  PIIIDQ Y   N++ AS+V+L
Sbjct  282   NCTLNNTDNGIRIKTYGGSPPSQASGILFQDIVMVRVKNPIIIDQSYG--NKESASRVRL  339

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI-VSAAGKGVHLKPNKCVNAET  183
              DVR++NIRGT++     +++ CS TVPCE V L++I++    A +  H   + C NA+ 
Sbjct  340   SDVRYQNIRGTSTSV-VGVNIKCSNTVPCERVSLSNINLNYVGAKQHNHEISSVCTNAKL  398

Query  182   IVKGKRNP  159
                G + P
Sbjct  399   NYAGFQLP  406



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   320 bits (821),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 254/404 (63%), Gaps = 16/404 (4%)
 Frame = -1

Query  1361  ATMEIKAGIFVILLGIA--LLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIR  1188
             + M  +A IF+ LL +A  + + GV  I +         DV KFGAK DG+ D +  ++ 
Sbjct  3     SKMMARAAIFLYLLSLAAAMRTGGVSMIGQAE------IDVRKFGAKADGRSDDSQIIVN  56

Query  1187  AWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSN-YW  1011
             AWNKAC S   + VVI +G++LAG + FQGPC A  + ++++G + A +DL+ + S   W
Sbjct  57    AWNKACTSPSPSTVVISKGSYLAGPLKFQGPCKAD-VNLKVEGAVKAPADLNKFKSQGSW  115

Query  1010  FIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVN  831
              + +++ G+ ++GGG+ +G+G   W+ +   +      LP +L F  +N S + DI  +N
Sbjct  116   VLFQNIDGLTLSGGGSFDGQGAAAWKENNCAQTGKCNSLPTNLQFTSINNSHVQDITSLN  175

Query  830   SKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDG  651
             SK FH+++ +CN+  +  + I AP DS NTDGIH+  S  VN+    + TGDDCVS+GDG
Sbjct  176   SKLFHVELLNCNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNIIGADIRTGDDCVSLGDG  235

Query  650   TTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLK  471
             +  + +  VTCGPGHGIS+GSLGK   E  V GVTVRNCTL  T NG R+KT+  SP   
Sbjct  236   SQQVHIEGVTCGPGHGISVGSLGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGV  295

Query  470   ASGIIFEDIMLHNVTRPIIIDQD---YNSKNRKEASKVKLKDVRFRNIRGTASKKHPAIS  300
             ASG+ FEDI ++NV+ PI+IDQ+   YN+  +K  SKVK+ DV FRNIRGT++    A+ 
Sbjct  296   ASGMHFEDITVNNVSTPILIDQNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPL-AVK  354

Query  299   LICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGK  168
             L+CS+ VPC+ VELADI++      G     ++C N +  + GK
Sbjct  355   LVCSRGVPCQKVELADINLRYNGRNGT--ATSQCENVKPTIAGK  396



>ref|XP_007145196.1| hypothetical protein PHAVU_007G218300g [Phaseolus vulgaris]
 gb|ESW17190.1| hypothetical protein PHAVU_007G218300g [Phaseolus vulgaris]
Length=414

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/410 (45%), Positives = 247/410 (60%), Gaps = 24/410 (6%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPRGRG-------------HTHTIFDVTKFGAKPDGKGDSTMAMI  1191
             +  LGIALLS    CI   R              +   IFDVTKFGA  DGK D+  A  
Sbjct  7     IFFLGIALLS--CSCIGASRALETRRSLLLPILNNGPQIFDVTKFGAVADGKTDNIHAFR  64

Query  1190  RAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTA-KRIVIEIKGTMVADSDLSVYTSN  1017
              AW  AC +S   AKV+IP GT+   + +F GPC + K I +E+ GT+VA+++ S Y S 
Sbjct  65    AAWGAACKNSTTEAKVLIPEGTYRIAQTMFAGPCNSPKPITVEVIGTVVANTNPSQYVSP  124

Query  1016  YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN--APLLPVSLIFQGVNRSGIHDI  843
              WF  + + G+ +TG G  +G+G  +W  +  +K KN  APL P SL F  VN S +  I
Sbjct  125   EWFTFQDIDGLVLTGTGVFDGQGAAMWPLNDCKKNKNNCAPL-PASLKFYKVNNSMVTGI  183

Query  842   KFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVS  663
               +NS  FH  +  C++ ++S L ITAP +SPNTDG+HIS S  + V+  V+GTGDDC+S
Sbjct  184   TSLNSMQFHFHIHGCSNVSLSHLNITAPENSPNTDGMHISSSDMIRVSSSVIGTGDDCIS  243

Query  662   IGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRAS  483
             IG  TTNL +  +TCGPGHGIS+GSLGKR +E  V GVTV NCT + TTNGARIKT+  +
Sbjct  244   IGHSTTNLTIHDITCGPGHGISVGSLGKRPEEGSVNGVTVTNCTFVNTTNGARIKTWTGT  303

Query  482   PQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV--KLKDVRFRNIRGTASKKHP  309
               ++   I +E I++ +V  P+IIDQ Y S    E S    K+ DV FRNI+GT +  + 
Sbjct  304   VPMEIKNITYEGIIMKDVQNPVIIDQSYGSGLPGEPSTSVWKISDVHFRNIKGT-TVSNI  362

Query  308   AISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             A+SL CS   PC+ VE+AD+D+  A         + C+NA+ I  G  NP
Sbjct  363   AVSLQCSIRNPCQGVEVADVDLAYAGPLSTTFL-SSCLNAKAIFGGILNP  411



>gb|KHN08670.1| Galacturan 1,4-alpha-galacturonidase4 [Glycine soja]
Length=418

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 239/374 (64%), Gaps = 10/374 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGP--CTA  1086
             IFDVTKFGA  D + D+  A   AW +AC +S   AKV+IP GTF A + +F GP  CT+
Sbjct  44    IFDVTKFGAVADDQTDNIDAFRAAWGEACKNSTTQAKVLIPAGTFRAAQTMFAGPGPCTS  103

Query  1085  -KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
              K I++E+ GT+ A++D S Y +  WF    + G+ +TG G  +G+G   W ++   K K
Sbjct  104   PKPIIVEVIGTVKANTDPSEYVTPEWFSFLDIDGLVLTGNGVFDGQGAASWPYNDCAKTK  163

Query  908   N--APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                APL P SL F  VN S + DI  +NS  FH  +  C++F++S + ITAPG+SPNTDG
Sbjct  164   GDCAPL-PASLKFAKVNNSIVTDITSLNSMQFHFHIHGCSNFSLSNINITAPGNSPNTDG  222

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             +HIS S ++ V D V+GTGDDC+SIG  TTN+ +T +TCGPGHGIS+GSLGKR +E  V 
Sbjct  223   MHISSSDSIKVFDSVIGTGDDCISIGHSTTNIAITNITCGPGHGISVGSLGKRPEERSVN  282

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY--NSKNRK  381
             G++V NCT + TTNGARIKT+  +   +A+ I +E +++  V  PIIIDQ Y  N K   
Sbjct  283   GISVTNCTFVNTTNGARIKTWMGTVPAEATNITYEGLIMKGVQNPIIIDQSYGSNKKTTP  342

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
               S  K+ ++ FR I+GT +  + A+SL CS + PCE VE+AD+D+  + G       + 
Sbjct  343   STSVWKISNIHFRKIQGT-TVSNIAVSLQCSTSNPCEGVEIADVDLAYSGGPHNTTFVSS  401

Query  200   CVNAETIVKGKRNP  159
             C NA+ +  G  NP
Sbjct  402   CSNAKAVFGGILNP  415



>ref|XP_004298148.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/378 (46%), Positives = 237/378 (63%), Gaps = 7/378 (2%)
 Frame = -1

Query  1277  GRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSR--GAAKVVIPRGTFLAGEVVF  1104
             G   T  IF+V  FGA  +GK DS++++IR W  AC     G ++VVIP GTF AG V+F
Sbjct  51    GADPTEKIFNVLDFGAVTNGKKDSSLSLIRTWIAACRGTHTGKSRVVIPEGTFKAGPVIF  110

Query  1103  QGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             QGPCT+K+ I++EI+GT++  +DLS+Y    W +IE V GV VTG GT++G+G  VW+  
Sbjct  111   QGPCTSKKPIIVEIRGTVLGANDLSLYKEPSWILIERVDGVIVTGRGTLDGQGSSVWKHV  170

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                   N   LP +L F  V    I  I  ++ KG H+ +++  +  V  ++I AP  SP
Sbjct  171   ESCSGSNCSPLPPNLKFNRVTNGVIRGINSLHPKGVHIFITESQNIRVHWVQIEAPATSP  230

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIHIS S NV +    + TGDDCV +  G+TN+ + +V CGPGHGIS+GSLGK   E
Sbjct  231   NTDGIHISDSNNVRIARTRISTGDDCVGMIQGSTNIAINKVFCGPGHGISVGSLGKYETE  290

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY--NS  393
              DV+G+ V+NCT   T NG RIK++  S    A+G+IF D+++ NV  PIIIDQ+Y  N 
Sbjct  291   NDVRGIVVKNCTFNNTDNGIRIKSWPGSQPSLATGMIFRDLIMQNVKNPIIIDQEYGCND  350

Query  392   KNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHL  213
             K  K  SKVK+ +V + N++GT S    A+ LICS   PCED+EL DID+     K V  
Sbjct  351   KCNKAPSKVKISNVHYINVKGTTSSDI-AVDLICSSHSPCEDIELRDIDLKYVGPKKVRT  409

Query  212   KPNKCVNAETIVKGKRNP  159
               ++C NA+    G +NP
Sbjct  410   S-SQCKNAKIGYGGIQNP  426



>ref|XP_008353213.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=427

 Score =   319 bits (817),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 233/371 (63%), Gaps = 7/371 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA-KR  1080
             IF+V  FGAKPDG  D++M  I+ W  ACH+ G ++V+IP GT+ +G VVFQGPCT+ K 
Sbjct  55    IFNVVDFGAKPDGNHDASMNFIKTWLAACHNTGKSRVLIPPGTYKSGPVVFQGPCTSSKP  114

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQF--DADEKIKN  906
             +V+++ GT+   +DLS+Y   YWF+ E+V G+ + G G  +G+G   W+   D       
Sbjct  115   VVVQVLGTIKGLNDLSLYEEPYWFLFENVEGLVIIGNGIFDGQGSSAWKVAGDCGSSSDG  174

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP ++ F GV    I  I  +NSKG H+ ++D  +  V ++ I+AP  SPNTDGIHI
Sbjct  175   CSPLPSNIKFNGVRDGVIRGISSLNSKGVHLFITDSQNVRVRRVNISAPRTSPNTDGIHI  234

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S NV V    + TGDDC+ +  G+TN+ +  V CGPGHGIS+GSLGK   E DV G+T
Sbjct  235   SNSNNVKVARTHIATGDDCIGMIQGSTNIAINNVICGPGHGISVGSLGKYEHENDVTGIT  294

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK--NRKEAS  372
             V+  T + T NG RIK++  S   +ASG++F+DI++ NV  PIIIDQ+Y +   N+ + S
Sbjct  295   VKKTTFLNTDNGIRIKSWPGSGPSRASGMVFKDIIMQNVRNPIIIDQEYCTGGCNKNQPS  354

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
              V++ DV + NIRGT +  + A+  ICS  VPC++++L DID+         L  N C N
Sbjct  355   HVQISDVHYINIRGT-TPSNVAVDFICSSQVPCQNIQLHDIDLKYTGPNAAALT-NVCKN  412

Query  191   AETIVKGKRNP  159
              +   +G +NP
Sbjct  413   VKAGFRGIQNP  423



>ref|XP_004161670.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=453

 Score =   320 bits (819),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 171/372 (46%), Positives = 238/372 (64%), Gaps = 10/372 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
             ++FDVTK GAK DGK D   A +  W  AC ++ G  K +IP+ TFL G V F GPC + 
Sbjct  82    SVFDVTKHGAKADGKTDDAQAFMTTWIAACRNTVGPTKFLIPQRTFLVGPVTFAGPCKSF  141

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
              I +E +GT+ A  D+S Y+S  WF IE + G  +TG G  +G+G  VW ++  +K    
Sbjct  142   PITLENQGTVKATIDISAYSSPEWFSIEDITGFILTGSGVFDGQGLSVWPYNDCKKNNLC  201

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              +LP+S+ F  +N + +  +  +NS GFH  V  C +F  + ++I AP +SPNTDG+H+S
Sbjct  202   QILPISIKFTRLNHTIVDGLTSINSMGFHTSVFYCYNFTATNMKIIAPHNSPNTDGMHLS  261

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S  V + + V+GTGDDCVSIG  T N+ VT VTCGPGHG+S+GSLGK ++E  V  V V
Sbjct  262   TSKLVTIANSVIGTGDDCVSIGHSTENITVTNVTCGPGHGLSVGSLGKYSKEKGVYDVLV  321

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVK  363
             +NCT+   TNGARIKT+ +     AS IIFEDI+++NV  PIIIDQ Y +K +KE S  K
Sbjct  322   KNCTIFNATNGARIKTWASPISGLASRIIFEDIVMNNVKNPIIIDQTYGTKKKKE-SNWK  380

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP----NKCV  195
             + +V+F+NIRGT S  + A+ L CS+  PCE VEL DI++   +  G +L+     + C 
Sbjct  381   VSNVQFKNIRGT-STTNVAVLLECSKLFPCEGVELRDINL---SYGGTNLRNTTIVSSCS  436

Query  194   NAETIVKGKRNP  159
             NA+    G +NP
Sbjct  437   NAKIATFGVQNP  448



>ref|XP_007043095.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007043096.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX98926.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX98927.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=429

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 238/371 (64%), Gaps = 7/371 (2%)
 Frame = -1

Query  1274  RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             +G +  +F+V  FGA+ DG  D + A   AW KAC + G   +VIPRGT+L G V F GP
Sbjct  51    KGRSSHLFNVKSFGARADGLTDDSKAFRAAWKKACQATGEVDLVIPRGTYLVGPVKFAGP  110

Query  1094  CT-AKRIVIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDAD  921
             CT   +I + +KG + A ++LS Y  S  W   + V G+ +TGGGT +G+G   W ++  
Sbjct  111   CTNVSKITVRVKGYLKATTNLSQYGYSAGWVEFKWVEGLILTGGGTFDGQGAKAWPYNRC  170

Query  920   EKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNT  741
                 N  LLP ++ F G NR+ +  I  VNSK FHM + +C +F  SK++I+AP DSPNT
Sbjct  171   PTDFNCKLLPTNVKFVGTNRTVVRSITSVNSKFFHMALVECKNFKGSKIKISAPADSPNT  230

Query  740   DGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETD  561
             DGIHI  S++V+ +  ++GTGDDC+SIG G + + +T ++CGPGHGIS+GSLG+   E D
Sbjct  231   DGIHIERSSSVHFSRSLIGTGDDCISIGQGNSQVTITSISCGPGHGISVGSLGRYRNEGD  290

Query  560   VKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NS  393
             V G+ VR+CT+ GTTNG RIKT+  SP +  A+ + FE+I ++NVT PIIIDQ Y    S
Sbjct  291   VSGLVVRDCTITGTTNGIRIKTWANSPDRSAATNMTFENINMNNVTNPIIIDQAYCPFTS  350

Query  392   KNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHL  213
                   S+VKL D+ F+ I+GT+S    A++L CS+ +PC+D+ L D+ +  A+G+    
Sbjct  351   CTPMGTSQVKLSDIYFKKIKGTSSSA-VAVTLECSKGIPCQDIYLEDVHLDLASGEKQAT  409

Query  212   KPNKCVNAETI  180
                K V A+ I
Sbjct  410   STCKNVRAKYI  420



>gb|AAX45476.1| polygalacturonase [Lilium longiflorum]
 gb|AAZ91659.1| polygalacturonase [Lilium longiflorum]
Length=413

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 222/345 (64%), Gaps = 7/345 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              T  +V  FGA  DGK DST A++RAW++AC+  G  +V++P G +L G + F+GPC   
Sbjct  28    ETKVNVKSFGAVGDGKTDSTQAILRAWDQACNGFGKQRVIVPEGVYLTGPMAFRGPCNG-  86

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
              I ++++G + A  D+  Y +  W   E + G+ VTGGG  N +G   W  +     KN 
Sbjct  87    FISMQVRGELRAYGDVGKYPNAKWVSYEDLNGLLVTGGGRFNAQGSQAWTQNDCSTKKNC  146

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LL  S+ F     + I  I  ++SK FH+ +  C D  V  + ITAPG SPNTDGIHI 
Sbjct  147   ALLTTSVKFDHCTNATIRRINSIDSKFFHIAIDQCTDITVHHINITAPGTSPNTDGIHIG  206

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              STNVN+++ ++GTGDDC+S+G G++++ +++V CGPGHGIS+GSLG+   E +V  V V
Sbjct  207   RSTNVNISNAIIGTGDDCISLGPGSSHITISKVQCGPGHGISVGSLGRYMNEENVWDVKV  266

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQ-----DYNSKNRKE  378
             +NCTL GTTNG RIKT++ S   +AS  IF+DI +  V  PIIIDQ     DY + N   
Sbjct  267   KNCTLTGTTNGVRIKTWKGSSPSEASQFIFQDIEMREVQNPIIIDQEYCSYDYCANNPPA  326

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
              SKVKL D++F NI+GT++ K  AI+LICS  VPCE ++L+DI +
Sbjct  327   PSKVKLSDIQFMNIKGTSTSK-VAINLICSSAVPCEGIQLSDISL  370



>ref|XP_006845467.1| hypothetical protein AMTR_s00019p00130680 [Amborella trichopoda]
 gb|ERN07142.1| hypothetical protein AMTR_s00019p00130680 [Amborella trichopoda]
Length=383

 Score =   314 bits (805),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 228/342 (67%), Gaps = 5/342 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKR  1080
             +F+V +FGA  DG  D+T A   AW  AC  +G + +VIP GTFL G V+F+GPC  A  
Sbjct  13    VFNVMQFGAIADGTKDNTEAFGAAWKAACEWKGPSSLVIPEGTFLVGPVLFKGPCPNASP  72

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             +V+++KG + A +D+S Y S+ W + ++V G+ +TGGGT +G+G   W  +   K  +  
Sbjct  73    VVVQVKGKVKASTDMSKYPSDDWIVFQYVDGLLLTGGGTFDGQGASAWSLNQCPKKAHCK  132

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             LLP SL F  +    I  I  V+SK FHM +  C +  V  ++I+AP DSPNTDGIHI  
Sbjct  133   LLPTSLKFSFITNGAIRGINSVDSKLFHMLLFGCKNMEVQSIKISAPADSPNTDGIHIGS  192

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+N+ ++   +GTGDDC+S+G G+T + V  V CGPGHGIS+GSLGKR  E DV+G+ V+
Sbjct  193   SSNITISRSQIGTGDDCISLGPGSTQVTVDNVFCGPGHGISVGSLGKRPNEGDVEGLHVK  252

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQD---YNSKNRKEASK  369
             NCT+  TTNG RIKT+  S    AS   +EDI+++NV  PIIIDQ+   Y S + K  S+
Sbjct  253   NCTISDTTNGLRIKTWEDSDSSSASNFTYEDIVMNNVANPIIIDQEYCPYASCSHKGPSR  312

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             VK+ ++ F+NIRGT++ K  A++L+CS+  PCE+V+L DI +
Sbjct  313   VKINNISFKNIRGTSTSKV-AVNLLCSRAFPCENVKLDDIKL  353



>ref|XP_010556723.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Tarenaya 
hassleriana]
Length=421

 Score =   315 bits (808),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 238/372 (64%), Gaps = 11/372 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+T++GAK DG  DS  A + AW + C S   AK+V+P+GTFL G  VF GPC ++ 
Sbjct  49    TVFDITQYGAKGDGSTDSFKAFLSAWIQVCESSVPAKLVVPKGTFLTGPTVFAGPCKSQ-  107

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT+ A   ++ Y +  W + E V  + + GGGT +G+GE  W+  A +K  N  
Sbjct  108   VTVEVQGTVKATPGVAGYATPEWILFERVDNLVLNGGGTFDGQGEIAWRDHACKKRGNCK  167

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P S+ F+ +N + +H I  VNSK FHM +    +  +  + + AP  SPNTDGIH+S 
Sbjct  168   LPPTSIKFRRMNNTEVHHITSVNSKAFHMFLVKTINTTIHNVNLIAPDTSPNTDGIHLSN  227

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             +  V + D  +GTGDDCVS+G G+ N+ V RV CGPGHG SIGSLGK   E DV GVT+R
Sbjct  228   ADFVKILDSNIGTGDDCVSVGRGSNNVTVERVICGPGHGFSIGSLGKYKGEEDVTGVTIR  287

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+  T NGARIKT+  S   KAS I+FEDI+++NV  PIIIDQ+Y +  R  AS+V++
Sbjct  288   NCTMNNTDNGARIKTWGGSDASKASDIVFEDIIMNNVKNPIIIDQEYGT--RGGASRVEI  345

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK------C  198
              +V+F+NIRGT   K   +  +CS  VPC+++++ D+++ +  GK +  K         C
Sbjct  346   SNVKFKNIRGTTITKE-VVQFVCSSLVPCKEIKVVDVNL-AYTGKPLGRKAGGSIVGAIC  403

Query  197   VNAETIVKGKRN  162
              +A+ I  G+ N
Sbjct  404   NHADIIFGGRLN  415



>gb|KGN50738.1| hypothetical protein Csa_5G222970 [Cucumis sativus]
Length=422

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 237/372 (64%), Gaps = 13/372 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
             ++FDVTK GAK DGK D   A +  W  AC ++ G AK +IP+GTFL G V F GPC + 
Sbjct  54    SVFDVTKHGAKADGKTDDAQAFMTTWIAACRNTVGPAKFLIPQGTFLVGPVTFAGPCKSY  113

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
              I +E +GT+ A +D+S Y+S  WF +E + G  +TG G  +G+G  VW ++  +K    
Sbjct  114   PITLENQGTVKATTDISAYSSPEWFSLEDITGFILTGSGVFDGQGLSVWPYNDCKKNNLC  173

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LLP+S+ F  +N + +  +  +NS GFH  V  C +F  + ++I AP +SPNTDG+H+S
Sbjct  174   QLLPISIKFTRLNHTIVDGLTSINSMGFHTSVFYCYNFTATNMKIIAPHNSPNTDGMHLS  233

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S  V + + ++GTGDDCVSIG  T N+ VT VTCGPGHG+   SLGK ++E  V  V V
Sbjct  234   TSKLVTIANSIIGTGDDCVSIGHSTENITVTNVTCGPGHGL---SLGKYSKEKGVYDVLV  290

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVK  363
             +NCT+   TNGARIKT+ +     AS IIFEDI+++NV  PIIIDQ Y +K +KE S  K
Sbjct  291   KNCTIFNATNGARIKTWASPVSGLASRIIFEDIVMYNVKNPIIIDQTYGTKKKKE-SNWK  349

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP----NKCV  195
             + +V+F+NIRGT S  + A+ L CS+  PCE VEL DI++   +  G +L+     + C 
Sbjct  350   VSNVQFKNIRGT-STTNVAVLLECSKLFPCEGVELRDINL---SYGGTNLRNTTIVSSCS  405

Query  194   NAETIVKGKRNP  159
             NA+    G + P
Sbjct  406   NAKIATFGVQKP  417



>ref|XP_011091008.1| PREDICTED: exopolygalacturonase-like [Sesamum indicum]
Length=408

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/394 (43%), Positives = 248/394 (63%), Gaps = 8/394 (2%)
 Frame = -1

Query  1337  IFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRG  1158
             + V++L  AL+S        GR    T F+V  +GAKP  + +ST A ++AW  AC    
Sbjct  19    VLVLILCSALVSCHAAGGRAGRA-LFTTFNVLNYGAKPGKQQESTQAFVKAWRAACDFDR  77

Query  1157  AAKVVIPRGTFLAGEVVFQGPCTAKR-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVE  981
              A+++IP G +  GE +FQGPC ++  I I ++GT+ A SD+S Y    W   + V G+ 
Sbjct  78    EARILIPPGVYKLGETIFQGPCKSQTPITILLQGTLQAVSDISAYPDKGWISFDEVNGLI  137

Query  980   VTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSD  801
             +TGGGTI+G+G+D+W++D  +   +   L  S+    V  + +  I  +NS GFHM +++
Sbjct  138   LTGGGTIDGKGQDLWKYDDCKTNPDCTHLAASIYMTKVKNAKVKSINLINSMGFHMHITN  197

Query  800   CNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVT  621
                    +L+IT+  D PNTDG+HIS S  V V+  V  TGDDC+SIG G+ N+ + ++T
Sbjct  198   SYLVRFHRLKITSE-DGPNTDGMHISKSNTVKVSRSVFRTGDDCISIGQGSNNVTINKIT  256

Query  620   CGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIM  441
             CGPGHGIS+GSLGK A E DV+G+ V+NCTL+GTTNG RIKT+ AS   KASG++F+DI+
Sbjct  257   CGPGHGISVGSLGKVANELDVQGLIVQNCTLVGTTNGLRIKTFPASGPSKASGMLFKDII  316

Query  440   LHNVTRPIIIDQDYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             + NV  PIIIDQ+Y SK+ K  S+VK+ DV ++NIRGT +    A++L CS   PC+++ 
Sbjct  317   MENVKNPIIIDQNYGSKSTKP-SRVKISDVIYQNIRGT-TISPVAVNLKCSAQEPCKNIR  374

Query  260   LADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
               +I++   +   V    + C NA     G ++P
Sbjct  375   FHNINLRHTSNVRVS---STCTNAVVQRTGLQSP  405



>ref|XP_006442242.1| hypothetical protein CICLE_v10023493mg [Citrus clementina]
 gb|ESR55482.1| hypothetical protein CICLE_v10023493mg [Citrus clementina]
Length=396

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 173/374 (46%), Positives = 238/374 (64%), Gaps = 22/374 (6%)
 Frame = -1

Query  1337  IFVILLGIALLST---GVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACH  1167
             +F++ LG A+++    G++           IFDVTK+GA  DG+ D+T A +RAWN AC 
Sbjct  8     LFLMFLGFAVVTKVQGGIK-----------IFDVTKYGAIGDGRIDNTKAFLRAWNDACK  56

Query  1166  SRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTS-NYWFIIEHVA  990
               G + V+IPRGTFL G V F GPC  K    +IKG + A SDL   ++ + W    +V 
Sbjct  57    WDGNSGVLIPRGTFLLGTVTFTGPC-KKSTAFQIKGVIRAPSDLKRMSNPDQWIGFRYVD  115

Query  989   GVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMK  810
              + V G GT++G+G   W F++  +  N P LP+S++F  V  S I  I  VNSK  H+ 
Sbjct  116   RLLVNGRGTVDGQGASAWSFNSCAEDPNCPSLPISMVFNFVTNSRISGITSVNSKNAHIS  175

Query  809   VSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVT  630
             +  C+  ++  ++ITAP  SPNTDGI I  S  + +T   +GTGDDC+++  G+TN+ VT
Sbjct  176   LYGCHKVSIDNIKITAPYQSPNTDGIKIGDSKGIKITHSSIGTGDDCIALLSGSTNINVT  235

Query  629   RVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLK-ASGIIF  453
              V+CGPGHGIS+GSLG+ A E +V G+ VRNCT  GTTNG RIKT+ ASPQ   ASG  F
Sbjct  236   DVSCGPGHGISVGSLGRYANERNVHGLAVRNCTFRGTTNGVRIKTW-ASPQANVASGFTF  294

Query  452   EDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQT  282
             E+I + NV  PI+IDQ Y    S N+K  S V++KDV +RNI GT+S K  A++  CS+T
Sbjct  295   ENIFMSNVENPIVIDQMYCPHGSCNQKITSNVQIKDVTYRNIWGTSSTK-VAVNFQCSKT  353

Query  281   VPCEDVELADIDIV  240
              PCE++ L DI +V
Sbjct  354   FPCENIVLQDIYLV  367



>ref|XP_007224043.1| hypothetical protein PRUPE_ppa015208mg, partial [Prunus persica]
 gb|EMJ25242.1| hypothetical protein PRUPE_ppa015208mg, partial [Prunus persica]
Length=376

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/373 (44%), Positives = 238/373 (64%), Gaps = 7/373 (2%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSR-GAAKVVIPRGTFLAGEVVFQGPCT  1089
             T  IF+V   GAKPDG GDS++A I+ W  AC +  G ++VVIP+GTF  G V+FQGPC+
Sbjct  3     TEKIFNVLDHGAKPDGSGDSSIAFIQTWIAACRNHTGRSRVVIPKGTFKTGPVIFQGPCS  62

Query  1088  -AKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKI  912
              +K IV+++ GT+   +D+S+Y   +WF+ EHV G+ +TG G  +G+G   W+ + D   
Sbjct  63    CSKPIVVQVSGTIKGLNDISLYEEPFWFLFEHVEGLVLTGNGVFDGQGSSSWK-NIDGCS  121

Query  911   KNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGI  732
               +PL P S+ F GV    I  I  +NSKG H+ +++  +  V  + I+AP  SPNTDGI
Sbjct  122   SCSPL-PASIKFNGVKNGVIRGITSLNSKGVHVFLTNSQNIRVRGVNISAPDTSPNTDGI  180

Query  731   HISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKG  552
             HIS S N+ +  + +GTGDDC+ +  G+TN+ +  V CGPGHGISIGSLGK   E DV G
Sbjct  181   HISNSNNIKIARVHIGTGDDCIGMIQGSTNVAINNVVCGPGHGISIGSLGKYQNENDVTG  240

Query  551   VTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK--NRKE  378
             + V+  T + T NG RIK++  S   +ASG+IF+D+++ NV +PIIIDQ+Y +   N+ +
Sbjct  241   IIVKKTTFLNTDNGIRIKSWPGSTPSRASGMIFQDLIMQNVKKPIIIDQEYCAGGCNKNQ  300

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
              S+V++ +V + NI+GT + K  A+  ICS   PC++VEL DI++            + C
Sbjct  301   PSRVQISNVHYINIKGTTASKI-AVDFICSSQFPCKNVELRDINLNYIGPSNGGPITSIC  359

Query  197   VNAETIVKGKRNP  159
              NAE    G +NP
Sbjct  360   KNAEVGFGGIQNP  372



>ref|XP_009596400.1| PREDICTED: exopolygalacturonase-like [Nicotiana tomentosiformis]
Length=398

 Score =   312 bits (799),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 228/378 (60%), Gaps = 7/378 (2%)
 Frame = -1

Query  1286  IPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             I R       +F+V  +GAK DGK D++ A +  W  AC   G +K +IP G ++    +
Sbjct  16    ILRYSSAEEKLFNVQSYGAKADGKTDNSKAFLSTWKDACQWNGTSKFLIPSGEYMVYAAI  75

Query  1106  FQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             F GPC+   +  +I+G + A +D S++ ++ W   ++V G+E+ GGGT++G+G   W + 
Sbjct  76    FIGPCSGS-MTFQIQGVVKAPTDPSLFCNSTWISFQYVNGLEIEGGGTLDGQGASAWPYF  134

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                K  N P LPV L    +  + +HDI  +NSK FH  +  CN+   S + +TAPGDSP
Sbjct  135   DTSKNSNCPTLPVILKLDFIKNAVVHDIHSINSKSFHFDLFMCNNVTFSHVNLTAPGDSP  194

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIH+  STN+ V D  +GTGDDC+S+ +G+ ++ ++ +TCGPGHGISIGSLGK   E
Sbjct  195   NTDGIHMGVSTNIQVLDSNIGTGDDCISMINGSQSINISGITCGPGHGISIGSLGKTQNE  254

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY--NS  393
               V  + V+NCTLI T NGARIKT+  S    A+ I FEDI + NV  PIIIDQ Y  + 
Sbjct  255   V-VTDIHVKNCTLISTQNGARIKTWAPSESGSATSINFEDIFMDNVRNPIIIDQHYCPSP  313

Query  392   KNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHL  213
                 EAS V++KDV F NIRGT+S    A++L CS + PC+ + L +I++V     G  +
Sbjct  314   PCSSEASSVQIKDVTFNNIRGTSSSVE-AVTLNCSASFPCQGINLTEINLVYNGAGGPAI  372

Query  212   KPNKCVNAETIVKGKRNP  159
                 C NA+    G   P
Sbjct  373   S--SCDNAQGTATGMELP  388



>ref|XP_008235125.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=483

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/365 (46%), Positives = 234/365 (64%), Gaps = 16/365 (4%)
 Frame = -1

Query  1211  DSTMAMIRAWNKAC--HSRGAAKVVIPRGTFLAGEVVFQGPCTAKR--IVIEIKGTMVAD  1044
             D+  A I+ W  AC  +  G  KV+IP+GTF+ G V+FQGPCT+ +  I++E++G + A 
Sbjct  117   DNASAFIKTWVAACRGNYSGPTKVLIPKGTFMTGPVIFQGPCTSSKEPIIVEVEGYVKAS  176

Query  1043  SDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVN  864
             +DLS+Y S  WF  E + G+ VTG GT +G+GE  W+    +   +    P SL F  VN
Sbjct  177   TDLSLYASPEWFTFEMIDGLIVTGEGTFDGQGESTWKSSGCKDKSSCAQAPSSLKFNHVN  236

Query  863   RSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVG  684
              + +  I  +NSK FH  +  C++  ++ + ITAP DSPNTDG+HIS STNV V + V+G
Sbjct  237   NTLVEGITSLNSKFFHAHIYGCSNLTMNNVHITAPDDSPNTDGVHISTSTNVKVLNSVIG  296

Query  683   TGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGAR  504
             TGDDCVSIG G+ ++LV  +TCGPGHGIS+GSLGKR  +  V  + V NCTL  TTNGAR
Sbjct  297   TGDDCVSIGQGSNDILVNNITCGPGHGISVGSLGKRIDDKSVSQIHVSNCTLRNTTNGAR  356

Query  503   IKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKE--------ASKVKLKDVR  348
             IKT+ A    +AS I +E+I++  V  PI+IDQ+Y  K  K         ASK K+ +V 
Sbjct  357   IKTWAAESGGEASDITYENIVMDQVQIPIVIDQNYGKKKPKSGTGPVGGAASKWKISNVH  416

Query  347   FRNIRGTASKKHPAISLICSQTVPCEDVELADIDI--VSAAGKGVHLKPNKCVNAETIVK  174
             FRNIRGT+S ++ A+SL CS + PC+ +E+ADI+   + AA K   L   +C NA+   K
Sbjct  417   FRNIRGTSS-RNIAVSLQCSSSNPCDGIEMADINFSYLGAAVKDTALT-TECYNAKIAPK  474

Query  173   GKRNP  159
             G + P
Sbjct  475   GVQIP  479



>ref|XP_006489253.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=444

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/348 (45%), Positives = 224/348 (64%), Gaps = 11/348 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDVT +GA+PDG+ +++   + AWN AC   G +   IP GTFL G V   GPC   + 
Sbjct  69    LFDVTDYGAEPDGETETSSPFLEAWNAACSHNGDSTFYIPEGTFLLGPVSITGPCHNNQP  128

Query  1076  V-IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGG----TINGRGE-DVWQFDADEK  915
               I IKGT++A  +LS +    W + + + G+ ++GG      I+ +GE + W+ ++  K
Sbjct  129   PKIVIKGTLMAPPNLSAFPDTNWIVFQDLHGINISGGNGEVPNIDAQGEVEAWKRNSCSK  188

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
              +    L  SL F  V+   I +I   NSKGFH+   DC++ NV  + I++PGDSPNTDG
Sbjct  189   SEKCNKLITSLRFNNVSHGTISNIAVSNSKGFHVAFLDCDNINVYNVSISSPGDSPNTDG  248

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+  STN+N+T   +G GDDC+SIG G++N+ V  V CGPGHGISIGSLGK   E DV 
Sbjct  249   IHVGMSTNINITSSNIGAGDDCISIGPGSSNISVADVKCGPGHGISIGSLGKYTDEEDVV  308

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY----NSKN  387
             G+ VRNCT+ GT NG R+KT+  +P  +AS ++F DI++ NV+ PIIIDQ+Y    + K+
Sbjct  309   GINVRNCTITGTQNGVRVKTWPGAPASRASNLMFTDIVMINVSNPIIIDQEYCPSNSCKS  368

Query  386   RKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
               E S VKL ++ F+NI GT + +   ++LICS  VPCE++ L DI++
Sbjct  369   TSEPSLVKLSNIHFKNISGTYNTES-GVTLICSSGVPCENIHLIDINL  415



>ref|XP_009767891.1| PREDICTED: exopolygalacturonase-like [Nicotiana sylvestris]
Length=398

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 233/394 (59%), Gaps = 10/394 (3%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGA  1155
             F+   GIA +   +  I         +F+V  +GA  DGK D++ A +  W  AC   G 
Sbjct  3     FISSFGIAFV---LYLILGCSSAEENLFNVQSYGAIADGKTDNSKAFLSTWKDACQWNGT  59

Query  1154  AKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVT  975
             AK +IP G ++     F GPC+   +  +I+G + A +D S++ +  W  I++V G+E+ 
Sbjct  60    AKFLIPSGEYMVYAANFIGPCSGS-MTFQIQGVVKAPTDPSLFCNTTWISIQYVNGLEIE  118

Query  974   GGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCN  795
             GGGT++G+G   W +    K  N P LP++L    +  + +HDI  +NSK FH  +  CN
Sbjct  119   GGGTLDGQGASAWPYFDTSKNSNCPTLPITLKLDFIENATVHDINSINSKSFHFDLFRCN  178

Query  794   DFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCG  615
             +   S + +TAPGDSPNTDGIH+  STN+ V+D  +GTGDDC+S+ +G+ ++ ++ +TCG
Sbjct  179   NVTFSHVNLTAPGDSPNTDGIHMGVSTNIQVSDSNIGTGDDCISMINGSQSINISGITCG  238

Query  614   PGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLH  435
             PGHGISIGSLGK   E  V  + V+NCTLI T NGARIKT+  S    A+ I FEDI + 
Sbjct  239   PGHGISIGSLGKTQNEV-VTDIHVKNCTLIATQNGARIKTWAPSESGSATNINFEDIFMD  297

Query  434   NVTRPIIIDQDY--NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             NV  PIIIDQ Y  +     EAS V++KDV F NIRGT+S    A++L CS + PC+ + 
Sbjct  298   NVRNPIIIDQHYCPSPPCSSEASSVQIKDVTFNNIRGTSSSV-AAVTLNCSASFPCQGIN  356

Query  260   LADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             L +I++V     G  +    C NA     G   P
Sbjct  357   LTEINLVYNGAGGPAIS--SCDNANGTATGTELP  388



>ref|XP_009109724.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Brassica 
rapa]
 gb|ABW24665.1| pollen-specific polygalacturonase [Brassica rapa subsp. oleifera]
 emb|CDX90151.1| BnaA08g18330D [Brassica napus]
Length=421

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/370 (45%), Positives = 230/370 (62%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TK GA  +G  DS+ A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVFDITKNGAVGNGATDSSKAFLNTWLQVCASPVPATLLVPKGDFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT++A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   K  N  
Sbjct  109   VTVEVQGTIIAPP--SGYPTPEWFLFEHVDNVVLTGPGTFHGKGEAVWKADGCGKKLNCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + NV  ++I AP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNILNLDISGISSVNAKAFHMFLVKTTNVNVQNIKIIAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D ++ TGDDC+S+G G+TN+ V RVTCGPGHG+S+GSLGK   E +V G+  R
Sbjct  227   AVNVHIADSLIATGDDCISVGRGSTNVTVERVTCGPGHGLSVGSLGKYPNEENVAGIHFR  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+  T NG RIK++  S    A  I +EDIM+ NV  PIIIDQ+Y S  R   SKV +
Sbjct  287   NCTMKDTDNGLRIKSWGGSSPSTAVDITYEDIMMTNVKNPIIIDQNYGS--RGGDSKVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              +V F+N+RGT   K   +  +CS++VPC+ V + D+++     KG H      L    C
Sbjct  345   SNVLFKNVRGTTITKD-EVQFMCSKSVPCKGVSVVDVELNFVGDKGGHPSSSGGLVGALC  403

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  404   TNANVIFGGK  413



>ref|XP_006477959.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=443

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/344 (49%), Positives = 225/344 (65%), Gaps = 8/344 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GA  DG+ D+T A  RAWN AC   G + V+IPRGTFL G + F GPC  K  
Sbjct  74    IFDVTKYGAIGDGRIDNTKAFFRAWNDACKWDGNSGVLIPRGTFLLGTITFTGPC-KKST  132

Query  1076  VIEIKGTMVADSDLSVYTS-NYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
               +IKG + A S+L   T+ + W    +V  + V G GT++G+G+  W F++  +  N P
Sbjct  133   AFQIKGVIRAPSNLKRMTNPDQWIGFRYVDRLLVNGRGTVDGQGDSAWSFNSCAEDPNCP  192

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP+S++F  V  S I  I  VNSK  H+ +  C+  ++  ++ITAP  SPNTDGI I  
Sbjct  193   SLPISMVFNFVTNSRISGITSVNSKNAHISLYGCHKVSIDNIKITAPYQSPNTDGIKIGD  252

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S  + +T   +GTGDDC+++  G+TN+ VT VTCGPGHGIS+GSLG+ A E +V G+ VR
Sbjct  253   SKGIKITHSSIGTGDDCIALLSGSTNINVTDVTCGPGHGISVGSLGRYANERNVHGLAVR  312

Query  539   NCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEAS  372
             NCT  GTTNG RIKT+ ASPQ   ASG  FE+I + NV  PI+IDQ Y    S N+K  S
Sbjct  313   NCTFRGTTNGVRIKTW-ASPQANVASGFTFENIFMSNVENPIVIDQMYCPHGSCNQKITS  371

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIV  240
              V++KDV +RNI GT+S K  A++  CS+T PCE++ L DI +V
Sbjct  372   NVQIKDVTYRNIWGTSSTK-VAVNFQCSKTFPCENIVLQDIYLV  414



>ref|XP_008386673.1| PREDICTED: exopolygalacturonase-like isoform X2 [Malus domestica]
Length=495

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 238/379 (63%), Gaps = 21/379 (6%)
 Frame = -1

Query  1250  DVTKFGAKPDGKGDSTMAMIRAWNKAC--HSRGAAKVVIPRGTFLAGEVVFQGPC--TAK  1083
             D T  G  P+ +  S  A IR W  AC  +  G  KVVIP+GTFL G VVFQGPC  + +
Sbjct  119   DETGAGESPEEENGS--AFIRTWVAACRGNYSGPTKVVIPKGTFLIGPVVFQGPCNSSTE  176

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
              IV+E++G + A +DLS Y+   WF  E V G+ +TG GT +G+G++VW+   +++  +A
Sbjct  177   PIVVEVQGYVKASTDLSQYSXPEWFTFELVDGLIITGDGTFDGQGQNVWKTRDNKESSSA  236

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
                P SL F  VN + I  I  +NSK FH  +  C +  +S + + APGDSPNTDG+HIS
Sbjct  237   SNAPSSLKFNKVNNTLIEGITSLNSKFFHTHMFGCKNVTMSNVHLIAPGDSPNTDGLHIS  296

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S+ + V + V+ TGDDCVSIG G+ ++ V  VTCGPGHGISIGSLGK A E  V  + V
Sbjct  297   TSSQIKVLNSVMATGDDCVSIGQGSHDITVKNVTCGPGHGISIGSLGKYADELSVSQIYV  356

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKE-----  378
              NCT   TTNGARIKT+      +A+GII+EDI++  V  PIIIDQ+Y +K ++      
Sbjct  357   SNCTFRNTTNGARIKTWAGESAGEATGIIYEDIIMDQVQNPIIIDQNYGAKKKEAAGPPS  416

Query  377   --ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP-  207
               ASK K+ DV FRNIRGT S ++ A+SL CS   PCE VEL DI+    + +G   K  
Sbjct  417   GPASKWKISDVHFRNIRGT-SARNVAVSLACSSAKPCEGVELTDINF---SYQGTSTKST  472

Query  206   ---NKCVNAETIVKGKRNP  159
                ++C NA+   KG +NP
Sbjct  473   ALTSECFNAKITSKGVQNP  491



>ref|XP_002314372.2| hypothetical protein POPTR_0010s01460g [Populus trichocarpa]
 gb|EEF00543.2| hypothetical protein POPTR_0010s01460g [Populus trichocarpa]
Length=409

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 167/367 (46%), Positives = 232/367 (63%), Gaps = 9/367 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK-R  1080
             +F+V ++GAKP GK DS ++ IRAW  AC+ RG A+++IP GTFL G  +FQGPC     
Sbjct  47    VFNVLQYGAKPGGKQDSALSFIRAWRAACNYRGTARLLIPMGTFLIGATIFQGPCLGPVP  106

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             I ++I GT+ A  D S+Y  ++W + E + G+ VTG GT++G+G  VW+++         
Sbjct  107   IKVQIAGTLKAVPDPSMYEEDFWILFEKINGLLVTGTGTVDGQGNAVWKYN-----DGGS  161

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
               P S+ F  V    I  I  VN  GFH+ +    +     L ITAP  SPNTDGIHIS 
Sbjct  162   RFPSSIKFNHVVNGIIRQITSVNPMGFHISIVLSQNIRAKNLHITAPATSPNTDGIHISQ  221

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ V V+  V+ TGDDCV+I  G+T++ + +VTCGPGHG S+GSLGK   E DV+GV V 
Sbjct  222   SSVVKVSRSVISTGDDCVAIIQGSTDVSIKKVTCGPGHGFSVGSLGKYPDEKDVRGVVVT  281

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCTL    NG RIKT+  SP  +AS I+F+DI++ NV RPIIIDQ Y SK+    S+VK+
Sbjct  282   NCTLRNADNGVRIKTWGGSPPSQASNILFQDIIMDNVKRPIIIDQTYGSKS-NSPSRVKI  340

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETI  180
              DVR+ NIRGT++    A+ L+CS+TVPCE +  ++I++     K +    + C NA+  
Sbjct  341   SDVRYINIRGTSASAV-AVDLMCSKTVPCEKLYFSNINLKYYGQKKLPFT-STCTNAKVN  398

Query  179   VKGKRNP  159
               G + P
Sbjct  399   YAGYQFP  405



>ref|XP_010530386.1| PREDICTED: exopolygalacturonase [Tarenaya hassleriana]
Length=428

 Score =   311 bits (796),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 238/382 (62%), Gaps = 9/382 (2%)
 Frame = -1

Query  1280  RGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQ  1101
             R R     I +V  +GA+ D + D++ A + AWNKAC + G+  +VIP+G +  G + F 
Sbjct  44    RNRRINSVIVNVHSYGARADARTDNSKAFLAAWNKACKASGSVVLVIPKGVYSLGPLRFA  103

Query  1100  GPC-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             GPC     I + +KG + A +DLS Y S   W     + G+ +TGGGT +G+G   W F+
Sbjct  104   GPCRNVSDITVHLKGHLKAVTDLSKYRSGTGWIEFGWIDGLTLTGGGTFDGQGASAWPFN  163

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                   N  LLP ++ F G+NR+ I  I  VNSK FH+ + +C DF  ++++I+AP DSP
Sbjct  164   GCPTDFNCKLLPTNVKFVGMNRTVIRGITSVNSKFFHIALVECRDFKGTRIKISAPSDSP  223

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDG+HI  S+NV  +   + TGDDCVSIG G + + +T + CGPGHGIS+GSLG+   E
Sbjct  224   NTDGVHIERSSNVYFSRSSIATGDDCVSIGQGNSQITITSIRCGPGHGISVGSLGRYPNE  283

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASPQL-KASGIIFEDIMLHNVTRPIIIDQDY---  399
              DVKG+ VR+C +IGTTNG RIKT+  SP L  A+ + F++I+++NVT PIIIDQ Y   
Sbjct  284   KDVKGLVVRDCRMIGTTNGIRIKTWANSPGLSSATNMTFKNIIMNNVTNPIIIDQSYCPF  343

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADI--DIVSAAGK  225
             +S   K  S+VKL D+ F+NIRGT+S    A+ L CS+ +PC++V L ++  D+ S+ G+
Sbjct  344   SSCTSKVPSRVKLSDIYFKNIRGTSSSAI-AVQLHCSRGMPCQNVYLENVHLDLSSSGGR  402

Query  224   GVHLKPNKCVNAETIVKGKRNP  159
                   + C N      G + P
Sbjct  403   RQASASSSCRNVRAKYIGTQIP  424



>ref|XP_010251320.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=399

 Score =   310 bits (793),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 224/349 (64%), Gaps = 6/349 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRI  1077
             FDV K+GA+ DG  D + A + AW  AC S GA KV+IP+  ++ G V F GPC   K I
Sbjct  28    FDVVKYGARGDGVHDDSKAFLAAWKAACESSGAVKVLIPKANYMVGPVKFYGPCDKVKSI  87

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              + +KG + A +DL  Y +  W     V G+ +TGGGT +G+G   W F++    KN  +
Sbjct  88    TVYMKGYLKATTDLKDYGTYDWITFGFVEGLTLTGGGTFDGQGAASWSFNSCRLKKNCQV  147

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  +N + +  I  +NSK FHM + DCN+F    L+ITAP  SPNTDGIHI  S
Sbjct  148   LPTNLKFVSLNDTVVRGITSLNSKFFHMGLVDCNNFMGRDLKITAPETSPNTDGIHIERS  207

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             T V+V   ++GTGDDC+SIG  + ++ ++ VTCGPGHGISIGSLG+  +E DV G+ V++
Sbjct  208   TTVSVYSSIIGTGDDCISIGHSSYDITISGVTCGPGHGISIGSLGRYEKEKDVNGIVVKD  267

Query  536   CTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQD---YNSKNRKEASK  369
             CT+  T NG RIKT+  SP   +AS + F +I++H V+ PIIIDQ    Y S     +S+
Sbjct  268   CTITETMNGVRIKTWEDSPVGSQASNMTFNNIVMHRVSNPIIIDQTYCPYTSCTSASSSR  327

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
             VKLKD+ F+NIRGT++    A+ L CS+ +PCE+V L +I +  + G G
Sbjct  328   VKLKDIYFKNIRGTSTTP-VAVLLECSKGLPCENVFLENIHLELSPGGG  375



>ref|XP_009417454.1| PREDICTED: exopolygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=398

 Score =   309 bits (792),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 232/368 (63%), Gaps = 4/368 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFD   F A  DG+ D   A++ AW+ AC  R  A  VIP+ TFLAG   F+GPC     
Sbjct  28    IFDPMDFEAMGDGETDDGQALVDAWDSACEHRAPAIFVIPKRTFLAGPATFEGPCRVTPK  87

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             V +I GT+ A   ++ Y +  WF  +H+ G+E+ GGGT++G+G   W        ++   
Sbjct  88    V-QILGTVKAVPSMNDYYNPGWFEFKHLNGLEIGGGGTLDGQGAASWNKTNCPPKRSCKS  146

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+S+    V+ + I ++ F+NSKGFH+ +   +   +S+LRI+AP DSPNTDGIHIS S
Sbjct  147   LPISMRLLRVSNATISNLTFMNSKGFHIGLQQSSSVTISRLRISAPADSPNTDGIHISRS  206

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              NV +T L +GTGDDC+SIG G  NL ++ VTCGPGHGIS+GSLGK   E DV GV+VRN
Sbjct  207   DNVMLTSLNIGTGDDCISIGQGVNNLQISDVTCGPGHGISVGSLGKYMNEEDVSGVSVRN  266

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR--KEASKVK  363
             CT+ GTTNG RIKT+  SP  +AS   FEDI++HNV+ PIIIDQ Y   +      S+VK
Sbjct  267   CTVSGTTNGVRIKTWPGSPPSQASNFTFEDIIMHNVSNPIIIDQHYCPDHDCVVSPSRVK  326

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAET  183
             +++V FR I+GT S    A+ L+CS+T+ CE+V L DI ++           + C N + 
Sbjct  327   IQNVTFRRIQGT-SNDPVAVKLMCSETMACENVHLQDISLIMENNTATSNITSSCSNVKG  385

Query  182   IVKGKRNP  159
             +  G +NP
Sbjct  386   VAVGLQNP  393



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   309 bits (792),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 229/369 (62%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  +
Sbjct  24    VFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-V  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               E++GT+ A +D S++ ++ W + +H+ G+ ++GGGT +G+G+  W  +   K  N   
Sbjct  83    EFELQGTLKAPTDPSLFKTDGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   N+ +A   S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+ IRGT S    A+ ++CSQ+VPC++VE+ADID+V    +G     ++C N +
Sbjct  323   KISKVSFKKIRGT-SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPAT--SECANVK  379

Query  185   TIVKGKRNP  159
              ++ GK NP
Sbjct  380   PVLSGKLNP  388



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   309 bits (792),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 229/369 (62%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  +
Sbjct  24    VFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-V  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               E++GT+ A +D S++ ++ W + +H+ G+ ++GGGT +G+G+  W  +   K  N   
Sbjct  83    EFELQGTLKAPADPSLFKTDGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   N+ +A   S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+ IRGT S    A+ ++CS++VPCE+VE+ADID+V    +G     ++C N +
Sbjct  323   KISKVSFKKIRGT-SASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPAT--SECANVK  379

Query  185   TIVKGKRNP  159
              ++ GK NP
Sbjct  380   PVLSGKLNP  388



>ref|XP_007224662.1| hypothetical protein PRUPE_ppa026115mg, partial [Prunus persica]
 gb|EMJ25861.1| hypothetical protein PRUPE_ppa026115mg, partial [Prunus persica]
Length=376

 Score =   308 bits (790),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 237/373 (64%), Gaps = 7/373 (2%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSR-GAAKVVIPRGTFLAGEVVFQGPCT  1089
             T  IF+V   GAKPDG GDS++A I+ W  AC +  G ++VVIP+GTF  G V+FQGPC+
Sbjct  3     TEKIFNVLDHGAKPDGSGDSSIAFIQTWIAACRNHTGRSRVVIPKGTFKTGPVIFQGPCS  62

Query  1088  -AKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKI  912
              +K IV+++ GT+   +D+S+Y   +WF+ E V G+ +TG G  +G+G   W+ + D   
Sbjct  63    CSKPIVVQVSGTIKGLNDISLYEEPFWFLFERVEGLVLTGNGVFDGQGSSSWK-NIDGCS  121

Query  911   KNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGI  732
               +PL P S+ F GV    I  I  +NSKG H+ +++  +  V  + I+AP  SPNTDGI
Sbjct  122   SCSPL-PASIKFNGVKNGVIRGITSLNSKGVHVFLTNSQNIRVRGVNISAPDTSPNTDGI  180

Query  731   HISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKG  552
             HIS S N+ +  + +GTGDDC+ +  G+TN+ +  V CGPGHGISIGSLGK   E DV G
Sbjct  181   HISNSNNIKIARVHIGTGDDCIGMIQGSTNVAINNVVCGPGHGISIGSLGKYQNENDVTG  240

Query  551   VTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK--NRKE  378
             + V+  T + T NG RIK++  S   +ASG+IF+D+++ NV +PIIIDQ+Y +   N+ +
Sbjct  241   IIVKKTTFLNTDNGIRIKSWPGSTPSRASGMIFQDLIMQNVKKPIIIDQEYCAGGCNKNQ  300

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
              S+V++ +V + NI+GT + K  A+  ICS   PC++VEL DI++            + C
Sbjct  301   PSRVQISNVHYINIKGTTASKI-AVDFICSSQFPCKNVELRDINLNYIGPSNGGPITSIC  359

Query  197   VNAETIVKGKRNP  159
              NAE    G +NP
Sbjct  360   KNAEVGFGGIQNP  372



>ref|XP_011006455.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=409

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/367 (46%), Positives = 231/367 (63%), Gaps = 9/367 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK-R  1080
             +F+V ++GAKP GK DS ++ IRAW  AC+ RG A+++IPR TFL G  +FQGPC     
Sbjct  47    VFNVLQYGAKPGGKQDSALSFIRAWRAACNYRGTARLLIPRATFLIGATIFQGPCLGPVP  106

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             I ++I GT+ A +D S+Y  ++W + E + G+ VTG GT++G+G  VW+++         
Sbjct  107   IKVQIAGTLKAVADPSMYEEDFWILFEKINGLLVTGTGTVDGQGNAVWKYN-----DGGS  161

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
               P S+ F  V    I  I  VN  GFH+ +    +     L ITAP  SPNTDGIHIS 
Sbjct  162   RFPSSIKFNHVVNGIIRQITSVNPMGFHISIVLSQNIRAKHLHITAPAMSPNTDGIHISQ  221

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ V V+  V+ TGDDCV+I  G+T++ + +VTCGPGHG S+GSLGK   E DV+GV V 
Sbjct  222   SSVVKVSRSVISTGDDCVAIIQGSTDVSIKKVTCGPGHGFSVGSLGKYPDEKDVRGVVVT  281

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCTL    NG RIKT+  SP  +AS I+F+DI++ NV RPIIIDQ Y SK+    S+VK+
Sbjct  282   NCTLRNADNGVRIKTWGGSPPSQASNILFQDIIMDNVKRPIIIDQTYGSKS-NSPSRVKI  340

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETI  180
              DVR+ NIRGT S     + L+CS+TVPCE +  ++I++     K +    + C NA+  
Sbjct  341   SDVRYINIRGT-SASAVGVDLMCSKTVPCEKLYFSNINLKYYGQKKLPFT-STCTNAKVN  398

Query  179   VKGKRNP  159
               G + P
Sbjct  399   YAGYQFP  405



>ref|XP_002315493.2| hypothetical protein POPTR_0010s00940g [Populus trichocarpa]
 gb|EEF01664.2| hypothetical protein POPTR_0010s00940g [Populus trichocarpa]
Length=408

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 234/376 (62%), Gaps = 10/376 (3%)
 Frame = -1

Query  1283  PRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVF  1104
             PR R     +F+V ++GAKP GK DS ++ IRAW  AC+ RG A+++IP GTFL G  +F
Sbjct  38    PR-RDPNEKVFNVLQYGAKPGGKQDSALSFIRAWRAACNYRGTARLLIPMGTFLVGATIF  96

Query  1103  QGPCTAK-RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             QGPC     I ++I GT+ A  D S+Y  ++W + E++ G+ VTG GT++G+G  VW+++
Sbjct  97    QGPCLGPVPIKVQIAGTLKAVPDPSMYEEDFWILFENINGLLVTGTGTVDGQGNAVWKYN  156

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                        P S+ F  V    I  I  VN  GFH+ +    +     L ITAP  SP
Sbjct  157   -----DGGSRFPSSIKFNHVANGIIRQITSVNPMGFHISIVLSQNIRAKHLHITAPATSP  211

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIHIS S+ V V+  V+ TGDDCV+I  G+T++ V +VTCGPGHG S+GSLGK   E
Sbjct  212   NTDGIHISQSSVVKVSRSVISTGDDCVAIIQGSTDVSVKKVTCGPGHGFSVGSLGKYPDE  271

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN  387
              DV+GV V NCTL    NG RIKT+  SP  +AS I+F+DI++ NV RPIIIDQ Y SK+
Sbjct  272   KDVRGVVVTNCTLRNADNGVRIKTWGGSPPSQASNILFQDIIMDNVKRPIIIDQTYGSKS  331

Query  386   RKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP  207
                 S+VK+ DVR+ NIRGT++ +   + L CS+ VPCE +  ++I++     K +    
Sbjct  332   -NSPSRVKISDVRYINIRGTSASEV-GVDLKCSEAVPCEKLYFSNINLKYYGPKKLPFT-  388

Query  206   NKCVNAETIVKGKRNP  159
             + C NA+    G + P
Sbjct  389   STCTNAKVNYVGNQFP  404



>gb|EPS67111.1| hypothetical protein M569_07664 [Genlisea aurea]
Length=320

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 221/333 (66%), Gaps = 14/333 (4%)
 Frame = -1

Query  1124  LAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGE  945
             + GEVVF+GPC A  I ++I+G + A+ D S YT   WF+I+ V+ V VTGGGT++G+G 
Sbjct  1     MVGEVVFKGPCAAGPITVQIQGNVTANEDPSAYTLGAWFMIQDVSNVIVTGGGTLDGKGA  60

Query  944   DVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRIT  765
              VW++D          + VSL+ + V+   ++ + FVNS GFH K++D +D  V  L IT
Sbjct  61    SVWKYD-----DGGTPMAVSLVMERVSFGKMNGLFFVNSMGFHSKITDSHDVVVDALTIT  115

Query  764   APGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSL  585
             AP  SPNTDGIH+S +TNVN+T+ V+GTGDDCVSIG G  N+LV+ VTCGPGHGIS+GSL
Sbjct  116   APATSPNTDGIHLSNATNVNITNSVIGTGDDCVSIGQGAVNVLVSGVTCGPGHGISVGSL  175

Query  584   GKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQ  405
             GKR  E +V GV V +C +  T+NGARIKTY  +P+L+A+GI F+DI + +V  PIIIDQ
Sbjct  176   GKRDNELNVSGVKVIHCKMSSTSNGARIKTYSETPELQATGITFQDITMDHVANPIIIDQ  235

Query  404   DYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGK  225
              Y+S   K+ S VK+ DV F +I+GT +    AI L CS T PCE V+L++I++  A   
Sbjct  236   HYHSSKTKD-SNVKISDVHFIDIKGTTTTP-AAIQLDCSATHPCESVQLSNINLQPAG--  291

Query  224   GVHLKPNKCVNAETIVKGKRNPGGSCG*LARFC  126
             GV      C NA+T V G   P      + R C
Sbjct  292   GVTALTATCANAKTTVTGTTTPP-----MPRLC  319



>gb|ABY21306.1| pollen allergen Pla o 2 [Platanus orientalis]
Length=378

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/382 (42%), Positives = 238/382 (62%), Gaps = 10/382 (3%)
 Frame = -1

Query  1280  RGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQ  1101
             RG   +   F+V  +GAK  G GD + A+++AW  AC S G + V+IP G ++ GEV+ +
Sbjct  2     RGVQSSGGTFNVNDYGAK--GSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLE  59

Query  1100  GPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDAD  921
             GPC   +I  ++ G + A +D+S + S  W +  HV G+ V+G GT +G+G+  W  +  
Sbjct  60    GPCKGSKIGFQLDGVVKAPADVSAFKSEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNC  119

Query  920   EKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNT  741
             +K +N    P+++ F  +  + + DI  +NSK FH+ V +C++ +   + I+APG S NT
Sbjct  120   DKDENCNRPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINT  179

Query  740   DGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETD  561
             DGIHI  S  V +TD  + TGDDCVSIG G+ N+ VT+V CGPGHGIS+GSLGK   E D
Sbjct  180   DGIHIGLSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKD  239

Query  560   VKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR-  384
             V+G+TV  CT  GT+NG R+KT+  SP   A+ + FED+ + NV  P+I+DQ+Y    + 
Sbjct  240   VRGITVTGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQC  299

Query  383   --KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI-VSAAGKGVHL  213
               K  S+VKL +++F NIRGT+S    AI + CS   PC ++E+ +I++ + AAG   + 
Sbjct  300   SLKAPSRVKLSNIKFNNIRGTSSGPD-AIVIACSHGFPCSNLEIGEINLALHAAGAPAN-  357

Query  212   KPNKCVNAETIVKGKRNPGGSC  147
               + C NA+ I  GK+ P   C
Sbjct  358   --STCTNAKPIFSGKQVPAIKC  377



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/398 (43%), Positives = 245/398 (62%), Gaps = 21/398 (5%)
 Frame = -1

Query  1337  IFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRG  1158
             +F+  LG+A         P G+     +FDVTKFGA P+G  D + A++ A+ +AC S  
Sbjct  2     LFLARLGVAQAPAA----PTGQ---PGVFDVTKFGATPNG--DISKAILDAFKEACASTS  52

Query  1157  AAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEV  978
              ++V++P+GTF   +V  +GPC A  +  +++GT+ A  D        WF + +V    +
Sbjct  53    PSRVIVPKGTFQMKQVKLEGPCKAP-LEFQLQGTLQASPDPKALPEGEWFTVNYVNQFTL  111

Query  977   TGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDC  798
             +G G  +G+G+  W  +   K K A  LP +L F  +N S I DI   +SK FHM V+ C
Sbjct  112   SGTGIFDGQGKAAWAQNDCAKTKCA-HLPYNLSFNYLNSSTIQDITSKDSKNFHMNVNGC  170

Query  797   NDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTC  618
             N+F ++++ I+AP +S NTDGIH++ S NVN+TD V+GTGDDC+SIGD    L +T+VTC
Sbjct  171   NNFTLNRVTISAPKESINTDGIHVARSKNVNITDCVIGTGDDCISIGDELEQLHITKVTC  230

Query  617   GPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIML  438
             GPGHGIS+GSLGK   E  V GV V+NCT I T NG R+KT+ AS Q   + + +EDI++
Sbjct  231   GPGHGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIVV  290

Query  437   HNVTRPIIIDQ---DYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCED  267
              NV+ P++IDQ    YN  N+   S VK+  V  +N++GT+S +  A+ L+CS+ VPCE 
Sbjct  291   QNVSNPVVIDQVYCPYNQCNKDLPSLVKISKVSIKNVKGTSSTQD-AVQLLCSKGVPCEG  349

Query  266   VELADIDIVSAAGKGVHLKPNK--CVNAETIVKGKRNP  159
             VE+ DIDI     +G    P K  C N +    GK+NP
Sbjct  350   VEVGDIDIAYNGKEG----PAKTSCENVKPTFVGKQNP  383



>emb|CDY35744.1| BnaC03g58650D [Brassica napus]
Length=421

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/370 (44%), Positives = 230/370 (62%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TK GA  +G  DS+ A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVFDITKNGAVGNGATDSSKAFLNTWLQVCASPVPATLLVPKGDFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT++A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   K  +  
Sbjct  109   VTVEVQGTIIAPP--SGYPTPEWFLFEHVDNVVLTGPGTFHGKGEAVWKADGCGKKVDCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + NV  ++ITAP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNILNLDISGISSVNAKAFHMFLVKTTNVNVQNIKITAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D ++ TGDDC+S+G G+TN+ V RVTCGPGHG+S+GSLGK   E +V G+  +
Sbjct  227   AVNVHIVDSLIATGDDCISVGRGSTNVTVERVTCGPGHGLSVGSLGKYPNEENVAGIHFK  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NC +  T NG RIK++  S    A  I FEDIM+ NV  PIIIDQ+Y S  R   SKV +
Sbjct  287   NCIMKDTDNGLRIKSWGGSSPSTAVDITFEDIMMTNVKNPIIIDQNYGS--RGGDSKVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              +V F+N+RGT   K   +  +CS++VPC+ V + D+++     KG H      L    C
Sbjct  345   SNVLFKNVRGTTITKD-EVQFMCSKSVPCKGVSVVDVELNFVGDKGGHPSSSGGLVGALC  403

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  404   TNANVIFGGK  413



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 229/369 (62%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  +
Sbjct  24    VFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-V  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               E++GT+ A +D S++ ++ W + +H+ G+ ++GGGT +G+G+  W  +   K  N   
Sbjct  83    EFELQGTLKAPADPSLFKTDGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   N+ +A   S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+ IRGT S    A+ ++CS++VPCE+VE+ADID+V    +G     ++C N +
Sbjct  323   KISKVSFKKIRGT-SASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPAT--SECANVK  379

Query  185   TIVKGKRNP  159
              ++ GK NP
Sbjct  380   PVLSGKLNP  388



>ref|XP_010690734.1| PREDICTED: exopolygalacturonase [Beta vulgaris subsp. vulgaris]
Length=402

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 236/372 (63%), Gaps = 9/372 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCT-AKR  1080
             I +V  F  + DG+ D + A I AW KAC+S G   ++IP+GT+L G + F+GPC     
Sbjct  30    IINVRSFRIRADGRNDDSQAFIAAWEKACNSGGNVTLLIPKGTYLVGPLKFRGPCQQVSS  89

Query  1079  IVIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             + + +KG + A +DLS Y   + W     + G+ + GGG I+G+G + W ++      N 
Sbjct  90    LTVLMKGYLKATTDLSGYEFGSGWIEFAWINGLILKGGGVIDGQGAEAWPYNDCPTSSNC  149

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LLP +L F G+NR+ +HDI  +NSK FH+ + +C +F  S L+I+AP DSPNTDGIH+ 
Sbjct  150   DLLPTNLKFVGMNRTIVHDITSLNSKFFHIALVECRNFKGSALKISAPEDSPNTDGIHLE  209

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S NV  + L +GTGDDC+SIG G + + +T VTCGPGHGIS+GSLGK   E DV G+ V
Sbjct  210   RSANVQFSRLSIGTGDDCISIGQGNSQITITNVTCGPGHGISVGSLGKYPHEQDVNGLFV  269

Query  542   RNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEA  375
             RNCT+IGT+NG RIKT+  SP +  A+ + FE+I++ +V  PIIIDQ Y   +S + +  
Sbjct  270   RNCTIIGTSNGIRIKTWANSPGKSAATNMKFENIVMKHVRNPIIIDQAYCPFDSCSSEAP  329

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S+VKL ++ F+NIRGT S    A+ L CS+ +PC+++ L ++ +   +G+   L  + C 
Sbjct  330   SRVKLSNIYFKNIRGT-SLSEVAVKLSCSKGIPCKNIFLQNVHLNLTSGE--RLPVSTCE  386

Query  194   NAETIVKGKRNP  159
             N      G + P
Sbjct  387   NVRARYIGTQMP  398



>ref|XP_006418305.1| hypothetical protein EUTSA_v10007721mg [Eutrema salsugineum]
 gb|ESQ36658.1| hypothetical protein EUTSA_v10007721mg [Eutrema salsugineum]
Length=421

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/370 (44%), Positives = 231/370 (62%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             ++FD+TKFGA  DG  +S  A +  W + C S   A +++P+GTFLAG V+F GPC +K 
Sbjct  50    SVFDITKFGAVGDGSTNSFKAFLNTWIQVCDSPVPATLLVPKGTFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT++A +  S Y +  WF+ E V  V +TG GT +G+GE VW+ D   K     
Sbjct  109   VTVEVQGTVIATT--SGYATPEWFLFERVDNVHLTGTGTFHGKGEAVWKEDGCGKKVQCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + N+  +++ AP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNMKNVEISGISSVNAKAFHMFLVKTENVNIHNIKLIAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D  + TGDDCVS+G G+ N+ V RVTCGPGHG+S+GSLGK   E DV G+ VR
Sbjct  227   ADNVSILDSTIATGDDCVSVGRGSNNVTVERVTCGPGHGLSVGSLGKYKDEEDVSGIHVR  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+I T NG RIKT+  S   +A+ I FEDI++ +V  PIIIDQ+Y S  R   SKV +
Sbjct  287   NCTMIETDNGLRIKTWGGSGPSRAADIKFEDIIMQSVKNPIIIDQNYGS--RGGDSKVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              DV F+N+RGT   K   + + CS++VPC+ V + D+++     +G        L    C
Sbjct  345   SDVLFKNVRGTTITKD-IVQIACSKSVPCKGVNVVDVNLSFVGKEGGEKSSSGGLVGALC  403

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  404   DNANVIFGGK  413



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/369 (44%), Positives = 229/369 (62%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  +
Sbjct  24    VFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-V  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               E++GT+ A +D S++ ++ W + +H+ G+ ++GGGT +G+G+  W  +   K  N   
Sbjct  83    EFELQGTLKAPADPSLFKTDGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   ++ +A   S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+ IRGT S    A+ ++CSQ+VPC++VE+ADID+V    +G     ++C N +
Sbjct  323   KISKVSFKKIRGT-SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPAT--SECANVK  379

Query  185   TIVKGKRNP  159
              ++ GK NP
Sbjct  380   PVLSGKLNP  388



>ref|XP_007020651.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY12176.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=416

 Score =   308 bits (789),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 229/372 (62%), Gaps = 8/372 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V ++GA  DGK D++ A   AW +AC S G + V+IP GT+L    VFQGPC    I
Sbjct  33    LFNVLQYGASGDGKTDNSKAFTNAWKQACQSGGNSVVLIPLGTYLVLPTVFQGPCKGA-I  91

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               ++KG + A +D +    ++W    ++  + +TGGG+++G+G   W ++      N P 
Sbjct  92    AFQVKGLLRAPTDAASLHLDHWISFRYIDRLTITGGGSLDGQGASAWPYNTCLTDPNCPP  151

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              PV+L F  V  S I+ I  +NSK FH  +    +  + ++ I+APGDSPNTDGIHI  S
Sbjct  152   FPVTLRFDFVTNSWINHITSINSKNFHFNIFASTNIRIHQVNISAPGDSPNTDGIHIGDS  211

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             T ++++D  + TGDDCVS+G G+ N+ +T V CGPGHG S+GSLGK   E DV GVTVRN
Sbjct  212   TGIHISDSEIATGDDCVSMGPGSQNINITNVHCGPGHGFSVGSLGKSPNEKDVAGVTVRN  271

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEASKV  366
             CTL GT NG RIKT+  S   + S + FE + + NV  PI IDQ+Y   +   R+  S+V
Sbjct  272   CTLTGTLNGLRIKTWSPSHSSRCSDVTFEHVNVENVNNPIFIDQNYCPSHKCGRQWESRV  331

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI---VSAAGKGVHLKPNKCV  195
             K++ VRFRNI G++S +  A++L CS++ PCE++EL +I+I       G       + C 
Sbjct  332   KIQGVRFRNIWGSSSSR-IAVNLQCSRSTPCENIELRNINIDYNGGGGGATAAAAASSCS  390

Query  194   NAETIVKGKRNP  159
             N   +  G+++P
Sbjct  391   NVHGVAYGEQHP  402



>ref|XP_007200668.1| hypothetical protein PRUPE_ppa015568mg [Prunus persica]
 gb|EMJ01867.1| hypothetical protein PRUPE_ppa015568mg [Prunus persica]
Length=482

 Score =   310 bits (794),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/365 (45%), Positives = 229/365 (63%), Gaps = 16/365 (4%)
 Frame = -1

Query  1211  DSTMAMIRAWNKAC--HSRGAAKVVIPRGTFLAGEVVFQGPCTAKR--IVIEIKGTMVAD  1044
             D+  A I+ W  AC  +  G A V+IP+GTF+ G V+FQGPCT+ +  I++E++G + A 
Sbjct  116   DNASAFIKTWVAACRGNYSGPATVLIPKGTFMTGPVIFQGPCTSSKEPILVEVEGYVKAS  175

Query  1043  SDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVN  864
             +DLS+Y S  WF  E + G+ VTG GT +G+GE  W+ +  +   +    P SL F  VN
Sbjct  176   TDLSLYASPEWFTFEMIDGLIVTGEGTFDGQGESTWKSNGCQDKSSCAQAPSSLKFNHVN  235

Query  863   RSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVG  684
              + +  I  +NSK FH  +  C +  ++ + ITAPGDSPNTDG+H S STNV V + V+ 
Sbjct  236   NTLVERITSLNSKFFHAHIYGCTNLTMNNVHITAPGDSPNTDGVHTSTSTNVKVLNSVIA  295

Query  683   TGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGAR  504
             TGDDCVSIG G+ ++LV  VTCGPGHGIS+GSLGKR  +  V  + V NCTL  TTNGAR
Sbjct  296   TGDDCVSIGQGSNDILVNNVTCGPGHGISVGSLGKRKDDKSVSQIHVSNCTLRNTTNGAR  355

Query  503   IKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA--------SKVKLKDVR  348
             IKT+ A    +AS I +E+I++  V  PI+IDQ+Y  K  K          SK K+ +V 
Sbjct  356   IKTWAAESAGEASDITYENIVMDQVQIPIVIDQNYGQKKPKAGTGPAGGPPSKWKISNVH  415

Query  347   FRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAG--KGVHLKPNKCVNAETIVK  174
             FRNIRGT+S ++ A+SL CS + PC+ +E+ADI+     G  K   L   +C NA+    
Sbjct  416   FRNIRGTSS-RNIAVSLQCSSSNPCDGIEMADINFSYLGGAVKDTSLT-TECYNAKIAPA  473

Query  173   GKRNP  159
             G + P
Sbjct  474   GVQIP  478



>ref|XP_009109723.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Brassica 
rapa]
Length=420

 Score =   308 bits (788),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/370 (44%), Positives = 230/370 (62%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TK GA  +G  DS+ A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVFDITKNGAVGNGATDSSKAFLNTWLQVCASPVPATLLVPKGDFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT++A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   K  N  
Sbjct  109   VTVEVQGTIIAPP--SGYPTPEWFLFEHVDNVVLTGPGTFHGKGEAVWKADGCGKKLNCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + NV  ++ITAP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNILNLDISGISSVNAKAFHMFLVKTKNVNVQNIKITAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D ++ TGDDC+S+G G+TN+ V RVTCGPGHG+S+GSLGK   E +V G+  +
Sbjct  227   AVNVHIADSLIATGDDCISVGRGSTNVTVERVTCGPGHGLSVGSLGKYPNEENVAGIHFK  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NC +  T NG RIK++  S    A  I FEDI + NV  PIIIDQ+Y S  R   SKV +
Sbjct  287   NCIMKDTDNGLRIKSWGGSSPSTAVDITFEDITMTNVKNPIIIDQNYGS--RGGDSKVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              +V F+N+RGT   K   + ++CS++VPC+ V + D+++     KG H      L    C
Sbjct  345   SNVLFKNVRGTTITKD-EVQIMCSKSVPCKGVSVVDVELNFVGDKGGHPSASGGLVGALC  403

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  404   DNANVIFGGK  413



>ref|XP_011010959.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=412

 Score =   307 bits (786),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/373 (45%), Positives = 230/373 (62%), Gaps = 9/373 (2%)
 Frame = -1

Query  1274  RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             R     +F+V ++GAKP GK DS ++ IRAW  AC+ RG A+++IP GTFL G  +FQGP
Sbjct  44    RDPNEKVFNVLQYGAKPGGKQDSALSFIRAWRAACNYRGTARLLIPMGTFLIGATIFQGP  103

Query  1094  CTAK-RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADE  918
             C     I ++I GT+ A  D S+Y  ++W + E++ G+ VTG GT++G+G  VW+++   
Sbjct  104   CLGPVPIKVQIAGTLKAVPDPSMYEEDFWILFENINGLLVTGTGTVDGQGNAVWKYN---  160

Query  917   KIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTD  738
                     P S+ F  V    I  I  VN  GFH+ +    +     L ITAP  SPNTD
Sbjct  161   --DGGSRFPSSIKFNHVVNGIIRQITSVNPMGFHISIVLSQNIRAKHLHITAPATSPNTD  218

Query  737   GIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDV  558
             GIHIS S+ V V+  V+ TGDDCV+I  G+T++ V +VTCGPGHG S+GSLGK   E DV
Sbjct  219   GIHISQSSVVKVSRSVISTGDDCVAIIQGSTDVSVKKVTCGPGHGFSVGSLGKYPDEKDV  278

Query  557   KGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKE  378
             +GV V NCTL    NG RIKT+  SP  +AS I+F+DI++ NV RPIIIDQ Y SK+   
Sbjct  279   RGVVVTNCTLRNADNGVRIKTWGGSPPSQASNILFQDIIMDNVKRPIIIDQTYGSKS-NS  337

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
              S+VK+ DVR+ NIRGT S     + L CS+ VPCE +  ++I++     K +    + C
Sbjct  338   PSRVKISDVRYINIRGT-SGSEVGVDLKCSEAVPCEKLYFSNINLKYYGPKKLPFT-STC  395

Query  197   VNAETIVKGKRNP  159
              NA+    G + P
Sbjct  396   TNAKVNYVGNQFP  408



>ref|XP_010522804.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Tarenaya 
hassleriana]
Length=443

 Score =   308 bits (789),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 222/338 (66%), Gaps = 4/338 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+T++GA  DGK ++  A + AW KAC S   AK+V+P+GTF++G +VF GPC + ++
Sbjct  72    VFDITQYGAVGDGKTNNFKAFLNAWIKACQSAVPAKLVVPKGTFVSGPMVFAGPCMS-QV  130

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +E++GT+ A   +  + +  W + E V  + + G GT +G GE  W+  A  K  N  L
Sbjct  131   TVEVQGTVKATPGVQGFATQEWILFERVDNLVLRGDGTFDGSGEVAWRDHACNKGGNCKL  190

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P +L F+ ++ + +  I  +NSK FHM +    +  +  +++ AP DSPNTDG+H+S +
Sbjct  191   PPTTLKFREMSNTEVQGITSLNSKAFHMFLVKTTNTTIHNVKLIAPDDSPNTDGVHLSNA  250

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              +V + D  +GTGDDCVS+G G+ ++ V RV CGPGHG S+GSLGK   E DV G+TVRN
Sbjct  251   DSVKILDSYIGTGDDCVSVGRGSNDVTVERVVCGPGHGFSVGSLGKYKGEEDVSGITVRN  310

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLK  357
             CTL GT NGARIKT+  S   KA+ I FEDI+++NV  PIIIDQ+Y S  R   SKV++ 
Sbjct  311   CTLNGTDNGARIKTWGGSDASKATDITFEDIIMNNVKNPIIIDQEYGS--RGGPSKVEIS  368

Query  356   DVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             +V F+NIRGT+  K   I  +CS  VPC+ + + DIDI
Sbjct  369   NVLFKNIRGTSVTKD-VIQFVCSTAVPCKGINVVDIDI  405



>emb|CDX90152.1| BnaA08g18320D [Brassica napus]
Length=420

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/370 (44%), Positives = 230/370 (62%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TK GA  +G  DS+ A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVFDITKNGAVGNGATDSSKAFLNTWLQVCASPVPATLLVPKGDFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT++A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   +  N  
Sbjct  109   VTVEVQGTIIAPP--SGYPTPEWFLFEHVDNVVLTGPGTFHGKGEAVWKADGCGQKANCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + NV  ++ITAP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNILNLDISGISSVNAKAFHMFLVKTKNVNVQNIKITAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D ++ TGDDC+S+G G+TN+ V RVTCGPGHG+S+GSLGK   E +V G+  +
Sbjct  227   AVNVHIVDSLIATGDDCISVGRGSTNVTVERVTCGPGHGLSVGSLGKYPNEENVAGIHFK  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NC +  T NG RIK++  S    A  I FEDI + NV  PIIIDQ+Y S  R   SKV +
Sbjct  287   NCIMKDTDNGLRIKSWGGSSPSTAVDITFEDITMTNVKNPIIIDQNYGS--RGGDSKVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              +V F+N+RGT   K   + ++CS++VPC+ V + D+++     KG H      L    C
Sbjct  345   SNVLFKNVRGTTITKD-EVQIMCSKSVPCKGVSVVDVELNFVGDKGGHPSASGGLVGALC  403

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  404   DNANVIFGGK  413



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/369 (44%), Positives = 228/369 (62%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  +
Sbjct  24    VFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-V  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               E++GT+ A +D S++ ++ W + + + G+ V+GGGT +G+G+  W  +   K  N   
Sbjct  83    EFELQGTLKAPADPSLFKTDGWVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   ++ +A   S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+ IRGT S    A+ ++CSQ+VPC++VE+ADID+V    +G     ++C N +
Sbjct  323   KISKVSFKKIRGT-SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPAT--SECANVK  379

Query  185   TIVKGKRNP  159
              ++ GK NP
Sbjct  380   PVLSGKLNP  388



>ref|XP_006845393.1| hypothetical protein AMTR_s00019p00058670 [Amborella trichopoda]
 gb|ERN07068.1| hypothetical protein AMTR_s00019p00058670 [Amborella trichopoda]
Length=386

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 239/369 (65%), Gaps = 7/369 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRI  1077
             F+V ++GA  DG  D++ A   AW  AC  +G +++VIP GTFL G V+F+GPC +A  +
Sbjct  17    FNVMQYGAIADGATDNSEAFDAAWKAACEWKGPSRLVIPEGTFLVGPVLFKGPCPSASPM  76

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             V+++KG + A +++S Y S+ W + ++V G+ VTGGGT +G+G   W  +   K  +  L
Sbjct  77    VVQVKGKVKASTEMSKYPSDDWIVFQYVDGLVVTGGGTFDGQGASAWSLNECPKKAHCKL  136

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP SL F  +    I  I  V+SK FH+ +  C +  V  + I+APGDSPNTDGIHIS S
Sbjct  137   LPTSLKFSSITNGEIRGISSVDSKLFHILLFRCKNMKVQSIDISAPGDSPNTDGIHISSS  196

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             +N++++   +GTGDDC+SIG GTT + ++ V CGPGHGIS+GSLGK  +E DV+G+ V N
Sbjct  197   SNISISQTRIGTGDDCISIGPGTTQVTMSNVFCGPGHGISVGSLGKFPKEEDVQGIHVEN  256

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQD---YNSKNRKEASKV  366
             CT+  TTNG RIKT+  S    ASG  +EDI+++NV  PIIIDQ    Y+S  +K  S++
Sbjct  257   CTISDTTNGLRIKTWADSASSSASGFAYEDIVMNNVANPIIIDQQYCPYSSCPQKGPSRL  316

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+ D+ F+NIRGT S K  A++L+CS+  PC++V+L DI +     K        C N +
Sbjct  317   KISDISFKNIRGTTSSKG-AVNLLCSEAFPCQNVKLDDIKL--EYNKQGETSTASCTNVK  373

Query  185   TIVKGKRNP  159
              +  G + P
Sbjct  374   GVSAGVQMP  382



>ref|XP_007199143.1| hypothetical protein PRUPE_ppa019563mg [Prunus persica]
 gb|EMJ00342.1| hypothetical protein PRUPE_ppa019563mg [Prunus persica]
Length=387

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 233/377 (62%), Gaps = 9/377 (2%)
 Frame = -1

Query  1274  RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             R     +FDV  FGA+ DG+ D + A + AW +AC S G A + IP+GT++ G + F GP
Sbjct  11    RAKNSAVFDVMSFGARADGRTDDSNAFMAAWKEACQSTGRAHITIPKGTYIIGPLKFSGP  70

Query  1094  CTAKRIVIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADE  918
             C      + I+G + A +DL  Y     W     + G+ +TGGGT +GRG   W  +   
Sbjct  71    CLNVS-SLTIRGYLKATTDLRKYGFGGSWLEFGWMEGLTLTGGGTFDGRGARAWPHNKCP  129

Query  917   KIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTD  738
                N  LLP SL F  +N++ I  +  VNSK FH+ + +C++F  S+L+I+AP  SPNTD
Sbjct  130   TDSNCKLLPTSLKFVAMNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTD  189

Query  737   GIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDV  558
             GIHI  S++V  +   + TGDDC+S+G G + + +T +TCGPGHGIS+GSLGK   E DV
Sbjct  190   GIHIERSSSVYFSLSHIATGDDCISVGQGNSQITITSITCGPGHGISVGSLGKYPDERDV  249

Query  557   KGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSK  390
              G+ V++CT+ GTTNG RIKT+  SP    A+ + FE+I+++NVT PIIIDQ Y    S 
Sbjct  250   SGLVVKDCTMTGTTNGIRIKTWANSPGNSAATNMTFENIVMNNVTNPIIIDQLYCPFTSC  309

Query  389   NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK  210
               K  S+VKL D+ F+NIRGT+S +  A++L CS+ +PC+++ L D+ +  ++G+     
Sbjct  310   TSKAPSRVKLSDIYFKNIRGTSSSE-VAVALECSKGIPCQNIYLEDVHLDLSSGE--KQA  366

Query  209   PNKCVNAETIVKGKRNP  159
              + C N +    G + P
Sbjct  367   TSSCSNVKAKFSGTQIP  383



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 226/368 (61%), Gaps = 7/368 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              +V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  + 
Sbjct  25    LNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-VE  83

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
              E++GT+ A +D S++ ++ W + + + G+ V+GGGT +G+G+  W  +   K  N   L
Sbjct  84    FELQGTLKAPADPSLFKTDGWVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRTL  143

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S 
Sbjct  144   PTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRSD  203

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
              VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V NC
Sbjct  204   GVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTNC  263

Query  533   TLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKVK  363
             T+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   N+ +A   S +K
Sbjct  264   TIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLIK  323

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAET  183
             +  V F+ IRGT S    A+ ++CSQ+VPC++VE+ADID+V    +G     ++C N + 
Sbjct  324   ISKVSFKKIRGT-SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPAT--SECANVKP  380

Query  182   IVKGKRNP  159
             ++ GK NP
Sbjct  381   VLSGKLNP  388



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   305 bits (782),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/408 (42%), Positives = 240/408 (59%), Gaps = 15/408 (4%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTI-FDVTKFGAKPDGKGDSTMAMIRAWN  1179
             M  K    + LLG  LL   V C  +      TI FD+T  GAKPD   D T A + +W 
Sbjct  1     MASKLNFTLSLLGFYLLIIEVSCQTQNLAPGDTIVFDITTKGAKPDA--DVTQAFLDSWT  58

Query  1178  KACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYT-SNYWFII  1002
              AC S+  +KV++P G ++ G +  +GPC     VIEI G   A SD++ +   + WF +
Sbjct  59    AACASKKPSKVLVPAGNYILGAITLKGPCQTPT-VIEILGNFKAPSDVAAFKKEDSWFKV  117

Query  1001  EHVAGVEV---TGGGTINGRGEDVWQFDADEKIKNAPL-LPVSLIFQGVNRSGIHDIKFV  834
             E+V  + +    GGG  +G+G+  W+ +   K  N    LP ++ F  V+ S +  +  +
Sbjct  118   ENVDSLIIISGKGGGVFDGQGQAGWKKNECTKNANCAFDLPYNIRFNFVSNSKVSGLTSL  177

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             NSK FH+ +  C    +S + ITAP DSPNTDGIHI  S N+ V    +GTGDDCVS GD
Sbjct  178   NSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIGRSENIIVRGWTIGTGDDCVSFGD  237

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             G  N+L+  VTCGPGHG+S+GSLGK   E  V  +T+RNCT+  T NG R+KT+  S + 
Sbjct  238   GAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCTIKNTDNGVRVKTWHNSYES  297

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKVKLKDVRFRNIRGTASKKHPAI  303
               +G+ FEDI + NV  P+I+DQ+Y   N    K  SKVK+ D+RF+N++G +S K  A+
Sbjct  298   TVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVKISDIRFKNVKGKSSTKE-AV  356

Query  302   SLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              LICS+ VPC+ VELADIDI      G  +  + C   + ++ GK++P
Sbjct  357   KLICSEGVPCDKVELADIDIQYTGPDGPAV--SMCKFVKPLLTGKQSP  402



>gb|EMT18530.1| Exopolygalacturonase [Aegilops tauschii]
Length=415

 Score =   305 bits (782),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 220/342 (64%), Gaps = 7/342 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             +D+TK GAKPDG  D T A+  AW  AC S G   ++IP+G FL G + F GPC    + 
Sbjct  45    YDITKLGAKPDGTTDCTEAVEEAWASACGSTGNPTIIIPKGDFLTGALNFTGPCKGDGLS  104

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I+++G ++A +DL+ + SN W  I  V  + +TG G I+G+G+ VW  ++ +K  N  +L
Sbjct  105   IKLEGNLLASNDLAKFKSN-WIEIMRVKKLSITGKGNIDGQGKAVWTKNSCQKNYNCKIL  163

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+    + + I  I  +NSK FHM +  C    V  ++++APGDSPNTDGIH+  S+
Sbjct  164   PNSLVLDFCDDALIEGISIINSKFFHMNIFQCKGVTVKDVKVSAPGDSPNTDGIHMGDSS  223

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV++ D  +G GDDC+SIG G+T + ++ VTCGPGHGISIGSLG+   E DV  +TV+NC
Sbjct  224   NVSIIDTTIGVGDDCISIGPGSTQVNISGVTCGPGHGISIGSLGRYKDEKDVTDITVKNC  283

Query  533   TLIGTTNGARIKTYR-ASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK----NRKEASK  369
              L G+TNG RIK+Y  A   L AS I +E+I + +   PIIIDQ Y       ++ EA +
Sbjct  284   VLKGSTNGLRIKSYEDAKSPLVASKIHYENIEMDDSGYPIIIDQKYCPNKLCTSKGEADR  343

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             V +KDV F+NI GT+S    A+SL+CS   PCE V ++D+ I
Sbjct  344   VTVKDVTFKNITGTSSTPE-AVSLLCSDKKPCEGVTMSDVKI  384



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 244/399 (61%), Gaps = 28/399 (7%)
 Frame = -1

Query  1340  GIFVILLGIALLSTGVECIPRGRGHTHTIFDVT--KFGAKPDGKGDSTMAMIRAWNKACH  1167
             G+FV LL    L++        + H  ++FDVT  ++GAKP    D T A+ +AWN +C 
Sbjct  9     GMFVFLL----LASAT------KAHESSVFDVTSAEYGAKPGS--DITFALAKAWNDSCA  56

Query  1166  SRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVA---DSDLSVYTSNYWFIIEH  996
             S  A+KVV+P GT+      F+GPC A  I ++++GT+ A   DSDL++     W   +H
Sbjct  57    SPSASKVVVPSGTYKLSGASFRGPCKAP-IELQVQGTLQAPEKDSDLTM--EGTWVGFQH  113

Query  995   VAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFH  816
             V  + V+GGGT +G+G  VW  +   K K+     V+L F  V  S I D+  +NSK FH
Sbjct  114   VDMITVSGGGTFDGQGAFVWSQNNSSKSKHCSG-SVNLRFDFVTNSIIQDVTSLNSKNFH  172

Query  815   MKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLL  636
             + V  CN+     + ITAPGDS NTDGIHI  ST +N+T   +GTGDDCVSIGDG   + 
Sbjct  173   VHVYGCNNVTFQHVHITAPGDSKNTDGIHIGKSTGINITHTFIGTGDDCVSIGDGNNQIA  232

Query  635   VTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGI  459
             VT V+CGPGHGISIGSLG+   E  + G+ V+NCTL  T NG RIKT+  SP    AS I
Sbjct  233   VTNVSCGPGHGISIGSLGRYDNEESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDI  292

Query  458   IFEDIMLHNVTRPIIIDQ---DYNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICS  288
              FEDI++ NV+ PI+IDQ    Y   +    SKVK+ DV F+NI+G+++    ++ ++CS
Sbjct  293   HFEDIIMVNVSNPIVIDQLYCPYKKCDNLPPSKVKISDVSFKNIQGSSATAL-SLKIVCS  351

Query  287   QTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKG  171
                PCE++ELADID+  +  KG     ++C+N +  + G
Sbjct  352   SGSPCENMELADIDLTYSGAKGTLT--SQCLNVKPTISG  388



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/374 (43%), Positives = 235/374 (63%), Gaps = 7/374 (2%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
             ++ +F+V  FGA  DG  D++ A   AW +AC+    + V++P G +L   VVF+GPC A
Sbjct  29    SNGVFNVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTSVVFKGPCKA  88

Query  1085  KRIVIEIKGTMVADSDLS-VYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
               I  +++G ++A   LS +     W   E +    +TGGGT +G+G   W  +   K  
Sbjct  89    P-ISFQLQGLILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAWPENQCHKNS  147

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             N  L P+S+ F  +N S I  ++ V+SK FH+ +  C +  ++K+ I+AP DSPNTDGIH
Sbjct  148   NCQL-PISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIH  206

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             I  S  + +++ ++ TGDDCVS+GDG+ N+LV+ V+CGPGHGIS+GSLGK  +E DV G+
Sbjct  207   IGRSNGIEISNSIIATGDDCVSLGDGSQNVLVSDVSCGPGHGISVGSLGKYKKEEDVVGL  266

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             TV NCT  GT+NG RIKT+  S   KAS   FED+ ++NV  PI+IDQ+Y   N  N K 
Sbjct  267   TVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQCNIKV  326

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
              S+VK+ +VRFRNIRGT+  K  A+ ++CS+ +PC++VE+ DI++V           + C
Sbjct  327   PSRVKISNVRFRNIRGTSLTKE-AVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSC  385

Query  197   VNAETIVKGKRNPG  156
              N +  + GK+ P 
Sbjct  386   SNVKPTLVGKQIPA  399



>ref|XP_010913888.1| PREDICTED: exopolygalacturonase-like [Elaeis guineensis]
Length=404

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/371 (43%), Positives = 230/371 (62%), Gaps = 10/371 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRI  1077
             F+V  FGA+ DG  D++ A + AW  AC S GA  +VIP GT+    V F+GPC   + +
Sbjct  34    FNVINFGARADGVTDNSQAFLAAWKAACTSTGAVNLVIPSGTYFLNPVQFRGPCKNVQSL  93

Query  1076  VIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              ++++GT+ A +DL+ Y T+  W     V  + +TGGGT +G+GE  W  +   + +N  
Sbjct  94    TVQMQGTLKASTDLNQYATARVWVEFGWVDHLTLTGGGTFDGQGEVTWPLNTCPRDQNCK  153

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             + P SL+F  +N + ++ IK VNSK FH+ V  C +F  S+++ITAP +SPNTDGIH+  
Sbjct  154   IPPTSLMFVNMNNTIVNHIKSVNSKFFHIGVLGCQNFQGSRIQITAPAESPNTDGIHLER  213

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             ++ V ++D  + TGDDCVS+G G + + +  + CGPGHGIS+GSLGK   E DV+G+ VR
Sbjct  214   NSGVTISDSEIATGDDCVSVGQGNSLVTLNGIRCGPGHGISVGSLGKYQNEKDVRGLIVR  273

Query  539   NCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEAS  372
             +C+L  T NG RIKT+  SP     + + FE+I+++NV  PIIIDQ Y          +S
Sbjct  274   DCSLTETDNGIRIKTWANSPTSSVCANMTFENIVMNNVANPIIIDQSYCPYANCMSSASS  333

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
             KVK+ D+ FRNI GT SK   A++L CSQ VPCE V L D+D+      G +     C+N
Sbjct  334   KVKISDIHFRNITGT-SKTPVAVTLKCSQRVPCEKVSLQDVDLTFT---GQNSTSATCLN  389

Query  191   AETIVKGKRNP  159
              +    G +NP
Sbjct  390   VKADYSGTQNP  400



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   305 bits (780),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 164/394 (42%), Positives = 239/394 (61%), Gaps = 13/394 (3%)
 Frame = -1

Query  1322  LGIALLSTGV--ECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAK  1149
              GI LL + +   CI + +       DVT+ GAKPDG  D +  +  AW +AC+S  A+ 
Sbjct  5     FGITLLCSWLFFTCIVQAQTGP---IDVTQLGAKPDGSADMSQVLADAWKQACNSTTAST  61

Query  1148  VVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSD-LSVYTSNYWFIIEHVAGVEVTG  972
             ++IP+GTFL  E    GPC A  + I+I+G + A  D   +   N W  I++V  + ++G
Sbjct  62    ILIPKGTFLLKEASLAGPCKAP-VEIQIQGIIKAPEDPAQISKDNEWMTIKYVDQLTLSG  120

Query  971   GGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCND  792
             GGT++G+G   W  +          LP +L    VN + I D+  +NSK FH+ +  CN+
Sbjct  121   GGTLDGQGAKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNN  180

Query  791   FNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGP  612
                    ITAPGDSPNTDGIHI  ST V +TD  +GTGDDC+SIGDG   + +++VTCGP
Sbjct  181   ITFQHFTITAPGDSPNTDGIHIGHSTGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGP  240

Query  611   GHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHN  432
             GHGIS+GSLG+   E  V+G+ V +CT+ GT NG R+K++ A+    A+ + FE I++ N
Sbjct  241   GHGISVGSLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQN  300

Query  431   VTRPIIIDQDYNSKNR---KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             V+ P+IIDQ+Y   N+      S VK+  V F+NI GT S    A++L+CS+++PC+ VE
Sbjct  301   VSNPVIIDQEYCPNNQCTNTAPSSVKIAQVSFKNITGT-SATPAAVTLLCSKSIPCDGVE  359

Query  260   LADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             +ADID+     +G ++  N C N +  + GK NP
Sbjct  360   IADIDLAYNGNQG-NVSSN-CANVKPALSGKLNP  391



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   305 bits (780),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 226/353 (64%), Gaps = 11/353 (3%)
 Frame = -1

Query  1259  TIFDVTK--FGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
             ++FDVT   +GAKP    D + A+ +AW+ AC S  A+KVV+P GT+   E  F+GPC A
Sbjct  25    SVFDVTSATYGAKPGS--DVSTALAKAWSDACASPSASKVVVPSGTYKLKEANFRGPCKA  82

Query  1085  KRIVIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
               I ++++GT+ A +D S  T  + W   +++  + ++GGGT +G+G   W  +   K K
Sbjct  83    P-IEMQVQGTLQAPADASQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNK  141

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             N   +PV+L F+ +  S + DI  +NSK FHM V  CN     +L ITAP DS NTDGIH
Sbjct  142   NCKPIPVNLRFEFLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIH  201

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             I  ST +N+T   +GTGDDC+SIGD +  + VT VTCGPGHGISIGSLGK   E DV G+
Sbjct  202   IGASTGINITHAKIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGI  261

Query  548   TVRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQ---DYNSKNRK  381
              V+NCTL  T NG RIKT+  SP    ASGI +EDI++ NV+ PI++DQ    Y    +K
Sbjct  262   IVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQK  321

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
               SKVK+ +V F+NI+G +S    A+ L+C+  +PCE+VEL DID+     KG
Sbjct  322   PPSKVKISNVSFKNIKG-SSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKG  373



>emb|CDX90415.1| BnaA03g43660D [Brassica napus]
Length=412

 Score =   305 bits (780),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 166/384 (43%), Positives = 237/384 (62%), Gaps = 11/384 (3%)
 Frame = -1

Query  1364  VATMEIKAGIF---VILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAM  1194
             ++ +E+K  IF    +L    +  +    + RG   +  I DV  FGA+ +   D+T A 
Sbjct  1     MSIVEMKFTIFHYLRVLFFFFMALSSYSFVVRGDKSSVLIVDVRSFGARANDHRDNTKAF  60

Query  1193  IRAWNKACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTS  1020
             + AW+ AC S  ++  ++IPRG F  G + F GPCT    + + +KG + A +DLS Y S
Sbjct  61    VAAWDMACKSSSSSVDLIIPRGEFHVGPIRFSGPCTNVTHLTVRVKGHLKASTDLSKYRS  120

Query  1019  NY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDI  843
                W     + G+ +TGGGT +G+G   W F+      +  LLP SL F G+NR+ +  I
Sbjct  121   GGGWIEFGWINGLTLTGGGTFDGQGALAWPFNNCITDSHCKLLPTSLKFVGMNRTIVRRI  180

Query  842   KFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVS  663
               VNSK FHM +  C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCVS
Sbjct  181   SSVNSKFFHMALVQCRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCVS  240

Query  662   IGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRAS  483
             IG G + + +T + CGPGHGIS+GSLG+   E DVKG+ VR+C + GTTNG RIKT+  S
Sbjct  241   IGQGNSQITITSIKCGPGHGISVGSLGRYPNEKDVKGLVVRDCKMSGTTNGIRIKTWADS  300

Query  482   PQL-KASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKK  315
             P L +A+ + F++I++ NVT PIIIDQ Y   +S +    SKVKL ++ F+NIRG++S K
Sbjct  301   PGLSEATNMTFQNIIMSNVTNPIIIDQSYCPFSSCSSNVPSKVKLSEIYFKNIRGSSSSK  360

Query  314   HPAISLICSQTVPCEDVELADIDI  243
               A+ L CS+ +PC+ V L ++ +
Sbjct  361   -VAVQLHCSEGMPCKKVYLENVHL  383



>ref|XP_010109588.1| hypothetical protein L484_005247 [Morus notabilis]
 gb|EXC23297.1| hypothetical protein L484_005247 [Morus notabilis]
Length=496

 Score =   307 bits (786),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/411 (40%), Positives = 238/411 (58%), Gaps = 19/411 (5%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECIP-----RGRGHTH--------TIFDVTKFGAKPDGKGDSTMAM  1194
              +  L +A   TGV   P     RG    H         IF+V  FGAKP G+ D+T A 
Sbjct  89    LIWCLSLAYCVTGVPLPPAPDTFRGTNLAHHERADPTEKIFNVLSFGAKPGGRKDNTEAF  148

Query  1193  IRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK-RIVIEIKGTMVADSDLSVYTSN  1017
             ++ W  ACH +G A+V IP G +  G V F GPC  +  I++ I+GT+ AD+D+S+Y   
Sbjct  149   MQTWVAACHYKGKARVFIPPGIYKLGPVTFAGPCGGRGPIIVHIQGTLKADTDISLYDEP  208

Query  1016  YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKF  837
              WF+ E + G+ V G GT +G+GE  W+++      +   LP ++    V    +     
Sbjct  209   QWFLFEAINGLVVIGSGTFDGQGESAWKYNDCHNNNDCVQLPSNIKLNKVTNGVLRGFTS  268

Query  836   VNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIG  657
              NSKG H+ ++ C +  + +L + AP  SPNTDG+HIS S NV ++  V+ TGDDC+ + 
Sbjct  269   ANSKGVHIFITQCQNIRLRRLHVFAPATSPNTDGVHISNSNNVRISRTVIRTGDDCIGMI  328

Query  656   DGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQ  477
              G+TN+ + +V CGPGHGIS+GSLGK   E DV+G+ V+N T + T NG RIKT+  S  
Sbjct  329   KGSTNIAINKVICGPGHGISVGSLGKYENEEDVRGIIVKNTTFLKTDNGIRIKTWPGSTP  388

Query  476   LKASGIIFEDIMLHNVTRPIIIDQDY-NSKNRKEASKVKLKDVRFRNIRGTASKKHPAIS  300
              +ASG+IF+D+ + NV  PIIIDQ Y  S  +K+ S+VK+ +V + N+RGT+S    A+ 
Sbjct  389   SQASGMIFQDLFMDNVRNPIIIDQGYCPSGCKKQPSRVKISNVHYINVRGTSSSDV-AVD  447

Query  299   LICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPGGSC  147
              +CS   PC+++ L +ID+    GKG       C NA     G  NP  +C
Sbjct  448   FMCSPQYPCDNIHLYNIDL-KYTGKGPATA--TCSNARVGYGGLINPHVTC  495



>gb|KFK28496.1| hypothetical protein AALP_AA7G003400 [Arabis alpina]
Length=426

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 228/373 (61%), Gaps = 8/373 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKV-VIPRGTFLAGEVVFQGPCT-AK  1083
             I +V  FGA+ + + D T A + AW+KAC S   + + +IPRG F  G + F GPCT   
Sbjct  51    IVNVISFGARANNQKDQTKAFVAAWDKACKSSSRSVLFIIPRGEFYVGPLRFSGPCTNVT  110

Query  1082  RIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
              + ++++G + A +DLS Y S   W     + G+ +TGGGT +G+G   W ++      N
Sbjct  111   NLTVQVEGHLKASTDLSKYRSGSGWIEFGWINGLTLTGGGTFDGQGALAWPYNNCASDHN  170

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
               LLP SL F G+NR+ +  I  VNSK FH+ + +C DF  ++L ITAP  SPNTDGIHI
Sbjct  171   CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALVECRDFKGTRLNITAPSYSPNTDGIHI  230

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               S+NV  +   + TGDDCVSIG G + + +T + CGPGHGIS+GSLG+   E DVKG+ 
Sbjct  231   ERSSNVYFSRSRIATGDDCVSIGQGNSQITITSIKCGPGHGISVGSLGRYPNEKDVKGLV  290

Query  545   VRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             VR+C + GTTNG RIKT+  SP L  A+ + F++I++ NVT PIIIDQ Y   +S     
Sbjct  291   VRDCKMSGTTNGIRIKTWADSPGLSAATNMTFQNIIMSNVTNPIIIDQSYCPFSSCTSNV  350

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
              SKVKL ++ F+NIRGT+S K  A+ L CS+  PC+ V L ++ +  +  +G     + C
Sbjct  351   PSKVKLSEIYFKNIRGTSSSK-VAVQLHCSRGRPCQKVYLENVHLEQSENRGNEAVSSSC  409

Query  197   VNAETIVKGKRNP  159
              N      G + P
Sbjct  410   RNVRANYIGTQIP  422



>ref|XP_011000860.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=428

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/362 (43%), Positives = 235/362 (65%), Gaps = 12/362 (3%)
 Frame = -1

Query  1286  IPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             I   +G+   +FDV +FGA+ DG+ D + A I AW +AC + G  K++IP+G +L G V 
Sbjct  46    ISHHKGNNSLLFDVKRFGARADGRTDDSKAFIAAWKEACGATGKVKLLIPKGMYLIGPVK  105

Query  1106  FQGPC-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQ  933
             F GPC     + + +KG + A + LS Y S   W     +  + +TGGGT +G+G   W 
Sbjct  106   FAGPCKNVSSLTVYMKGYLKATAKLSRYGSGTGWVEFGWLERLTLTGGGTFDGQGAKAWP  165

Query  932   FDA--DEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAP  759
             ++   D K K   LLP ++ F  +N++ +  I  +NSK FH+ + +C +F  +K++I+AP
Sbjct  166   YNCTNDSKCK---LLPTNVKFVAMNQTVVQGITSLNSKFFHIALVECKNFKGTKIKISAP  222

Query  758   GDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGK  579
              DSPNTDGIH+  S++V ++  ++GTGDDC+SIG G + + +TR+ CGPGHGIS+GSLG+
Sbjct  223   ADSPNTDGIHVERSSSVYISQSLIGTGDDCISIGQGNSQVTITRIKCGPGHGISVGSLGR  282

Query  578   RAQETDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQD  402
                E DV G+ VR+C + GTTNG RIKT+  SP    A+ + FE+I+++NVT PIIIDQ 
Sbjct  283   YEDEGDVSGLVVRDCAMSGTTNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQS  342

Query  401   Y---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAA  231
             Y   +S    E SKVKL D+ F+ IRGT+S    A++L CS+ +PC+++ L ++ +  ++
Sbjct  343   YCPFSSCISTEPSKVKLSDIYFKQIRGTSSSA-VAVALECSKGIPCQNIYLENVHLELSS  401

Query  230   GK  225
             G+
Sbjct  402   GE  403



>ref|XP_009589812.1| PREDICTED: exopolygalacturonase-like [Nicotiana tomentosiformis]
Length=400

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 233/372 (63%), Gaps = 12/372 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKR  1080
              F+V  +GA  D K D++ A ++AW  AC  RG + V+IP GT++   V F+GPC +  R
Sbjct  31    FFNVLDYGAVADEKRDNSQAFLKAWEDACQWRGRSMVLIPYGTYMLRSVSFEGPCRSLMR  90

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              VI  KG + A +  S++ +N W    ++ G+ V GGG ++G+G   W ++   K  +  
Sbjct  91    FVI--KGVLKAPTSPSLFNTNTWIGFRYINGLVVKGGGYLDGQGASAWPYNDCSKNPHCM  148

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LPV+L F  V  S IH ++ +NSK  H+ +  CN+ N+S +R+TAPGDSPNTDGIHI  
Sbjct  149   PLPVTLRFDFVTNSRIHHLRSINSKNSHINLFACNNINISFVRMTAPGDSPNTDGIHIGD  208

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             STN+ ++  V+ TGDDC+S+  G+ N+ ++ VTCGPGHGISIGSLGK   E  V G+ VR
Sbjct  209   STNIRISRTVIQTGDDCISMVTGSRNIDISDVTCGPGHGISIGSLGKSPGEF-VTGINVR  267

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY-----NSKNRKEA  375
             NCT IGT NGARIKT+  S   +AS I F DI + NV  P++IDQ Y      S   ++ 
Sbjct  268   NCTFIGTQNGARIKTWAPSLSSEASDIFFGDIYMQNVNNPVLIDQQYCPYPSCSNLGQDN  327

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             SKV++ +V F NI GT+S K  AISL CS+ VPC++V+L +I++      G     + C+
Sbjct  328   SKVQISNVTFSNIWGTSSSK-VAISLKCSKLVPCKNVQLNNINLAYHGRGGP--ATSSCL  384

Query  194   NAETIVKGKRNP  159
             N      GK++P
Sbjct  385   NVIGASYGKQSP  396



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/369 (44%), Positives = 228/369 (62%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GAK DG  D + A++ AW +AC S   AKV+IP GTF   EV   GPC A  +
Sbjct  24    VFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAP-V  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               E++GT+ A +D S++ ++ W + + + G+ V+GGGT +G+G+  W  +   K  N   
Sbjct  83    EFELQGTLKAPADPSLFKTDGWVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V  + IHD+  ++SK F + V    +       + AP DS NTDGIHI  S
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V+GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+IG  NG RIKT+ AS    AS + FEDI + NV  P+I+DQ Y   ++ +A   S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAGVPSLI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+ IRGT S    A+ ++CSQ+VPC++VE+ADID+V    +G     ++C N +
Sbjct  323   KISKVSFKKIRGT-SASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPAT--SECANVK  379

Query  185   TIVKGKRNP  159
              ++ GK NP
Sbjct  380   PVLSGKLNP  388



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 232/370 (63%), Gaps = 9/370 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              D+ KFGAK DGK D + A+  AW +AC S   + VVI +G ++ G V FQGPC A  + 
Sbjct  27    IDIKKFGAKADGKTDDSQAINSAWKEACTSATPSTVVIAKGNYMVGPVKFQGPCKAP-VS  85

Query  1073  IEIKGTMVADSDLS-VYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             + ++GT+ A ++   + + + W I +++  + V+GGGT +G+G   W  +   K      
Sbjct  86    LRVEGTLQAPAEPEKLKSQDGWVIFQNIDALSVSGGGTFDGQGSIAWSKNDCAKTGKCNS  145

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+SL   G+  + I DI   NSK FHM + +C +  +  + I APG+S NTDGIHI  S
Sbjct  146   LPISLRLTGLTNAHIQDITSTNSKLFHMNILNCKNVTLQHVTIKAPGESLNTDGIHIGRS  205

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             TN+N+T   + TGDDCVSIGDG+  + + +VTCGPGHGISIGSLG+   E  V+GVTVRN
Sbjct  206   TNINITGAEIQTGDDCVSIGDGSQQINIEKVTCGPGHGISIGSLGRYHDEQPVRGVTVRN  265

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNV-TRPIIIDQDYNSKNRKEA---SK  369
             CT+  T+NG R+KT+ ASP   AS + FEDI++ NV T P++IDQ+Y    + +A   S+
Sbjct  266   CTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTTSPVLIDQEYCPNGQCQAKMPSR  325

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             VK+ +V F+NIRGT S    A+ L CS+ +PC++VE++DI++      G     + C N 
Sbjct  326   VKISNVSFKNIRGT-SADPVAVKLACSKGIPCQNVEISDINLTCNGKNGTCT--SVCSNV  382

Query  188   ETIVKGKRNP  159
                V GK  P
Sbjct  383   NPTVTGKVIP  392



>ref|XP_010266273.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=428

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 229/371 (62%), Gaps = 10/371 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCT-AKRI  1077
             F+V  +GAK DGK D + A   AW  AC + G   + IP+ T+L G V F GPCT  K I
Sbjct  57    FNVISYGAKGDGKHDDSQAFAEAWKAACGASGTVTLEIPKATYLVGPVKFSGPCTNVKSI  116

Query  1076  VIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              +++KG + A +DL +Y  ++ W     V G+ +TG GT +G+G + W F+     KN  
Sbjct  117   TVDMKGYLKATTDLKMYGKTDDWIEFGWVDGLTLTGDGTFDGQGAESWSFNKCPVTKNCQ  176

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             +LP ++ F  +  + +  I  +NSK FHM + DC +F  S++RI+AP +SPNTDGIHI  
Sbjct  177   VLPTNVKFVAMTNTVVRGITSLNSKFFHMGLIDCKNFVGSEIRISAPENSPNTDGIHIER  236

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
              T V +    +GTGDDC+SIG G + + ++ VTCGPGHGISIGSLG+   E DV GVTVR
Sbjct  237   CTGVEIYHSSIGTGDDCISIGHGNSQVTISGVTCGPGHGISIGSLGRYQNEGDVTGVTVR  296

Query  539   NCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDYN---SKNRKEAS  372
             +CT+ GTTNG RIKT+  SP    AS + F+DI+++NV  PIIIDQ Y    S +    S
Sbjct  297   DCTISGTTNGVRIKTWENSPSSTVASNMTFQDIVVNNVANPIIIDQTYCPYVSCSSTAPS  356

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
             +VKL+D+ F+NIRGT+S    A+ L CS+ VPC++V L D+ I    G       + C N
Sbjct  357   RVKLQDLHFKNIRGTSSSP-VAVMLECSKGVPCQNVNLHDVHIELMTGGTAK---SSCQN  412

Query  191   AETIVKGKRNP  159
              +    G + P
Sbjct  413   IKATYSGTQIP  423



>ref|XP_008805455.1| PREDICTED: exopolygalacturonase-like [Phoenix dactylifera]
Length=404

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 230/371 (62%), Gaps = 10/371 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRI  1077
             F+V  FGA+ +G  D + A + AW  AC S GA  +VIP GT+    + F+GPC   + +
Sbjct  34    FNVMNFGARGNGVTDDSQAFLAAWKAACASTGAVNLVIPSGTYFLNPIKFRGPCKNVQSL  93

Query  1076  VIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              +++KGT+ A +DL  Y TS  W     V G+ +TGGGT NG+GE  W  +   K KN  
Sbjct  94    TVQMKGTLKASTDLKQYKTSGVWVEFGWVDGLTLTGGGTFNGQGEVTWPLNTCPKQKNCK  153

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             + P SL+F   N + ++ IK VNSK FH+ V  C +F  S ++ITAP +SPNTDGIH+  
Sbjct  154   IPPTSLMFVNTNNTIVNGIKSVNSKFFHIGVLGCQNFQGSGIKITAPAESPNTDGIHLER  213

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             ++ VN+++  + TGDDCVS+G G + + +  + CGPGHGIS+GSLGK   E DV+G+ V+
Sbjct  214   NSGVNISNSEIATGDDCVSVGQGNSYITLNGIKCGPGHGISVGSLGKYKDEKDVQGLIVQ  273

Query  539   NCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQD---YNSKNRKEAS  372
             +CTL  T NG RIKT+  SP     + + FE+I+++NV  PIIIDQ    Y S     +S
Sbjct  274   DCTLTETDNGIRIKTWANSPTNSICANMTFENIVMNNVANPIIIDQSYCPYASCQSSASS  333

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
             KVK+ D+ F+NI GT SK   A++L CS+ +PCE V L D+D+ +  G+        C+N
Sbjct  334   KVKISDIHFKNITGT-SKTPVAVTLRCSKGIPCERVSLDDVDL-NFTGENSTFA--TCLN  389

Query  191   AETIVKGKRNP  159
              +    G +NP
Sbjct  390   VKAEYTGTQNP  400



>gb|EMS56561.1| Exopolygalacturonase [Triticum urartu]
Length=420

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 221/342 (65%), Gaps = 7/342 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             +D+TK GAKPDG  D T A+  AW  AC S G   ++IP+G FL G + F GPC    + 
Sbjct  50    YDITKLGAKPDGTTDCTEAVEEAWASACGSTGNPTIIIPKGDFLTGALNFTGPCKGDGLT  109

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I+++G ++A +DL+ + SN W  I  V  + +TG G I+G+G+ VW  ++ +K  N  +L
Sbjct  110   IKLEGNLLASNDLAKFKSN-WIEIMRVKKLSITGKGNIDGQGKAVWTKNSCQKNYNCKIL  168

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+    + + I  I  +NSK FHM +  C    V  ++++APGDSPNTDGIH+  S+
Sbjct  169   PNSLVLDFCDDALIEGISIINSKFFHMNIFQCKGVIVKDVKVSAPGDSPNTDGIHMGDSS  228

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV++ D  +G GDDC+S+G GTT + ++ VTCGPGHGISIGSLG+   E DV  +TV+NC
Sbjct  229   NVSIIDTTIGVGDDCISMGPGTTKVNISGVTCGPGHGISIGSLGRYKDEKDVTDITVKNC  288

Query  533   TLIGTTNGARIKTYR-ASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK----NRKEASK  369
              L G++NG RIK+Y  A   L AS I +E++ + +   PIIIDQ Y       ++ +A +
Sbjct  289   VLKGSSNGLRIKSYEDAKSPLVASKITYENVKMEDSGNPIIIDQKYCPNKLCTSKGDADR  348

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             V +KDV F+NI GT+S    A+SL+CS+  PCE + ++D+ I
Sbjct  349   VTVKDVTFKNITGTSSTPE-AVSLLCSEKKPCEGITMSDVKI  389



>ref|XP_002273801.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI27302.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 224/341 (66%), Gaps = 4/341 (1%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  +GA  +G  D++ A+ RAWN+ACH +G   V+IPRGT++   V FQGPC+ + +
Sbjct  29    VFNVMNYGAIANGHYDNSEALGRAWNEACHWKGTGVVLIPRGTYMVHPVKFQGPCSGRTM  88

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +   G ++A +D ++  ++ W   + + G+ V+GGG+ NG+GE VW  +   K  N   
Sbjct  89    FLN-TGEVLAPTDPALIHADNWIAFQEIDGLRVSGGGSFNGQGEKVWHNNVCHKNYNCKP  147

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             L  SL F+ V    I  I  +NSK FH  + D    +++ ++I AP +SPNTDGIHI  S
Sbjct  148   LSSSLSFKFVTNGRIDHITSINSKMFHFNIYDNQKISINHVKILAPAESPNTDGIHIGRS  207

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              ++ +T+  + TGDDC+S+  G+ ++ +  V CGPGHGIS+GSLGK   E +V+G+TVRN
Sbjct  208   NDIRITNSEIRTGDDCISLKQGSRDIHIQNVQCGPGHGISVGSLGKDEGEEEVRGITVRN  267

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY--NSKNRKEASKVK  363
             CT  G+ NG RIKT+ AS +  AS   FEDI++ NV  PI IDQ+Y  +    +  S+V+
Sbjct  268   CTFQGSDNGLRIKTWAASTRNIASDFTFEDIVVENVRNPINIDQEYCPHPPCNEGESQVE  327

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIV  240
             +K+V+FRNIRGT+S K  A+SLICS  +PC D+EL +ID+V
Sbjct  328   IKNVKFRNIRGTSSTK-VAVSLICSSRIPCSDIELHNIDLV  367



>emb|CDY01524.1| BnaC07g35140D [Brassica napus]
Length=405

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 233/382 (61%), Gaps = 8/382 (2%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNK  1176
             ME     ++ +L   + S+    +  G   +    DV  FGA+ +   D+T A + AW+K
Sbjct  1     MEFTIIHYLRVLFFFIASSSYSFVVPGDKSSVLTVDVRSFGARANDHRDNTKAFVAAWDK  60

Query  1175  ACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSNY-WFI  1005
             AC S  ++  ++IPRG F  G + F GPCT    + + +KG + A +DLS Y S   W  
Sbjct  61    ACTSSSSSVDLIIPRGEFHVGPLRFSGPCTNVTHLTVRVKGHLKASTDLSKYRSGGGWIE  120

Query  1004  IEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSK  825
                + G+ +TGGGT +G+G   W F+      +  LLP SL F G+NR+ +  I  VNSK
Sbjct  121   FGWINGLTLTGGGTFDGQGALAWPFNNCTTDSHCKLLPTSLKFVGMNRTVVRRISSVNSK  180

Query  824   GFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTT  645
              FH+ +  C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCVSIG G +
Sbjct  181   FFHIALVQCRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCVSIGQGNS  240

Query  644   NLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLK-A  468
              + +T + CGPGHGIS+GSLG+   E DVKG+ VR+C + GTTNG RIKT+  SP L  A
Sbjct  241   QITITSIKCGPGHGISVGSLGRYPNEKDVKGLVVRDCKMSGTTNGIRIKTWADSPGLSAA  300

Query  467   SGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISL  297
             + + F++I++ NVT PIIIDQ Y   +S      SKVKL ++ F+NIRGT+S K  A+ L
Sbjct  301   TNMTFQNIIMSNVTNPIIIDQSYCPFSSCTSSVPSKVKLSEIYFKNIRGTSSSK-VAVQL  359

Query  296   ICSQTVPCEDVELADIDIVSAA  231
              CS+ +PC+ V L ++ +  A+
Sbjct  360   HCSEGMPCKKVYLENVHLYLAS  381



>gb|AEW90949.1| polygalacturonase R2-7 [Secale cereale x Triticum turgidum subsp. 
durum]
Length=415

 Score =   303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 219/342 (64%), Gaps = 7/342 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             +D+ K GAKPDGK D T  +  AW  AC   G   +VIP+G FL G + F GPC    + 
Sbjct  45    YDIAKLGAKPDGKTDCTKEVEEAWASACGGTGKQTIVIPKGDFLTGALNFTGPCKGDGVT  104

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I+++G ++A +DL+ + SN W  I  V  + +TG G I+G+G+ VW  ++ +K  N  +L
Sbjct  105   IKLEGNLLASNDLAKFKSN-WIEIMRVKNLVITGKGNIDGQGKAVWTKNSCQKNYNCKIL  163

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+    + + I  I  +NSK FHM + +C    V  ++++APGDSPNTDGIH+  S+
Sbjct  164   PNSLVLDFCDDALIEGISIINSKFFHMNIYECKGVTVKDVKVSAPGDSPNTDGIHMGDSS  223

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV++ D  +G GDDC+SIG GT  + ++ VTCGPGHGISIGSLG+   E DV  +TV+NC
Sbjct  224   NVSIIDTTIGVGDDCISIGPGTKQVNISGVTCGPGHGISIGSLGRYKDEKDVTDITVKNC  283

Query  533   TLIGTTNGARIKTYR-ASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK----NRKEASK  369
              L G+TNG RIK+Y  A   L AS I +E+I + +   PIIIDQ Y       ++ ++++
Sbjct  284   VLKGSTNGLRIKSYEDAKSPLIASKITYENIKMDDSGYPIIIDQKYCPNKLCTSKGDSAR  343

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             V +KDV F+NI GT+S    A+SL+CS   PCE + ++D+ I
Sbjct  344   VTVKDVTFKNITGTSSSPE-AVSLLCSDKKPCEGITMSDVKI  384



>dbj|BAK06865.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   303 bits (777),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 218/342 (64%), Gaps = 7/342 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             +D+TK GAKPDGK DST A+  AW  AC   G   +VIP+G FL G + F GPC    + 
Sbjct  62    YDITKLGAKPDGKTDSTKAVEEAWASACGGTGKQTIVIPKGDFLTGALNFTGPCKGDGVT  121

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I+++G ++A +DLS + SN W  I  +  + +TG G+I+G+G+ VW  ++ +K  N  +L
Sbjct  122   IKLEGNLLASNDLSKFPSN-WIEIMRIKNLVITGKGSIDGQGKAVWTKNSCQKNYNCKIL  180

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+    + + I  I  +NSK FHM + +C    V  +++ APGDSPNTDGIH+  S+
Sbjct  181   PNSLVLDFCDDALIEGISIINSKFFHMNIYECKGVTVKDVKVNAPGDSPNTDGIHMGDSS  240

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NVN+ D  +  GDDC+SIG G+  + ++ VTCGPGHGISIGSLG+   E DV  + V+NC
Sbjct  241   NVNIIDTTIAVGDDCISIGPGSKQVNISGVTCGPGHGISIGSLGRYKDEKDVTDIHVKNC  300

Query  533   TLIGTTNGARIKTYRASPQ-LKASGIIFEDIMLHNVTRPIIIDQDYNSKN----RKEASK  369
                G+TNG RIK+Y  S   L AS I +E+I + +   PIIIDQ Y        + ++S+
Sbjct  301   VFKGSTNGLRIKSYEDSKSPLVASKISYENIKMDDSGYPIIIDQKYCPNKLCTAKGDSSR  360

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             V +KDV F+NI GT+S    A+SL+CS   PCE V ++D+ I
Sbjct  361   VTVKDVTFKNITGTSSTPE-AVSLLCSDKKPCEGVTMSDVKI  401



>ref|XP_007035658.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY06584.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=426

 Score =   303 bits (776),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 228/371 (61%), Gaps = 7/371 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRI  1077
             F+V  +GAK DGK DS++  IRA+  AC+  G A +VIP G FL G V+F GPC     +
Sbjct  53    FNVLDYGAKADGKTDSSINFIRAFKAACNYNGNAMMVIPDGNFLIGPVIFSGPCFNPSPL  112

Query  1076  VIEIKGTMVADSDLSVYTSNY----WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
             +I+  G + A SD+S Y        W   + + G+ +TG GT +G+G +VW+++   K  
Sbjct  113   IIQANGMVKAQSDISYYAGGADDTDWITFQSIDGLILTGHGTFHGQGAEVWKYNNCGKKS  172

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             N   LP +L F  VN + I  I  ++ KGFH+ +S   +F +  +++ AP +SPNTDGIH
Sbjct  173   NCVRLPATLKFIKVNDAIIRGITSIDPKGFHIFISMSQNFRIFNIKLVAPAESPNTDGIH  232

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             +S S  V ++  +V TGDDCVS+  G+TN+ V +V CGPGHG SIGSLG    E DVKG+
Sbjct  233   MSKSNLVKISKSIVATGDDCVSMIQGSTNISVKKVFCGPGHGFSIGSLGHYDAEADVKGI  292

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASK  369
              V+NC+L  T NG RIKTY+ S   KAS IIF DI++  V  PIIIDQ+Y ++   E SK
Sbjct  293   VVKNCSLTDTDNGLRIKTYKNSSPSKASSIIFRDIVMTRVKNPIIIDQEYGNRRSNEPSK  352

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK-PNKCVN  192
             V + DV + NIRGT   K  A+ L CS + PC+ + L ++++  A     +L   + CVN
Sbjct  353   VSISDVFYTNIRGTTISK-VAVDLTCSLSNPCQGIHLNNVNLQYAGLPNDNLPFSSNCVN  411

Query  191   AETIVKGKRNP  159
             A+    G ++P
Sbjct  412   AKVAYVGAQSP  422



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   304 bits (778),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 161/411 (39%), Positives = 243/411 (59%), Gaps = 7/411 (2%)
 Frame = -1

Query  1379  VEHIYVATMEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTM  1200
             ++ IY    E +   +V +  I++L   +  +         + D+ K+GA      D T 
Sbjct  48    IQWIYNEEAEERRQQWVEMGKISILPAAIALLFFASTARSLVCDIAKYGAGGGTSSDITQ  107

Query  1199  AMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTS  1020
             A++ AW +AC +  A+KV++P GT++  EVV +GPC +  I +++ GT+ A +D +   +
Sbjct  108   ALVSAWKEACAATEASKVLVPAGTYVLREVVLEGPCKSS-IEVQVDGTLQAPADPAQMKT  166

Query  1019  NYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIK  840
             + W     V  + ++G GT +G+G+  W  +      +   LP+++ F  V    + DI 
Sbjct  167   DGWVAFRGVDLLTLSGSGTFDGQGKTAWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDIT  226

Query  839   FVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSI  660
              ++SK FH+ V +C +     + ITAPGDSPNTDGIHI  ST +N+ D  + TGDDC+SI
Sbjct  227   SLDSKQFHVNVLNCKNLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISI  286

Query  659   GDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASP  480
             GDG+  + +T VTCGPGHGIS+GSLGK   E  V G+ V+NCT+ GT NG RIKT+ ASP
Sbjct  287   GDGSEQMTITGVTCGPGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASP  346

Query  479   QLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKVKLKDVRFRNIRGTASKKHP  309
                AS + FEDI L NV  P+IIDQ Y   N+   +  S++K+ +V F  IRGT+S +  
Sbjct  347   AGTASDMHFEDITLDNVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQA-  405

Query  308   AISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPG  156
             A++L CS  +PC +VE++DIDI     +G     + C N +  + GK+NP 
Sbjct  406   AVTLACSSRLPCTEVEISDIDIAYHGPEGPAT--SVCSNVKPTISGKQNPA  454



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   303 bits (775),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 234/370 (63%), Gaps = 13/370 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GAKP+   D T A+  AW +AC S    K+VIP GT+  G +  +G C +  I
Sbjct  54    IFDVTKYGAKPNA--DITQALADAWKEACASTSPCKIVIPTGTYKLGTIELKGECKSP-I  110

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              I+++GT+ A  DL   T   W   +++  + VT GG  +G+G+  W+ +  +K      
Sbjct  111   EIQVQGTLQAPPDL---TGEDWVHFKYIDYLSVTSGGVFDGQGKQAWESNDCDKNPKCAR  167

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             +P++L F  +  + + DI   +SK FH++V  CN+     + + AP  S NTDGIHI  S
Sbjct  168   IPMNLKFSFIKNAIVSDITSKDSKNFHIQVLGCNNLTFQHVNVNAPETSINTDGIHIGRS  227

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               +N+ +  +GTGDDC+S+GDG+  + +T VTCGPGHGIS+GSLG+   E  V+G+ V+N
Sbjct  228   LGINILNTNIGTGDDCISLGDGSKQVTITNVTCGPGHGISVGSLGRYNLEEPVEGLQVKN  287

Query  536   CTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQD---YNSKNRKEASK  369
             CTL GTTNG RIKT+ ASP    AS + +ED++++NV  PI+IDQ+   YN  N++  SK
Sbjct  288   CTLTGTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCPYNQCNKQVPSK  347

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             VK+  V F+NIRGT S    A++L+CS + PC+ VELADID+  +  +G     ++C N 
Sbjct  348   VKISKVSFKNIRGT-SGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGPIT--SRCANV  404

Query  188   ETIVKGKRNP  159
             +  V GK+NP
Sbjct  405   KPTVSGKQNP  414



>gb|AAQ63000.1| oil palm polygalacturonase allergen PEST643 [Elaeis guineensis]
Length=433

 Score =   303 bits (775),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 227/371 (61%), Gaps = 10/371 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             F+V KFGA  DGK D + A ++AW  AC   G  K+VIPRG +L   + F+GPC     V
Sbjct  62    FNVKKFGAAADGKSDDSAAFLKAWETACPLEGRKKIVIPRGEYLVNPIRFEGPCNGLMEV  121

Query  1073  IEIKGTMVADSDLSVYTSN---YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             + + G + A  D++V+       W    H+  + +TG GT +G+G   WQ +   K K+ 
Sbjct  122   L-LSGVVKAQPDINVFNQQGHKEWITFNHIDRLLITGAGTFDGQGSYAWQHNTCSKKKDC  180

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LLP +L    V R+ +  I  V+SK F M +   N+  + +++I AP ++PNTDGIHI 
Sbjct  181   SLLPGNLRLNFVARATVRGISVVDSKSFQMTIFGSNNVRIHRIKIIAPEEAPNTDGIHIG  240

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              STNV +TD  +GTGDDC+S+G G+  +LV+ V+CGPGHGISIGSLG+   E DV GVTV
Sbjct  241   NSTNVRITDSEIGTGDDCISVGPGSRQILVSGVSCGPGHGISIGSLGRYHNEPDVSGVTV  300

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEAS  372
             +NCTL GTTNG R+KT++ S   +AS   FE+++++ V  PII+DQ+Y    +  +   S
Sbjct  301   KNCTLTGTTNGLRVKTWQNSESSRASDFHFENVVMNGVQNPIIVDQEYCPVGNCEKGAPS  360

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
              V++ +V F+NIRGT++ +  A+ L CS+TV C++V L DID+         L   +C  
Sbjct  361   LVEISNVTFQNIRGTSASRM-AVHLFCSKTVNCKNVILQDIDLKFVDANSPSLA--QCYY  417

Query  191   AETIVKGKRNP  159
             A+    G  NP
Sbjct  418   AQGTAAGYMNP  428



>ref|XP_010913952.1| PREDICTED: exopolygalacturonase-like [Elaeis guineensis]
Length=433

 Score =   303 bits (775),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 227/371 (61%), Gaps = 10/371 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             F+V KFGA  DGK D + A ++AW  AC   G  K+VIPRG +L   + F+GPC     V
Sbjct  62    FNVKKFGAAADGKSDDSAAFLKAWETACPLEGRKKIVIPRGEYLVNPIRFEGPCNGLMEV  121

Query  1073  IEIKGTMVADSDLSVYTSN---YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             + + G + A  D++V+       W    H+  + +TG GT +G+G   WQ +   K K+ 
Sbjct  122   L-LSGVVKAQPDINVFNQQGHKEWITFNHIDRLLITGAGTFDGQGSYAWQHNTCSKKKDC  180

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LLP +L    V R+ +  I  V+SK F M +   N+  + +++I AP ++PNTDGIHI 
Sbjct  181   SLLPGNLRLNFVARATVRGISVVDSKSFQMTIFGSNNVRIHRIKIIAPEEAPNTDGIHIG  240

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              STNV +TD  +GTGDDC+S+G G+  +LV+ V+CGPGHGISIGSLG+   E DV GVTV
Sbjct  241   NSTNVRITDSEIGTGDDCISVGPGSRQILVSGVSCGPGHGISIGSLGRYHNEPDVSGVTV  300

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEAS  372
             +NCTL GTTNG R+KT++ S   +AS   FE+++++ V  PII+DQ+Y    +  +   S
Sbjct  301   KNCTLTGTTNGLRVKTWQNSESSRASDFHFENVVMNGVQNPIIVDQEYCPVGNCEKGAPS  360

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
              V++ +V F+NIRGT++ +  A+ L CS+TV C++V L DID+         L   +C  
Sbjct  361   LVEISNVTFQNIRGTSASRM-AVHLFCSKTVNCKNVILQDIDLKFVDANSPSLA--QCYY  417

Query  191   AETIVKGKRNP  159
             A+    G  NP
Sbjct  418   AQGTATGYMNP  428



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 232/371 (63%), Gaps = 14/371 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDVTKFGA P+G  D + A++ A+ +AC S  A+++++P+G F   +V  +GPC A  +
Sbjct  14    VFDVTKFGATPNG--DISKAILDAFKEACASTSASRIIVPKGRFQMKQVKLEGPCKAP-L  70

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               +++GT+ A  D  +     WF + ++    ++G G  +G+G+  W  +   K K A  
Sbjct  71    EFQLQGTLEASPDPKILPEGEWFTVNYLNQFTLSGTGIFDGQGKAAWAQNDCAKTKCA-H  129

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  +N S I DI   +SK FHM V+ CN+   +++ ITAP +S NTDGIH++ S
Sbjct  130   LPYNLSFNFLNSSTIQDITSKDSKNFHMNVNGCNNLTFNRITITAPKESINTDGIHVARS  189

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              NVN+TD V+GTGDDC+S+GD    L +T+VTCGPGHGIS+GSLGK   E  V GV V+N
Sbjct  190   KNVNITDSVIGTGDDCISVGDELEQLHITKVTCGPGHGISVGSLGKTPGEKPVVGVYVKN  249

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQ---DYNSKNRKEASKV  366
             CT I T NG R+KT+ AS Q   + + +EDI++ NV+ PI+IDQ    YN  N+   S V
Sbjct  250   CTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVYCPYNQCNKDLPSLV  309

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK--CVN  192
             K+  V  +N++GT S+   A+ L+CS+ VPCE VE+ DIDI     +G    P K  C N
Sbjct  310   KISKVSIKNVKGT-SRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEG----PAKTSCEN  364

Query  191   AETIVKGKRNP  159
              +    G +NP
Sbjct  365   VKPTFVGNQNP  375



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 225/353 (64%), Gaps = 11/353 (3%)
 Frame = -1

Query  1259  TIFDVTK--FGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
             ++FDVT   +GAKP    D + A+ +AW+ AC S  A+KVV+P GT+   E  F+GPC A
Sbjct  25    SVFDVTSATYGAKPGS--DVSTALAKAWSDACASPSASKVVVPSGTYNLKEANFRGPCKA  82

Query  1085  KRIVIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
               I ++++GT+ A +D    T  + W   +++  + ++GGGT +G+G   W  +   K K
Sbjct  83    P-IEMQVQGTLQAPADAGQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNK  141

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             N   +PV+L F+ +  S + DI  +NSK FHM V  CN     +L ITAP DS NTDGIH
Sbjct  142   NCKPIPVNLRFEFLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIH  201

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             I  ST +N+T   +GTGDDC+SIGD +  + VT VTCGPGHGISIGSLGK   E DV G+
Sbjct  202   IGASTGINITHAKIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGI  261

Query  548   TVRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQ---DYNSKNRK  381
              V+NCTL  T NG RIKT+  SP    ASGI +EDI++ NV+ PI++DQ    Y    +K
Sbjct  262   IVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQK  321

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
               SKVK+ +V F+NI+G +S    A+ L+C+  +PCE+VEL DID+     KG
Sbjct  322   PPSKVKISNVSFKNIKG-SSFTPLAVKLVCTTGIPCENVELIDIDLTYGGDKG  373



>ref|XP_002516967.1| Exopolygalacturonase clone GBGE184 precursor, putative [Ricinus 
communis]
 gb|EEF45581.1| Exopolygalacturonase clone GBGE184 precursor, putative [Ricinus 
communis]
Length=412

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 227/372 (61%), Gaps = 8/372 (2%)
 Frame = -1

Query  1274  RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             R     +F+V +FGAK D + D+ +A I+AW   C+  G A++V+P G FLA  +VFQGP
Sbjct  45    RNPNEKVFNVLQFGAKHDPRKDNALAFIQAWKATCNWAGNARLVVPGGEFLASSMVFQGP  104

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C     +++I GT+ A SDLS Y  ++W   E V G+ VTG GT++G+G++VW+++    
Sbjct  105   CKNPAPIVQIIGTIKAVSDLSNYAEDFWISFEKVNGLIVTGTGTVDGQGQNVWKYNDG--  162

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                  + P ++    V+   I  I  VN  GFH+ +    +    +L + AP  SPNTDG
Sbjct  163   --GGSIFPANIKLLHVSNGIIRQINSVNPMGFHIGIVLSQNIRARRLHLNAPESSPNTDG  220

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
              HIS S  V +   V+ TGDDCV +  G+T++ + +VTCGPGHGISIGSLGK   E DV+
Sbjct  221   FHISQSNQVKIAKSVIATGDDCVGMIHGSTDISIKKVTCGPGHGISIGSLGKYPDEKDVR  280

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA  375
             G+ V NCTL  T NG RIKT+  SP   A+ + F+DI++ NV  PIIIDQ Y SK+    
Sbjct  281   GILVTNCTLKNTDNGIRIKTWGGSPPSVATSLTFQDIIMDNVRHPIIIDQSYGSKS--AP  338

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S+VK+ +V++ NIRGT + +   + + CS+ VPCE V L++I++    GK +    + C+
Sbjct  339   SRVKISNVKYMNIRGTTNSEV-GVDIQCSKQVPCEGVRLSNINLKYIGGKKLPFS-SSCL  396

Query  194   NAETIVKGKRNP  159
             NA     G + P
Sbjct  397   NARVSYAGMQFP  408



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/403 (42%), Positives = 238/403 (59%), Gaps = 19/403 (5%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDV-TKFGAKPDGKGDSTMAMIRAWN  1179
             + I   +FV+LL   L  +  +  P         FDV  KFGAK DGK D +   + AW 
Sbjct  5     LNIVPSMFVLLL---LFISASKVQPDA-------FDVVAKFGAKADGKTDLSKPFLDAWK  54

Query  1178  KACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIE  999
             +AC S   + VVIP+GT+L  +V  +GPC A  I I ++GT+ A +D S +    W    
Sbjct  55    EACASVTPSTVVIPKGTYLLSKVNLEGPCKAP-IEINVQGTIQAPADPSAFKDPNWVRFY  113

Query  998   HVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGF  819
              V   ++ GGG  +G+G   ++ +  E  +    LPV++ F  V  + I DI   +SK F
Sbjct  114   SVENFKMFGGGIFDGQGSIAYEKNTCENREFRSKLPVNIRFDFVTNALIQDITSKDSKLF  173

Query  818   HMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNL  639
             H+ V  C +  + +L+I AP +SPNTDGIH+  S  VN+    + TGDDC+SIGDGT N+
Sbjct  174   HINVFACKNITLERLKIEAPDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNM  233

Query  638   LVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGI  459
             ++  +TCGPGHGISIGSLGK   E  V+G+ + NCT+  T+NGARIKT+        S I
Sbjct  234   VIKEITCGPGHGISIGSLGKFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEI  293

Query  458   IFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICS  288
              FEDI ++NV+ PI+IDQ Y   N   + E SKVKL ++ F+NIRGT++    AI  ICS
Sbjct  294   HFEDITMNNVSSPILIDQQYCPWNKCKKNEESKVKLSNISFKNIRGTSALPE-AIKFICS  352

Query  287   QTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              + PC++VELADIDI      G     ++C+N + I  GK NP
Sbjct  353   GSSPCQNVELADIDI---QHNGAEPATSQCLNVKPITIGKLNP  392



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/371 (44%), Positives = 231/371 (62%), Gaps = 9/371 (2%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T FDVTK+GA+ DGK D + A++ AW  AC S  A++VVIP G +  G+V  +GPC A  
Sbjct  24    TYFDVTKYGAQADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIEGPCKAP-  82

Query  1079  IVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             I + +KGT+ A  D S +     W   +H+    ++G G  +G+G+ VW+     + K  
Sbjct  83    INLIVKGTVRAPVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWRQKC-SRTKYC  141

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
               LP++L F  +  S I DI   +SK FH+ V  C +    ++ ITAP DS NTDGIHI 
Sbjct  142   HQLPINLRFNFLTNSIIKDITSKDSKQFHINVLRCRNITFFQVAITAPEDSQNTDGIHIG  201

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S  VN+T   + TGDDCVSIGDG+  + +T+V CGPGHGIS+GSLG    E  V G+ V
Sbjct  202   RSRGVNITHSTIQTGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRV  261

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEAS  372
             +NCTL  TTNG R+KT+ +SPQ  A+ + F DI+++NV+ PIIIDQ+Y   N  N +  S
Sbjct  262   KNCTLSDTTNGVRVKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQIPS  321

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
             +VKL ++ F+NIRGT S +  A++L+CS+  PC+ VEL +ID+     +G     ++C N
Sbjct  322   RVKLSNISFKNIRGTTSTEL-AVNLVCSKGAPCQKVELGNIDLKYTGPEGT--ASSQCKN  378

Query  191   AETIVKGKRNP  159
              E  + G + P
Sbjct  379   VEATLWGTQQP  389



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/370 (42%), Positives = 228/370 (62%), Gaps = 7/370 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             + D+ K+GA      D T A++ AW +AC +  A+KV++P GT++  EVV +GPC +  I
Sbjct  24    VCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKVLVPAGTYVLREVVLEGPCKSS-I  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +++ GT+ A +D +   ++ W     V  + ++G GT +G+G+  W  +      +   
Sbjct  83    EVQVDGTLQAPADPAQMKTDGWVAFRGVDLLTLSGSGTFDGQGKTAWTKNDCNLKTDCVT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+++ F  V    + DI  ++SK FH+ V +C +     + ITAPGDSPNTDGIHI  S
Sbjct  143   LPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNLTFQHVTITAPGDSPNTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             T +N+ D  + TGDDC+SIGDG+  + +T VTCGPGHGIS+GSLGK   E  V G+ V+N
Sbjct  203   TGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPGHGISVGSLGKYPNEQPVTGLHVKN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKV  366
             CT+ GT NG RIKT+ ASP   AS + FEDI L NV  P+IIDQ Y   N+   +  S++
Sbjct  263   CTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPWNQCKSQAPSQI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+ +V F  IRGT+S +  A++L CS  +PC +VE++DIDI     +G     + C N +
Sbjct  323   KISNVSFSRIRGTSSTQA-AVTLACSSRLPCTEVEISDIDIAYHGPEGPAT--SVCSNVK  379

Query  185   TIVKGKRNPG  156
               + GK+NP 
Sbjct  380   PTISGKQNPA  389



>ref|XP_008223247.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=423

 Score =   302 bits (773),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/373 (43%), Positives = 230/373 (62%), Gaps = 7/373 (2%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSR-GAAKVVIPRGTFLAGEVVFQGPCT  1089
             T  IF+V   GAKP G GDS++A I+ W  AC +  G ++VVIP GTF  G V+F+GPC 
Sbjct  50    TEKIFNVLDHGAKPHGSGDSSIAFIQTWIAACRNHTGRSRVVIPEGTFKTGPVIFEGPCN  109

Query  1088  -AKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKI  912
              +K IV+++ GT+   +D+S+Y   +WF+ E V G+ +TG G  +G+G   W+       
Sbjct  110   CSKPIVVQVSGTIKGLNDISLYAEPFWFLFERVEGLVLTGNGVFDGQGSSSWKNIVG--C  167

Query  911   KNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGI  732
              +   LP S+ F GV    I  I  +NSKG H+ +++  +  V  + I+AP  SPNTDGI
Sbjct  168   SSCSPLPASIKFNGVKNGVIRGITSLNSKGVHVFLTNSQNIRVRGVNISAPDTSPNTDGI  227

Query  731   HISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKG  552
             HIS S N+ +  + +GTGDDC+ +  G+TN+ +  V CGPGHGISIGSLGK   E+DV+G
Sbjct  228   HISSSNNIKIARVHIGTGDDCIGMIQGSTNVAINNVVCGPGHGISIGSLGKYQNESDVRG  287

Query  551   VTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK--NRKE  378
             + V+  T   T NG RIK++  S   +ASG+IF+D+ + NV  PIIIDQ+Y +   N+ +
Sbjct  288   IIVKKTTFFNTDNGIRIKSWPGSTPSRASGMIFQDLNMQNVRNPIIIDQEYCAGGCNKNQ  347

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
              S+V++ +V + NIRGT + K  A+  ICS   PC++VEL DI++            + C
Sbjct  348   PSRVQISNVHYINIRGTTASKI-AVDFICSSQFPCKNVELRDINLKYIGPSNGGPITSIC  406

Query  197   VNAETIVKGKRNP  159
              NAE    G +NP
Sbjct  407   KNAEVGFGGIQNP  419



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/369 (44%), Positives = 226/369 (61%), Gaps = 9/369 (2%)
 Frame = -1

Query  1253  FDV-TKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             FDV  KFGAK DGK D +   + AW +AC S   + VVIP+GT+L  +V  +GPC A  I
Sbjct  29    FDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVVIPKGTYLLSKVNLEGPCKAP-I  87

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              I ++GT+ A +D S +    W     V   ++ GGG  +G+G   ++ +  E  +    
Sbjct  88    EINVQGTIQAPADPSAFKDPNWVRFYSVENFKMFGGGIFDGQGSIAYEKNTCENREFRSK  147

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LPV++ F  +  + I DI   +SK FH+ V  C +  + +L+I AP +SPNTDGIH+  S
Sbjct  148   LPVNIRFDFLTNALIQDITSKDSKLFHINVFACKNITLERLKIEAPDESPNTDGIHMGKS  207

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+    + TGDDC+SIGDGT N+++  +TCGPGHGISIGSLGK   E  V+G+ + N
Sbjct  208   EGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGHGISIGSLGKFQNEEPVEGIKISN  267

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKV  366
             CT+  T+NGARIKT+        S I FEDI ++NV+ PI+IDQ Y   N   + E SKV
Sbjct  268   CTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQYCPWNKCKKNEESKV  327

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             KL ++ F+NIRGT++    AI  ICS + PC++VELADIDI      G     ++C+N +
Sbjct  328   KLSNISFKNIRGTSALPE-AIKFICSGSSPCQNVELADIDI---KHNGAEPATSQCLNVK  383

Query  185   TIVKGKRNP  159
              I  GK NP
Sbjct  384   PITSGKLNP  392



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/370 (42%), Positives = 228/370 (62%), Gaps = 7/370 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             + D+ K+GA      D T A++ AW +AC +  A+KV++P GT++  EVV +GPC +  I
Sbjct  24    VCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKVLVPAGTYVLREVVLEGPCKSS-I  82

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +++ GT+ A +D +   ++ W     V  + ++G GT +G+G+  W  +      +   
Sbjct  83    EVQVDGTLQAPADPAQMKTDGWVAFRGVDLLTLSGSGTFDGQGKTAWTKNDCNLKTDCVT  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+++ F  V    + DI  ++SK FH+ V +C +     + ITAPGDSPNTDGIHI  S
Sbjct  143   LPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNLTFQHVTITAPGDSPNTDGIHIGRS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             T +N+ D  + TGDDC+SIGDG+  + +T VTCGPGHGIS+GSLGK   E  V G+ V+N
Sbjct  203   TGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPGHGISVGSLGKYPNEQPVTGLHVKN  262

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKV  366
             CT+ GT NG RIKT+ ASP   AS + FEDI L NV  P+IIDQ Y   N+   +  S++
Sbjct  263   CTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPWNQCKSQAPSQI  322

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+ +V F  IRGT+S +  A++L CS  +PC +VE++DIDI     +G     + C N +
Sbjct  323   KISNVSFSRIRGTSSTQA-AVTLACSSRLPCTEVEISDIDIAYHGPEGPAT--SVCSNVK  379

Query  185   TIVKGKRNPG  156
               + GK+NP 
Sbjct  380   PTISGKQNPA  389



>ref|NP_171778.1| polygalacturonase 4 [Arabidopsis thaliana]
 sp|P49062.1|PGLR1_ARATH RecName: Full=Exopolygalacturonase clone GBGE184; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF02888.1|AC009525_22 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL16194.1|AF428425_1 At1g02790/T14P4_2 [Arabidopsis thaliana]
 emb|CAA51032.1| exopolygalacturonase [Arabidopsis thaliana]
 emb|CAA76127.1| polygalacturonase [Arabidopsis thaliana]
 gb|AAL38686.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM91746.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE27470.1| polygalacturonase 4 [Arabidopsis thaliana]
Length=422

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/371 (43%), Positives = 229/371 (62%), Gaps = 13/371 (4%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T++D+TKFGA  DG  ++  A +  W + C S   A +++P+GTFLAG V+F GPC +K 
Sbjct  50    TVYDITKFGAVGDGSTNTFKAFLNTWIQVCDSPVPATLLVPKGTFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + + + GT++A +  S Y +  WF+ E V  + +TG GT +G+GE VW+ D   K     
Sbjct  109   VTVNVIGTIIATT--SGYATPEWFLFERVDNLVLTGTGTFHGKGEAVWKADGCGKKVQCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I+ I  VN+K FHM +    + N+  +++TAP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNMKNVEINGISSVNAKAFHMFLVKTENVNIQNIKLTAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D  + TGDDCVS+G G+ N+ V RV CGPGHG+S+GSLGK   E DV G+ V 
Sbjct  227   ADNVSILDSTIATGDDCVSVGRGSNNVTVERVICGPGHGLSVGSLGKYKNEEDVSGIHVN  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+I T NG RIKT+  S   KA  I FE+I++ +V  PIIIDQ+Y S  R   S+V +
Sbjct  287   NCTMIETDNGLRIKTWGGSDPSKAVDIKFENIIMQSVKNPIIIDQNYGS--RGGDSQVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK-------  201
              D+ F+NIRGT   K   + ++CS++VPC+ V + D+++      G   K +        
Sbjct  345   SDILFKNIRGTTITKD-VVQIMCSKSVPCQGVNVVDVNLDYVGKTGGEKKSSSGGLVGAL  403

Query  200   CVNAETIVKGK  168
             C NA  I  GK
Sbjct  404   CDNANVIFGGK  414



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 226/369 (61%), Gaps = 8/369 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              DVT+ GAKPDG  D +  +  AW +AC+S   + ++IP+GTFL  E    GPC A  + 
Sbjct  27    IDVTQLGAKPDGSADMSQVLADAWKQACNSTTPSTILIPKGTFLLKEASLAGPCKAP-VE  85

Query  1073  IEIKGTMVADSDLSVYTSN-YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             ++I+GT+ A  D +  T +  W  I +V  + ++GGGT++G+G   W  +          
Sbjct  86    VQIQGTVKAPEDPAQITKDKEWMSIIYVDQLTLSGGGTLDGQGAKAWTQNECRVKTECSK  145

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L    VN + I D+  +NSK FH+ +  CN+       I APGDSPNTDGIHI  S
Sbjct  146   LPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITFQHFTIIAPGDSPNTDGIHIGHS  205

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             T V +TD  +GTGDDC+SIGDG   + +++VTCGPGHGIS+GSLG+   E  V+G+ V +
Sbjct  206   TGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTD  265

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKV  366
             CT+ GT NG R+K++ AS    A+ + FE I++ NV+ P+IIDQ+Y   N+      S V
Sbjct  266   CTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSNPVIIDQEYCPNNQCTNTAPSSV  325

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+  V F+NI GT S    A++L+CS+++PCE VE+ADID+     +G     + C N +
Sbjct  326   KIAQVSFKNITGT-SATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGS--VSSNCANVK  382

Query  185   TIVKGKRNP  159
               + GK NP
Sbjct  383   PALSGKLNP  391



>ref|XP_002312795.2| hypothetical protein POPTR_0009s17010g [Populus trichocarpa]
 gb|EEE86750.2| hypothetical protein POPTR_0009s17010g [Populus trichocarpa]
Length=419

 Score =   301 bits (770),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 236/374 (63%), Gaps = 9/374 (2%)
 Frame = -1

Query  1286  IPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             I   +G++  +FDV +FGA+ DG+ D + A I AW +AC + G  +++IP+GT+L G V 
Sbjct  41    ISHHKGNSSLLFDVKRFGARADGRTDDSKAFIAAWKEACRATGKVELLIPKGTYLIGPVK  100

Query  1106  FQGPCTAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQF  930
             F GPC   + V  + G + A + LS Y S   W     +  + +TGGGT +G+G   W +
Sbjct  101   FAGPC---KNVSSLTGYLKATAKLSRYGSGTGWVEFGWLERLTLTGGGTFDGQGAKAWPY  157

Query  929   DADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDS  750
             +         LLP ++ F  +N++ +  I  +NSK FH+ + +C +F  +K++I+AP DS
Sbjct  158   NNCTNDSKCKLLPTNVKFVAMNQTVVQGITSLNSKFFHIALVECKNFKGTKIKISAPADS  217

Query  749   PNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQ  570
             PNTDGIH+  S++V ++  ++GTGDDC+SIG G + + +TR+ CGPGHGIS+GSLG+   
Sbjct  218   PNTDGIHVERSSSVYISQSLIGTGDDCISIGQGNSQVTITRIRCGPGHGISVGSLGRYED  277

Query  569   ETDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY--  399
             E DV G+ VR+C + GT NG RIKT+  SP    A+ + FE+I+++NVT PIIIDQ Y  
Sbjct  278   EGDVSGLVVRDCAISGTMNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQSYCP  337

Query  398   -NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
              +S    E SKVKL D+ F+ IRGT+S    A++L CS+ +PC+++ L ++ +  ++G+ 
Sbjct  338   FSSCISTEPSKVKLSDIYFKQIRGTSSSA-VAVALECSKGIPCQNIYLENVHLELSSGEK  396

Query  221   VHLKPNKCVNAETI  180
                   K V A  I
Sbjct  397   QATSSCKNVRARYI  410



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   300 bits (768),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 223/369 (60%), Gaps = 8/369 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             F +T +G K     D T A   AW  AC S   +K+++P+GT++  +VVF+GPC A  + 
Sbjct  33    FSITNYGLKGTEDEDITKAFSVAWEAACSSTSPSKLIVPKGTYVLRQVVFEGPCKAP-LE  91

Query  1073  IEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             +++ GT+ A  D S +     W   + +    + G GT +G+G   W  +   K      
Sbjct  92    LQVHGTIKAPEDPSYFIEKAGWISFQRIDRFALVGNGTFDGQGSTAWSQNDCHKTGECNK  151

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+++ F  +    + DI  +NSK FH+ V  CN+   S++ I AP DSPNTDGIHI  S
Sbjct  152   LPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLTFSRVNIKAPEDSPNTDGIHIGRS  211

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              N+N+TD V+ TGDDC+S+G G+ N+ + RV CGPGHGIS+GSLG+  +E  V G+ VRN
Sbjct  212   KNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGHGISVGSLGRYTKEEPVSGIIVRN  271

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKV  366
             CT   T NG R+KT+ +S +  A+G+ F+DI + NV+ PI+IDQ+Y   N    K+ S+V
Sbjct  272   CTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVIDQEYCPYNHCKAKKPSQV  331

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             KL ++ FRNI GT+S +  A+ L CS  VPCE+VE++DIDI      G  +  + C N  
Sbjct  332   KLSNISFRNIHGTSSTQM-AMKLACSSGVPCENVEISDIDIKYTGSDGDSM--SDCTNVS  388

Query  185   TIVKGKRNP  159
               + GK+ P
Sbjct  389   PKIFGKQYP  397



>ref|XP_006856225.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
 gb|ERN17692.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
Length=403

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 164/407 (40%), Positives = 240/407 (59%), Gaps = 16/407 (4%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNK  1176
             MEIK  + + LLGI  +  G           +  F+V  +GAK DGK D T A + AW +
Sbjct  1     MEIKVVLLLCLLGIQAVECGSS-SSSSLSSNYGFFNVKDYGAKGDGKTDDTKAFMDAWKE  59

Query  1175  ACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTS-NYWFII  1002
             AC SRG  +++IP G +L G + F+GPC     + I++ G + A  D+S + S + W + 
Sbjct  60    ACGSRGPGRLLIPWGAYLVGPLEFRGPCKNVPTMHIQLIGILKAPRDMSKFGSLDTWVLF  119

Query  1001  EHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKG  822
               V G+ +TGGGT +G+G   W  +         LLP S+ F  +  + +  I  +NSK 
Sbjct  120   GWVDGLTLTGGGTFDGQGSSAWPLNKCTTNTKCKLLPTSVKFASLTNTVVRGISSLNSKF  179

Query  821   FHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTN  642
             FH+ + DC  F  S ++ITAP DSPNTDGIH+ G+T++ ++   +GTGDDC+S+G G + 
Sbjct  180   FHIAILDCKHFKASSIKITAPEDSPNTDGIHLEGNTDITISQSTIGTGDDCISVGPGNSL  239

Query  641   LLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKAS  465
             + +  V CGPGHGIS+GSLGK   E DV G++VR+C++  T NG RIKT+  SP + +A 
Sbjct  240   VSIDNVKCGPGHGISVGSLGKYVDEGDVDGLSVRDCSISNTMNGLRIKTWAGSPGESRAR  299

Query  464   GIIFEDIMLHNVTRPIIIDQDYNSKN---RKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
              + F++I+++NV  PIIIDQ Y   +    K  S+VKL D+ F+NIRGT SK   A+ L 
Sbjct  300   NMTFQNIIMNNVGNPIIIDQSYCPYSFCPDKAPSQVKLSDITFKNIRGT-SKTEVAVKLE  358

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNK--CVNAETIVKGKRNP  159
             CS+  PC+++ L D+ +    G      P K  CVN +    G + P
Sbjct  359   CSKGHPCKEIILQDVHLEYNGG------PAKASCVNVKATYSGTQIP  399



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 231/370 (62%), Gaps = 9/370 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GA+ DG  D + A+++AW  +C S  A+ V+IP GT+  G++   GPC A  I
Sbjct  27    IFDVTKYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAP-I  85

Query  1076  VIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
                ++GT++A  D S + +   W   + +    ++GGG  +G+G+ VW            
Sbjct  86    NFVVQGTVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKTVWGRKCPH-YAYCK  144

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP++L F  +  S + DI   +SK FH+ +  C +     + I+AP +S NTDGIHI  
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHIGR  204

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ +N+TD  + TGDDCVSIGDG+  + + RVTCGPGHGIS+GSLGK   E  V G++V+
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             NCTL  T NG R+KT+ AS Q  AS + FEDI+++NV  PIIIDQ+Y   N  N K  S+
Sbjct  265   NCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             +KL +V FRNIRGT S +  A+ L+CSQ VPC+DVEL DI++     +G  +  ++C N 
Sbjct  325   IKLSNVSFRNIRGTTSTQ-VAVKLLCSQGVPCQDVELGDINLKYNGKEGPAM--SQCKNI  381

Query  188   ETIVKGKRNP  159
             +  + G + P
Sbjct  382   KPNLLGVQLP  391



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 239/394 (61%), Gaps = 13/394 (3%)
 Frame = -1

Query  1322  LGIALLSTGV--ECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAK  1149
             L I LL + +   CI + R       DV + GAK DG+ D +  +  AW +AC+S  A+ 
Sbjct  5     LDITLLCSWLFFTCIVQARTGP---IDVIQLGAKRDGRADMSQVLANAWKQACNSTTAST  61

Query  1148  VVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSD-LSVYTSNYWFIIEHVAGVEVTG  972
             ++IP+GTFL  E    GPC A  I I+I+GT+ A +D   +     W  I +V  + ++G
Sbjct  62    ILIPKGTFLLKEASLVGPCKAP-ITIQIQGTIKAPADPAQISKDKEWITIMYVNQLTLSG  120

Query  971   GGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCND  792
             GGT++G+G   W  +          LP +L    VN + I D+  +NSK FH+ +  CN+
Sbjct  121   GGTLDGQGAKAWTQNECRVKTECSKLPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFACNN  180

Query  791   FNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGP  612
                    ITAPGDSPNTDGIHI  ST V +T+  +GTGDDC+SIGDG   + +++VTCGP
Sbjct  181   VTFQHFTITAPGDSPNTDGIHIGHSTGVVITNSNIGTGDDCISIGDGAKQVNISKVTCGP  240

Query  611   GHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHN  432
             GHGIS+GSLG+   E  V+G+ V +CT+ GT NG R+K++ AS +  A+ + FE I++ N
Sbjct  241   GHGISVGSLGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQN  300

Query  431   VTRPIIIDQDYNSKNR---KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             V+ P+IIDQ+Y   N+      S+VK+  V F++I GT S    A++L+CS+++PCE VE
Sbjct  301   VSNPVIIDQEYCPNNQCTNTAPSRVKIAQVSFKHITGT-SATPAAVTLLCSKSIPCEGVE  359

Query  260   LADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             +A ID+     +G     +KC N + ++ GK NP
Sbjct  360   VAHIDLAYNGKQGT--LSSKCANVKPVLSGKLNP  391



>ref|XP_009111183.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Brassica 
rapa]
 emb|CDY15439.1| BnaA08g27230D [Brassica napus]
Length=420

 Score =   300 bits (768),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 165/370 (45%), Positives = 227/370 (61%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TKFGA  +G  +S  A +  W + C S   A +++P+G FL G V+F GPC +K 
Sbjct  49    TVFDITKFGAVGNGATNSFKAFLNTWLQVCASPVPATLLVPKGEFLTGPVIFAGPCKSK-  107

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + IE++GT+ A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   K  N  
Sbjct  108   VTIEVQGTITATP--SGYATPEWFLFEHVDNVLLTGPGTFHGKGEAVWKADGCGKKVNCN  165

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + N+  + I AP +SPNTDGIH+S 
Sbjct  166   LPPTSLKFRNILNLEIAGISSVNAKAFHMFLVKTTNVNIHNINIIAPAESPNTDGIHLSN  225

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NVN+ +  +GTGDDC+S+G G+TN+ V  VTCGPGHG+S+GSLGK   E DV G+  +
Sbjct  226   AVNVNIVESTIGTGDDCISVGRGSTNVTVEHVTCGPGHGLSVGSLGKYPNEEDVSGIHFK  285

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             +CT+ GT NG RIK++  S   KA  I FEDI + +V  PIIIDQ+Y S  R   SKV +
Sbjct  286   SCTMKGTDNGLRIKSWGGSSPSKAVDIKFEDITMESVKNPIIIDQNYGS--RGGDSKVAI  343

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              DV F+N+RGT   K   + ++CS++VPC  V + D+++     KG H      L    C
Sbjct  344   SDVLFKNVRGTTITKD-EVQIMCSKSVPCTGVSVIDVNLNFVGDKGGHPSSSGGLIGALC  402

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  403   TNANVIFGGK  412



>emb|CBI22963.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   299 bits (765),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 219/347 (63%), Gaps = 11/347 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVT +GA  DGK ++ MA + AW+ AC+  G + +++P GTF  G + F GPC   + 
Sbjct  31    IFDVTMYGAVGDGKTENGMAFLAAWDDACNHPGKSTLLVPNGTFFIGPISFIGPCQNNQS  90

Query  1076  V-IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTIN-----GRGEDVWQFDADEK  915
               +EI+GT+ A S L  + +  W +   +  + +TG  T N      +GE+ W+  AD +
Sbjct  91    PKVEIRGTLKAPSSLKAFPTPSWIMFRQLQSLILTGETTTNTSLFDAQGEESWR-HADCR  149

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
              K     P S+I   V    I +I   N KGFHM + + ++  V  + ITAP +SPNTDG
Sbjct  150   HKLKCQFPTSIILVNVTNGNISNITLKNGKGFHMGIINSDNVTVHGVNITAPWNSPNTDG  209

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             +HI  STN+++T   +G GDDCVSIG G+ N+ V    CGPGHGIS+GSLGK + E DV 
Sbjct  210   VHIGYSTNIHITSSTIGVGDDCVSIGPGSINITVFNTKCGPGHGISVGSLGKYSAEKDVV  269

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA  375
             GV V+NCT+ GT NG RIKT+  SP  KAS   FEDI++ NV+ PIIIDQ+Y   +   +
Sbjct  270   GVRVKNCTINGTQNGVRIKTWPGSPASKASSFWFEDIVMINVSNPIIIDQEYCPWSTCTS  329

Query  374   SK---VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             SK   VKL D+ F NIRGT + K  A++L+CS +VPCED++L +I++
Sbjct  330   SKPSLVKLSDIHFTNIRGTFNTKS-AVALMCSSSVPCEDIQLLNINL  375



>emb|CDY35745.1| BnaC03g58660D [Brassica napus]
Length=411

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 226/370 (61%), Gaps = 22/370 (6%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TK GA          A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVFDITKNGA----------AFLNTWLQVCASPVPATLLVPKGDFLAGPVIFAGPCKSK-  98

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + +E++GT++A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   K  N  
Sbjct  99    VTVEVQGTIIAPP--SGYPTPEWFLFEHVDNVVLTGPGTFHGKGEAVWKADGCGKKLNCN  156

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + NV  ++ITAP +SPNTDGIH+S 
Sbjct  157   LPPTSLKFRNILNLDISGISSVNAKAFHMFLVKTTNVNVQNIKITAPAESPNTDGIHLSN  216

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D ++ TGDDC+S+G G+TN+ V RVTCGPGHG+S+GSLGK   E +V G+  +
Sbjct  217   AVNVHIADSLIATGDDCISVGRGSTNVTVERVTCGPGHGLSVGSLGKYPNEENVAGIHFK  276

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
              CT+  T NG RIK++  S    A  I FEDIM+ NV  PIIIDQ+Y S  R   SKV +
Sbjct  277   KCTMKDTDNGLRIKSWGGSSPSTAVDITFEDIMMTNVKNPIIIDQNYGS--RGGDSKVAI  334

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              +V F+N+RGT   K   + ++CS++VPC+ V + D+++     KG H      L    C
Sbjct  335   SNVLFKNVRGTTITKD-EVQIMCSKSVPCKGVSVVDVELNFVGDKGGHPSASGGLVGALC  393

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  394   DNANVIFGGK  403



>ref|XP_008235914.1| PREDICTED: exopolygalacturonase [Prunus mume]
Length=551

 Score =   303 bits (777),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/416 (40%), Positives = 246/416 (59%), Gaps = 21/416 (5%)
 Frame = -1

Query  1379  VEHIYVATMEIKAGIFVILLGIALLSTGVECIPRG---RGHTHTIFDVTKFGAKPDGKGD  1209
             V  I+V +M    G+F           GV+   R    R     +FDV  FGA+ DG+ D
Sbjct  144   VRLIFVLSMLWVGGVF---------GKGVKAEGRSLHHRAKNSAVFDVMSFGARADGRTD  194

Query  1208  STMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLS  1032
              + A + AW +AC S G   + IP+GT++ G + F GPC     + + +KG + A +DL 
Sbjct  195   DSNAFMAAWKEACQSTGRVHITIPKGTYIIGPLKFSGPCLNVSSLTLRVKGYLKATTDLR  254

Query  1031  VY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSG  855
              Y     W     + G+ +TGGGT +G+G   W  +         LLP SL F  +N++ 
Sbjct  255   KYGFGGGWLEFAWMEGLTLTGGGTFDGQGARAWPHNKCPTDSKCKLLPTSLKFVAMNKTV  314

Query  854   IHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGD  675
             I  +  VNSK FH+ + +C++F  S+L+I+AP  SPNTDGIHI  S++V  +   + TGD
Sbjct  315   IRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHIERSSSVYFSLSHIATGD  374

Query  674   DCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKT  495
             DC+S+G G +++ +T +TCGPGHGIS+GSLGK   E DV G+ V++CT+ GTTNG RIKT
Sbjct  375   DCISVGQGNSHITITSITCGPGHGISVGSLGKYPDERDVSGLVVKDCTMTGTTNGIRIKT  434

Query  494   YRASPQ-LKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGT  327
             +  SP    A+ + FE+I+++NVT PIIIDQ Y    S   K  S+VKL D+ F+NIRGT
Sbjct  435   WANSPSNSAATNMTFENIVMNNVTNPIIIDQLYCPFTSCTSKAPSRVKLSDIYFKNIRGT  494

Query  326   ASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             +S +  A++L CS+ +PC+++ L D+ +  ++G+      + C N +    G + P
Sbjct  495   SSSE-VAVALECSEGIPCQNIYLEDVHLDLSSGE--KQATSSCNNVKAKFSGTQIP  547



>ref|XP_004487822.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=421

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 229/376 (61%), Gaps = 19/376 (5%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKR  1080
             + +V  FGAKPDGK D T A +  W  AC S   A+++IP+G FL   + F GPC T + 
Sbjct  51    VVNVMSFGAKPDGKFDCTQAFMDGWRAACKSNVQARLLIPQGRFLVSSMFFAGPCLTPEP  110

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDAD---EKIK  909
             I I++ GT+VA +D+S Y +  W + E +AG+++ GGGT +G+G+  W+F  D   +   
Sbjct  111   ITIQVVGTVVATTDISEYENGEWLMFEDIAGIKLIGGGTFDGQGKSAWEFHQDCESDPTN  170

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
                  P SL F  V    I +IK V+ KGFH+ V++  +  +  L+++AP  SPNTDG+H
Sbjct  171   TCVRSPSSLYFNKVTNGVIQNIKSVDPKGFHIFVTNSANIRLRLLKLSAPATSPNTDGLH  230

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             IS STNV ++   V TGDDCVS+    +N+ + R+ CGPGHGISIGSLGK   E +V GV
Sbjct  231   ISHSTNVKISKSSVETGDDCVSMIQAVSNVTINRLKCGPGHGISIGSLGKYPDEQEVNGV  290

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYN-SKN-RKEA  375
              V++CTL GTTNG R K +       AS I F DI + NV  PIIIDQ+Y  S N +K+ 
Sbjct  291   RVKSCTLTGTTNGLRFKAWPDKYPGAASDISFTDITMENVKNPIIIDQEYQCSPNCKKKP  350

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP----  207
             S VK+KDV + NI GT + +  A+ + CS+  PC++++L +ID+         L P    
Sbjct  351   SLVKIKDVAYTNISGTTTSQI-AVDMRCSKQFPCQNIKLQNIDL--------KLGPTPVG  401

Query  206   NKCVNAETIVKGKRNP  159
             ++C N + I  G + P
Sbjct  402   SRCANIKPIYVGIQRP  417



>ref|XP_006414139.1| hypothetical protein EUTSA_v10027030mg, partial [Eutrema salsugineum]
 gb|ESQ55592.1| hypothetical protein EUTSA_v10027030mg, partial [Eutrema salsugineum]
Length=393

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 224/354 (63%), Gaps = 13/354 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AK  1083
             I +V  FGA+ +   D T A   AW+KAC S  ++  ++IPRG F  G + F GPCT   
Sbjct  11    IVNVHSFGARANDHRDHTKAFEAAWDKACKSSSSSVDLIIPRGEFSVGPLRFSGPCTNVS  70

Query  1082  RIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
              + + +K    A +DLS Y S   W     + G+ +TGGGT +G+G   W F+      N
Sbjct  71    NLTVRVK----ASTDLSKYRSGGGWIEFRWINGLTLTGGGTFDGQGAVAWPFNNCTTDSN  126

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
               LLP SL F G+NR+ +  I  VNSK FHM + +C DF  ++L ITAP DSPNTDGIHI
Sbjct  127   CKLLPTSLKFVGMNRTVVRRISSVNSKFFHMALVECRDFKGTRLNITAPSDSPNTDGIHI  186

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               S+NV  +   + TGDDCVSIG G + + +T + CGPGHGIS+GSLG+   E DVKG+ 
Sbjct  187   ERSSNVYFSRSHIATGDDCVSIGQGNSQITITSIKCGPGHGISVGSLGRYPNEKDVKGLV  246

Query  545   VRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             VR+C + GTTNG RIKT+  SP L  A+ + F++I++ NVT PIIIDQ Y   +S     
Sbjct  247   VRDCKMSGTTNGIRIKTWANSPGLSAATNMTFQNIVMKNVTNPIIIDQSYCPFSSCTSNV  306

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI-VSAAGKGV  219
              SKVKL D+ F+NIRGT+S +  A+ L CS+ +PC+ V L ++ + +S++G G+
Sbjct  307   PSKVKLSDIYFKNIRGTSSSR-VAVQLHCSRGIPCKKVFLENVHLYLSSSGGGI  359



>emb|CDY65794.1| BnaCnng48740D [Brassica napus]
Length=420

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/370 (45%), Positives = 227/370 (61%), Gaps = 12/370 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TKFGA  +G  +S  A + AW + C S   A +++P+G FL G V+F GPC +K 
Sbjct  49    TVFDITKFGAVGNGATNSFKAFLNAWLQVCASPVPATLLVPKGEFLTGPVIFAGPCKSK-  107

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + IE++GT+ A    S Y +  WF+ EHV  V +TG GT +G+GE VW+ D   K  +  
Sbjct  108   VTIEVQGTITATP--SGYATPEWFLFEHVDNVLLTGPGTFHGKGEAVWKADGCGKKVDCN  165

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + N+  + I AP +SPNTDGIH+S 
Sbjct  166   LPPTSLKFRNILNLEIAGISSVNAKAFHMFLVKTTNVNIHNINIIAPAESPNTDGIHLSN  225

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NVN+    +GTGDDC+S+G G+TN+ V  VTCGPGHG+S+GSLGK   E DV G+  +
Sbjct  226   AVNVNIVQSTIGTGDDCISVGRGSTNVTVEHVTCGPGHGLSVGSLGKYPHEEDVSGIHFK  285

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             +CT+ GT NG RIK++  S   KA  I FEDI + +V  PIIIDQ+Y S  R   SKV +
Sbjct  286   SCTMKGTDNGLRIKSWGGSSPSKAVDIKFEDITMESVKNPIIIDQNYGS--RGGDSKVAI  343

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              DV F+N+RGT   K   + ++CS++VPC  V + D+++     KG H      L    C
Sbjct  344   SDVLFKNVRGTTITKD-EVQIMCSKSVPCTGVSVIDVNLNFVGDKGGHPSASGGLIGALC  402

Query  197   VNAETIVKGK  168
              NA  I  GK
Sbjct  403   TNANVIFGGK  412



>ref|XP_006419502.1| hypothetical protein CICLE_v10004345mg [Citrus clementina]
 gb|ESR32742.1| hypothetical protein CICLE_v10004345mg [Citrus clementina]
Length=805

 Score =   309 bits (792),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 224/348 (64%), Gaps = 11/348 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDVT +GA+PDG+ +++   + AWN AC   G +   IP GTFL G V   GPC   + 
Sbjct  430   LFDVTDYGAEPDGETETSSPFLEAWNAACSHNGDSTFYIPEGTFLLGPVSITGPCHNNQP  489

Query  1076  V-IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGG----TINGRGE-DVWQFDADEK  915
               I IKGT++A  +LS +    W + + + G+ ++GG      I+ +GE + W+ ++  K
Sbjct  490   PKIVIKGTLMAPPNLSAFPDTNWIVFQDLHGINISGGNGEVPNIDAQGEVEAWKRNSCSK  549

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
              +    L  SL F  V+   I +I   NSKGFH+   DC++ NV  + I++PGDSPNTDG
Sbjct  550   SEKCNKLITSLRFNNVSHGTISNIAVSNSKGFHVAFLDCDNINVYNVSISSPGDSPNTDG  609

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+  STN+N+T   +G GDDC+SIG G++N+ V  V CGPGHGISIGSLGK   E DV 
Sbjct  610   IHVGMSTNINITSSNIGAGDDCISIGPGSSNISVADVKCGPGHGISIGSLGKYTDEEDVV  669

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY----NSKN  387
             G+ VRNCT+ GT NG R+KT+  +P  +AS ++F DI++ NV+ PIIIDQ+Y    + K+
Sbjct  670   GINVRNCTITGTQNGVRVKTWPGAPASRASNLMFTDIVMINVSNPIIIDQEYCPSNSCKS  729

Query  386   RKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
               E S V+L ++ F+NI GT + +   ++LICS  VPCE++ L DI++
Sbjct  730   TSEPSLVELSNIHFKNISGTYNTES-GVTLICSSGVPCENIHLIDINL  776


 Score =   271 bits (694),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/305 (45%), Positives = 196/305 (64%), Gaps = 10/305 (3%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGD------STMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVF  1104
             T  +F+V +FGAKP  K D      + MA ++A+  ACH  G A++VIPRGTF+ G V F
Sbjct  57    TAKVFNVLQFGAKPGDKEDRHNIDSNHMAFVKAFEAACHHEGKARLVIPRGTFVLGPVTF  116

Query  1103  QGPCTAKRIVIEIKGTMVADSDLSVYTSN--YWFIIEHVAGVEVTGGGTINGRGEDVWQF  930
              GPC    ++++I+GT+ A +D+S +      W   +++ G+ VTG GT +G+G   W++
Sbjct  117   MGPCNNTPLIVQIQGTIKAITDISEFPGQGEEWVNFQNINGLVVTGSGTFDGQGASCWKY  176

Query  929   DADEKIKNAP--LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPG  756
                +   N P   LP ++ F  V+ + +  I  VNSKGFH  ++ C +  +  L I AP 
Sbjct  177   RDTKNDNNVPGQRLPANIQFVEVSNAIVRGITSVNSKGFHYFITGCKNIRLYHLNIIAPD  236

Query  755   DSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKR  576
             +SPNTDGIHIS S  V +    +GTGDDCV +  G++N+ V +VTCGPGHGIS+GSLGK 
Sbjct  237   ESPNTDGIHISQSDVVKIAKSYIGTGDDCVGMIRGSSNVSVKKVTCGPGHGISVGSLGKY  296

Query  575   AQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYN  396
               E DVKG+ V++CTL+GT NG RIKTY    + +AS +IF+DI++ +V  PIIIDQ Y 
Sbjct  297   DNEADVKGIIVKDCTLVGTQNGLRIKTYEGKSESRASSMIFQDIVMKDVKHPIIIDQFYG  356

Query  395   SKNRK  381
              K++K
Sbjct  357   GKDKK  361



>ref|XP_008798766.1| PREDICTED: exopolygalacturonase-like [Phoenix dactylifera]
Length=426

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 217/345 (63%), Gaps = 8/345 (2%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T F+V  FGA  DGK DS+ A ++AW  AC   G  ++ IP G +L   + F+GPC    
Sbjct  51    TAFNVMNFGAAADGKSDSSAAFLKAWEAACPLEGRKRIYIPGGEYLVNPIKFEGPCNGI-  109

Query  1079  IVIEIKGTMVADSDLSVYTSN---YWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
             + +++ G + A  D++V+       W   +HV  + +TG GT +G+G   WQ +   K K
Sbjct  110   MEVQLSGVVKAQPDINVFNREGHKEWITFDHVDRLLITGSGTFDGQGSYAWQHNTCSKKK  169

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             +  LLP +L    V ++ +  I  VNSK F M +   N+  +  ++I AP D+PNTDGIH
Sbjct  170   DCSLLPGNLRLNFVTKTTVRGISLVNSKSFQMTIFGSNNVRIQHIKIVAPRDAPNTDGIH  229

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             I  STNV +TD  +GTGDDCVS+G G+  +LV+ V CGPGHGISIGSLG+   E DV GV
Sbjct  230   IGNSTNVRITDSEIGTGDDCVSVGPGSRRILVSGVFCGPGHGISIGSLGRYLNEPDVSGV  289

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             TV+NCTL GTTNG R+KT++ S + +AS   FEDI++  V  PII+DQ+Y    +  +  
Sbjct  290   TVKNCTLTGTTNGLRVKTWQKSNRSRASDFHFEDIVMRGVQNPIIVDQEYCPVGNCVKGA  349

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
              S V++ +V FRNIRGT++ +  A+ L CS+ V C+++ L DID+
Sbjct  350   PSLVEISNVTFRNIRGTSASRM-AVHLFCSKAVSCKNLVLQDIDL  393



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 239/408 (59%), Gaps = 15/408 (4%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTI-FDVTKFGAKPDGKGDSTMAMIRAWN  1179
             M  K    + LLG  LL   V C  +      TI FD+T  GAKP    D T A + +W 
Sbjct  1     MASKLNFTLCLLGFYLLIIEVSCQTQNLAPGDTIVFDITTKGAKPGA--DVTQAFLDSWT  58

Query  1178  KACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYT-SNYWFII  1002
              AC S+  +KV++P G +L G +  +GPC     VIEI G   A SD++ +  ++ WF +
Sbjct  59    AACASKKPSKVLVPAGNYLLGAITLKGPCQTPT-VIEILGNFKAPSDVAAFKKADSWFKV  117

Query  1001  EHVAGVEVTGGG---TINGRGEDVWQFDADEKIKNAPL-LPVSLIFQGVNRSGIHDIKFV  834
             E+V  V + GG      +G+G+  W+ +   K  N    LP ++ F  V+ S +  +  +
Sbjct  118   ENVDSVIIIGGKGGGVFDGQGQAGWKKNECSKNANCAFDLPYNIRFNFVSNSKVSGLTSL  177

Query  833   NSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGD  654
             NSK FH+ +  C    +S + +TAP DSPNTDGIHI  S N+ V    +GTGDDCVS GD
Sbjct  178   NSKSFHIVLMGCKQLELSGMTVTAPADSPNTDGIHIGRSENIIVRGWTIGTGDDCVSFGD  237

Query  653   GTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL  474
             G  N+L+  VTCGPGHG+S+GSLGK   E  V  +T+RNC +  T NG R+KT+  S + 
Sbjct  238   GAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCIIKNTDNGVRVKTWHNSYES  297

Query  473   KASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKVKLKDVRFRNIRGTASKKHPAI  303
               +G+ FEDI L NV  P+I+DQ+Y   N  +A   SKVK+ D+RF+N+RG +S K  A+
Sbjct  298   TVTGLYFEDITLENVRNPVIVDQEYCPWNHCKARTPSKVKISDIRFKNVRGKSSTKE-AV  356

Query  302   SLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              LICSQ VPC+ VELADIDI      G  +  + C   + ++ GK++P
Sbjct  357   KLICSQGVPCDKVELADIDIQYTGPGGPAV--SMCKFVKPLLTGKQSP  402



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/379 (42%), Positives = 235/379 (62%), Gaps = 12/379 (3%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
             ++ +F+V  FGA  DG  D++ A   AW +AC+    + V++P G +L   VVF+GPC A
Sbjct  29    SNGVFNVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTSVVFKGPCKA  88

Query  1085  KRIVIEIKGTMVADSDLS-VYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
               I  +++G ++A   LS +     W   E +    +TGGGT +G+G   W  +   K  
Sbjct  89    P-ISFQLQGLILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAWPENQCHKNS  147

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             N  L P+S+ F  +N S I  ++ V+SK FH+ +  C +  ++K+ I+AP DSPNTDGIH
Sbjct  148   NCQL-PISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIH  206

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLV-----TRVTCGPGHGISIGSLGKRAQET  564
             I  S  + +++ ++ TGDDCVS+GDG+ N+LV     + V+CGPGHGIS+GSLGK  +E 
Sbjct  207   IGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLVSDVSCGPGHGISVGSLGKYKKEE  266

Query  563   DVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NS  393
             DV G+TV NCT  GT+NG RIKT+  S   KAS   FED+ ++NV  PI+IDQ+Y   N 
Sbjct  267   DVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQ  326

Query  392   KNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHL  213
              N K  S+VK+ +VRFRNIRGT+  K  A+ ++CS+ +PC++VE+ DI++V         
Sbjct  327   CNIKVPSRVKISNVRFRNIRGTSLTKE-AVRIVCSKEIPCQNVEIGDINLVYNGIDDKGP  385

Query  212   KPNKCVNAETIVKGKRNPG  156
               + C N +  + GK+ P 
Sbjct  386   AISSCSNVKPTLVGKQIPA  404



>ref|XP_004160573.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Cucumis sativus]
Length=440

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 228/371 (61%), Gaps = 28/371 (8%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKAC-HSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             +FDVTK GAK DG+ D   A +  W  AC ++ G AK +IP+  FL G V F GPC +  
Sbjct  87    VFDVTKHGAKADGETDDAQAFMTTWIAACRNTVGPAKFLIPQDIFLVGPVTFAGPCKSFP  146

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             I +E +GT+ A +D+S Y+S+ WF IE V G  +TG G  +G+G                
Sbjct  147   ITLENQGTVKATTDISAYSSSEWFSIEDVTGFILTGSGVFDGQGVS--------------  192

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
                 S+ F  +N + I  +  +NS GFH  V  C +F  + ++ITAP +SPNTDG+H+S 
Sbjct  193   ----SIKFSRLNHTIIDGLTSINSMGFHTSVFYCYNFTATNMKITAPHNSPNTDGMHLST  248

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S  V +++ ++GTGDDCVSIG  T N+++T VTCGPGHG+S+GSLGK ++E  V  V V+
Sbjct  249   SKLVTISNSIIGTGDDCVSIGHSTENIIITNVTCGPGHGLSVGSLGKYSKEKGVYDVLVK  308

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+   TNGARIKT+ +     AS I+FEDI+++NV  PIIIDQ Y ++  KE S  K+
Sbjct  309   NCTIFNATNGARIKTFASPIPGLASRIVFEDIVMYNVKNPIIIDQTYGTEEGKE-SNWKV  367

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKP----NKCVN  192
              D+ F+NIRGT S  + A+ L CS+  PCE VEL DI++      G  L+     + C N
Sbjct  368   SDILFKNIRGT-STTNVAVLLECSKLFPCEGVELRDINLTYG---GTDLRNTTVVSSCSN  423

Query  191   AETIVKGKRNP  159
             A+    G +NP
Sbjct  424   AKIATFGVQNP  434



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 162/372 (44%), Positives = 234/372 (63%), Gaps = 13/372 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GA+ DG  D + A+++AW  AC S  A+ V+IP GT+  G+++  GPC A  I
Sbjct  27    IFDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAP-I  85

Query  1076  VIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
                ++GT++A  D S + +   W   + +    ++G G  +G+G+ VW     + + +A 
Sbjct  86    NFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVW---GTKCLSSAY  142

Query  899   L--LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP++L F  +  S + DI   +SK FH+ +  C +     + I+AP +S NTDGIHI
Sbjct  143   CNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHI  202

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               S+ +N+TD  + TGDDCVSIGDG+  + + RVTCGPGHGIS+GSLGK   E  V G++
Sbjct  203   GRSSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGIS  262

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEA  375
             V+NCTL  T NG R+KT+ AS Q  AS + FEDI+++NV  PIIIDQ+Y   N  N K  
Sbjct  263   VKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSP  322

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S++K+ +V FRNIRGT S +  A+ LICSQ VPC DVEL DI++     +G  +  ++C 
Sbjct  323   SRIKISNVSFRNIRGTTSTQ-VAVKLICSQGVPCHDVELGDINLEYNGNEGPAM--SQCK  379

Query  194   NAETIVKGKRNP  159
             N +  + G + P
Sbjct  380   NIKPNLLGVQLP  391



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/377 (42%), Positives = 231/377 (61%), Gaps = 17/377 (5%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  9     GESQTGVFDITKYGA--NSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  66

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  67    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKLDQFTMSGGGILDGQAAAAWECKQSKK  125

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S I DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  126   CNK---LPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  182

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  183   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVV  242

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV VRNCT   T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  243   GVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNK  302

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+CS+ VPCE +E+ DIDI  +  +G    P 
Sbjct  303   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEG----PA  357

Query  203   K--CVNAETIVKGKRNP  159
             K  C N +  +KGK+NP
Sbjct  358   KSSCENIKPSLKGKQNP  374



>emb|CDY15264.1| BnaC05g01430D [Brassica napus]
Length=418

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 228/372 (61%), Gaps = 12/372 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+T+FGA  DG+ ++  A ++AW + C S   A +++P+G FLAG ++F GPC +K 
Sbjct  47    TVFDITQFGAVGDGRTNTFKAFLKAWIQVCASPVPATLLVPKGNFLAGPIIFAGPCKSK-  105

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + + ++GT+ A +  S + +  W + E V  V +TG G I+GRGE +W  D   K     
Sbjct  106   VTVNVQGTISATT--SGFATPEWILFERVDNVHLTGPGIIHGRGEAIWGADGCGKKFKCN  163

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    +  I  VN+K FHM +    + N+  ++I AP +SPNTDGIH+S 
Sbjct  164   LPPTSLKFRNIVNLEVSGISSVNAKAFHMFLVKTVNVNIHNIKIIAPAESPNTDGIHLSN  223

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV + D  +GTGDDCVS+G G+ N+ V RV CGPGHG+S+GSLGK   E DV G+  +
Sbjct  224   ADNVRILDSFIGTGDDCVSVGRGSNNVTVERVVCGPGHGLSVGSLGKYLNEEDVSGIHFK  283

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+  T NG RIK++  S   KA  I FEDI++ NV  PIIIDQ+Y S  R   S+V +
Sbjct  284   NCTMRNTDNGLRIKSWGGSTPSKAVDIHFEDIIMENVKNPIIIDQNYGS--RGGESRVAI  341

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              DV F+ +RGT   K   +  +CS++VPC+ V + D+++     KG H      L  + C
Sbjct  342   SDVLFKGVRGTTITKD-FVQFMCSKSVPCKGVRVEDVNLNFVGNKGGHQSASGGLIGSLC  400

Query  197   VNAETIVKGKRN  162
              NA  I+ GK N
Sbjct  401   NNANVILGGKVN  412



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/361 (44%), Positives = 226/361 (63%), Gaps = 13/361 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GA+ DG  D + A+++AW  +C S  A+ V+IP GT+  G++   GPC A  I
Sbjct  27    IFDVTKYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAP-I  85

Query  1076  VIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
                ++GT++A  D S + +   W   + +    ++GGG  +G+G+ VW            
Sbjct  86    NFVVQGTVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKTVWGRKCPH-YAYCK  144

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP++L F  +  S + DI   +SK FH+ +  C +     + I+AP +S NTDGIHI  
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHIGR  204

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ +N+TD  + TGDDCVSIGDG+  + + RVTCGPGHGIS+GSLGK   E  V G++V+
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             NCTL  T NG R+KT+ AS Q  AS + FEDI+++NV  PIIIDQ+Y   N  N K  S+
Sbjct  265   NCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV------HLKP  207
             +KL +V FRNIRGT S +  A+ L+CSQ VPC+DVEL DI++     +G       ++KP
Sbjct  325   IKLSNVSFRNIRGTTSTQ-VAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKP  383

Query  206   N  204
             N
Sbjct  384   N  384



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 157/370 (42%), Positives = 234/370 (63%), Gaps = 9/370 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             FD+ K+GAK DGK D + A+ RAW +AC S   + V+I +G ++AG V FQGPC A  + 
Sbjct  27    FDIKKYGAKADGKTDDSQAINRAWKEACASTTPSTVLIAKGNYMAGPVKFQGPCKAP-VS  85

Query  1073  IEIKGTMVADSDLS-VYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             I ++GT+ A ++   + + + W +  ++ G+ V+GGGT +G+G   W  +   K      
Sbjct  86    IRVEGTLQAPAEPEKLKSQDGWVVFRNIDGLTVSGGGTFDGQGSIAWSKNDCAKTGKCNS  145

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+++ F G+  S I +I   NSK FH+ V +C +  +  + ITAPG+S NTDGIHI  S
Sbjct  146   LPINIRFSGLTNSHIQNITSSNSKLFHINVLNCKNVTLQHVIITAPGESLNTDGIHIGRS  205

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             +N+N+T   + TGDDC+S+GDG+  + + +V CGPGHGISIGSLG+   E  V GVTVRN
Sbjct  206   SNINITGAEIKTGDDCISLGDGSQQINIEKVKCGPGHGISIGSLGRYHDEQPVTGVTVRN  265

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNV-TRPIIIDQDYNSKNRKEA---SK  369
             CT+  T+NG R+KT+ ASP   AS + FEDI++ NV T P++IDQ+Y    + +A   SK
Sbjct  266   CTISNTSNGVRVKTWPASPNGVASDLHFEDIIMENVKTSPVLIDQEYCPNGQCQAKIPSK  325

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             VK+ +V F+NIRGT S     + L CS+ +PC++V+++DI +      G     + C N 
Sbjct  326   VKISNVSFKNIRGT-SADPVVVKLACSKGIPCQNVQISDIHLTYNGKNGAAT--SVCTNV  382

Query  188   ETIVKGKRNP  159
             +  + G+  P
Sbjct  383   KPTMTGQIFP  392



>emb|CDP06168.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 164/404 (41%), Positives = 239/404 (59%), Gaps = 18/404 (4%)
 Frame = -1

Query  1349  IKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKAC  1170
              K  +F+I L I   ++ +  +P      H IF+V  +GA+ DG  D + A +RAWN AC
Sbjct  7     FKVVLFIIFLFITADASTI--LP------HKIFNVDNYGARADGSTDDSQAFLRAWNDAC  58

Query  1169  HSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVA  990
               RG +KV+IP G ++   V F GPC  + I + IKGT+ A ++ +++ +N W    +V 
Sbjct  59    QWRGRSKVLIPLGNYMLNSVTFVGPCNGEMIFV-IKGTLRAPTNPALFFTNTWIGFRYVD  117

Query  989   GVEVTGGGTINGRGEDVWQF-DADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHM  813
              + + GGG ++G+G   W   D  + I   PL P+SL    +  S I  ++ +NSK  H+
Sbjct  118   NLTLEGGGYLDGQGAAAWPHNDCSKNIGCLPL-PISLRLDFITNSRIQKLRSINSKNAHV  176

Query  812   KVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLV  633
              +  CN+ N+S +R++APG+SPNTDGIHI  S N+ ++ + +GTGDDC+S+  G+ N+++
Sbjct  177   NLFACNNINISHVRLSAPGNSPNTDGIHIGFSNNIKISSVNIGTGDDCISMVSGSQNIVI  236

Query  632   TRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIF  453
             + V CGPGHGISIGSLG+   +  V  + V N T   T NG RIKT+  S    AS I F
Sbjct  237   SDVFCGPGHGISIGSLGRAFAKEYVMHINVVNTTFRNTQNGVRIKTWSPSSPSLASDINF  296

Query  452   EDIMLHNVTRPIIIDQDY----NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQ  285
             +DI++ NV  PIIIDQDY    +    +  S+V+++DV FRNI GT+S K  AI L CS+
Sbjct  297   QDIIMDNVNNPIIIDQDYCPFCSPTGGESISQVQIRDVTFRNISGTSSSK-VAIYLQCSR  355

Query  284   TVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPGG  153
              VPC  V+L DID+      G  +    C N      GK+ P G
Sbjct  356   VVPCHKVKLVDIDLAYREAGGPAIA--SCSNVYGASYGKQVPSG  397



>ref|XP_004292314.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=416

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/349 (46%), Positives = 223/349 (64%), Gaps = 9/349 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V  FGAK DG+ D + A   AW +AC S+G   ++IPRG ++ G + F GPC   R 
Sbjct  48    VFNVKSFGAKADGQTDDSKAFTAAWKEACQSKGRVHLIIPRGKYMVGPLKFSGPC---RN  104

Query  1076  VIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             V  +   M A ++LS Y     W       G+ +TGGGT +G+G   W  +   K  N  
Sbjct  105   VSALNLRMNATTELSKYEFGGGWIQFAWTKGLTLTGGGTFDGQGAKAWPHNKCSKDSNCK  164

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             LLP SL F G+N++ I  I  VNS  FH+ V DC+ F  SKL+I AP  SPNTDGIHI  
Sbjct  165   LLPTSLKFIGMNKTVIRGISSVNSMFFHIAVVDCHYFKGSKLKIQAPETSPNTDGIHIER  224

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S++V  +   + TGDDC+S+G+G +++ +T + CGPGHGIS+GSLGK   E DV G+ VR
Sbjct  225   SSSVYFSSSHIATGDDCISVGEGNSHVTITSIACGPGHGISVGSLGKYPNEGDVSGLVVR  284

Query  539   NCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEAS  372
             +CT+ GTTNG RIKT+  SP +  A+ + F +I+++NVT PIIIDQ Y    S   +  S
Sbjct  285   DCTISGTTNGIRIKTWANSPGRSAATNMTFTNIVMNNVTNPIIIDQLYCPLRSCASQTPS  344

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGK  225
             KVKL D+ F+NIRGT+S +  A++L CS+ +PC+++ L D+ +  A+GK
Sbjct  345   KVKLSDIYFKNIRGTSSSQ-VAVALECSRGIPCQNIYLEDVHLNLASGK  392



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/377 (42%), Positives = 231/377 (61%), Gaps = 17/377 (5%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  20    GESQTGVFDITKYGA--NSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  77

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  78    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKLDQFTMSGGGILDGQAAAAWECKQSKK  136

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S I DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  137   CNK---LPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  193

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  194   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVV  253

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV VRNCT   T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  254   GVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNK  313

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+CS+ VPCE +E+ DIDI  +  +G    P 
Sbjct  314   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEG----PA  368

Query  203   K--CVNAETIVKGKRNP  159
             K  C N +  +KGK+NP
Sbjct  369   KSSCENIKPSLKGKQNP  385



>ref|XP_010649600.1| PREDICTED: exopolygalacturonase-like [Vitis vinifera]
Length=446

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/349 (45%), Positives = 219/349 (63%), Gaps = 13/349 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVT +GA  DGK ++ MA + AW+ AC+  G + +++P GTF  G + F GPC   + 
Sbjct  70    IFDVTMYGAVGDGKTENGMAFLAAWDDACNHPGKSTLLVPNGTFFIGPISFIGPCQNNQS  129

Query  1076  V-IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTIN-----GRGEDVWQFDADEK  915
               +EI+GT+ A S L  + +  W +   +  + +TG  T N      +GE+ W+  AD +
Sbjct  130   PKVEIRGTLKAPSSLKAFPTPSWIMFRQLQSLILTGETTTNTSLFDAQGEESWR-HADCR  188

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
              K     P S+I   V    I +I   N KGFHM + + ++  V  + ITAP +SPNTDG
Sbjct  189   HKLKCQFPTSIILVNVTNGNISNITLKNGKGFHMGIINSDNVTVHGVNITAPWNSPNTDG  248

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             +HI  STN+++T   +G GDDCVSIG G+ N+ V    CGPGHGIS+GSLGK + E DV 
Sbjct  249   VHIGYSTNIHITSSTIGVGDDCVSIGPGSINITVFNTKCGPGHGISVGSLGKYSAEKDVV  308

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA  375
             GV V+NCT+ GT NG RIKT+  SP  KAS   FEDI++ NV+ PIIIDQ+Y   +   +
Sbjct  309   GVRVKNCTINGTQNGVRIKTWPGSPASKASSFWFEDIVMINVSNPIIIDQEYCPWSTCTS  368

Query  374   SK-----VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             SK     VKL D+ F NIRGT + K  A++L+CS +VPCED++L +I++
Sbjct  369   SKVSPSLVKLSDIHFTNIRGTFNTKS-AVALMCSSSVPCEDIQLLNINL  416



>ref|XP_009776874.1| PREDICTED: exopolygalacturonase-like [Nicotiana sylvestris]
Length=400

 Score =   297 bits (760),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 160/372 (43%), Positives = 231/372 (62%), Gaps = 12/372 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKR  1080
              F+V  +GA  D K D++ A ++AW  AC  RG + V+IP GT++   V F+GPC +  R
Sbjct  31    FFNVLDYGAVADEKRDNSQAFLKAWEDACQWRGRSMVLIPYGTYMLRSVSFEGPCRSLMR  90

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              VI  KG + A +  S++ +N W    ++ G+ V GGG ++G+G   W ++   K  +  
Sbjct  91    FVI--KGVLKAPTSPSLFNTNTWIGFRYINGLVVKGGGYLDGQGASAWPYNDCSKNPHCM  148

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LPV+L    V  S IH ++ +NSK  H+ +  CN+ N+S +R+TAPGDSPNTDGIHI  
Sbjct  149   PLPVTLRLDFVTNSRIHHLRSINSKNSHINLFACNNINISFVRMTAPGDSPNTDGIHIGA  208

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             STN+ ++  V+ TGDDC+S+  G+ N+ ++ VTCGPGHGISIGSLGK   E  V G+ VR
Sbjct  209   STNIRISRTVIQTGDDCISMVTGSRNIDISEVTCGPGHGISIGSLGKSPGEF-VTGINVR  267

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY-----NSKNRKEA  375
             NCT I T NGARIKT+  S   +AS I F DI + NV  P++IDQ Y      S   ++ 
Sbjct  268   NCTFIDTQNGARIKTWAPSLSSEASDIFFGDIYVQNVNNPVLIDQQYCPYPSCSNLGQDN  327

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             SKV++ +V F NI GT+S K  A++L CS+ VPC++V+L +I++      G     + C+
Sbjct  328   SKVQISNVTFSNIWGTSSSK-VAVTLKCSKLVPCKNVQLNNINLAYHGRGGP--ATSSCL  384

Query  194   NAETIVKGKRNP  159
             N      GK++P
Sbjct  385   NVIGASYGKQSP  396



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/401 (40%), Positives = 240/401 (60%), Gaps = 12/401 (3%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGA  1155
             F+I+  + L +  + CI        + F+V  +GAK DGK D    ++ AW +AC+S  A
Sbjct  10    FIIVGAVFLCTYLLTCIKNSESAIISNFNVVNYGAKCDGKTDDGKPILEAWKQACNSNIA  69

Query  1154  AKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEV  978
             + VVIP G ++ G V FQGPC A  + + ++G + A S L V+   + W +   ++G+ +
Sbjct  70    STVVIPPGNYILGPVDFQGPCKAA-VTVRVEGYLRAPSMLDVFKLRDGWIVFRDISGLTI  128

Query  977   TGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDC  798
              GGGT +G+G   W+ +   K   +  +P ++ F G+    +++I  ++SK FHM +  C
Sbjct  129   EGGGTFDGQGMIAWKENNCAK-SGSCSMPTNIRFTGITNGEVNNITSLDSKMFHMNIIKC  187

Query  797   NDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTC  618
             N      + I AP  SPNTDGIHI  S+ +N+T   + TGDDCVS+GDG+ ++ +  +TC
Sbjct  188   NYMTFKGITIDAPVSSPNTDGIHIGRSSMINITGATIRTGDDCVSLGDGSQHISINNITC  247

Query  617   GPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIML  438
             GPGHGIS+GSLGK   E  V GV VRNCTL+ T NG R+KT+  S    ASG+ F+DI++
Sbjct  248   GPGHGISVGSLGKYPGEQPVVGVIVRNCTLVNTMNGLRVKTWPNSFNGIASGLHFQDIII  307

Query  437   HNVTRPIIIDQDYNSKN---RKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCED  267
              NV+ P++IDQDY   +    +  SKVK+ DV F+NI+GT++ K  AI L CS+ +PCE+
Sbjct  308   DNVSNPVLIDQDYCPDDLCKLQVPSKVKVSDVLFKNIKGTSATKM-AIQLKCSKIMPCEN  366

Query  266   VELADIDIVSAAGKG-----VHLKPNKCVNAETIVKGKRNP  159
             V L DID+     KG          ++C N    + GK +P
Sbjct  367   VTLDDIDLCYLGNKGNNRNTTSTATSECFNVRPAIMGKLSP  407



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 225/369 (61%), Gaps = 8/369 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             FDV  +GAK +G  D + A+  AW  AC ++ A+ VVI +G ++ G + F+GPCTA  + 
Sbjct  28    FDVKAYGAKANGMTDDSKAINSAWKDACAAKEASTVVIAKGNYMVGPLKFEGPCTAP-VT  86

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             ++++GT+ A +D      + W    +V G+ V+GGG  +G+G   W  +   K      L
Sbjct  87    VKVQGTLKAPADPKRLRDD-WVAFRNVEGLTVSGGGIFDGQGAIAWSVNNCAKTGKCNSL  145

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P +L F  +  S I  I  +NSK FHM + +CN+     + I AP +S NTDGIHI  ST
Sbjct  146   PTNLQFTKLTNSKIEGITSLNSKLFHMNILNCNNVTFQNIVINAPKNSLNTDGIHIGRST  205

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
              VN+T   + TGDDCVS+GDG   + V +VTCGPGHGISIGSLG+   E  V GVTVRNC
Sbjct  206   MVNITGATIKTGDDCVSLGDGCQQINVEKVTCGPGHGISIGSLGRYHDEQPVIGVTVRNC  265

Query  533   TLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKVK  363
             TL  T NG RIKT+ ASP   AS + FEDI+++NV+ PI+IDQ+Y   N    K  S+VK
Sbjct  266   TLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQEYCPYNNCLAKVPSRVK  325

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAET  183
             + DVRF  IRGT S    A+ ++CS+ +PC++V + DI++V    +G     + C N + 
Sbjct  326   ISDVRFEGIRGT-SATQVAVKIVCSRGLPCQNVFVEDINLVYNGKEGSST--SLCANVKP  382

Query  182   IVKGKRNPG  156
              V GK  P 
Sbjct  383   QVSGKVFPA  391



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 235/370 (64%), Gaps = 11/370 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDVT +GA+ +   D T A+  AW  AC S    KV+IPRGT+       +GPC    I
Sbjct  27    VFDVTTYGAQLNM--DITQALSNAWKDACASPIRGKVLIPRGTYKLSRATLEGPCKVP-I  83

Query  1076  VIEIKGTMVADSDLSVYTS-NYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              ++++GT+ A +D S +   + W    +V G+ + GGGT +G+G  VW  + +++ +   
Sbjct  84    KVQLQGTLRAPTDPSGFNEGDGWVTFRNVDGLTLAGGGTFDGQGSAVWGKNCEQQ-QYCG  142

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP++  F  V  S I DI  +NSK FH+ V    +   S+++I AP DSPNTDGIHI  
Sbjct  143   KLPINFRFDFVTNSLIRDIISLNSKQFHINVLGGQNVTFSRVKIIAPEDSPNTDGIHIGR  202

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ +++TD V+ TGDDCVS+GDG   + + RVTCGPGHGIS+GSLGK + E  V+GV VR
Sbjct  203   SSGISITDTVIQTGDDCVSLGDGCKEISIRRVTCGPGHGISVGSLGKYSNEDPVEGVIVR  262

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             NCT+  T+NG R+KT+  S    AS + FEDI++ NV  P++IDQ+Y   N  N K  S+
Sbjct  263   NCTIRNTSNGVRVKTWPDSHDGLASNLHFEDIVMENVGNPVLIDQEYCPWNQCNAKVPSR  322

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             +K+ DV F+NIRGT++    A++L+CS   PC++VE+ADID+  +   G  +  ++C N 
Sbjct  323   IKISDVSFKNIRGTSTTAL-AVNLVCSSGFPCQNVEIADIDLQYSGNDGPIM--SQCKNV  379

Query  188   ETIVKGKRNP  159
             +  + GK+NP
Sbjct  380   KPTISGKQNP  389



>ref|XP_002892124.1| hypothetical protein ARALYDRAFT_887420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68383.1| hypothetical protein ARALYDRAFT_887420 [Arabidopsis lyrata subsp. 
lyrata]
Length=422

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 228/371 (61%), Gaps = 13/371 (4%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T++D+TKFGA  DG  ++  A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVYDITKFGAVGDGSTNTFKAFLNTWIQVCDSPVPATLLVPKGQFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + + ++GT++A +  S Y +  WF+ E V  + +TG GT +G+GE VW+ D   K     
Sbjct  109   VTVNVQGTIIATT--SGYATPEWFLFERVDNLVLTGTGTFHGKGEAVWKADGCGKKVQCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I+ I  VN+K FHM +    + N+  +++ AP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNMKNVEINGISSVNAKAFHMFLVKTENVNIQNIKLIAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV++ D  + TGDDCVS+G G+ N+ V RV CGPGHG+S+GSLGK   E DV G+ V 
Sbjct  227   ADNVSILDSTIATGDDCVSVGRGSNNVTVERVICGPGHGLSVGSLGKYKNEEDVSGIHVN  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT++ T NG RIKT+  S   KA  I FE+I++ +V  PIIIDQ+Y S  R   S+V +
Sbjct  287   NCTMVETDNGLRIKTWGGSDPSKAVDIKFENIIMQSVKNPIIIDQNYGS--RGGDSQVAI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK-------  201
              D+ F+NIRGT   K   + ++CS++VPC+ V + D+++      G   K +        
Sbjct  345   SDILFKNIRGTTITKD-IVQIMCSKSVPCKGVNVVDVNLNYVGKTGGEKKSSSGGLVGAL  403

Query  200   CVNAETIVKGK  168
             C NA  I  GK
Sbjct  404   CDNANVIFGGK  414



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 230/370 (62%), Gaps = 9/370 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GA+ DG  D + A+++AW  AC S  A+ V+IP GT+  G+++  GPC A  I
Sbjct  27    IFDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAP-I  85

Query  1076  VIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
                ++GT++A  D S + +   W   + +    ++G G  +G+G+ VW            
Sbjct  86    NFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGTKCLSS-SYCN  144

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP++L F  +  S + DI   +SK FH+ +  C +     + I+AP +S NTDGIHI  
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHIGR  204

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ +N+TD  + TGDDCVSIGDG+  + + RVTCGPGHGIS+GSLGK   E  V G++V+
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             NCTL  T NG R+KT+ AS Q  AS + FEDI+++NV  PIIIDQ+Y   N  N K  S+
Sbjct  265   NCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             +K+ +V FRNIRGT S +  A+ LICSQ  PC+DVEL DI++     +G  +  ++C N 
Sbjct  325   IKISNVSFRNIRGTTSTQ-VAVKLICSQGEPCQDVELGDINLEYNGNEGPAM--SQCKNI  381

Query  188   ETIVKGKRNP  159
             +  + G + P
Sbjct  382   KPNLLGVQLP  391



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   297 bits (760),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 239/403 (59%), Gaps = 14/403 (3%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDV-TKFGAKPDGKGDSTMAMIRAWN  1179
             M +   I V+ + + L +T    IP+ +    T+ DV  K+GAK D K D +  ++ AW 
Sbjct  1     MAVLLNIPVLSMLLLLFTTS---IPKAQS---TVVDVVAKYGAKADEKTDLSTPLLNAWK  54

Query  1178  KACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIE  999
             +AC S   +K+VIP+GT+        GPC +  I +++ G + A +D S +    W +  
Sbjct  55    EACASTTPSKIVIPKGTYRLSRASLDGPCKSA-IELQVSGIIKAPADPSAFKDPNWVVFN  113

Query  998   HVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGF  819
             HV  + ++GGG  +G+G  VW  +   K K    LP++L F  V+ + +  I   +SK F
Sbjct  114   HVDHLTISGGGVFDGQGAAVWGKNNCAKNKYCAALPINLRFNYVSNAIVQGITTKDSKQF  173

Query  818   HMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNL  639
             H+ V  C +F      ++AP +S NTDGIHI  S  V V D  + TGDDCVS+GDG+ N+
Sbjct  174   HVNVLGCRNFTFQHFTVSAPENSINTDGIHIGRSNGVKVLDTNIKTGDDCVSLGDGSKNV  233

Query  638   LVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGI  459
             +V RVTCGPGHGIS+GSLGK   E  V G+ VRNCTL  T NG R+KT+  S    A+ +
Sbjct  234   IVERVTCGPGHGISVGSLGKFNDEEPVSGIFVRNCTLSNTMNGVRVKTWPDSHPGSATDM  293

Query  458   IFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICS  288
              FEDI+L+NV  PI+IDQ+Y   N  N K  S++KL ++ F+ IRGT+S +  A+ L+CS
Sbjct  294   HFEDIILNNVGNPILIDQEYCPWNLCNLKVPSRIKLSNISFKKIRGTSSTQQ-AVRLVCS  352

Query  287   QTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             + +PC+ VELADIDI      G     ++C N +    GK+NP
Sbjct  353   RGLPCDRVELADIDITYKGPGGPAT--SECTNVKPRTSGKQNP  393



>ref|XP_006303792.1| hypothetical protein CARUB_v10012094mg [Capsella rubella]
 gb|EOA36690.1| hypothetical protein CARUB_v10012094mg [Capsella rubella]
Length=423

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 160/371 (43%), Positives = 224/371 (60%), Gaps = 13/371 (4%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+TKFGA  DG  +S  A +  W + C S   A +++P+G FLAG V+F GPC +K 
Sbjct  51    TVFDITKFGAVGDGSTNSFKAFLNTWIQVCESPVPATLLVPKGQFLAGPVIFAGPCKSK-  109

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + ++++GT++A +  S Y +  WF+ E V  V +TG GT +G+GE VW+ D   K     
Sbjct  110   VTVDVQGTIIATT--SGYATPEWFLFERVDNVHLTGTGTFHGKGEAVWKADGCGKKVQCN  167

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    + NV  +++ AP +SPNTDGIH+S 
Sbjct  168   LPPTSLKFRNMKNVEIDGITSVNAKAFHMFLVKTENVNVHNIKLLAPAESPNTDGIHLSN  227

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV + D  + TGDDCVS+G G  N+ V RV CGPGHG+SIGSLGK   E DV G+ V 
Sbjct  228   ADNVKILDSTIATGDDCVSVGRGCNNVTVERVICGPGHGLSIGSLGKYKNEEDVSGIRVN  287

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT++ T NG RIKT+  S   K   + F +I++ +V  PIIIDQ+Y S  R   S+V++
Sbjct  288   NCTMLETDNGLRIKTWGGSDPSKVVDVKFTNIIMQSVKNPIIIDQNYGS--RGGDSRVEI  345

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK-------  201
              DV F+NIRGT   K   + L+CS++VPC  V + D+++      G   K +        
Sbjct  346   TDVLFQNIRGTTITKD-IVQLMCSKSVPCRGVNVVDVNLNYVGKPGGEKKSSSGGIVGAF  404

Query  200   CVNAETIVKGK  168
             C NA  I  GK
Sbjct  405   CDNANVIFGGK  415



>dbj|BAK05779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   297 bits (761),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 161/347 (46%), Positives = 215/347 (62%), Gaps = 11/347 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDV  FGA  DG+ D + A IRAW KAC S G A VVIP+G +    VVF+GPC    +
Sbjct  37    VFDVMDFGAIADGETDDSKAFIRAWMKACASPGRAAVVIPKGEYRLQPVVFRGPCKGY-M  95

Query  1076  VIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              + + G + A  DL+ +  S+ W     + G+ VTGGGT +GRGE  W  +      N  
Sbjct  96    EVRLAGVLRAPDDLAAFRGSHEWINFASIDGLLVTGGGTFDGRGESSWHLNECPTNPNCK  155

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LPVS+    V    I  +  +NSK FH+ +    D ++ ++ I AP DSPNTDG+HI G
Sbjct  156   PLPVSIKLGRVRNVTITAVTSLNSKFFHVIIIGSQDVSIHRVTIRAPRDSPNTDGVHIQG  215

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+NV +TD  + TGDDCVS+G G+ ++ V+ V+CGPGHGIS+GSLG+   E DV+G+ V 
Sbjct  216   SSNVRITDTAIATGDDCVSVGPGSADITVSGVSCGPGHGISVGSLGRHPGEEDVRGLRVS  275

Query  539   NCTLIGTTNGARIKTYRAS--PQLKASGIIFEDIMLHNVTRPIIIDQDY----NSKNRKE  378
             NCTL GT NG RIKT+R    P    SG++FEDI++  V  PIIIDQ+Y    +S  R E
Sbjct  276   NCTLAGTANGVRIKTWRGGLRPGSVVSGLVFEDIVMRKVRNPIIIDQEYCPYSSSSCRHE  335

Query  377   A--SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             +  S VK+ DV+F+NIRG  S    A+ L CS   PC  +EL DID+
Sbjct  336   SRPSVVKISDVKFKNIRGV-SATQVAVKLSCSGASPCHGLELRDIDL  381



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 231/377 (61%), Gaps = 17/377 (5%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  21    GESQTGVFDITKYGA--NSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  78

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  79    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKIDQFTMSGGGILDGQAAAAWECKQSKK  137

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S + DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  138   CNK---LPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  194

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  195   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVV  254

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV VRNCT   T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  255   GVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNK  314

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+CS+ VPCE +E+ DIDI  +  +G    P 
Sbjct  315   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEG----PA  369

Query  203   K--CVNAETIVKGKRNP  159
             K  C N +  +KGK+NP
Sbjct  370   KSSCENIKPSLKGKQNP  386



>gb|KEH33414.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=395

 Score =   296 bits (759),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 161/397 (41%), Positives = 240/397 (60%), Gaps = 17/397 (4%)
 Frame = -1

Query  1328  ILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAK  1149
             IL  + LL+    CI   +     +F+V  +GA  DGK D+  A ++AW+ AC+S G   
Sbjct  5     ILFVLGLLAV---CISESQARVTNVFNVLNYGAIADGKTDNKEAFLKAWSDACNSNGKVT  61

Query  1148  VVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGG  969
             ++IP+GT++  +V+F GPC       +I+GT+ A  D   + ++ W   ++V  + V G 
Sbjct  62    LLIPKGTYMVKQVIFSGPCKGST-NFKIQGTLKAPID-PFFATDKWINFQYVNNLVVGGP  119

Query  968   GTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDF  789
             GT++G+G   W  +  +   N P LP+S+ F  V    IH ++  NSKG H K+  C + 
Sbjct  120   GTLDGQGSSAWSVNDCKNNPNCPRLPISMTFDFVTNGTIHHLRSFNSKGAHFKLFACENM  179

Query  788   NVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPG  609
               +K+RI+APGDSPNTDGI I  S  + +    +GTGDDC+++  GT N+ ++ V CGPG
Sbjct  180   IFTKIRISAPGDSPNTDGIKIGKSNGITIKSASIGTGDDCIAMVSGTRNVWISDVFCGPG  239

Query  608   HGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQ---LKASGIIFEDIML  438
             HG+SIGSLGK   E DV  + V+NCT   TTNG RIKT+ ASP    LKAS I++EDI++
Sbjct  240   HGVSIGSLGKNDGEEDVDNINVKNCTFSDTTNGLRIKTW-ASPLTKILKASHIVYEDIVM  298

Query  437   HNVTRPIIIDQDYNSKNR----KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCE  270
             +NV  PI+IDQ+Y   NR    K  S V++  V ++NIRG+ + +H A++L CS+  PC+
Sbjct  299   NNVGNPILIDQEY-CPNRGCSNKVPSNVQINTVSYKNIRGSVNSEH-AMNLKCSEKEPCQ  356

Query  269   DVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             ++ + +ID+    GK      N C +A     GK+NP
Sbjct  357   NIIVENIDLWPNDGK--RKLNNWCSHAYVSSFGKQNP  391



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 226/352 (64%), Gaps = 11/352 (3%)
 Frame = -1

Query  1256  IFDVTK--FGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
             +FDVT   +GAKP    D T A+ +AW  AC S   +KVV+P GT++  E  F+GPC A 
Sbjct  26    VFDVTSATYGAKPGS--DITHALAKAWIDACASPAPSKVVVPSGTYMLTEASFKGPCKAP  83

Query  1082  RIVIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
              I I+++G + A +D    T  + W   +HV  + V+GGG  +G+G   W+ +   K K+
Sbjct  84    -IEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGXFDGQGALAWKKNDCNKNKD  142

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                + +++ F  V  S I DI  ++SK FH+ V  C++    ++ +TAPG+S NTDGIHI
Sbjct  143   CKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVNVTAPGESINTDGIHI  202

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               ST +N+TD  +GTGDDCVSIGDG   + VTRVTCGPGHGIS+GSLG+   E  V G+ 
Sbjct  203   GRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSLGRYPNEEPVVGIR  262

Query  545   VRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             V+NCTL  T+NG RIKT+ ASP    AS + FEDI++ NV+ P++IDQ Y   N   +  
Sbjct  263   VKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCPWNQCKQNV  322

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
              SKVK+ +V F+NI+G+++    A+ ++CS  +PCE+VELADID+     KG
Sbjct  323   PSKVKISNVSFKNIKGSSATPL-AVQIVCSGGIPCENVELADIDLTYNGNKG  373



>emb|CDX88444.1| BnaC06g38880D [Brassica napus]
Length=400

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 168/397 (42%), Positives = 234/397 (59%), Gaps = 13/397 (3%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECI-PRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRG  1158
               ++L IA L++GV    P GR     IFDV  +GA+ DGK D+  A  RAW  AC  +G
Sbjct  8     LTLILFIASLASGVSAAAPAGR----MIFDVRSYGARGDGKTDNANAFTRAWKDACQWKG  63

Query  1157  AAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEV  978
             +A+V +P GTF  G V F GPC   RI   IKGT++A  D +    + W I  +V  + V
Sbjct  64    SARVFVPLGTFYLGGVTFVGPCQ-NRISFIIKGTLLAPKDANAIKQDTWIIFRYVDYLTV  122

Query  977   TGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDC  798
             +GGGT++G+G   W+ +   +  N   LP+++ FQ V  S I  IK +NSK  H+     
Sbjct  123   SGGGTLDGQGTSAWRLNDCTRNPNCRPLPMNIAFQFVRFSRISRIKSINSKMGHLNFFAV  182

Query  797   NDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTC  618
               F ++++ I AP DSPNTDGI I  S ++ + D+ +GTGDDC++I  GTTNL V  V C
Sbjct  183   EYFEITRVSIRAPADSPNTDGIKIGSSHHMKIHDVFIGTGDDCIAILSGTTNLDVFSVKC  242

Query  617   GPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIM  441
             GPGHGIS+GSLG+   E  V G++VR+    GT+NG RIKT+  S      S   F+++ 
Sbjct  243   GPGHGISVGSLGRFKDEKSVYGISVRDSVFTGTSNGVRIKTWAPSASRNIVSNFTFQNLQ  302

Query  440   LHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCE  270
             + NV  PIIIDQ Y   N   +   S+V++++V+F NI GT++ K  A+ L CSQT PC+
Sbjct  303   MINVGSPIIIDQQYCPNNQCTKNSHSQVQIENVKFNNIWGTSTDK-VAVKLQCSQTAPCK  361

Query  269   DVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             DVELA I++V     G       C N     +GK +P
Sbjct  362   DVELAGINLVHRGVDGPATA--LCENVSGRTRGKISP  396



>ref|XP_002870065.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46324.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   297 bits (760),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 168/385 (44%), Positives = 237/385 (62%), Gaps = 20/385 (5%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNK  1176
             ++I + IFVILL  +   T V+        +  + D+  FGA+ +   D T A + AW+K
Sbjct  7     LKIFSFIFVILLSSSEAETRVD------KSSVFLVDIRSFGARANDHRDHTKAFVAAWDK  60

Query  1175  ACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSN-YWFI  1005
             AC S  ++   +IPRG F  G + F GPCT    + + +K    A +DLS Y S   W  
Sbjct  61    ACKSSSSSVHFIIPRGEFSVGPLRFSGPCTNVSNLTVRVK----ASTDLSKYRSGGAWIE  116

Query  1004  IEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSK  825
                + G+ +TGGGT +G+G   W F+      N  LLP SL F G+NR+ +  I  VNSK
Sbjct  117   FGWINGLTLTGGGTFDGQGALAWPFNNCTSDSNCKLLPTSLKFVGMNRTVVRRISSVNSK  176

Query  824   GFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTT  645
              FH+ + +C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCVSIG G +
Sbjct  177   FFHIALVECRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCVSIGQGNS  236

Query  644   NLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLK-A  468
              + +T + CGPGHGIS+GSLG+   E DVKG+ V++C + GTTNG RIKT+  SP L  A
Sbjct  237   QITITSIKCGPGHGISVGSLGRYPNEKDVKGLVVKDCKISGTTNGIRIKTWANSPGLSAA  296

Query  467   SGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISL  297
             + + FE+I+++NVT PIIIDQ Y   +S      SKV+L ++ F+NIRGT+S +  A+ L
Sbjct  297   TNMTFENIIMNNVTNPIIIDQSYCPFSSCISNVPSKVELSEIYFKNIRGTSSSR-VAVQL  355

Query  296   ICSQTVPCEDVELADI--DIVSAAG  228
              CS+ +PC+ V L ++  D+ S+ G
Sbjct  356   HCSRGMPCKKVYLENVHLDLSSSDG  380



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   296 bits (758),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 159/352 (45%), Positives = 224/352 (64%), Gaps = 11/352 (3%)
 Frame = -1

Query  1256  IFDVTK--FGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
             +FDVT   +GAKP    D T A+ +AW  AC S   +KVV+P GT++  E  F+GPC A 
Sbjct  26    VFDVTSATYGAKPGS--DITQALAKAWTDACASPTPSKVVVPSGTYMLTEASFKGPCKAP  83

Query  1082  RIVIEIKGTMVADSDLSVYTS-NYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
              I I+++G + A +D    T  + W   EHV  + V+GGGT +G+G   W+ +   K K+
Sbjct  84    -IEIQVQGKLTAPADGGKLTKPDTWVCFEHVNKLTVSGGGTFDGQGALAWKKNDCNKNKD  142

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                + +++ F  V  S I DI  ++SK FH+ V  C++    ++ +TAPG+S NTDGIHI
Sbjct  143   CKSMAINMRFDFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVNVTAPGESINTDGIHI  202

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               ST +N+TD  +GTGDDCVSIGDG   + VTRVTCGPGHGIS+GSLG+   E  V G+ 
Sbjct  203   GRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSLGRYPNEEPVVGIR  262

Query  545   VRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             V+NCTL  T+NG RIKT+ ASP    AS + FEDI++ NV+ P++IDQ Y   N   +  
Sbjct  263   VKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCPWNQCKQNV  322

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
              SK+K+ +V F+NI+G+++    A+ ++CS  + CE VEL DID+     KG
Sbjct  323   PSKIKISNVSFKNIKGSSATPL-AVQIVCSSGIACEKVELDDIDLTYNGNKG  373



>ref|XP_003528630.1| PREDICTED: polygalacturonase [Glycine max]
Length=422

 Score =   297 bits (760),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 227/372 (61%), Gaps = 11/372 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACH-SRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             I +V  FGAK DGK D T + ++AW K CH S G A++ +P G F+   + F GPC A  
Sbjct  52    IVNVQDFGAKGDGKFDCTESFMQAWAKTCHQSSGPARLYVPAGRFVVSSMYFNGPCNATS  111

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN--  906
             I I+++GT++A +D+S Y +  W   ++  G+++ GGGT +G+G+D WQ+  + +  N  
Sbjct  112   ITIQVQGTVLATTDISEYENGDWLFFQNHNGLKIVGGGTFDGQGKDSWQYAQNCESANDG  171

Query  905   -APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
                  P +L F G +   + +I+ VN KGFH+ V+ C +  + KL++ APG SPNTDGIH
Sbjct  172   SCARNPSNLYFSGNSNLVVQNIRSVNPKGFHIFVTKCTNVRLRKLKLVAPGTSPNTDGIH  231

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             +S S  V ++   + TGDDCVS+  G  N+ + ++ CGPGHGISIGSLGK A E DV+GV
Sbjct  232   VSHSDTVIMSRNTIATGDDCVSLIPGLRNIFINKLKCGPGHGISIGSLGKYADEGDVRGV  291

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN--RKEA  375
              ++NC+L GTTNG RIK +       AS + F DI++ +V  PIIIDQ+Y      +K+ 
Sbjct  292   RIKNCSLTGTTNGLRIKAWPERYPGAASDVSFSDIIMKDVKNPIIIDQEYECYPDCKKKP  351

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S VKL+++ F NIRGT      A+ L CS   PC+ V + DID+      G+    ++CV
Sbjct  352   SLVKLQNIHFSNIRGTTISPL-AVDLRCSGLFPCQGVTIRDIDL----KIGLTPTTSRCV  406

Query  194   NAETIVKGKRNP  159
             N   +  G   P
Sbjct  407   NTRPLFGGLLMP  418



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   296 bits (758),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 159/375 (42%), Positives = 232/375 (62%), Gaps = 13/375 (3%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  20    GESQTGVFDITKYGA--NSNADISEALLSAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  77

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  78    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKIDQFTMSGGGILDGQAAAAWECKNSKK  136

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S I DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  137   CNK---LPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  193

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  194   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVI  253

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV VRNCT   T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  254   GVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNK  313

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+CS+ VPCE +E+ DIDI S +GK    K +
Sbjct  314   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLCSKGVPCEGIEVGDIDI-SYSGKEGPAK-S  370

Query  203   KCVNAETIVKGKRNP  159
              C N +  +KGK+NP
Sbjct  371   SCENIKPSLKGKQNP  385



>ref|XP_008451195.1| PREDICTED: exopolygalacturonase isoform X2 [Cucumis melo]
Length=401

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 227/373 (61%), Gaps = 7/373 (2%)
 Frame = -1

Query  1280  RGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQ  1101
             R R  +  ++ V  FGA+ +G  D + A + AW  AC S G    +IP+GT+L G V F 
Sbjct  21    RYRTKSSHVYSVRSFGARANGLTDDSNAFLAAWRTACDSAGVVTFLIPKGTYLVGPVKFS  80

Query  1100  GPC-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             GPC     + +++KG + A ++LS Y S   W     + G+ +TGGGT +GRG + W F+
Sbjct  81    GPCKNVSSLTVKMKGYLKASTNLSKYGSGAGWIEFRWMEGLTLTGGGTFDGRGSEAWPFN  140

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                   N  LLP +L F  +N + +  I  +NSK FH+ +  C  F  SKL+I+AP +SP
Sbjct  141   NCRDDYNCKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKGFIGSKLKISAPENSP  200

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIHI  S+NV+ +   + TGDDC+SIG G + + ++ + CGPGHGIS+GSLG+   E
Sbjct  201   NTDGIHIDRSSNVHFSLSHIQTGDDCISIGQGNSEVTISSINCGPGHGISVGSLGRYRNE  260

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---  399
              DV G+ V+NC+L GT NG RIKT+  SP    A+ + FE+I ++NV+ PIIIDQ Y   
Sbjct  261   GDVSGLVVKNCSLTGTANGIRIKTWPNSPGSSSATNMTFENITMNNVSNPIIIDQSYCPF  320

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
                + K  S VKL D+ F+NIRGT+S K  A++L CS+  PC++V L ++ +  ++G+  
Sbjct  321   GFCSFKAPSLVKLSDIYFKNIRGTSSSK-VAVALECSKGFPCQNVNLENVHLDLSSGENH  379

Query  218   HLKPNKCVNAETI  180
                  K V A  I
Sbjct  380   PSSTCKYVRARYI  392



>ref|XP_009136909.1| PREDICTED: exopolygalacturonase [Brassica rapa]
Length=424

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/388 (43%), Positives = 235/388 (61%), Gaps = 16/388 (4%)
 Frame = -1

Query  1364  VATMEIKAGIF----VILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMA  1197
             ++ +E+K  IF    V+     +  +    + RG   +  I DV  FGA+ +   D+T A
Sbjct  1     MSIVEMKFTIFHYLRVLFFFFFVALSSYSFVVRGDKSSVLIVDVRSFGARANDHRDNTKA  60

Query  1196  MIRAWNKACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYT  1023
              + AW+ AC S  ++  ++IPRG F  G + F GPCT    + + +K    A +DLS Y 
Sbjct  61    FVAAWDMACKSSSSSVDLIIPRGEFHVGPIRFSGPCTNVTHLTVRVK----ASTDLSKYR  116

Query  1022  SNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHD  846
             S   W     + G+ +TGGGT +G+G   W F+      +  LLP SL F G+NR+ +  
Sbjct  117   SGGGWIEFGWINGLTLTGGGTFDGQGALAWPFNNCITDSHCKLLPTSLKFVGMNRTIVRR  176

Query  845   IKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCV  666
             I  VNSK FHM +  C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCV
Sbjct  177   ISSVNSKFFHMALVQCRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCV  236

Query  665   SIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRA  486
             SIG G + + +T + CGPGHGIS+GSLG+   E DVKG+ VR+C + GTTNG RIKT+  
Sbjct  237   SIGQGNSQITITSIKCGPGHGISVGSLGRYPNEKDVKGLVVRDCKMSGTTNGIRIKTWAD  296

Query  485   SPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASK  318
             SP L  A+ + F++I++ NVT PIIIDQ Y   +S +    SKVKL ++ F+NIRGT+S 
Sbjct  297   SPGLSAATNMTFQNIIMSNVTNPIIIDQSYCPFSSCSSNVPSKVKLSEIYFKNIRGTSSS  356

Query  317   KHPAISLICSQTVPCEDVELADIDIVSA  234
             K  A+ L CS+ +PC+ V L ++ +  A
Sbjct  357   K-VAVQLHCSEGMPCKKVYLENVHLYLA  383



>ref|XP_010413907.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=383

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 231/374 (62%), Gaps = 11/374 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACH-SRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             +FDV  +GA  DGK D+ MA  +AWN AC  S G + V I  G F   +V F GPC    
Sbjct  10    VFDVRNYGAYSDGKRDNGMAFTKAWNDACQWSSGRSTVYIAPGVFYLRQVTFAGPC-KNS  68

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             I   +KGT++A  + S+   + W + E+V  + VTGGG ++G+G   W  +   K  N  
Sbjct  69    ITFMVKGTLLAPRNPSLINQDEWILFEYVDSLTVTGGGLLDGQGSYSWPLNDCNKNSNCR  128

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              L +++ F  V  S I  ++ +NSK  H  +   NDFN+S + ITAPGDSPNTDGI I  
Sbjct  129   SLAMNIGFAFVRSSRIDGLRSINSKMGHFNIYGVNDFNISGVTITAPGDSPNTDGIKIGR  188

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+N+++ ++ +GTGDDC++I DGTTNL ++ V CGPGHGIS+GSLG+   E +V+G+TVR
Sbjct  189   SSNMHIHNVTIGTGDDCIAILDGTTNLDISHVRCGPGHGISVGSLGRYKDEKNVQGLTVR  248

Query  539   NCTLIGTTNGARIKTYRAS-PQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR-----KE  378
             +   IGTT+G RIKT+  S  ++  S  ++E+I++ NV  PIIIDQ Y    +     K 
Sbjct  249   DSVFIGTTDGLRIKTWAKSISEISVSNFLYENILMINVGNPIIIDQQYCPNGQCDSSGKY  308

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKC  198
             AS V++KDV++  I GT++ K  A+ + CS+T PC+DVEL+DI++      G+      C
Sbjct  309   ASHVQIKDVKYNKIWGTSTSKE-ALKMQCSKTFPCQDVELSDINLKYVGPDGIVTA--LC  365

Query  197   VNAETIVKGKRNPG  156
              N    ++GK  PG
Sbjct  366   QNVGGSIRGKIVPG  379



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/369 (41%), Positives = 222/369 (60%), Gaps = 8/369 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             F +  +G K     D T A   AW  AC S   +K+++P+GT++  +VVF+GPC A  + 
Sbjct  33    FSIANYGLKGTEDEDITKAFSVAWKAACSSTSPSKLIVPKGTYVLRQVVFEGPCKAP-LE  91

Query  1073  IEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
             +++ GT+ A  D S +     W   + +    + G GT +G+G   W  +   K      
Sbjct  92    LQVHGTIKAPEDPSDFIEKAGWISFQRIDRFALVGNGTFDGQGSTAWSQNDCHKTGECNK  151

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+++ F  +    + DI  +NSK FH+ V  CN+   S++ I AP DSPNTDGIHI  S
Sbjct  152   LPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLTFSRVNIKAPEDSPNTDGIHIGRS  211

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              N+N+TD V+ TGDDC+S+G G+ N+ + RV CGPGHGIS+GSLG+  +E  V G+ VRN
Sbjct  212   KNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGHGISVGSLGRYTKEEPVSGIIVRN  271

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKV  366
             CT   T NG R+KT+ +S +  A+G+ F+DI + NV+ P++IDQ+Y   N    K+ S+V
Sbjct  272   CTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPVVIDQEYCPYNHCKAKKPSQV  331

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             KL ++ FRNI GT+S +  A+ L CS  VPCE+VE++DIDI      G  +  + C N  
Sbjct  332   KLSNISFRNIHGTSSTQM-AMKLACSSGVPCENVEISDIDIKYTGSDGDSM--SDCTNVS  388

Query  185   TIVKGKRNP  159
               + GK+ P
Sbjct  389   PKIFGKQYP  397



>ref|XP_008451194.1| PREDICTED: exopolygalacturonase isoform X1 [Cucumis melo]
Length=417

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 227/373 (61%), Gaps = 7/373 (2%)
 Frame = -1

Query  1280  RGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQ  1101
             R R  +  ++ V  FGA+ +G  D + A + AW  AC S G    +IP+GT+L G V F 
Sbjct  37    RYRTKSSHVYSVRSFGARANGLTDDSNAFLAAWRTACDSAGVVTFLIPKGTYLVGPVKFS  96

Query  1100  GPC-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             GPC     + +++KG + A ++LS Y S   W     + G+ +TGGGT +GRG + W F+
Sbjct  97    GPCKNVSSLTVKMKGYLKASTNLSKYGSGAGWIEFRWMEGLTLTGGGTFDGRGSEAWPFN  156

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                   N  LLP +L F  +N + +  I  +NSK FH+ +  C  F  SKL+I+AP +SP
Sbjct  157   NCRDDYNCKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKGFIGSKLKISAPENSP  216

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIHI  S+NV+ +   + TGDDC+SIG G + + ++ + CGPGHGIS+GSLG+   E
Sbjct  217   NTDGIHIDRSSNVHFSLSHIQTGDDCISIGQGNSEVTISSINCGPGHGISVGSLGRYRNE  276

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---  399
              DV G+ V+NC+L GT NG RIKT+  SP    A+ + FE+I ++NV+ PIIIDQ Y   
Sbjct  277   GDVSGLVVKNCSLTGTANGIRIKTWPNSPGSSSATNMTFENITMNNVSNPIIIDQSYCPF  336

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
                + K  S VKL D+ F+NIRGT+S K  A++L CS+  PC++V L ++ +  ++G+  
Sbjct  337   GFCSFKAPSLVKLSDIYFKNIRGTSSSK-VAVALECSKGFPCQNVNLENVHLDLSSGENH  395

Query  218   HLKPNKCVNAETI  180
                  K V A  I
Sbjct  396   PSSTCKYVRARYI  408



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/397 (41%), Positives = 246/397 (62%), Gaps = 20/397 (5%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECIPRGRGHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRG  1158
             FV LL + LL      +   +  +   +FD+TK+GAKP+   D T A+  AW +AC S  
Sbjct  7     FVALLPMLLL------VSNSKAQSAAGVFDITKYGAKPNA--DITAALASAWKEACASTT  58

Query  1157  AAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEV  978
              +KV+IP+GT+   +   +GPC +  I ++++GT+ A SD+     +   ++E+V  + V
Sbjct  59    PSKVLIPKGTYGLTQSNLKGPCKS-SIELQLEGTVQASSDVK---GDGLLLLEYVDQLTV  114

Query  977   TGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDC  798
             +G G ++G+G+  W  +     K    LP++L F  V  S + DI  ++SK +H  +  C
Sbjct  115   SGTGVVDGQGKTAWGKNDCHLKKICTKLPMNLKFNFVTNSIVKDITSLDSKNYHFNLLAC  174

Query  797   NDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTC  618
              +     + ITAPG+SPNTDGIH+  S  +N+ +  + TGDDC+S+G     ++++ VTC
Sbjct  175   KNLTFDHVTITAPGNSPNTDGIHVGDSEQINILNTNIATGDDCISVGSSNKQIVISDVTC  234

Query  617   GPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIM  441
             GPGHGISIGSLGK   E ++ GVTV+ C L GTTNG RIKT+  S     AS + FEDI 
Sbjct  235   GPGHGISIGSLGKYTNEKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIE  294

Query  440   LHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCE  270
             + NV+ P++IDQ+Y   N  NRK  SK+K+  V F+NIRGT++    A+ L+CSQ+ PCE
Sbjct  295   MVNVSNPVLIDQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPV-AVKLVCSQSNPCE  353

Query  269   DVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
              VE+ADID+  +  +G  +K ++C N + ++ GK+NP
Sbjct  354   GVEVADIDLTYSGSEG-PIK-SQCANVKPVISGKQNP  388



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 225/361 (62%), Gaps = 13/361 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDVTK+GA+ DG  D + A+++AW  AC S  A+ V+IP GT+  G+++  GPC A  I
Sbjct  27    IFDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAP-I  85

Query  1076  VIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
                ++GT++A  D S + +   W   + +    ++G G  +G+G+ VW            
Sbjct  86    NFVVQGTVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGTKCLSS-SYCN  144

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
              LP++L F  +  S + DI   +SK FH+ +  C +     + I+AP +S NTDGIHI  
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHIGR  204

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+ +N+TD  + TGDDCVSIGDG+  + + RVTCGPGHGIS+GSLGK   E  V G++V+
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             NCTL  T NG R+KT+ AS Q  AS + FEDI+++NV  PIIIDQ+Y   N  N K  S+
Sbjct  265   NCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV------HLKP  207
             +K+ +V FRNIRGT S +  A+ LICSQ  PC+DVEL DI++     +G       ++KP
Sbjct  325   IKISNVSFRNIRGTTSTQ-VAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKP  383

Query  206   N  204
             N
Sbjct  384   N  384



>gb|KHN02943.1| Polygalacturonase [Glycine soja]
Length=422

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 227/372 (61%), Gaps = 11/372 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACH-SRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             I +V  FGAK DGK D T + ++AW K CH S G A++ +P G F+   + F GPC A  
Sbjct  52    IVNVQDFGAKGDGKFDCTESFMQAWAKTCHQSSGPARLYVPDGRFVVSSMYFNGPCNATS  111

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN--  906
             I I+++GT++A +D+S Y +  W   ++  G+++ GGGT +G+G+D WQ+  + +  N  
Sbjct  112   ITIQVQGTVLATTDISEYENGDWLFFQNHNGLKIVGGGTFDGQGKDSWQYAQNCESANDG  171

Query  905   -APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
                  P +L F G +   + +I+ VN KGFH+ V+ C +  + KL++ APG SPNTDGIH
Sbjct  172   SCARNPSNLYFSGNSNLVVQNIRSVNPKGFHIFVTKCTNVRLRKLKLVAPGTSPNTDGIH  231

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             +S S  V ++   + TGDDCVS+  G  N+ + ++ CGPGHGISIGSLGK A E DV+GV
Sbjct  232   VSHSDTVIMSRNTIATGDDCVSLIPGLRNIFINKLKCGPGHGISIGSLGKYADEGDVRGV  291

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN--RKEA  375
              ++NC+L GTTNG RIK +       AS + F DI++ +V  PIIIDQ+Y      +K+ 
Sbjct  292   RIKNCSLTGTTNGLRIKAWPERYPGAASDVSFSDIIMKDVKNPIIIDQEYECYPDCKKKP  351

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S VKL+++ F NIRGT      A+ L CS   PC+ V + DID+      G+    ++CV
Sbjct  352   SLVKLQNIHFSNIRGTTISPL-AVDLRCSGLFPCQGVTIRDIDL----KIGLTPTTSRCV  406

Query  194   NAETIVKGKRNP  159
             N   +  G   P
Sbjct  407   NTRPLFGGLLMP  418



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 240/370 (65%), Gaps = 13/370 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDVT FGAKPD   D T A++ AW + C S   +KV+IP+G++   +   +GPC +  I
Sbjct  29    VFDVTSFGAKPDA--DITGALVSAWKEGCASITPSKVLIPKGSYGLSQSNLKGPCKS-SI  85

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              ++I+GT+ A SD      +   I+E+V  + V+G G ++G+G++ W+ +     K    
Sbjct  86    ELQIEGTLQAPSDPK---GDGLLILEYVDRLTVSGMGVLDGQGKEGWEKNDCHLKKICTK  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP++L    +  S + DI  ++SK +H+ +  C +     + ITAPGDSPNTDGIH+S S
Sbjct  143   LPMNLKLNFITNSIVKDITSLDSKNYHINLLGCKNLTFDHVTITAPGDSPNTDGIHVSSS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               +N+ +  + TGDDC+S+GD    ++++ VTCGPGHGISIGSLGK ++E +V GVTV+ 
Sbjct  203   EEINILNTNIATGDDCISVGDTNKQIVISDVTCGPGHGISIGSLGKYSKEKEVVGVTVKK  262

Query  536   CTLIGTTNGARIKTYRAS-PQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             C L  TTNG RIKT+  S     AS + FEDI + NV+ P+IIDQ+Y   N  NRK  SK
Sbjct  263   CKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVIIDQEYCPWNQCNRKVPSK  322

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             +K+  V F+NIRGT++    A+ ++CS++ PCE+VE+ADID+  +  +G  +K ++C N 
Sbjct  323   IKISKVSFKNIRGTSATPV-AVKIVCSKSNPCEEVEVADIDLTYSGSEG-PIK-SQCANV  379

Query  188   ETIVKGKRNP  159
             + ++ GK+NP
Sbjct  380   KPVISGKQNP  389



>ref|XP_008645431.1| PREDICTED: exopolygalacturonase-like [Zea mays]
 gb|AFW70751.1| hypothetical protein ZEAMMB73_321863 [Zea mays]
Length=413

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 213/341 (62%), Gaps = 7/341 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              D+ + GAK DGK DST  +++AW  AC + G  K+VIP G +L G +  +GPC +  I+
Sbjct  46    LDIAQLGAKGDGKSDSTPMILKAWKNACEATGVQKIVIPPGNYLTGGLELKGPCKS-SII  104

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I + G ++   DLS Y  N W  IE+V  + + G GTI+G+G  VW  +  +   N  +L
Sbjct  105   IRLDGNLLGTGDLSAYQRN-WIEIENVENLSINGHGTIDGQGALVWSKNQCQHSYNCKIL  163

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+   V    I  I  +NSK FH+ + +C +  + K+ + APGDSPNTDGIHI  S+
Sbjct  164   PNSLVLDFVTNVQIRGITLLNSKFFHLNIFECKNVLIDKVTVKAPGDSPNTDGIHIGDSS  223

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV ++   +G GDDC+SIG G+  + +  V CGPGHGIS+GSLG+   E DV+ V V  C
Sbjct  224   NVTISSTTIGVGDDCISIGPGSKMIRIHGVKCGPGHGISVGSLGRYKDEKDVEDVQVTGC  283

Query  533   TLIGTTNGARIKTYRAS-PQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEASKV  366
             T+ GTTNG RIK+Y  S   LKAS  ++E I + NV+ PIIIDQ Y   N   +  ASKV
Sbjct  284   TIAGTTNGLRIKSYEDSKSSLKASKFLYEGITMDNVSYPIIIDQKYCPNNICVKSGASKV  343

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
              + DV F+NI GT++    AI+L C+  +PC+ V+L ++DI
Sbjct  344   AVNDVVFKNIHGTSNTPE-AITLNCANNLPCQGVQLVNVDI  383



>ref|XP_009118746.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Brassica 
rapa]
Length=418

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/345 (45%), Positives = 221/345 (64%), Gaps = 7/345 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+TKFGA  DG  ++  A ++AW + C S   A +++P G +LAG V+F GPC + R+
Sbjct  49    VFDITKFGAVGDGATNTFKAFLKAWIQVCDSPVPATLLVPAGQYLAGPVIFAGPCKS-RV  107

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +E++GT++A +  S Y +  WF+ E V  V +TG GT NG+GED+W+    +K  N  L
Sbjct  108   TVEVQGTIIATT--SGYATPEWFLFERVNDVLLTGTGTFNGKGEDIWKEGCGKKT-NCNL  164

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P SL F+ +    +  I  VNSK FHM +      N+  +++ AP +SPNTDGIH+S +
Sbjct  165   PPTSLKFRNLKNLEVSGITSVNSKAFHMFLVKTEFVNIHNIKLLAPAESPNTDGIHLSNA  224

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              +V++T+  + TGDDCVSIG G+ N+ +  + CGPGHGISIGSLGK  +E DV G+ V N
Sbjct  225   DHVSITNSKMATGDDCVSIGRGSNNVTIQGIICGPGHGISIGSLGKYKKEEDVSGIHVSN  284

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLK  357
             CT+I T NG RIKT+  S   KA+ I FE+I + +V  PIIIDQ+Y S  R   S+V + 
Sbjct  285   CTMIETDNGLRIKTWGGSDPSKAADIKFENIQMQSVKNPIIIDQNYGS--RGGDSQVAVS  342

Query  356   DVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
             DV F NIRGT +  H  + L CS++VPC  V + D+++     KG
Sbjct  343   DVLFSNIRGT-TITHNVVQLNCSKSVPCAGVNVVDVNLNYVGKKG  386



>ref|XP_010439893.1| PREDICTED: exopolygalacturonase [Camelina sativa]
Length=418

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/397 (42%), Positives = 239/397 (60%), Gaps = 17/397 (4%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTH----TIFDVTKFGAKPDGKGDSTMAMIR  1188
             ME    +   L+ I+ LS+ V      R        +  +V  FGA+ +   D T A + 
Sbjct  1     MESFRYLIFFLIFISTLSSSVAGTLSLRNRVDKSSVSFVNVRSFGARANDHRDHTKAFVA  60

Query  1187  AWNKACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSNY  1014
             AW+KAC S  ++  ++IPRG F  G + F GPCT    + + +K    A +DLS Y S  
Sbjct  61    AWDKACKSSSSSVHLIIPRGEFSVGPLRFSGPCTNVSNLTVRVK----ASTDLSKYRSGG  116

Query  1013  -WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKF  837
              W     + G+ +TGGGT +G+G   W F+      N  LLP SL F G+NR+ +  I  
Sbjct  117   GWIEFGWINGLTLTGGGTFDGQGALAWPFNNCTSDSNCKLLPTSLKFVGMNRTVVRRISS  176

Query  836   VNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIG  657
             VNSK FH+ + +C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCVSIG
Sbjct  177   VNSKFFHIAIVECRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCVSIG  236

Query  656   DGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASP-  480
              G + + +T + CGPGHGIS+GSLG+   E DVKG+ V++C + GTTNG RIKT+  SP 
Sbjct  237   QGNSQITITSIKCGPGHGISVGSLGRYPNEKDVKGLVVKDCKMSGTTNGIRIKTWANSPG  296

Query  479   QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHP  309
             Q  A+ + F++I+++NVT PIIIDQ Y   +S      SKVKL D+ F+NIRGT+S +  
Sbjct  297   QSAATNMTFQNIIMNNVTNPIIIDQSYCPFSSCISNVPSKVKLSDIYFKNIRGTSSSR-V  355

Query  308   AISLICSQTVPCEDVELADIDI-VSAAGKGVHLKPNK  201
             A+ L CS+ +PC+ V L ++ + +S++  G+    N+
Sbjct  356   AVQLHCSRGMPCKKVYLENVHLDLSSSDAGMKQSRNR  392



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 226/352 (64%), Gaps = 11/352 (3%)
 Frame = -1

Query  1256  IFDVTK--FGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
             +FDVT   +GAKP    D T A+ +AW  AC S   +KVV+P GT++  E  F+GPC A 
Sbjct  26    VFDVTSATYGAKPGS--DITHALAKAWIDACASPAPSKVVVPSGTYMLTEASFKGPCKAP  83

Query  1082  RIVIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
              I I+++G + A +D    T  + W   +HV  + V+GGGT +G+G   W+ +   K K+
Sbjct  84    -IEIQVQGKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGTFDGQGALAWKKNDCNKNKD  142

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                + +++ F  V  S I DI  ++SK FH+ V  C++    ++ +TAP +S NTDGIHI
Sbjct  143   CKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFXRVNVTAPXESINTDGIHI  202

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               ST +N+TD  +GTGDDCVSIGDG   + VTRVTCGPGHGIS+GSLG+   E  V G+ 
Sbjct  203   GRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVGSLGRYPNEEPVVGIR  262

Query  545   VRNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKE  378
             V+NCTL  T+NG RIKT+ ASP    AS + FEDI++ NV+ P++IDQ Y   N   +  
Sbjct  263   VKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCPWNQCKQNV  322

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
              SKVK+ +V F+NI+G+++    A+ ++CS  +PCE+VELADID+     KG
Sbjct  323   PSKVKISNVSFKNIKGSSATPL-AVQIVCSGGIPCENVELADIDLTYNGNKG  373



>ref|XP_003534833.2| PREDICTED: exopolygalacturonase clone GBGE184-like [Glycine max]
Length=422

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/376 (43%), Positives = 226/376 (60%), Gaps = 14/376 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKR  1080
             I +V  FGA PDGK D T A + AW  AC S   A+++IP+G F+   + F GPC T   
Sbjct  51    IVNVMSFGAIPDGKFDCTQAFMHAWRAACKSNVQARLLIPKGRFVVSTMFFAGPCLTPGP  110

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVW----QFDADEKI  912
             I I++ GT+ A +D+S Y +  W + E + G+++ GGGT +G G+  W      +ADE  
Sbjct  111   ITIQVVGTVAATTDISEYANGEWLMFEELDGIKLIGGGTFDGMGKGSWATAENCEADES-  169

Query  911   KNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGI  732
              N    P S+ F  V    I +IK V+ KGFH+ V+ C +  +  L++TAP  SPNTDGI
Sbjct  170   NNCVRNPSSIYFHNVRNGIIQNIKSVDPKGFHLFVTSCANIRLRLLKLTAPATSPNTDGI  229

Query  731   HISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKG  552
             HIS S +V ++  ++ TGDDCVS+  G  N+ + ++ CGPGHGISIGSLGK  +E +VK 
Sbjct  230   HISNSIDVKLSKNIIETGDDCVSMIQGVNNVTINKLKCGPGHGISIGSLGKYPEEQEVKD  289

Query  551   VTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RK  381
             + V+NCT++GTTNG RIKT+       AS I F DI++  V  PIIIDQ+Y  +    +K
Sbjct  290   IRVKNCTMVGTTNGLRIKTWPDKYPGAASDITFGDIVMDKVKNPIIIDQEYECEPANCKK  349

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
             + S V +KDV F NIRGT      A+ L CS+  PC+D++L +ID+      G     ++
Sbjct  350   KPSLVNIKDVVFSNIRGTTISPI-AVDLRCSKQFPCQDIKLQNIDL----NLGPKPSGSR  404

Query  200   CVNAETIVKGKRNPGG  153
             C N + I  G + P  
Sbjct  405   CANIKPIYTGVQRPAA  420



>gb|KDP27841.1| hypothetical protein JCGZ_18921 [Jatropha curcas]
Length=411

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 232/368 (63%), Gaps = 11/368 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC--TAK  1083
             IF+V  FGAK + + D+ +  I+AW  AC  RG A+++IP G FLA E+VF GPC  TA 
Sbjct  49    IFNVLHFGAKCNPRTDNALNFIKAWRAACDWRGKARLLIPAGEFLASEMVFAGPCKNTAP  108

Query  1082  RIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
              IV +I GT+ A SD+S Y+ + W + +++ G+ +  GG ++G+G +VW++         
Sbjct  109   TIV-QIVGTIKAVSDMSSYSEDSWMLFQNINGL-IINGGIVDGQGPNVWKYHDG----GG  162

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              + P S+ F  V    I  +  VN  GFH+ +  C +  V+ +R+ AP DSPNTDGIH+S
Sbjct  163   SVFPASIKFFRVTNGVIRMLHSVNPMGFHIGIVLCENIRVTNIRLDAPDDSPNTDGIHLS  222

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              +  V +T  V+ TGDDCV +  G T++ + ++TCGPGHGISIGSLGK   E +VKG+TV
Sbjct  223   QTHLVKITRSVIATGDDCVGMIHGCTDITIKKLTCGPGHGISIGSLGKYPDEKEVKGITV  282

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVK  363
              NCTL  T NG RIKT+  SP   ASG+ F+DI++ +V  PIIIDQ Y S++  E SKVK
Sbjct  283   TNCTLKNTDNGLRIKTWAGSPPSCASGMTFQDIIMKSVKNPIIIDQSYGSESN-EPSKVK  341

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAET  183
             + DV+F N+RGT   +   + L CS+  PCE V+L++ID+     K   +  + C NA+ 
Sbjct  342   ISDVKFLNVRGTTVSE-VGVKLECSKKCPCEGVQLSNIDLHYVGDKKKPIS-SVCQNAKI  399

Query  182   IVKGKRNP  159
                G++ P
Sbjct  400   KYAGRQLP  407



>ref|XP_010457266.1| PREDICTED: exopolygalacturonase clone GBGE184 [Camelina sativa]
Length=422

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 228/371 (61%), Gaps = 13/371 (4%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T++D+TKFGA  DG  +S  A +  W + C+S   A +++P+G FLAG V+F GPC +K 
Sbjct  50    TVYDITKFGAVGDGATNSFKAFLNTWIQVCNSPVPATLLVPKGDFLAGPVIFAGPCKSK-  108

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + ++++GT++A +  S Y +  W + E V  V +TG GT +G+GEDVW+ D   K     
Sbjct  109   VTVDVQGTVIATT--SGYATPEWILFERVDNVLLTGTGTFHGKGEDVWKADGCGKKVQCN  166

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    +  +  +++ AP +SPNTDGIH+S 
Sbjct  167   LPPTSLKFRNMKNVEISGISSVNAKAFHMFLVKTENVKIHNIKLVAPAESPNTDGIHLSN  226

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + +V++ D  + TGDDCVS+G G  N+ V RV CGPGHG+SIGSLGK   E DV G+ V 
Sbjct  227   ADHVSILDSTIATGDDCVSVGRGCNNVTVERVVCGPGHGLSIGSLGKYKHEEDVSGIHVN  286

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+I T NG RIKT+  S   K   + FE+I++ +V  PIIIDQ+Y S  R   S+V++
Sbjct  287   NCTMIETDNGLRIKTWGGSDPSKVVDVKFENIIMQSVKNPIIIDQNYGS--RGGDSRVEI  344

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK-------  201
              DV F+N+RGT +  H  + ++CS++VPC+ V + D+++      G   K +        
Sbjct  345   TDVLFKNVRGT-TITHDIVQIMCSKSVPCKGVNVVDVNLAYVGKPGGEKKSSAGGLVGAF  403

Query  200   CVNAETIVKGK  168
             C NA  I  GK
Sbjct  404   CDNANVIFGGK  414



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/380 (41%), Positives = 236/380 (62%), Gaps = 10/380 (3%)
 Frame = -1

Query  1283  PRGRGHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             P  +  ++  +FDV  FGAK DGK D + A++ AW KAC     +KVVIP G ++  +V 
Sbjct  18    PNAKAQSNNGVFDVMNFGAKADGKTDISQALMAAWRKACAVVSPSKVVIPEGEYILSQVT  77

Query  1106  FQGPCTAKRIVIEIKGTMVADSDLSVYTS-NYWFIIEHVAGVEVTGGGTINGRG-EDVWQ  933
               GPC A  + ++++GT+ A +D S + +   W   + +    ++G GT +G+G +  W 
Sbjct  78    LAGPCKAP-LEVQVRGTLKATADPSKFNNVPTWVTFQRIDRFTLSGAGTFDGQGGKAAWA  136

Query  932   FDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGD  753
              +  +++     LP++L F  V    + DI  V+SK  H+ +  C +   + + + AP  
Sbjct  137   QNDCKQVGRCNKLPINLRFNAVTNGLVRDITSVDSKQTHINLLSCKNLTFANITVNAPAQ  196

Query  752   SPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRA  573
             SPNTDGIHI  S+ +N+TD  + TGDDCVS+G+G+  + V RVTCGPGHGIS+GSLG R 
Sbjct  197   SPNTDGIHIGRSSGINITDSRISTGDDCVSLGEGSQKITVRRVTCGPGHGISVGSLG-RY  255

Query  572   QETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNS  393
             +E  V G+TV NCTLI T+NG R+KT+ AS +  AS + FEDI++ NV+ P++IDQ+Y  
Sbjct  256   REDPVFGITVANCTLINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCP  315

Query  392   KNR--KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
              N+  K  S+VK+ +V F+NIRGT S    A+ L CS  +PCE+VE+ DI++     +G 
Sbjct  316   GNKCAKAPSRVKISNVSFKNIRGT-SATQVAVELRCSSGIPCENVEIGDINLSYIGTEGP  374

Query  218   HLKPNKCVNAETIVKGKRNP  159
                 ++C N + I+ GK+ P
Sbjct  375   AT--SRCSNVKPIITGKQTP  392



>ref|XP_008645416.1| PREDICTED: exopolygalacturonase-like [Zea mays]
 ref|XP_008645417.1| PREDICTED: exopolygalacturonase-like [Zea mays]
 gb|AFW70747.1| hypothetical protein ZEAMMB73_580033 [Zea mays]
Length=435

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 213/341 (62%), Gaps = 7/341 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              D+ + GAK DGK DST  +++AW  AC + G  K+VIP G +L G +  +GPC +  I+
Sbjct  68    LDIAQLGAKGDGKSDSTPMILKAWKNACEATGVQKIVIPPGNYLTGGLELKGPCKS-SII  126

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I + G ++   DLS Y  N W  IE+V  + + G GTI+G+G  VW  +  +   N  +L
Sbjct  127   IRLDGNLLGTGDLSAYQRN-WIEIENVENLSINGHGTIDGQGALVWSKNQCQHSYNCKIL  185

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+   V    I  I  +NSK FH+ + +C +  + K+ + APGDSPNTDGIHI  S+
Sbjct  186   PNSLVLDFVTNVQIRGITLLNSKFFHLNIFECKNVLIDKVTVKAPGDSPNTDGIHIGDSS  245

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV ++   +G GDDC+SIG G+  + +  V CGPGHGIS+GSLG+   E DV+ V V  C
Sbjct  246   NVTISSTTIGVGDDCISIGPGSKMIRIHGVKCGPGHGISVGSLGRYKDEKDVEDVQVTGC  305

Query  533   TLIGTTNGARIKTYRAS-PQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEASKV  366
             T+ GTTNG RIK+Y  S   LKAS  ++E I + NV+ PIIIDQ Y   N   +  ASKV
Sbjct  306   TIAGTTNGLRIKSYEDSKSSLKASKFLYEGITMDNVSYPIIIDQKYCPNNICVKSGASKV  365

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
              + DV F+NI GT++    AI+L C+  +PC+ V+L ++DI
Sbjct  366   AVNDVVFKNIHGTSNTPE-AITLNCANNLPCQGVQLVNVDI  405



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 243/403 (60%), Gaps = 14/403 (3%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDV-TKFGAKPDGKGDSTMAMIRAWN  1179
             M ++  I V+ + + L ST    IP+ +    T+ DV  K+GAK D K D +  ++ AW 
Sbjct  1     MAVQLNIAVLSILLLLFSTS---IPKAQS---TVVDVVAKYGAKADEKTDLSTPLLHAWK  54

Query  1178  KACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIE  999
             +AC S   +K+VIP+GT+        GPC +  I +++ GT+ A +D S +    W +  
Sbjct  55    EACASTTPSKIVIPKGTYRLSRATLDGPCKSA-IELQVSGTIKAPADPSAFKDPNWVVFN  113

Query  998   HVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGF  819
             HV  + ++GGG  +G+G  VW  +   K K    LP++L F  V+ + +  I   +SK F
Sbjct  114   HVDHLTISGGGVFDGQGAAVWGKNNCAKNKYCAALPINLRFNFVSNAIVQGITTKDSKQF  173

Query  818   HMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNL  639
             H+ V  C +F      ++AP +S NTDGIHI  S  + + D  + TGDDCVS+GDG+ N+
Sbjct  174   HVNVLGCKNFTFQHFTVSAPENSINTDGIHIGRSNGIKILDTNIKTGDDCVSLGDGSKNV  233

Query  638   LVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGI  459
             +V RVTCGPGHGIS+GSLGK   E  V G+ +RNCT+  T NG R+KT+  S    A+ +
Sbjct  234   IVERVTCGPGHGISVGSLGKFKGEEPVSGIFIRNCTISNTMNGVRVKTWPDSHPGSATDM  293

Query  458   IFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICS  288
              FEDI+L+NV  PI+IDQ+Y   N  N K  S+VKL ++ F+ I GT+S +  A+ L+CS
Sbjct  294   HFEDIILNNVGNPILIDQEYCPWNLCNLKVPSRVKLSNISFKKIWGTSSTQQ-AVKLVCS  352

Query  287   QTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             + +PC+ VELADIDI      G  +  ++C+N +  + GK+NP
Sbjct  353   RGLPCDRVELADIDITYKGPGGPAI--SQCINVKPRLSGKQNP  393



>ref|XP_003565790.1| PREDICTED: exopolygalacturonase-like [Brachypodium distachyon]
Length=417

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/364 (45%), Positives = 219/364 (60%), Gaps = 12/364 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             FD+TK GA  DGK D +  +  AW  AC + G   VVIP+G FL G V F GPC    + 
Sbjct  50    FDITKLGAASDGKTDCSKELEEAWKSACGAAGQHTVVIPKGEFLCGPVNFSGPCEGD-VT  108

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I+I GT++A +DL  Y    W  I  V  + +TG GT++G+G +VW  D   K       
Sbjct  109   IQIDGTLLATNDLPKYGGGSWINILKVDNLVITGSGTLDGQGSNVWTKDPQAKAG----Y  164

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P +L+   V    +  I  +NSK FHM +   +D  +  + ITAPGDSPNTDGIHI  S+
Sbjct  165   PNTLVLDYVKNGSVSGITLLNSKFFHMNIYMSSDVKIDNVTITAPGDSPNTDGIHIGDSS  224

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             N++VT   +GTGDDC+SIG G+ ++ VT VTCGPG GIS+G LG+   E DV  VTV++C
Sbjct  225   NIHVTGATIGTGDDCISIGGGSASITVTGVTCGPGQGISVGCLGRYKDEKDVSDVTVKDC  284

Query  533   TLIGTTNGARIKTY-RASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK---NRKEASKV  366
              L  +TNG RIKTY  A   + AS + FE+I + +V  PIIIDQ+Y  +     K  S V
Sbjct  285   VLRSSTNGVRIKTYVDAVKSITASNLTFENIKMEDVANPIIIDQNYCPEKICTAKSKSAV  344

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
              +KD+ FRNI GT+S    A+SL+CS+  PC  VEL D++ V  +GK  +     C NA+
Sbjct  345   TVKDIIFRNITGTSSTPE-AVSLLCSEKQPCSGVELIDVN-VEYSGKN-NKTMGVCTNAK  401

Query  185   TIVK  174
              I K
Sbjct  402   GIAK  405



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 230/377 (61%), Gaps = 17/377 (5%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  9     GESQTGVFDITKYGA--NSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  66

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  67    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKLDQFTMSGGGILDGQAAAAWECKQSKK  125

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S I DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  126   CNK---LPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  182

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  183   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVV  242

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV VRNCT   T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  243   GVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNK  302

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+CS+ VPCE +E+ DIDI  +  +G    P 
Sbjct  303   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEG----PA  357

Query  203   K--CVNAETIVKGKRNP  159
             K  C N +  +K K+NP
Sbjct  358   KSSCENIKPSLKDKQNP  374



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 233/379 (61%), Gaps = 12/379 (3%)
 Frame = -1

Query  1265  THTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA  1086
             ++ +F+V  FGA  DG  D++ A   AW +AC+    + V++P G +     VF+GPC A
Sbjct  29    SNGVFNVIDFGAMADGIRDNSKAFENAWREACNWNTYSTVLVPPGKYFVTSAVFKGPCKA  88

Query  1085  KRIVIEIKGTMVADSDLS-VYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
               I  +++G ++A   LS +     W   E +    +TGGGT +G+G   W  +   K  
Sbjct  89    P-ISFQLQGLILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAWPENQCHKNS  147

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
             N  L P+S+ F  +N S I  ++ V+SK FH+ +  C +  ++K+ I+AP DSPNTDGIH
Sbjct  148   NCQL-PISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIH  206

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLV-----TRVTCGPGHGISIGSLGKRAQET  564
             I  S  + +++ ++ TGDDCVS+GDG+ N+LV     + V+CGPGHGIS+GSLGK  +E 
Sbjct  207   IGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLVSDVSCGPGHGISVGSLGKYKKEE  266

Query  563   DVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NS  393
             DV G+TV NCT  GT+NG RIKT+  S   KAS   FED+ ++NV  PI+IDQ+Y   N 
Sbjct  267   DVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQ  326

Query  392   KNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHL  213
              N K  S+VK+ +VRFRNIRGT+  K  A+ ++CS+ +PC++VE+ DI++V         
Sbjct  327   CNIKVPSRVKISNVRFRNIRGTSLTKE-AVRIVCSKEIPCQNVEIGDINLVYNGIDDKGP  385

Query  212   KPNKCVNAETIVKGKRNPG  156
               + C N +  + GK+ P 
Sbjct  386   AISSCSNVKPTLVGKQIPA  404



>ref|XP_004508193.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=422

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 227/371 (61%), Gaps = 10/371 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR-  1080
             + +V  FGAK DG  DST A ++AW   CH+ G  ++ IP G FL   + FQGPC A   
Sbjct  53    LVNVLSFGAKGDGVFDSTEAFMQAWQAVCHTEGQNRLYIPAGKFLVSSMYFQGPCLAPNP  112

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + I+++GT++A +D+S Y +  W + + + G+++ GGGT +G+G+  W++  + +  N  
Sbjct  113   VTIQVEGTVLATTDISEYENGDWLMFQKINGLKIIGGGTFDGQGQKSWEYTENCEASNEV  172

Query  899   LL--PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
              +  P SL F  V  + + +I+ VN KGFH+ ++ C++  + KL++ AP  SPNTDGIHI
Sbjct  173   CVRNPSSLFFMEVQNAIVQNIRSVNPKGFHVFITKCSNIRMRKLKLIAPETSPNTDGIHI  232

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S NV +    + TGDDC+S+  G+ N+ + R+ CGPGHGISIGSLGK   E +V+GV+
Sbjct  233   SSSVNVIIARNSISTGDDCISMIQGSENIFINRLKCGPGHGISIGSLGKYENEREVRGVS  292

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYN--SKNRKEAS  372
             ++N  LIGTTNG RIKT+       AS I F +I + NV  PIIIDQ+Y      +K+ S
Sbjct  293   IKNSALIGTTNGLRIKTWPDRYGGGASMISFSNINMTNVKNPIIIDQEYECYPNCQKKPS  352

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
              VK++D+ F N++GT      A+ L CS+  PC  V + DID+      G      +CVN
Sbjct  353   LVKIQDIHFANVKGTTISPI-AVDLRCSKLYPCSGVTIRDIDL----KFGNAPSSARCVN  407

Query  191   AETIVKGKRNP  159
              + +  G  NP
Sbjct  408   VKPVYGGFLNP  418



>emb|CDP18456.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   295 bits (755),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/372 (42%), Positives = 230/372 (62%), Gaps = 8/372 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IF+V  +GA+ DG  D + A +RAW+ AC  +G++ V+IP GT++   + F GPC  + +
Sbjct  30    IFNVVNYGARADGNTDDSQAFLRAWSDACQWKGSSTVLIPGGTYMLHSITFSGPCLGE-M  88

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
                I+GT+ A +  +++ ++ W     V  + VTG G ++G+G   W ++   K      
Sbjct  89    TFFIRGTLKAPTIPALFFTDTWIGFHSVDNLTVTGSGYLDGQGASAWHYNDCFKNSQCLP  148

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP SL F  +  S I  +  +NSK  H+ +  CN+ ++S +R++AP +SPNTDGIHI  S
Sbjct  149   LPSSLRFDFIRNSKIQYLSSINSKKVHINLFACNNIDISYVRVSAPENSPNTDGIHIGAS  208

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             TN+ ++ + +GTGDDC+S+  G+ N+ ++ V CGPGHGISIGSLGK +Q  +V G++VRN
Sbjct  209   TNIKISRVSIGTGDDCISMVSGSQNIDISEVICGPGHGISIGSLGKGSQNHNVMGISVRN  268

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY----NSKNRKEASK  369
              T   T NG RIKT+  S    AS I F++I++ NV  PIIIDQ Y         +  SK
Sbjct  269   ATFWNTENGVRIKTWSPSWSSLASNISFQNIIMKNVGNPIIIDQKYCPHCPPSGGESVSK  328

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             V+++DV F +I GT+S K  A+SL CS+ VPC++V+L DID+ +  G GV L    C N 
Sbjct  329   VQIRDVEFNDISGTSSSK-VALSLQCSKLVPCQNVKLVDIDL-AYKGLGV-LAIASCSNV  385

Query  188   ETIVKGKRNPGG  153
                  G +NPGG
Sbjct  386   IGTSYGIQNPGG  397



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/377 (41%), Positives = 231/377 (61%), Gaps = 17/377 (5%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  9     GESQTGVFDITKYGA--NSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  66

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  67    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKLDQFTMSGGGILDGQAAAAWECKQSKK  125

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S + DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  126   CNK---LPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  182

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  183   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVV  242

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV V NCT+  T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  243   GVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVYCPFNKCNK  302

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+CS+ VPCE +E+ DIDI  +  +G    P 
Sbjct  303   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEG----PA  357

Query  203   K--CVNAETIVKGKRNP  159
             K  C N +  +KGK+NP
Sbjct  358   KSSCENIKPSLKGKQNP  374



>ref|XP_009333810.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=420

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 158/394 (40%), Positives = 238/394 (60%), Gaps = 9/394 (2%)
 Frame = -1

Query  1322  LGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVV  1143
              G  + + G   +   +  +  +F+V  FGA+ DG+ D + A   AW +AC S G   ++
Sbjct  26    FGRGVKADGRSLLQHHKAKSSNLFNVKSFGARADGRTDDSDAFTAAWKEACQSTGRVHLI  85

Query  1142  IPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGG  969
             IP+GT+  G + F GPC     +   +KG + A +DL  Y S   W     + G+ +TGG
Sbjct  86    IPKGTYTIGPLRFSGPCVNVTSLNFRVKGYLKATTDLRKYGSGGGWIEFAWMKGLTLTGG  145

Query  968   GTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDF  789
             GT +GRG   W  +      N  LLP +L F  +N++ I  +  VNSK FH+ + +C++F
Sbjct  146   GTFDGRGAHAWPHNKCVTNSNCKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNF  205

Query  788   NVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPG  609
               S+L+I+AP  SPNTDGIHI  S++V  +   + TGDDC+S+G G + + +T +TCGPG
Sbjct  206   KGSRLKISAPETSPNTDGIHIERSSSVYFSSSRIATGDDCISVGQGNSQVTITSITCGPG  265

Query  608   HGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHN  432
             HGIS+GSLGK   E DV G+ V++CT+ GTTNG RIKT+  SP    A+ + FE+I+++N
Sbjct  266   HGISVGSLGKYPDERDVSGLVVKDCTMTGTTNGIRIKTWANSPGSSAATNMTFENIVMNN  325

Query  431   VTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVE  261
             VT PIIIDQ Y    +   K  S+VKL D+ F+NIRGT+S +  A+ L CS+ +PC+++ 
Sbjct  326   VTNPIIIDQSYCPFTACTSKAPSRVKLSDIYFKNIRGTSSSEM-AVLLECSKGIPCQNIF  384

Query  260   LADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             L D+ +  ++G+   L  + C N +    G + P
Sbjct  385   LEDVHLDLSSGE--KLATSSCSNVKAKFIGTQIP  416



>ref|XP_006856226.1| hypothetical protein AMTR_s00059p00207710 [Amborella trichopoda]
 gb|ERN17693.1| hypothetical protein AMTR_s00059p00207710 [Amborella trichopoda]
Length=431

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/372 (42%), Positives = 228/372 (61%), Gaps = 9/372 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA-KR  1080
              F+V  +GAK DG+ D + A++  W  AC  +G+ +  IP G ++ G + F GPC     
Sbjct  60    FFNVMNYGAKGDGRTDDSKALMDTWKAACGFKGSVRYYIPPGNYIVGPLNFNGPCKGVTT  119

Query  1079  IVIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             +   IKGT+ A +DLS Y  ++ W +   + G+++TG GT +G+G   W  +   K KN 
Sbjct  120   MNFMIKGTLKASTDLSKYGPTDSWVMFGWLTGLKLTGYGTFDGQGAASWPLNNCPKNKNC  179

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              +LP S+ F   + + +  I  +NSK FH+ + DC +F  + L+ITAP  SPNTDGIHI 
Sbjct  180   KVLPASIKFVATDYTEVQAITSLNSKFFHIVLLDCKNFKATNLQITAPATSPNTDGIHIE  239

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              ST+V++++  +GTGDDC+SIG G T + +  VTCGPGHGIS+GSLG+   E DV G++V
Sbjct  240   RSTDVSISNSKIGTGDDCISIGHGNTRVFINGVTCGPGHGISVGSLGRYPNEGDVMGLSV  299

Query  542   RNCTLIGTTNGARIKTYRASPQLK-ASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEA  375
               C L GT NG RIKT++ SP    A+ + FE+I+++NV  PIIIDQ+Y        +  
Sbjct  300   TGCVLTGTANGLRIKTWQDSPDTSVATNMTFENIVMYNVANPIIIDQNYCPYTYCTARAP  359

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S+VK+ DV F+NIRGT S    A++L CS  +PC++V L D+ + +  G G   K   C+
Sbjct  360   SRVKISDVSFKNIRGT-SATETAVTLHCSNGLPCQNVRLQDVQL-NYYGPGKRAKA-TCM  416

Query  194   NAETIVKGKRNP  159
             N +    G + P
Sbjct  417   NVKASYSGTQIP  428



>ref|XP_010431549.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=404

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 232/369 (63%), Gaps = 8/369 (2%)
 Frame = -1

Query  1334  FVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGA  1155
             F ++L IA +++ +            IFDV  +GA+ DGK D+ MA  +AW  AC  +G 
Sbjct  8     FRLILVIAAVTSSISAAASTDLPGRKIFDVRSYGARGDGKTDNAMAFTKAWKDACEWKGF  67

Query  1154  AKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVT  975
              +V +P GTF  G V+F GPC + RI   IKGT++A  + +      W I  +V  + V+
Sbjct  68    PRVYVPFGTFYLGGVIFTGPCKS-RISFIIKGTLLAPKEANAIKQETWIIFRYVDYLTVS  126

Query  974   GGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCN  795
             GGG ++G+G   W  +   +  N P LP++L FQ V  S I  I+ +NSK  H+      
Sbjct  127   GGGILDGQGSYSWSLNNCRQNPNCPALPMNLGFQFVRFSRIRHIRSINSKMGHLNFYAVQ  186

Query  794   DFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCG  615
             +FN+S++ I AP DSPNTDGI I  S+N+ + ++ +GTGDDC++I  GTTNL ++ V CG
Sbjct  187   NFNISRMSIRAPEDSPNTDGIKIGLSSNMKINNVDIGTGDDCIAILSGTTNLDISNVNCG  246

Query  614   PGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTY--RASPQLKASGIIFEDIM  441
             PGHGIS+GSLGK   E  V+G+TVR+    G+TNG RIKT+  R++P L  S  +++++ 
Sbjct  247   PGHGISVGSLGKYKGEKSVQGITVRDSIFNGSTNGVRIKTWGSRSTPNL-VSNFLYKNLQ  305

Query  440   LHNVTRPIIIDQDY--NSK-NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCE  270
             + NV  PI IDQ Y  NS  + + AS+++++DVR+ NI GT++ K  A+ L CS+ VPC+
Sbjct  306   MINVGNPINIDQRYCPNSNCDYESASQIQIQDVRYNNIWGTSTDKV-AVKLQCSKNVPCK  364

Query  269   DVELADIDI  243
              VEL DI++
Sbjct  365   GVELTDINL  373



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   300 bits (768),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/371 (44%), Positives = 229/371 (62%), Gaps = 9/371 (2%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T FDVTK+GA+ DGK D + A++ AW  AC S   ++VVIP G +  G+V  +GPC A  
Sbjct  215   TYFDVTKYGAQADGKTDISQALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAP-  273

Query  1079  IVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             I + +KGT+ A  D S +     W   +H+    ++G G  +G+G+ VW      + K  
Sbjct  274   INLIVKGTVRAPVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWGQKC-SRTKYC  332

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
               LP++L F  +  S I DI   +SK FH+ V  C +    ++ ITAP DS NTDGIHI 
Sbjct  333   NQLPINLRFNFLTNSIIKDITSKDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIG  392

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S  VN+T   + TGDDCVSIGDG+  + +T+V CGPGHGIS+GSLG    E  V G+ V
Sbjct  393   RSRGVNITHSTIQTGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRV  452

Query  542   RNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEAS  372
             +NCTL  TTNG R+KTY +SPQ  A+ + F DI+++NV+ PIIIDQ+Y   N  N +  S
Sbjct  453   KNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPS  512

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
             +VKL ++ F+NIRGT S +  A++L+CS+  PC+ VEL +ID+     +G     ++C N
Sbjct  513   RVKLSNISFKNIRGTTSTEL-AVNLVCSKGAPCQKVELGNIDLKYTGPEGT--ASSQCKN  569

Query  191   AETIVKGKRNP  159
              E  + G + P
Sbjct  570   VEATLWGTQQP  580


 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 115/167 (69%), Gaps = 3/167 (2%)
 Frame = -1

Query  791  FNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGP  612
              +  + I A  DS NTDGIH+  ST VN++D ++ TGDD +SIGDG+ ++ V +VTCGP
Sbjct  1    MTLQYVTINATRDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGP  60

Query  611  GHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHN  432
            GHGIS+GSLGK   E  V GVTV+NCTLI T NG R+KT+  SP   A+ + FEDI+++N
Sbjct  61   GHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNN  120

Query  431  VTRPIIIDQDYNSKNRKEA---SKVKLKDVRFRNIRGTASKKHPAIS  300
            V  PI+I+Q+Y   ++ +A   S+VK+ DV F+ I   +  ++ ++S
Sbjct  121  VGNPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQYKSVS  167



>ref|XP_010480327.1| PREDICTED: exopolygalacturonase clone GBGE184-like, partial [Camelina 
sativa]
Length=376

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 155/371 (42%), Positives = 228/371 (61%), Gaps = 13/371 (4%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T++D+TKFGA  +G  +S  A +  W + C+S   A +++P+G FLAG V+F GPC +K 
Sbjct  4     TVYDITKFGAVGNGATNSFKAFLNTWIQVCNSPVPATLLVPKGDFLAGPVIFAGPCKSK-  62

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + ++++GT++A +  S Y +  W + E V  V +TG GT +G+GEDVW+ D   K     
Sbjct  63    VTVDVQGTVIATT--SGYATPEWILFERVDNVLLTGTGTFHGKGEDVWKADGCGKKVQCN  120

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    I  I  VN+K FHM +    +  +  +++ AP +SPNTDGIH+S 
Sbjct  121   LPPTSLKFRNMKNVEISGISSVNAKAFHMFLVKTENVKIHNIKLVAPAESPNTDGIHLSN  180

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + +V++ D  + TGDDCVS+G G  N+ V RV CGPGHG+SIGSLGK   E DV G+ V 
Sbjct  181   ADHVSILDSTIATGDDCVSVGRGCNNVTVERVVCGPGHGLSIGSLGKYKHEEDVSGIHVN  240

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+I T NG RIKT+  S   K   + FE+I++ +V  PIIIDQ+Y S  R   S+V++
Sbjct  241   NCTMIETDNGLRIKTWGGSDPSKVVDVKFENIIMQSVKNPIIIDQNYGS--RGGDSRVEI  298

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK-------  201
              DV F+N+RGT +  H  + ++CS++VPC+ V + D+++      G   K +        
Sbjct  299   TDVLFKNVRGT-TITHDIVQIMCSKSVPCKGVNVVDVNLAYVGKPGGEKKSSAGGLVGAF  357

Query  200   CVNAETIVKGK  168
             C NA  I  GK
Sbjct  358   CDNANVIFGGK  368



>ref|XP_008357338.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
 ref|XP_008357339.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=421

 Score =   295 bits (755),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/378 (41%), Positives = 232/378 (61%), Gaps = 9/378 (2%)
 Frame = -1

Query  1274  RGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             +  +  +F+V  FGA+ DG+ D + A   AW +AC S G   ++IP+GT+  G + F GP
Sbjct  43    KAKSSNLFNVKSFGARADGRTDDSDAFTAAWKEACQSIGRVHLIIPKGTYTIGPLRFSGP  102

Query  1094  C-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDAD  921
             C     +   +KG + A +DL  Y S   W     + G+ +TGGGT +GRG   W  +  
Sbjct  103   CVNVTSLNFRVKGYLKATTDLRKYGSGSGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKC  162

Query  920   EKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNT  741
                 N  LLP +L F  +N++ I  +  VNSK FH+ + +C++F  S+L+I+AP  SPNT
Sbjct  163   ITNSNCKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNT  222

Query  740   DGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETD  561
             DGIHI  S++   +   + TGDDC+S+G G + + +T +TCGPGHGIS+GSLGK   E D
Sbjct  223   DGIHIERSSSXYFSSSRIATGDDCISVGQGNSQVTITSITCGPGHGISVGSLGKYPDERD  282

Query  560   VKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NS  393
             V G+ V++CT+ GTTNG RIKT+  SP    A+ + FE+I+++NVT PIIIDQ Y    +
Sbjct  283   VSGLVVKDCTMTGTTNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQSYCPFTA  342

Query  392   KNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHL  213
                K  S+VKL D+ F+NIRGT+S +  A+ L CS+ +PC+++ L D+ +  ++G+   L
Sbjct  343   CTSKAPSRVKLSDIYFKNIRGTSSSEM-AVLLECSKGIPCQNIFLEDVHLDLSSGE--KL  399

Query  212   KPNKCVNAETIVKGKRNP  159
               + C N +    G + P
Sbjct  400   ATSSCSNVKAKFIGTQIP  417



>gb|EYU31582.1| hypothetical protein MIMGU_mgv1a023133mg, partial [Erythranthe 
guttata]
Length=380

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/373 (42%), Positives = 226/373 (61%), Gaps = 9/373 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDV K+GA  DGK D+T A ++AW++AC   G ++V IP G FL   V F GPC+   I
Sbjct  10    IFDVVKYGAVSDGKTDNTKAFLKAWDEACGYSGRSRVFIPNGIFLLDSVSFVGPCSGP-I  68

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
                +KGT+ A +D   + ++ W    +V+ + V GGG  +G+G+  W F+  +       
Sbjct  69    SFLVKGTIRAPTDSRRFFTDTWIGFRYVSRLTVKGGGIFDGQGQAAWPFNDCKTNDQCKP  128

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  VN S + ++  +NSK  H+ +  C +FN++ +R+TAP DSPNTDGIHI  S
Sbjct  129   LPTTLRFDFVNNSRVLNLHSINSKSSHVNIFACGNFNITNVRLTAPSDSPNTDGIHIGSS  188

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             + + +T + + TGDDC+S+  G+ N+ +  V+CGPGHGISIGSLG+  +   VKG+TVRN
Sbjct  189   SQIKITHVRISTGDDCISMVSGSQNIEIYDVSCGPGHGISIGSLGRSHEHEYVKGITVRN  248

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR-----KEAS  372
             C+ IG+ NG RIKT+  S   +AS + F+DI + N   PI+IDQ Y   +      +  S
Sbjct  249   CSFIGSDNGVRIKTWSPSLYSEASDMTFQDIFMQNPKNPIVIDQQYCPSSHCLMKSESRS  308

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVN  192
              V++KDV F NI G +S K  A+ L CS T+PC +V+L DI++      G  +  ++C N
Sbjct  309   AVQIKDVTFSNIWGISSTK-VALDLQCSGTLPCRNVKLIDINLSYNGPGGQAI--SQCSN  365

Query  191   AETIVKGKRNPGG  153
                   GK  P G
Sbjct  366   VIGSSHGKLVPSG  378



>ref|XP_009341510.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=420

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 162/413 (39%), Positives = 246/413 (60%), Gaps = 13/413 (3%)
 Frame = -1

Query  1379  VEHIYVATMEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTM  1200
             V  +++ +M   A  F    G  + + G   +   +  +  +F+V  FGA+ DG+ D + 
Sbjct  11    VGMLFLLSMFCMASGF----GRGVKADGRSLLKHHKAKSSNLFNVKSFGARADGRTDDSD  66

Query  1199  AMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTMVADSDLSVYT  1023
             A   AW +AC S G   ++IP+GT+  G + F GPC     +   +KG + A +DL  Y 
Sbjct  67    AFTAAWKEACQSTGRVHLIIPKGTYTIGPLRFSGPCVNVTSLNFRVKGYVKATTDLRKYG  126

Query  1022  SNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHD  846
             S   W     + G+ +TGGGT +GRG   W  +      N  LLP +L F  +N++ I  
Sbjct  127   SGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCVTNSNCKLLPTNLKFVALNKTVIRG  186

Query  845   IKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCV  666
             +  VNSK FH+ + +C++F  S+L+I+AP  SPNTDGIHI  S++V  +   + TGDDC+
Sbjct  187   LTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHIERSSSVYFSSSRIATGDDCI  246

Query  665   SIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRA  486
             S+G G + + +T +TCGPGHGIS+GSLGK   E DV G+ V++CT+ GTTNG RIKT+  
Sbjct  247   SVGQGNSQVTITSITCGPGHGISVGSLGKYPDERDVSGLVVKDCTMTGTTNGIRIKTWAN  306

Query  485   SP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASK  318
             SP    A+ + FE+I+++NVT PIIIDQ Y    +   K  S+VKL D+ F+NIRGT+S 
Sbjct  307   SPGSSAATNMTFENIVMNNVTNPIIIDQSYCPFTACTSKAPSRVKLSDIYFKNIRGTSSS  366

Query  317   KHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             +  A+ L CS+ +PC+++ L D+ +  ++G+   L  + C N +    G + P
Sbjct  367   EM-AVLLECSKGIPCQNIFLEDVHLDLSSGE--KLATSSCSNVKAKFIGTQIP  416



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/405 (39%), Positives = 250/405 (62%), Gaps = 18/405 (4%)
 Frame = -1

Query  1361  ATMEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAW  1182
             +T+  ++  F++ L I L+ T V+ +          F V ++GA+ +G  D + A+++AW
Sbjct  4     STIFSRSTTFILFLFIGLI-TNVQAVD---------FHVKRYGARANGNSDDSQAIMKAW  53

Query  1181  NKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSN-YWFI  1005
               AC S   +K+VIP G ++   + FQGPC A  I ++++G + A +++    ++  W +
Sbjct  54    KDACSSTKPSKIVIPGGRYVVDSMKFQGPCLAP-IHVQVEGRLQAPTNIKKMRNDASWIV  112

Query  1004  IEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSK  825
              +++ G+ V+G GT +GRG   W+ +          LP+SL F  +N S I DI   +SK
Sbjct  113   FQYINGLTVSGKGTFDGRGSLAWKQNQCASSGKCGSLPISLRFFSLNNSLIKDITSTDSK  172

Query  824   GFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTT  645
              FHM V +C +  +  + I APGDSPNTDGIHI GS+ + + D  + TGDDCVSIGDG+ 
Sbjct  173   FFHMNVHNCRNVTLRNINIDAPGDSPNTDGIHIGGSSGITIHDARIKTGDDCVSIGDGSQ  232

Query  644   NLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKAS  465
              + V +VTCGPGHGISIGSLGK   E  V G+TVR+CT+  T  G RIKT+ AS +  AS
Sbjct  233   QINVEKVTCGPGHGISIGSLGKYKNEKPVSGITVRDCTITNTMFGVRIKTWPASTKGIAS  292

Query  464   GIIFEDIMLHNVTRPIIIDQD---YNSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLI  294
              + FE+I++ NV  PI+IDQ    Y + + +  S+V++ DV F+NIRGT++ +  A+ L+
Sbjct  293   NMQFENIVMDNVGTPILIDQQYCPYGTCHHQVPSRVQISDVGFKNIRGTSTTQ-VAVKLV  351

Query  293   CSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             CS+  PC++V+L++I++  +   G  +  ++C N +  V G+  P
Sbjct  352   CSRGYPCKNVKLSNINLKYSGTNGTAI--SECSNVKPAVVGRVVP  394



>ref|XP_011097055.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 227/369 (62%), Gaps = 10/369 (3%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
             +D+TK+GAK    GD + A++ AW +AC+S   + +VIPRGT+   +V   GP  A  + 
Sbjct  27    YDITKYGAK--SGGDISQALMDAWKEACNSTSPSTIVIPRGTWSLSQVKLLGPNKAP-LE  83

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             ++++GT+ A+          W  I +V    ++GGG  +GRG++ W+ +   K KN   L
Sbjct  84    LQVQGTLQANPGQLPNKEGEWITINYVNYFTLSGGGVFDGRGQEAWKQNDCHKNKNCAKL  143

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P++L F  VN S I D+   +SK FH+     ++    +  ++APGDSPNTDGIH+   T
Sbjct  144   PMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVTFLRFTVSAPGDSPNTDGIHLGRDT  203

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
              +N+ D ++ TGDDCVSIGD +  + +  VTCGPGHGIS+GSLG  A+E DV+G+ V NC
Sbjct  204   MINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHGISVGSLGGYAEEKDVQGIYVTNC  263

Query  533   TLIGTTNGARIKTYRASPQ-LKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEASKV  366
             T IGTTNG R+KT+ ++P  L  S + FED+++ NV+ PIIIDQ+Y   N   +   S +
Sbjct  264   TFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNVSSPIIIDQEYCPHNLCKKDRPSSI  323

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+ +V  +N+RGT +    A++ ICS   PCE+VE+ DID+     +G      KC N +
Sbjct  324   KISNVSIKNVRGTTNTAE-AVTFICSGLKPCENVEVGDIDLTYNGNQGPITT--KCANVK  380

Query  185   TIVKGKRNP  159
                 GK+NP
Sbjct  381   PKFVGKQNP  389



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 233/372 (63%), Gaps = 15/372 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FDVTK GA  + K D T A+++ W +AC ++  ++V+IP+GTF   +  FQGPC A  I
Sbjct  25    VFDVTKNGA--NAKVDITQALLKTWKQACATKSRSQVLIPKGTFKVSQATFQGPCKAP-I  81

Query  1076  VIEIKGTMVADS-DLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVW--QFDADEKIKN  906
                ++GT++A + D +    + W   EH+  + VTGGGT NG+G+  W     + +   N
Sbjct  82    EFNLQGTLLAPAVDGNFKGGDSWISFEHIDSLTVTGGGTFNGQGKTAWGKTCTSSQYCGN  141

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP+++ F  +  S +  +  ++SK FH+ V  C +      +++APGDS NTDGIHI
Sbjct  142   ---LPINVRFNFLTNSVVQYVTSLDSKQFHVNVLGCKNITFQHFKVSAPGDSLNTDGIHI  198

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
               ST+V V D  + TGDDC+SIG+G+  + + +V CGPGHGISIGSLG  A E  VKGV 
Sbjct  199   GRSTDVKVLDSNIQTGDDCISIGEGSQQVTINKVNCGPGHGISIGSLGMYANEEAVKGVF  258

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEA  375
             V++CTL  T NG RIKT+  S    AS + FEDI L NV  PI+IDQ+Y   N  N K +
Sbjct  259   VKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIVIDQEYCPWNKCNAKVS  318

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S+VKL ++ F+NIRG++S    A+ L+CS+  PC++V+L+DI++     +G     ++C 
Sbjct  319   SRVKLSNISFKNIRGSSSTA-VAVKLVCSKGYPCQNVQLSDINLSYKGSEGAIT--SECK  375

Query  194   NAETIVKGKRNP  159
             N + I+ GK NP
Sbjct  376   NVKPILSGKENP  387



>ref|XP_006647023.1| PREDICTED: exopolygalacturonase-like [Oryza brachyantha]
Length=387

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/348 (45%), Positives = 216/348 (62%), Gaps = 8/348 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              D+ + GAK DGK DST  +++AW  AC + G  K+VIP G +L G ++  GPCT+  I+
Sbjct  20    LDIAQPGAKGDGKSDSTRFILQAWTHACRATGTQKIVIPPGNYLTGALLLAGPCTSD-II  78

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             I + G ++  +DL+ Y +N W  I HV    + G GTI+G+G  VW  +   K  N  +L
Sbjct  79    IRLDGNLLGTADLNAYKTN-WIEIMHVNNFAINGHGTIDGQGPLVWSHNECHKSYNCKVL  137

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P SL+        I  +  +NSK FHM +    +  V K+ ITAPGDSPNTDGIHI  ST
Sbjct  138   PNSLVLDFSTNVTIRGVTLLNSKFFHMNIFQSKNVVVDKVTITAPGDSPNTDGIHIGDST  197

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV +    + TGDDC+SIG GT  + V  V CGPGHGIS+GSLG+   E DV+ V V NC
Sbjct  198   NVTIRATTIATGDDCISIGPGTRTVRVHGVRCGPGHGISVGSLGRYKDEKDVEDVVVSNC  257

Query  533   TLIGTTNGARIKTYRAS-PQLKASGIIFEDIMLHNVTRPIIIDQDYNSKN---RKEASKV  366
             TL GTTNG RIK+Y  S  +L+A+  +++ + + NV+ PIIIDQ Y   N   +   SKV
Sbjct  258   TLRGTTNGLRIKSYEDSKSELRATRFVYDGVTMDNVSYPIIIDQKYCPNNICSKSGHSKV  317

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
              + D+ F+NI GT++    A++L C+  +PC+ V+L ++D V  AGKG
Sbjct  318   AVTDIVFKNIAGTSATPE-AVTLNCANNLPCQGVQLQNVD-VKFAGKG  363



>ref|XP_010667119.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/378 (43%), Positives = 224/378 (59%), Gaps = 14/378 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK-R  1080
             +F++  F A  DG+ D   A + A+  AC   G A+++IP G F   +VVF GPC     
Sbjct  48    VFNLENFDAVGDGETDDVEAFMGAFRAACDHPGKARLLIPAGQFAVSQVVFAGPCKGPGP  107

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK-NA  903
             IV++I GT+ A  D+S+Y    W I E + G+ + GGGTI+G+G  VW++ AD  I    
Sbjct  108   IVVQITGTVKAVPDISMYPEPEWLIFERLNGLVIFGGGTIDGQGAHVWKY-ADCNINPQC  166

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
               LP S++ + VN + I  I  +N  GFH  ++   +  + +L I APGDSPNTDGIHIS
Sbjct  167   ARLPSSIVLKNVNNASIRRITSLNPMGFHYFITTSTNIRMQRLHIKAPGDSPNTDGIHIS  226

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S  V +    + TGDDC+ I  G+T L + ++TCGPGHGISIGSLGK   E DV  V V
Sbjct  227   SSNLVKIARSRIETGDDCIGILQGSTRLAINKITCGPGHGISIGSLGKYEDEEDVTAVQV  286

Query  542   RNCTLIGTTNGARIKTYRASPQ---LKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---K  381
             +NCTL  TTNG RIKT+   P    ++ASG +F+DI++ NV  PIIIDQ+Y  +      
Sbjct  287   KNCTLRDTTNGIRIKTFPFKPNVIPIRASGFLFKDIVMDNVKNPIIIDQEYCGRGHSCVN  346

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
               SK+KL D+ F NIRG+ +    AIS+ CS  VPC++V L +I+++   G         
Sbjct  347   GPSKIKLSDIFFHNIRGSTASSE-AISIKCSSAVPCQNVHLHNINLMGLKGPATA----S  401

Query  200   CVNAETIVKGKRNPGGSC  147
             CVNA+    G + P   C
Sbjct  402   CVNAKINFLGIQVPFLKC  419



>ref|XP_010449495.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=418

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/389 (43%), Positives = 238/389 (61%), Gaps = 18/389 (5%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGH----THTIFDVTKFGAKPDGKGDSTMAMIR  1188
             ME    + + L+ I+ LS+ V      R      + ++ +V  FGA+ +   D T A + 
Sbjct  1     MESFRYLKIFLIFISTLSSSVAGTLSLRNREDKSSVSLVNVRSFGARANDHRDHTKAFLA  60

Query  1187  AWNKACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSNY  1014
             AW+KAC S  ++  ++IPRG F  G + F GPCT    + + +K    A +DLS Y S  
Sbjct  61    AWDKACKSSSSSVHLIIPRGEFSVGPLRFSGPCTNVSNLTVRVK----ASTDLSKYRSGG  116

Query  1013  -WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKF  837
              W   E + G+ +TGGGT +G+G   W F+         LLP SL F G+NR+ +  I  
Sbjct  117   GWINFEWINGLTLTGGGTFDGQGALAWPFNNCTSDSKCKLLPTSLKFVGMNRTVVRRISS  176

Query  836   VNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIG  657
             VNSK FH+ + +C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCVSIG
Sbjct  177   VNSKFFHIALVECRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCVSIG  236

Query  656   DGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQ  477
              G + + +T + CGPGHGIS+GSLG+   E +VKG+ V++C + GTTNG RIKT+  SP 
Sbjct  237   QGNSRITITSIKCGPGHGISVGSLGRYPNEKNVKGLVVKDCKMSGTTNGIRIKTWANSPG  296

Query  476   LK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHP  309
             L  A+ + F++I+++NVT PIIIDQ Y   +S      SKVKL D+ F+NIRGT+S +  
Sbjct  297   LSAATNMTFQNIIMNNVTNPIIIDQSYCPFSSCITNVPSKVKLSDIYFKNIRGTSSSR-V  355

Query  308   AISLICSQTVPCEDVELADI--DIVSAAG  228
             A+ L CS+ +PC+ V L ++  D+ S+ G
Sbjct  356   AVQLHCSRGMPCKKVYLENVHLDLSSSFG  384



>ref|XP_004292620.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=597

 Score =   299 bits (766),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 238/370 (64%), Gaps = 19/370 (5%)
 Frame = -1

Query  1256  IFDVT--KFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTF-LAGEVVFQGPCTA  1086
             IFDVT  K+G  PD   D T A+  AW  AC S   + V++P GT+ L  ++ F+GPC A
Sbjct  25    IFDVTSSKYGGNPDS--DITKALTMAWTDACESGSTSTVLVPTGTYKLLEQISFEGPCNA  82

Query  1085  KRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I  +++G + A  D S    + W   + +  + ++GGGT +G+GE  W+ D     K+
Sbjct  83    P-IQFQLQGMLQAPEDRS-QLDDSWVYFKTIDKLTLSGGGTFDGQGELSWKED-----KH  135

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                 PV + F+ VN S I DI F++S  FH+ V   ++    ++ ITAP DSPNTDGIHI
Sbjct  136   FHSTPVDVRFKTVNNSVISDITFMDSAKFHISVHASSNITFQRVTITAPEDSPNTDGIHI  195

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             +GS+ + V+D  + TGDDCVSIGDG T +LV+ +TCGPGHGISIGSLGK   E  V GVT
Sbjct  196   AGSSKITVSDSYIATGDDCVSIGDGATEILVSNITCGPGHGISIGSLGKYPDEQPVVGVT  255

Query  545   VRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR--KE-  378
             V+NCTL GTTNGARIKT+  SP +  A  I+++DI++ NV  PI+I+Q+Y  K +  K+ 
Sbjct  256   VKNCTLTGTTNGARIKTWPDSPAEGVAKDILYQDIIMVNVKNPILINQNYCDKGKMCKQM  315

Query  377   -ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
               SKV++ DVRF+NIRG +S    A+ L CSQ++PC++VEL+DID+  +  +   +  ++
Sbjct  316   VPSKVQISDVRFKNIRG-SSLSPVAVKLDCSQSMPCQNVELSDIDLAYSGDEKDEIT-SE  373

Query  200   CVNAETIVKG  171
             C N +  + G
Sbjct  374   CSNVKPRITG  383



>emb|CDY32479.1| BnaA09g51170D [Brassica napus]
Length=418

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 221/345 (64%), Gaps = 7/345 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+TKFGA  DG  ++  A ++AW + C S   A +++P G +LAG V+F GPC + R+
Sbjct  49    VFDITKFGAVGDGATNTFKAFLKAWIQVCDSPVPATLLVPAGQYLAGPVIFAGPCKS-RV  107

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +E++GT++A +  S Y +  WF+ E V  V +TG GT NG+GED+W+    +K  N  L
Sbjct  108   TVEVQGTIIATT--SGYATPEWFLFERVNDVLLTGTGTFNGKGEDIWKEGCGKKT-NCNL  164

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P SL F+ +    +  I  VNSK FHM +      N+  +++ AP +SPNTDGIH+S +
Sbjct  165   PPTSLKFRNLKNLEVSGITSVNSKAFHMFLVKTEFVNIHNIKLLAPAESPNTDGIHLSNA  224

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              +V++T+  + TGDDCVSIG G+ N+ +  + CGPGHGISIGSLGK  +E DV G+ V N
Sbjct  225   DHVSITNSKMATGDDCVSIGRGSNNVTIQGIICGPGHGISIGSLGKYKKEEDVSGIHVSN  284

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLK  357
             CT+I T NG RIKT+  S   +A+ I FE+I + +V  PIIIDQ+Y S  R   S+V + 
Sbjct  285   CTMIETDNGLRIKTWGGSDPSRAADIKFENIQMQSVKNPIIIDQNYGS--RGGDSQVAVS  342

Query  356   DVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
             DV F NIRGT   ++  + L CS++VPC  V + D+++     KG
Sbjct  343   DVLFSNIRGTTITQN-VVQLNCSKSVPCAGVNVVDVNLNYVGKKG  386



>ref|XP_007138946.1| hypothetical protein PHAVU_009G251500g [Phaseolus vulgaris]
 gb|ESW10940.1| hypothetical protein PHAVU_009G251500g [Phaseolus vulgaris]
Length=421

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 229/372 (62%), Gaps = 11/372 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK-R  1080
             I +V  FGAK DG+ D T A + AW + CHS+G A+V++P G F+   + F GPCT    
Sbjct  51    INNVLSFGAKGDGEYDCTQAFMDAWRETCHSKGNARVLVPEGRFVVSTMFFAGPCTTPDP  110

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + I++ GT+VA +D+S Y +  W + E + G+ + GGGT +G G++ W+  A+ K+  + 
Sbjct  111   VTIQVVGTVVATTDISEYVNGEWLMFESIDGIRLIGGGTFDGVGKESWKTSANCKVDPSD  170

Query  899   LL---PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
                  P SL F+ V    I +IK ++ KGFH+ V++C +  +  L++ AP +SPNTDGIH
Sbjct  171   TCVRNPSSLYFRKVRNGIIQNIKSIDPKGFHVFVTNCVNIRLRLLKLVAPSESPNTDGIH  230

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             IS S NV V+   + TGDDC+S+  G  ++ + ++ CGPGHGISIGSLGK   E +VK +
Sbjct  231   ISQSVNVKVSKNNIETGDDCISMIQGANDVHINKMNCGPGHGISIGSLGKYPDELEVKNI  290

Query  548   TVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYN-SKN-RKEA  375
             +V N +++GTTNG RIKT+       AS I F DI + NV  PIIIDQ+Y  SKN + + 
Sbjct  291   SVTNISMVGTTNGVRIKTWPNKHPGSASFITFTDINMQNVQNPIIIDQEYECSKNCQNQP  350

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S V+LKD+ F NIRGT      A+ L CS   PCE V+L +I++      G     ++C 
Sbjct  351   SLVQLKDISFSNIRGTTPTPI-AVDLRCSMKFPCEKVKLENINL----SLGPKPTGSRCQ  405

Query  194   NAETIVKGKRNP  159
             N + I  G + P
Sbjct  406   NIKPIYMGLQKP  417



>gb|KGN43365.1| hypothetical protein Csa_7G027810 [Cucumis sativus]
Length=439

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/373 (42%), Positives = 228/373 (61%), Gaps = 8/373 (2%)
 Frame = -1

Query  1280  RGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQ  1101
             R +  +H +F V  FGA+ +G  D + A + AW  AC S G    +IP+GT+L G V+F 
Sbjct  60    RTKSSSH-VFSVRSFGARANGLTDDSNAFLAAWRMACDSAGVVTFLIPKGTYLVGPVIFS  118

Query  1100  GPC-TAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFD  927
             GPC     + ++++G + A ++LS Y S   W     + G+ + GGGT +GRG + W F+
Sbjct  119   GPCKNVSSLTVKMEGYLKASTNLSKYGSGAGWIEFRWMEGLTLNGGGTFDGRGAEAWPFN  178

Query  926   ADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSP  747
                   N  LLP +L F  +N + +  I  +NSK FH+ +  C  F  S+L+I+AP +SP
Sbjct  179   NCRDDYNCKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKRFVGSELKISAPENSP  238

Query  746   NTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQE  567
             NTDGIHI  S+N++ +   + TGDDC+SIG G + + ++ V CGPGHGIS+GSLG+   E
Sbjct  239   NTDGIHIDRSSNIHFSLSHIQTGDDCISIGQGNSQVTISSVNCGPGHGISVGSLGRYRNE  298

Query  566   TDVKGVTVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---  399
              DV G+ V+NC+L GT NG RIKT+  SP    A+ + FE+I ++NV+ PIIIDQ Y   
Sbjct  299   GDVSGLVVKNCSLTGTANGIRIKTWPNSPGSSSATNMTFENITMNNVSNPIIIDQSYCPF  358

Query  398   NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
                + K  S VKL D+ F+NIRGT+S K  A++L CS+  PC++V L ++ +  ++G+  
Sbjct  359   GFCSFKAPSLVKLSDIYFKNIRGTSSSK-VAVALECSKGFPCQNVNLENVHLDLSSGENH  417

Query  218   HLKPNKCVNAETI  180
                  K V A  I
Sbjct  418   PSSTCKYVRARYI  430



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/377 (43%), Positives = 225/377 (60%), Gaps = 15/377 (4%)
 Frame = -1

Query  1268  HTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCT  1089
              +  + D+TK GAKP+G  D+T  ++ AW +AC +    K+V+P G+FL   + F GPC 
Sbjct  21    RSQNVIDITKLGAKPNG--DATQGLMAAWKQACAAPAPTKIVVPPGSFLLNVIKFTGPCK  78

Query  1088  AKRIVIEIKGTMVADSDLS-VYTSNYWFIIEHVAGVEVT---GGGTINGRGEDVWQFDAD  921
             A  + IEI G   A  + + +  S+ W  IE++ G+ +     GGT +G+G+  W+ +  
Sbjct  79    AA-VTIEIAGNFKAPPNPAQMKGSDTWVKIENIQGLTINCLPTGGTFDGQGQMAWKQNNC  137

Query  920   EKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNT  741
              K  +   LP +  F  +  S I  IK +NSK +HM V  C +F +    I AP DS NT
Sbjct  138   AKTGSCNNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLGCKNFTLFDTTIQAPKDSLNT  197

Query  740   DGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETD  561
             DGIHI  S  + VT   +GTGDDC+S+GDG  ++ +  +TCGPGHGISIGSLG+  +E  
Sbjct  198   DGIHIGRSAGIFVTKAKIGTGDDCISMGDGAVDVHIEDITCGPGHGISIGSLGRYQKEAP  257

Query  560   VKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR-  384
             V GVTV+ CT+  T NG RIK++  S +  AS + FEDI + NV  PI+IDQ+Y   N  
Sbjct  258   VTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKNVLNPILIDQEYCPYNHC  317

Query  383   --KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK  210
               K  SKVKL ++ F+NIRGTA  K  A+ ++CS   PC+ VELADID+    G  V + 
Sbjct  318   KAKTPSKVKLSNISFKNIRGTAGSKE-AVKILCSSGAPCDKVELADIDLTFNGGHAVSM-  375

Query  209   PNKCVNAETIVKGKRNP  159
                C N + I  GK+NP
Sbjct  376   ---CKNVKPITSGKQNP  389



>gb|KDP29567.1| hypothetical protein JCGZ_19280 [Jatropha curcas]
 gb|KDP29570.1| hypothetical protein JCGZ_19283 [Jatropha curcas]
Length=373

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/372 (44%), Positives = 224/372 (60%), Gaps = 17/372 (5%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV-FQGPCTAKRI  1077
             +++  +GAKP G+ DS+ A++ AW +AC SR AA + +P+G F   + V F GPC    I
Sbjct  8     YNIVSYGAKPGGRTDSSKALLAAWTQACASREAATLYVPKGKFAVSKTVSFDGPCKNNAI  67

Query  1076  VIEIKGTMVADSDLSVY-TSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             V +I GT+ A SD +V   S  W I  HV GV V+GG  ++G+G  +W        K+ P
Sbjct  68    VFQINGTLSAPSDYNVIGNSEEWIIFRHVKGVTVSGG-ILDGQGSGLWS--CKNSGKSCP  124

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
                 SL F   N   I  +  +NS+ FH+ +++C D  V   +I+A  +SPNTDGIHI G
Sbjct  125   TGATSLKFANSNNIIITGLTSINSQMFHIVINECQDVTVQGAKISALEESPNTDGIHIGG  184

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             ST VN+ D  +GTGDDCVS+G G++NL + +V CGPGHGISIGSLGK  QE  V+ VTV 
Sbjct  185   STKVNIFDSNIGTGDDCVSVGPGSSNLWIQKVICGPGHGISIGSLGKDVQEKGVRNVTVT  244

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             NCT  GT NG RIKT+       A+ I F+  +++NV  PIIIDQ+Y   N+   ++AS 
Sbjct  245   NCTFTGTKNGVRIKTWGRPSNSFATDIHFQRAIINNVKNPIIIDQNYCDGNNNCPRQASG  304

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK--CV  195
             VK+ DV ++NI G+ S    A+   CS+T PC  ++L DI++        H +P K  C 
Sbjct  305   VKISDVTYKNIHGS-SATEVAVKFDCSKTHPCSAIKLQDIELT------YHNQPTKATCT  357

Query  194   NAETIVKGKRNP  159
             NA+ I  G   P
Sbjct  358   NADGIALGILQP  369



>gb|KEH37190.1| polygalacturonase [Medicago truncatula]
Length=423

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/425 (39%), Positives = 241/425 (57%), Gaps = 32/425 (8%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGR------------------GHTHTIFDVTKFGA  1230
             M     I V++L  AL+   V+  PR R                       I +V  FGA
Sbjct  1     MATAKKISVLILCFALVINYVDAGPRKRPVFGPDIYRGINVAKDTLAPGEKIINVMSFGA  60

Query  1229  KPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVIEIKGTM  1053
             KPDGK D T A +  W  AC S+  A+++IP G FL   + F GPC T   I I++ GT+
Sbjct  61    KPDGKSDCTQAFMDGWQAACKSKVQARLLIPSGRFLVSSMFFSGPCLTPGPITIQVVGTV  120

Query  1052  VADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL-----LPV  888
             VA +D+S Y    W + + ++G+++ GGGT +G+G+  W++   E  +  P       P 
Sbjct  121   VATTDISDYVDGEWLMFQKISGLKLIGGGTFDGQGQSSWKYA--ENCETNPTNQCVRAPS  178

Query  887   SLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNV  708
             S+ F  V    I +IK  + KGFH+ V++  +  +  +++ AP  SPNTDG+HIS S NV
Sbjct  179   SIYFNQVTDGIIQNIKSKDPKGFHVFVTNSANIRLRLIKLNAPATSPNTDGLHISHSINV  238

Query  707   NVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTL  528
              ++   V TGDDCVS+  G +N+ + R+ CGPGHGISIGSLGK   E +V G+ V+ C L
Sbjct  239   KISRSSVETGDDCVSMIQGVSNVTIKRIRCGPGHGISIGSLGKYPDEIEVSGIRVQTCKL  298

Query  527   IGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYN-SKN-RKEASKVKLKD  354
             +GTTNG RIK++       A+ I + DI + NV  PIIIDQ+Y  S N +K+ S VK+K+
Sbjct  299   VGTTNGLRIKSWPDKYPGAATDINYSDITMENVKNPIIIDQEYECSPNCKKKPSLVKIKN  358

Query  353   VRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVK  174
             + FRNIRGT +    A+ L CS+  PC++V L +I++   A K      +KC N + I  
Sbjct  359   ISFRNIRGTTTSPI-AVDLKCSKLFPCKNVGLHNINLSLGAKKPTA---SKCANIKPIYS  414

Query  173   GKRNP  159
             G + P
Sbjct  415   GSQKP  419



>ref|XP_010434565.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=418

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/397 (42%), Positives = 240/397 (60%), Gaps = 17/397 (4%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTH----TIFDVTKFGAKPDGKGDSTMAMIR  1188
             ME    + + L+ I+ LS+ V      R        +  +V  FGA+ +   D T A + 
Sbjct  1     MESFRYLKIFLIFISTLSSCVAGTLSLRNRVDKSSVSFVNVRSFGARANDHRDHTKAFVA  60

Query  1187  AWNKACHSRGAA-KVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSNY  1014
             AW+KAC S  ++  ++IPRG F  G + F GPCT    + + +K    A +DLS Y S  
Sbjct  61    AWDKACKSSSSSVHLIIPRGEFSVGPLRFSGPCTNVSNLTVRVK----ASTDLSKYRSGG  116

Query  1013  -WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKF  837
              W     + G+ +TGGGT +G+G   W F+      N  LLP SL F G+NR+ +  I  
Sbjct  117   GWIEFGWINGLTLTGGGTFDGQGALAWPFNNCTSDSNCKLLPTSLKFVGMNRTVVRRISS  176

Query  836   VNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIG  657
             VNSK FH+ + +C DF  ++L ITAP DSPNTDGIHI  S+NV  +   + TGDDCVSIG
Sbjct  177   VNSKFFHIALVECRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGDDCVSIG  236

Query  656   DGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQ  477
              G + + +T + CGPGHGISIG+LG+   E DVKG+ V++C + GTTNG RIKT+  SP 
Sbjct  237   QGNSQITITSIKCGPGHGISIGTLGRYPNEKDVKGLVVKDCKMSGTTNGIRIKTWANSPG  296

Query  476   LK-ASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHP  309
             L  A+ + F++I+++NVT PIIIDQ Y   +S      SKVKL D+ F+NIRGT+S +  
Sbjct  297   LSAATNMTFQNIIMNNVTNPIIIDQSYCPFSSCISNVPSKVKLSDIYFKNIRGTSSSR-I  355

Query  308   AISLICSQTVPCEDVELADIDI-VSAAGKGVHLKPNK  201
             A+ L CS+ +PC+ V L ++ + +S++ +G     N+
Sbjct  356   AVQLHCSRGMPCKKVYLENVHLDLSSSYEGRKQNSNR  392



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 230/377 (61%), Gaps = 17/377 (5%)
 Frame = -1

Query  1271  GHTHT-IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGP  1095
             G + T +FD+TK+GA  +   D + A++ A+ +AC S   + +VIP+GTF   +V  +GP
Sbjct  20    GESQTGVFDITKYGA--NSNADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGP  77

Query  1094  CTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEK  915
             C +  + ++I+ T+ A SD S      W  +  +    ++GGG ++G+    W+    +K
Sbjct  78    CKSP-LELQIQATLKAPSDPSQLKVGEWLTVNKLDQFTMSGGGILDGQAAAAWECKQSKK  136

Query  914   IKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDG  735
                   LP +L F  +  S I DI  ++SK FH+ V+ C +    +  ++AP +SPNTDG
Sbjct  137   CNK---LPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDG  193

Query  734   IHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVK  555
             IH+S S++VN+TD    TGDDC+S+GD T  L +TRVTCGPGHGIS+GSLG    E  V 
Sbjct  194   IHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVV  253

Query  554   GVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNR  384
             GV VRNCT   T NG RIKT+ AS     + + FEDI++ NV+ P++IDQ Y   N  N+
Sbjct  254   GVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNK  313

Query  383   KEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPN  204
                S+VK+  V F+NI+GT S+   A+SL+ S+ VPCE +E+ DIDI  +  +G    P 
Sbjct  314   DLPSQVKISKVSFQNIKGT-SRTQDAVSLLRSKGVPCEGIEVGDIDITYSGKEG----PA  368

Query  203   K--CVNAETIVKGKRNP  159
             K  C N +  +KGK+NP
Sbjct  369   KSSCENIKPSLKGKQNP  385



>ref|XP_008451196.1| PREDICTED: exopolygalacturonase isoform X3 [Cucumis melo]
Length=373

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 218/347 (63%), Gaps = 7/347 (2%)
 Frame = -1

Query  1247  VTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKRIVI  1071
             V  FGA+ +G  D + A + AW  AC S G    +IP+GT+L G V F GPC     + +
Sbjct  4     VRSFGARANGLTDDSNAFLAAWRTACDSAGVVTFLIPKGTYLVGPVKFSGPCKNVSSLTV  63

Query  1070  EIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             ++KG + A ++LS Y S   W     + G+ +TGGGT +GRG + W F+      N  LL
Sbjct  64    KMKGYLKASTNLSKYGSGAGWIEFRWMEGLTLTGGGTFDGRGSEAWPFNNCRDDYNCKLL  123

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P +L F  +N + +  I  +NSK FH+ +  C  F  SKL+I+AP +SPNTDGIHI  S+
Sbjct  124   PTNLKFVALNNTVVQHITSLNSKFFHLALVQCKGFIGSKLKISAPENSPNTDGIHIDRSS  183

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
             NV+ +   + TGDDC+SIG G + + ++ + CGPGHGIS+GSLG+   E DV G+ V+NC
Sbjct  184   NVHFSLSHIQTGDDCISIGQGNSEVTISSINCGPGHGISVGSLGRYRNEGDVSGLVVKNC  243

Query  533   TLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASKV  366
             +L GT NG RIKT+  SP    A+ + FE+I ++NV+ PIIIDQ Y      + K  S V
Sbjct  244   SLTGTANGIRIKTWPNSPGSSSATNMTFENITMNNVSNPIIIDQSYCPFGFCSFKAPSLV  303

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGK  225
             KL D+ F+NIRGT+S K  A++L CS+  PC++V L ++ +  ++G+
Sbjct  304   KLSDIYFKNIRGTSSSK-VAVALECSKGFPCQNVNLENVHLDLSSGE  349



>ref|XP_008340787.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Malus domestica]
Length=381

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 208/330 (63%), Gaps = 8/330 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTA-KR  1080
             IF+V  FGAKPDG  D++M  I+ W  ACH+ G ++V+IP GT+ +G VVFQGPCT+ K 
Sbjct  55    IFNVVDFGAKPDGNHDASMNFIKTWLAACHNTGKSRVLIPPGTYKSGPVVFQGPCTSSKP  114

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQF--DADEKIKN  906
             +V+++ GT+   +DLS+Y   YWF+ E+V G+ + G G  +G+G   W+   D       
Sbjct  115   VVVQVLGTIKGLNDLSLYEEPYWFLFENVEGLVIIGNGIFDGQGSSAWKVAGDCGSSSDG  174

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP ++ F GV    I  I  +NSKG H+ ++D  +  V ++ I+AP  SPNTDGIHI
Sbjct  175   CSPLPSNIKFNGVRDGVIRGISSLNSKGVHLFITDSQNVRVRRVNISAPRTSPNTDGIHI  234

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S NV V    + TGDDC+ +  G+TN+ +  V CGPGHGIS+GSLGK   E DV G+T
Sbjct  235   SNSNNVKVARTHIATGDDCIGMIQGSTNIAINNVICGPGHGISVGSLGKYEHENDVTGIT  294

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK--NRKEAS  372
             V+  T + T NG RIK++  S   +ASG++F+DI++ NV  PIIIDQ+Y +   N+ + S
Sbjct  295   VKKTTFLNTDNGIRIKSWPGSGPSRASGMVFKDIIMQNVRNPIIIDQEYCTGGCNKNQPS  354

Query  371   KVKLKDVRFRNIRGTASKKHPAISLICSQT  282
              V++ DV + NIRGT       +   C QT
Sbjct  355   HVQISDVHYINIRGTTPSN---VEFPCLQT  381



>ref|XP_004170505.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Cucumis sativus]
Length=395

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/295 (49%), Positives = 200/295 (68%), Gaps = 1/295 (0%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F++   GAK DG+ DST A ++AW KACHS G AKVV P GTFL G +V+ GPC    +
Sbjct  66    VFNIIAHGAKADGRTDSTQAFMQAWVKACHSSGPAKVVFPPGTFLTGPLVYAGPCDGP-M  124

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +EI+GT+ A +D+S Y+S  W + E V G+ + G GT +G+G D W+++   K     +
Sbjct  125   TVEIQGTVKATTDISQYSSAEWILFESVTGLNLIGRGTFDGQGADTWKYNDCSKHPQCII  184

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P S+ F  V +  +  I  VNSK FH+ V   ++  ++ + I APG+SPNTDG+HIS +
Sbjct  185   PPTSIKFNKVTQGLMEGITSVNSKAFHIFVVLSHNIKINNVHIVAPGNSPNTDGVHISQT  244

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VNVT+ ++GTGDDCVSIG G+TN+ V  +TCGPGHGIS+GSLGK   E +V+G+ V N
Sbjct  245   DVVNVTNSIIGTGDDCVSIGHGSTNINVLNITCGPGHGISVGSLGKYRDEKEVRGIFVSN  304

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEAS  372
             CT+  TTNG RIKT+ ASP  +A+ I F++I+L  V  PIIIDQ+Y SK +K  +
Sbjct  305   CTIRNTTNGVRIKTWAASPPGQATRITFQNIVLDKVRNPIIIDQNYGSKTKKSVT  359



>ref|NP_001241738.1| exopolygalacturonase precursor [Zea mays]
 gb|ACG34252.1| exopolygalacturonase precursor [Zea mays]
Length=428

 Score =   293 bits (750),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/386 (42%), Positives = 224/386 (58%), Gaps = 22/386 (6%)
 Frame = -1

Query  1298  GVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLA  1119
             G    P G       FD++KFGA  DGK DST  +   W  AC + G A ++IP+G +L 
Sbjct  46    GATAAPEGAARASRTFDISKFGATSDGKTDSTQVVQDTWTSACGAMGDATMLIPKGDYLV  105

Query  1118  GEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDV  939
             G + F+GPC    I I++ G ++  +DL+ YT++ W  + HV  + + G GT++G+G  V
Sbjct  106   GPLYFRGPCMGD-ITIQLDGILLGSNDLAKYTAS-WIQVSHVNNIVINGSGTLDGQGTAV  163

Query  938   WQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAP  759
             +     + +K    +P +L+   V    I  IK +NSK FH+ +    D  V  + ITAP
Sbjct  164   YTKSKTDVVK---AMPNTLVLFYVTNGTISGIKLLNSKFFHINIDTSKDITVKDVNITAP  220

Query  758   GDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGK  579
              D  NTDG+H+ GS+NV +T+  +GTGDDCVSIG G+  ++V  +TCGPG GIS+G LG+
Sbjct  221   ADVENTDGVHVGGSSNVRITNSTIGTGDDCVSIGPGSDGVMVNNITCGPGQGISVGCLGR  280

Query  578   RAQETDVKGVTVRNCTLIGTTNGARIKTYR-ASPQLKASGIIFEDIMLHNVTRPIIIDQD  402
                E DV  VTVR+C L  TTNG RIK+Y  A   L AS + FE+I +  V  PIIIDQ 
Sbjct  281   YKDEKDVSDVTVRDCVLRNTTNGVRIKSYEDAESVLTASHLTFENIRMEEVANPIIIDQY  340

Query  401   YNSK-----NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVS  237
             +  +      R  +S V +KDV FRNI GT+S    A+SL+CS+T PC  V L D+++  
Sbjct  341   FCPQKVCPGKRSNSSHVSIKDVTFRNISGTSSTPE-AVSLLCSETQPCSGVSLIDVNVEY  399

Query  236   AAGKGVHLKPNK----CVNAETIVKG  171
             A       K NK    C NA+   KG
Sbjct  400   AG------KNNKTMAVCSNAKGTAKG  419



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/381 (39%), Positives = 232/381 (61%), Gaps = 8/381 (2%)
 Frame = -1

Query  1280  RGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQ  1101
             RG   + ++F+V  +GAK  G GD + A+++AW  AC S+G + V+IP+G +  GEV  Q
Sbjct  1     RGVQSSGSVFNVNDYGAK--GAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQ  58

Query  1100  GPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDAD  921
             GPC   +I  +I G + A +D S + S+ W     + G+ V+G GT++G+G+  W  +  
Sbjct  59    GPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNC  118

Query  920   EKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNT  741
             +K  N     ++L F  +  + + DI  +NSK FH+ V +C D     + +TAPG S NT
Sbjct  119   DKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINT  178

Query  740   DGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETD  561
             DGIH+  S  V +T+  + TGDDC+SIG G+ N+ +T+V CGPGHGISIGSLG+   E +
Sbjct  179   DGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKE  238

Query  560   VKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQD---YNSK  390
             V+G+TV+ CT  GT NG R+KT+  SP   A+ + F+D+ ++NV  P+I+DQ+   Y   
Sbjct  239   VRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQC  298

Query  389   NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLK  210
             +R+  S++KL ++ F NIRGT++ K  A+ + CS  +PC ++++ +I++      G    
Sbjct  299   SRQAPSRIKLSNINFNNIRGTSTGKV-AVVIACSHGMPCSNMKIGEINLSYRGAGGPAT-  356

Query  209   PNKCVNAETIVKGKRNPGGSC  147
              + C N +    GK+ P   C
Sbjct  357   -STCSNVKPTFSGKQVPAIKC  376



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/368 (43%), Positives = 225/368 (61%), Gaps = 7/368 (2%)
 Frame = -1

Query  1253  FDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIV  1074
              DV  FGAK DG  D + A++ AW  AC+S   + +VIPRGTF   +   +GPC A  I 
Sbjct  27    LDVRSFGAKGDGVSDISQALLSAWKAACNSPKPSTIVIPRGTFGLLQATLEGPCKAP-IE  85

Query  1073  IEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLL  894
             ++++GT+ A  + ++     W  I+++    ++G GT +G+G   W  +   K  +   L
Sbjct  86    LQVQGTLKAPQNPNLIKDGEWVTIQYLDHFTLSGSGTFDGQGARAWAQNDCAKASDCSKL  145

Query  893   PVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGST  714
             P +  F  +N S I  I  +NSK FHM +  CN+  +S+L ITAPG S NTDGIH+  S+
Sbjct  146   PNNFSFNFLNNSIISGIASLNSKLFHMNILGCNNVTLSRLTITAPGTSLNTDGIHVGRSS  205

Query  713   NVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNC  534
              VN+TD  +GTGDDCVS+GDG+  + +T V CGPGHGISIGSLG+   E  V GV VRNC
Sbjct  206   GVNITDSTIGTGDDCVSLGDGSKQVSITNVVCGPGHGISIGSLGRYKNEEPVVGVFVRNC  265

Query  533   TLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---KEASKVK  363
             TLI T  G R+K++ ++    A+ + F+DI + NVT PI+IDQ+Y   N+      S+VK
Sbjct  266   TLINTLTGVRVKSWPSATTGAATDVHFDDITMRNVTSPIVIDQEYCPNNQCTLGAPSRVK  325

Query  362   LKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAET  183
             +  V F NIRGT++    A+ L+CS+T PCE VE+ DID+      G ++  N C N + 
Sbjct  326   ISKVSFNNIRGTSASAL-AVKLVCSKTFPCEGVEIGDIDLAYHGSLG-NITTN-CANVQP  382

Query  182   IVKGKRNP  159
                G++NP
Sbjct  383   TFMGRQNP  390



>ref|XP_006656242.1| PREDICTED: exopolygalacturonase-like [Oryza brachyantha]
 gb|ACN85327.1| polygalacturonase precursor [Oryza brachyantha]
Length=405

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (60%), Gaps = 12/373 (3%)
 Frame = -1

Query  1331  VILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAA  1152
             ++L  + LL     C  +       +FDVT FGA  DG+ D++ A +RAW +AC + G  
Sbjct  4     LLLSAMNLLIMASWCWLQASCGRQVVFDVTDFGAVTDGETDNSKAFVRAWTEACAAAGRP  63

Query  1151  KVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVT  975
              VV+P G +L   VVF+GPC    + + + G + A + L  +   + W     + G+ VT
Sbjct  64    AVVVPSGDYLLHPVVFRGPCRGY-VEVRVAGVVRAPAGLDAFRGYHEWINFAGIDGLLVT  122

Query  974   GGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCN  795
             G GT +GRG   W  +      +    P S+    V  + I  +  ++SK FH+ V+  +
Sbjct  123   GNGTFDGRGASSWHLNDCPWKPDCIPPPSSIKLARVRNATIDGVTSLDSKFFHVVVAGSH  182

Query  794   DFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCG  615
             D  +  + I APGDSPNTDG+HI GS+NV VTD  VGTGDDCVS+G G+ ++ V+ V+CG
Sbjct  183   DVEIRHVSIRAPGDSPNTDGVHIQGSSNVRVTDSAVGTGDDCVSVGPGSADVTVSGVSCG  242

Query  614   PGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL---KASGIIFEDI  444
             PGHGIS+GSLG+R  E DV+ + V NCT+ GT NG RIKT+R  P+     ASG++FEDI
Sbjct  243   PGHGISVGSLGRRPGEADVRRLRVSNCTIAGTANGVRIKTWRGGPRPASSAASGLVFEDI  302

Query  443   MLHNVTRPIIIDQDY------NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQT  282
             ++  V  PIIIDQ+Y      + ++ +  S VK+ DV+FRNIRG  S    A+ L CS  
Sbjct  303   VMRRVRNPIIIDQEYCPYISCHHQSERPPSVVKISDVKFRNIRGV-SATQVAVKLSCSAA  361

Query  281   VPCEDVELADIDI  243
              PC  +EL DID+
Sbjct  362   SPCRGLELRDIDL  374



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/374 (41%), Positives = 233/374 (62%), Gaps = 12/374 (3%)
 Frame = -1

Query  1268  HTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCT  1089
                ++FDVT++GAKP+   D T A+  AW +AC S   +K++IP+G +   +   +GPC 
Sbjct  17    EAQSLFDVTRYGAKPNT--DITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGPCK  74

Query  1088  AKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
             +  I +++ GT+ A    +    +   +  ++  + ++G G  +G+G+  W  +   K K
Sbjct  75    SVPIQVQVDGTLKAPLHPN---GDGLVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCHKKK  131

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
                 LP++L F  +  S + DI  ++SK FH+ +  C +     + I+AP +SPNTDGIH
Sbjct  132   ICTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTDGIH  191

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             IS S  +N+ D  + TGDDCVS+GD    + +T VTCGPGHGIS+GSLGK  +E DV GV
Sbjct  192   ISSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDVVGV  251

Query  548   TVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRK  381
             TV+ C LI TTNG RIKT+  S     AS + FEDI + NV+ P+IIDQ+Y   N  NRK
Sbjct  252   TVKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQCNRK  311

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
               SK+K+  V F+NIRGT++    A+ L+CS+++PCE VE+ADI++  +  +G  L  ++
Sbjct  312   VPSKIKISKVSFKNIRGTSATPI-AVKLVCSKSIPCEGVEVADINLTYSGIRGPIL--SE  368

Query  200   CVNAETIVKGKRNP  159
             C N + ++ GK++P
Sbjct  369   CANVQPLITGKQSP  382



>ref|XP_010099972.1| hypothetical protein L484_014009 [Morus notabilis]
 gb|EXB81077.1| hypothetical protein L484_014009 [Morus notabilis]
Length=403

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/380 (40%), Positives = 222/380 (58%), Gaps = 8/380 (2%)
 Frame = -1

Query  1286  IPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVV  1107
             I   + H   +F+V  +GA  DGK D++ A+  AW  AC S G   V+IP+GT+L   VV
Sbjct  18    ITNAKSHVRNVFNVMSYGAVADGKTDNSKAIFDAWTHACQSVGGGMVLIPKGTYLVNPVV  77

Query  1106  FQGPCTAKRIVIEIKGTMVADSDLSVYTS-NYWFIIEHVAGVEVTGGGTINGRGEDVWQF  930
              +G C   ++V  ++G + A +D   +   ++W   ++V    ++GGG+++G+G   W +
Sbjct  78    LKGTCKG-QMVFFLQGDLKAPTDQKSWDDIDHWITFQYVDNFVMSGGGSLDGQGASAWPY  136

Query  929   DADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDS  750
             +   K  +   LPVSL    VN + I  IK +NSK FHM +  CN+  +  + I APGDS
Sbjct  137   NTCNKDSHCKKLPVSLRLDFVNNAWISYIKLINSKNFHMNIFACNNIKLEHMHIMAPGDS  196

Query  749   PNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQ  570
             PNTDGIHI+ ST + V D ++ TGDDC+S G G  ++ + +V CGPGHGISIGSLG    
Sbjct  197   PNTDGIHIALSTGIKVWDSIISTGDDCLSFGPGMKDVDIWKVQCGPGHGISIGSLGSSPN  256

Query  569   ETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSK  390
             E DV+G  VRN   IGT NG RIKT+          I F  I++ NV  PI+IDQ+Y   
Sbjct  257   EKDVQGFIVRNSRFIGTQNGVRIKTWALPHASNVYNITFRRIIMQNVANPIVIDQEYCPS  316

Query  389   ---NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGV  219
                N + +S+++++DV+F NI GT+S K  A++L CS+  PC+ + L DI +      G 
Sbjct  317   GKCNPQGSSQIQIRDVKFMNIWGTSSSK-VAVNLDCSKGKPCQQIVLKDIYLAYKGKDGP  375

Query  218   HLKPNKCVNAETIVKGKRNP  159
              +  ++C N   +  GK  P
Sbjct  376   AI--SQCSNVNGVSYGKLQP  393



>ref|XP_003560585.2| PREDICTED: exopolygalacturonase-like [Brachypodium distachyon]
Length=404

 Score =   292 bits (747),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 166/396 (42%), Positives = 232/396 (59%), Gaps = 16/396 (4%)
 Frame = -1

Query  1325  LLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKV  1146
             L+ +  L T   C+         +FDVT FGA  DG+ D + A +RAW KAC + G   V
Sbjct  5     LVALLFLVTARWCLEVAHA-GRQVFDVTDFGAVADGQTDDSKAFLRAWMKACAAPGRPAV  63

Query  1145  VIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGG  969
             V+P+G +    VVF+GPC    + + + G + A  DL+ +  S+ W     + G+ VTGG
Sbjct  64    VVPKGEYRLHPVVFRGPCKGY-MELRLAGVLRAPDDLAAFRGSHEWVNFAGIDGLLVTGG  122

Query  968   GTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDF  789
             GT +GRG   W  +   +  +   LPVS+    V    I ++  ++SK FH+ +    D 
Sbjct  123   GTFDGRGASSWHLNDCPRKPDCTPLPVSIKLGRVRNVTITEVTSLDSKFFHVIIIGSQDV  182

Query  788   NVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPG  609
              + ++ I AP DSPNTDG+HI GS+NV +TD  V TGDDCVS+G G+ ++ V+ V+CGPG
Sbjct  183   AIHRVTIRAPRDSPNTDGVHIQGSSNVRITDTAVATGDDCVSVGPGSADITVSGVSCGPG  242

Query  608   HGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRAS--PQLKASGIIFEDIMLH  435
             HGIS+GSLG+   E DV+G+ V NCTL GT NG RIKT+R    P    SG++FEDI++ 
Sbjct  243   HGISVGSLGRHPGEEDVRGLRVSNCTLAGTANGVRIKTWRGGLRPAAGVSGLVFEDIVMR  302

Query  434   NVTRPIIIDQDY----NSKNRKEA----SKVKLKDVRFRNIRGTASKKHPAISLICSQTV  279
              V  PIIIDQ+Y    +S  R E+    S VK+ DV+F+NIRG  S    A+ L CS   
Sbjct  303   KVRNPIIIDQEYCPYSSSSCRHESALLPSVVKISDVKFKNIRGV-SATQVAVKLSCSGAS  361

Query  278   PCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKG  171
             PC  +EL DID+     +GV  + ++C N    V G
Sbjct  362   PCHGLELRDIDL-RYVKRGVATE-SRCANVAGGVAG  395



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 222/374 (59%), Gaps = 14/374 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+T  GAKPD   D T A + +W  AC S   +KV++P G ++ G +  +GPC     
Sbjct  35    VFDITTKGAKPDA--DVTQAFLDSWTAACASVKPSKVLVPAGNYILGAIKLKGPCQTPT-  91

Query  1076  VIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEV---TGGGTINGRGEDVWQFDADEKIK  909
             VIEI G   A  D++ +   + WF +E+V  + +    GGG  +G+G+  W+ +   K  
Sbjct  92    VIEILGNFKAPPDVAAFNKEDTWFKVEYVDSLILITGKGGGVFDGQGQAAWKLNECTKNA  151

Query  908   NAPL-LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGI  732
             N    LP +  F  V  S +  +  +NSK +H  +  C    +S + ITAP DSPNTDGI
Sbjct  152   NCGFDLPYNFRFNFVTNSKVSGLTSINSKLYHFALLGCKQLEMSDITITAPADSPNTDGI  211

Query  731   HISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKG  552
             HI  S  V V    +GTGDDCVS GDG  N+LV  VTCGPGHG+S+GSLGK   E  V  
Sbjct  212   HIGRSDGVIVRGFTIGTGDDCVSFGDGAKNVLVEGVTCGPGHGLSVGSLGKYPNEEPVSN  271

Query  551   VTVRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNR---K  381
             +T+RNCT+  T NG R+KT+  S +   +G+ FEDI + NV  P+I+DQ+Y   N    K
Sbjct  272   ITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAK  331

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
               SKVK+ D+RF+N++G +S K  A+ LICS+ VPC+ VELADID+      G  +  + 
Sbjct  332   TPSKVKISDIRFKNVKGKSSGKE-AVKLICSEGVPCDKVELADIDLQYTGTDGPAV--SM  388

Query  200   CVNAETIVKGKRNP  159
             C   + ++ GK++P
Sbjct  389   CKFVKPLLTGKQSP  402



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/374 (41%), Positives = 233/374 (62%), Gaps = 12/374 (3%)
 Frame = -1

Query  1268  HTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCT  1089
                ++FDVT++GAKP+   D T A+  AW +AC S   +K++IP+G +   +   +GPC 
Sbjct  17    EAQSLFDVTRYGAKPNT--DITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGPCK  74

Query  1088  AKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIK  909
             +  I +++ GT+ A    +    +   +  ++  + ++G G  +G+G+  W  +   K K
Sbjct  75    SVPIQVQVDGTLKAPLHPN---GDGLVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCHKKK  131

Query  908   NAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIH  729
                 LP++L F  +  S + DI  ++SK FH+ +  C +     + I+AP +SPNTDGIH
Sbjct  132   ICTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTDGIH  191

Query  728   ISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGV  549
             IS S  +N+ D  + TGDDCVS+GD    + +T VTCGPGHGIS+GSLGK  +E DV GV
Sbjct  192   ISSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDVVGV  251

Query  548   TVRNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRK  381
             TV+ C LI TTNG RIKT+  S     AS + FEDI + NV+ P+IIDQ+Y   N  NRK
Sbjct  252   TVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQCNRK  311

Query  380   EASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNK  201
               SK+K+  V F+NIRGT++    A+ L+CS+++PCE VE+ADI++  +  +G  L  ++
Sbjct  312   VPSKIKISKVSFKNIRGTSATPI-AVKLVCSKSIPCEGVEVADINLTYSGIRGPIL--SE  368

Query  200   CVNAETIVKGKRNP  159
             C N + ++ GK++P
Sbjct  369   CANVQPLITGKQSP  382



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/405 (40%), Positives = 233/405 (58%), Gaps = 10/405 (2%)
 Frame = -1

Query  1355  MEIKAGIFVILLGIALLSTGVECIPRGRGHTHTIFDV-TKFGAKPDGKGDSTMAMIRAWN  1179
             M I+      +L + LLS  +  +    G    + DV  KFGAK D K D +  ++ AW 
Sbjct  1     MAIQFNFVSSMLILVLLS--ISSVEGQGGGGGGVIDVVAKFGAKADEKTDLSKPLLDAWK  58

Query  1178  KACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIE  999
             +AC S   +K+VIP+G +        GPC A  I ++++GT+ A +D   +    W    
Sbjct  59    EACASTSPSKIVIPKGIYFLSTATLDGPCKAP-IELQVQGTVKAPADPGAFKEPKWIAFN  117

Query  998   HVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGF  819
              +   +++GGG  +G+G   ++ +  +       LP++L F  +  + I DI   +SK F
Sbjct  118   RIENFKLSGGGVFDGQGTTAYKREGCKGHDYCGSLPINLRFDFLTNAMIQDITTKDSKQF  177

Query  818   HMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNL  639
                V  C +       ++AP +SPNTDGIHI  S  VNV +  + TGDDCVSIGDG+ NL
Sbjct  178   QANVLGCKNITFEHFTVSAPDESPNTDGIHIGRSDGVNVLNSEIKTGDDCVSIGDGSKNL  237

Query  638   LVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLKASGI  459
             ++  VTCGPGHGISIGSLG    E  V GVTV+NCT+  T+NG RIKT+  +     S I
Sbjct  238   VINGVTCGPGHGISIGSLGLFKNEEPVDGVTVKNCTMTNTSNGVRIKTWPGAEPGTCSNI  297

Query  458   IFEDIMLHNVTRPIIIDQDYNSKNR---KEASKVKLKDVRFRNIRGTASKKHPAISLICS  288
              FEDI + NV+ PIIIDQ Y   N+    E SKVKL ++ F+NI GT+++   A+ +ICS
Sbjct  298   HFEDITVTNVSSPIIIDQKYCPWNKCKINEESKVKLSNISFKNIHGTSARPE-AVKIICS  356

Query  287   QTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNPGG  153
              T+PCE+VELADI+I  +   G  +  ++C N +  V GK+NP  
Sbjct  357   ATLPCENVELADIEITHSGPTGPAV--SQCSNVKPKVSGKQNPAA  399



>ref|XP_009793307.1| PREDICTED: exopolygalacturonase-like [Nicotiana sylvestris]
Length=414

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 156/369 (42%), Positives = 230/369 (62%), Gaps = 6/369 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              TIF+V  FGAKP+ +  ST A +RAW  AC   G A+V +P G +   E +F GPC   
Sbjct  43    QTIFNVLNFGAKPNSELISTQAFMRAWRAACDFNGRARVFVPPGVYTLAETIFSGPCKGT  102

Query  1082  R-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I+++I GT+ A +D+S Y++  W   + + G+ +TGGGT++ +G+ +WQF+  +   N
Sbjct  103   HPIMVQIAGTLKAVADVSEYSNFAWISFDSINGIIITGGGTLDAQGQALWQFNYCKTNLN  162

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP +L F GV    +  +  +NS GFH+ +++        L I AP +SPNTDGIHI
Sbjct  163   CVHLPATLFFNGVENGKVMRLNLINSMGFHIHITNSYLVRFHALSIDAPENSPNTDGIHI  222

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S  + ++  V+ TGDDCVS G G  N+ V +VTCGPGHGIS+GS+GK   E ++KG+ 
Sbjct  223   SKSNTIKLSRSVIRTGDDCVSFGQGANNVTVNKVTCGPGHGISVGSIGKLPGELEIKGLI  282

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V+NCTL GTTNG RIKT+  +   +A G++F DI++ NV  PIIIDQ Y  K+  E S+V
Sbjct  283   VKNCTLRGTTNGIRIKTFAGANPNRAIGMMFSDIVMENVKNPIIIDQSYGDKS-TEPSQV  341

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             ++ DV ++NIRGT + +  A+ L+CS  +PC +V L +I++   A   +    ++C NA 
Sbjct  342   RISDVIYQNIRGTTTSE-VAVQLMCSARLPCLNVRLTNINLKHIANTPIT---SQCQNAN  397

Query  185   TIVKGKRNP  159
                 G + P
Sbjct  398   VGYTGIQLP  406



>ref|XP_009106547.1| PREDICTED: exopolygalacturonase [Brassica rapa]
Length=400

 Score =   291 bits (745),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 223/370 (60%), Gaps = 8/370 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFDV  +GA+ DGK D+ +A  RAW  AC  +G+A+V +P GTF  G V F GPC   RI
Sbjct  31    IFDVRSYGARGDGKTDNAIAFTRAWKDACQWKGSARVFVPLGTFYLGGVTFAGPC-QNRI  89

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
                IKGT++A  D +    + W I  +V  + V+GGGT++G+G   W+ +   +  N   
Sbjct  90    SFIIKGTLLAPKDANAIKQDTWIIFRYVDYLTVSGGGTLDGQGTSAWRLNDCTRNPNCRP  149

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP+++ FQ V  S I  IK +NSK  H+       F ++++ I AP DSPNTDGI I  S
Sbjct  150   LPMNIAFQFVRFSRISRIKSINSKMGHLNFFAVEYFEITRVSIRAPEDSPNTDGIKIGSS  209

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              ++ + D+ +GTGDDC++I  GTTNL +  V CGPGHGIS+GSLG+   E  V G++VR+
Sbjct  210   HHMKIHDVFIGTGDDCIAILSGTTNLDIYSVKCGPGHGISVGSLGRFKDEKSVYGISVRD  269

Query  536   CTLIGTTNGARIKTYRASPQLKA-SGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
                 GT+NG RIKT+  S      S   F+++ + NV  PIIIDQ Y   N  ++   S+
Sbjct  270   SVFTGTSNGVRIKTWAPSASRNTVSNFTFQNLQMINVGNPIIIDQQYCPNNQCSKNSHSQ  329

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             V++++V+F NI GT++ K  A+ L CSQT PC+DVELA I++V     G       C N 
Sbjct  330   VQIENVKFNNIWGTSTDK-VAVKLQCSQTAPCKDVELAGINLVHRGIDGPATA--LCENV  386

Query  188   ETIVKGKRNP  159
                 +GK +P
Sbjct  387   SGWTRGKISP  396



>ref|XP_009411633.1| PREDICTED: exopolygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=406

 Score =   291 bits (746),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 158/399 (40%), Positives = 238/399 (60%), Gaps = 10/399 (3%)
 Frame = -1

Query  1337  IFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRG  1158
             + +I  G+A +      +  G+  +   F+V ++GA+ +G+ D T A + AW+ AC S G
Sbjct  8     LCIICHGMATVDGARTNVSGGKPKSSGTFNVKEYGARGNGRSDDTKAFLAAWDAACKSSG  67

Query  1157  AAKVVIPRGTFLAGEVVFQGPCT-AKRIVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGV  984
               K++IP GT+    + F GPC   + +  +++GT+ A +DL  Y +   W    HV G+
Sbjct  68    QVKILIPSGTYFLNPIEFNGPCRDVQSLKFQMQGTLRATTDLRKYGNGKGWVEFRHVDGL  127

Query  983   EVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVS  804
              VTGGGT +G+G   W F+   K KN  +LP S+ F     + +  I  +NSK FHM + 
Sbjct  128   TVTGGGTFDGQGAVSWPFNKCPKDKNCKVLPTSVKFVNTKDTVVRGITSLNSKFFHMALL  187

Query  803   DCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRV  624
              C++F  S + I+APG SPNTDGIH+ GST V ++   V TGDDC+SIG G + + ++ +
Sbjct  188   GCHNFKGSGITISAPGTSPNTDGIHLEGSTGVTISGSKVATGDDCISIGQGNSLVTISGI  247

Query  623   TCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQL-KASGIIFED  447
             TCGPGHGIS+GSLG+   E DVK V V++ T  GTTNG RIKT+  SP + K   + F++
Sbjct  248   TCGPGHGISVGSLGRYNDEEDVKNVIVKDSTFQGTTNGVRIKTWANSPAITKVQNMTFDN  307

Query  446   IMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVP  276
             +++ NV  PI+IDQ Y      +   AS+VKL D+ F+NIRGT +K+  A+ L CS+  P
Sbjct  308   LVMKNVDYPIVIDQTYCPFAKCDNSRASRVKLSDIHFKNIRGT-TKRPEAVILRCSKGTP  366

Query  275   CEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             C+ + L +I++ +    G     + C+NA+    G   P
Sbjct  367   CQKLSLHNINLKNIGFGGTL---STCLNAKAEYSGNIFP  402



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   291 bits (745),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 225/369 (61%), Gaps = 7/369 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F V  + AK  G  D T +++ AW KAC S   AKV I  GTF   EVV +GPC A  +
Sbjct  25    VFQVENYSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKA-HV  83

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
               EI+G + A +D S + ++ W + + + G+ V+GGGT +G+G+  W  +  +K  N   
Sbjct  84    EFEIRGRLQAPADPSRFKTDGWVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTNCRT  143

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP +L F  V+ + IH++  ++SK FH+ V    +       + APGDS NTDGIHI  S
Sbjct  144   LPTNLRFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRS  203

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               VN+ D  + TGDDCVS+GDG+  + V  VTCGPGHGIS+GSLGK   E  V GV V N
Sbjct  204   LGVNILDTNIKTGDDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTN  263

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEA---SKV  366
             CT+ G TNGARIKT+ AS    A+ + F+D+ +++V  P++IDQ Y   N+ +A   S V
Sbjct  264   CTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLV  323

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             K+ +V F  IRGT+S K  A+ + CS+ +PCE VE+ADI++V     G     ++C N  
Sbjct  324   KISNVSFERIRGTSSTK-VAVKIACSKRIPCEGVEIADINLVYKGPDGP--ATSECSNVR  380

Query  185   TIVKGKRNP  159
              ++ G +NP
Sbjct  381   PLISGMQNP  389



>ref|XP_009119612.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Brassica 
rapa]
Length=420

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 155/372 (42%), Positives = 227/372 (61%), Gaps = 12/372 (3%)
 Frame = -1

Query  1259  TIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKR  1080
             T+FD+T+FGA  DG+ ++  A ++AW + C S   A +++P+G FLAG ++F GPC +K 
Sbjct  47    TVFDITQFGAVGDGRTNTFKAFLKAWIQVCASPVPATLLVPKGNFLAGPIIFAGPCKSK-  105

Query  1079  IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
             + + ++GT+ A +  S + +  W + E V  V +TG G I+GRGE +W  D   K     
Sbjct  106   VTVNVQGTISATT--SGFATPEWILFERVDNVHLTGPGIIHGRGEAIWGADGCGKKFKCN  163

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             L P SL F+ +    +  I  VN+K FHM +    + N+  ++I AP +SPNTDGIH+S 
Sbjct  164   LPPTSLKFRNIVNLEVSGISSVNAKAFHMFLVKTVNVNIHNIKIIAPAESPNTDGIHLSN  223

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             + NV + D  +GTGDDCVS+G G+ N+ V RV CGPGHG+S+GSLGK   E DV G+  +
Sbjct  224   ADNVRILDSFIGTGDDCVSVGRGSNNVTVERVVCGPGHGLSVGSLGKYPNEEDVSGIHFK  283

Query  539   NCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKL  360
             NCT+  T NG RIK++  S   KA  I FEDI++ NV  PIIIDQ+Y S  R   S+V +
Sbjct  284   NCTMRNTDNGLRIKSWGGSTPSKAVDIHFEDIIMENVKNPIIIDQNYGS--RGGESRVAI  341

Query  359   KDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVH------LKPNKC  198
              DV F+ ++GT   K   +  +CS++VPC+ V + D+++     KG H      L  + C
Sbjct  342   SDVLFKGVKGTTITKD-FVQFMCSKSVPCKGVVVDDVNLNFVGHKGGHPSASGGLIGSLC  400

Query  197   VNAETIVKGKRN  162
              NA  +  G+ N
Sbjct  401   NNAGVVFGGRVN  412



>ref|NP_001141594.1| exopolygalacturonase precursor [Zea mays]
 ref|XP_008672453.1| PREDICTED: exopolygalacturonase isoform X1 [Zea mays]
 gb|ACF86688.1| unknown [Zea mays]
 tpg|DAA54678.1| TPA: exopolygalacturonase [Zea mays]
Length=428

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 224/386 (58%), Gaps = 22/386 (6%)
 Frame = -1

Query  1298  GVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLA  1119
             G    P G       FD++KFGA  DGK DST A+   W  AC + G A ++IP+G +L 
Sbjct  46    GATAAPEGAARASRTFDISKFGATSDGKTDSTQAVQDTWTSACGAMGDATMLIPKGDYLV  105

Query  1118  GEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDV  939
             G + F GPC    I I++ G ++  +DL+ YT++ W  + HV  + + G GT++G+G  V
Sbjct  106   GPLYFSGPCMGD-ITIQLDGILLGSNDLAKYTAS-WIQVSHVNNIVINGSGTLDGQGTAV  163

Query  938   WQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAP  759
             +     + +K    +P +L+   V    +  IK +NSK FH+ +    D  V  + ITAP
Sbjct  164   YTKSKTDVVK---AMPNTLVLFYVTNGTVSGIKLLNSKFFHINIDTSKDITVKDVNITAP  220

Query  758   GDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGK  579
              D  NTDG+H+ GS+NV +T+  +GTGDDCVSIG G+  ++V  +TCGPG GIS+G LG+
Sbjct  221   ADVENTDGVHVGGSSNVRITNSTIGTGDDCVSIGPGSDGVMVNNITCGPGQGISVGCLGR  280

Query  578   RAQETDVKGVTVRNCTLIGTTNGARIKTYR-ASPQLKASGIIFEDIMLHNVTRPIIIDQD  402
                E DV  VTVR+C L  TTNG RIK+Y  A   L AS + FE+I +  V  PIIIDQ 
Sbjct  281   YKDEKDVSDVTVRDCVLRNTTNGVRIKSYEDAESVLTASHLTFENIRMEEVANPIIIDQY  340

Query  401   YNSK-----NRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVS  237
             +  +      R  +S V +K+V FRNI GT+S    A+SL+CS+T PC  V L D+++  
Sbjct  341   FCPQKVCPGKRSNSSHVSIKNVTFRNISGTSSTPE-AVSLLCSETQPCSGVSLIDVNVEY  399

Query  236   AAGKGVHLKPNK----CVNAETIVKG  171
             A       K NK    C NA+   KG
Sbjct  400   AG------KNNKTMAVCSNAKGTAKG  419



>ref|XP_009618497.1| PREDICTED: exopolygalacturonase-like [Nicotiana tomentosiformis]
Length=414

 Score =   291 bits (746),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 156/369 (42%), Positives = 231/369 (63%), Gaps = 6/369 (2%)
 Frame = -1

Query  1262  HTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAK  1083
              TIF+V  FGAKP+ +  ST A +RAW  AC   G A++ +P G +   E +F GPC   
Sbjct  43    QTIFNVLNFGAKPNSELISTQAFMRAWRAACDFNGRARLFVPPGVYNLAETIFSGPCKGT  102

Query  1082  R-IVIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKN  906
               I+++I GT+ A +D+S Y++  W   + + G+ +TGGGT++ +G+ +WQF+  +   N
Sbjct  103   HPIIVQIAGTLKAVADVSEYSNFAWISFDSINGIIITGGGTLDAQGQALWQFNDCKSNSN  162

Query  905   APLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHI  726
                LP +L F GV    +  +  +NS GFH+ +++        L I AP +SPNTDGIHI
Sbjct  163   CVHLPATLFFNGVENGKVMRLNLINSMGFHIHITNSYLVRFHALTIDAPENSPNTDGIHI  222

Query  725   SGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVT  546
             S S  + ++  V+ TGDDCVS G G TN+ V +VTCGPGHGISIGS+GK + E +++G+ 
Sbjct  223   SKSNTIKLSRSVIRTGDDCVSFGQGATNVTVNKVTCGPGHGISIGSIGKLSGELEIRGLI  282

Query  545   VRNCTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKV  366
             V+NCTL GTTNG RIKT+  +   +A G++F DI++ NV  PIIIDQ Y  K+  E S+V
Sbjct  283   VKNCTLRGTTNGIRIKTFAGANPNRAIGMMFSDIVMENVKNPIIIDQSYGDKS-TEPSQV  341

Query  365   KLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNAE  186
             ++ DV ++NIRGT +    A+ L+CS  +PC +V L +I++   A   +    ++C NA 
Sbjct  342   RISDVIYQNIRGT-TISEVAVQLMCSARLPCLNVRLTNINLKHIANTPI---TSQCQNAN  397

Query  185   TIVKGKRNP  159
                 G + P
Sbjct  398   VGYTGIQFP  406



>ref|XP_002437276.1| hypothetical protein SORBIDRAFT_10g024020 [Sorghum bicolor]
 gb|EER88643.1| hypothetical protein SORBIDRAFT_10g024020 [Sorghum bicolor]
Length=404

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 218/345 (63%), Gaps = 9/345 (3%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +F+V+ FGA  DG+ D + A +RAW KAC + G A VV+PRG +L   +VF+GPC    +
Sbjct  31    VFNVSDFGAVADGRTDDSEAFLRAWTKACATPGRAAVVVPRGDYLLHPLVFRGPCKGY-M  89

Query  1076  VIEIKGTMVADSDLSVYT-SNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAP  900
              + + G + A   L+ +     W     + G+ VTGGGT +GRG   W  +   + ++  
Sbjct  90    EVHVAGVLRAPPGLAAFRGCREWVHFSSIDGLLVTGGGTFDGRGATAWPLNQCPQKRDCK  149

Query  899   LLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISG  720
             LLP S+    V  + I  +  ++SK FH+ V   +D  + ++ I AP  SPNTDG+HI G
Sbjct  150   LLPTSIKLGLVRNATITGVTSLDSKFFHVTVVGSHDVAIHRVSIRAPRSSPNTDGVHIQG  209

Query  719   STNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVR  540
             S+NV VTD  V TGDDCVS+G G ++++V+ V+CGPGHGIS+GSLG+   E DV+ + V 
Sbjct  210   SSNVRVTDSAVATGDDCVSVGPGASDVVVSGVSCGPGHGISVGSLGRYPGEEDVRRLRVA  269

Query  539   NCTLIGTTNGARIKTYRASPQLKA-SGIIFEDIMLHNVTRPIIIDQDYNS-----KNRKE  378
             NCTL GT+NG RIKT+R      A +G++FEDI++  V  PIIIDQ+Y       ++ + 
Sbjct  270   NCTLAGTSNGVRIKTWRGGTWPTAVTGLVFEDIVMRKVHNPIIIDQEYCPYASCRESEQR  329

Query  377   ASKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
              S V++ DV+FRNIRG ++ K  A+ L CS+  PC ++EL DID+
Sbjct  330   PSAVRISDVKFRNIRGESATKV-AVKLSCSEASPCRELELRDIDL  373



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/399 (42%), Positives = 240/399 (60%), Gaps = 16/399 (4%)
 Frame = -1

Query  1343  AGIFVILLGIALLSTGVECIPRGRGHTHTIFDVTKFGAKPDGKGDSTMAMIRAWNKACHS  1164
             + + VI   +ALLS  VE     R H   IF + K+G    G  D T A+  AWN AC S
Sbjct  7     SSLLVITFLMALLSFTVE----SRSHVDVIFHLRKYGNIVSG-ADVTEALKDAWNDACAS  61

Query  1163  RGAAKVVIPRGTFLAGEVVFQGPCTAKRIVIEIKGTMVADSDLSVYTSNYWFIIEHVAGV  984
                + VVIP+GTF   E  F+GPC +  + + ++GT+ A         + W    +V  +
Sbjct  62    LRPSAVVIPKGTFKVREGEFKGPCKSP-VEVRVRGTLQAPKHPH---GDSWITFAYVDRM  117

Query  983   EVTGGGTINGRGEDVWQFDADEKIKNAPLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVS  804
              ++GGG  +G+G+  W+ +   K  +   LP+SL F  +  S +  I  ++SK FH+ + 
Sbjct  118   TLSGGGVFDGQGKAGWEKNDCHKHISCARLPISLRFNFITNSIVRRITSLDSKNFHVNIL  177

Query  803   DCNDFNVSKLRITAPGDSPNTDGIHISGSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRV  624
              CN+     + I AP DSPNTDGIHI  S  +++    + TGDDC+S+GDG+  + +T V
Sbjct  178   GCNNLTFDGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITNV  237

Query  623   TCGPGHGISIGSLGKRAQETDVKGVTVRNCTLIGTTNGARIKTYRASPQLK-ASGIIFED  447
             TCGPGHGISIGSLGK   E  V+GV V+NCT++ TTNG RIKT+ ASP    A+ + F D
Sbjct  238   TCGPGHGISIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFLD  297

Query  446   IMLHNVTRPIIIDQDY---NSKNRKEASKVKLKDVRFRNIRGTASKKHPAISLICSQTVP  276
             I + NV+ PI+IDQ+Y   N  NRK  SK+K+  V F+NIRG+++    A+ LICS  +P
Sbjct  298   ITMVNVSNPILIDQEYCPWNQCNRKIPSKIKINKVSFKNIRGSSATP-VAVKLICSSNLP  356

Query  275   CEDVELADIDIVSAAGKGVHLKPNKCVNAETIVKGKRNP  159
             CE+V++A+ID+V    KG     ++C+N + I+ G +NP
Sbjct  357   CEEVKVANIDLVYNGIKGSLT--SECMNVKPIISGTQNP  393



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/370 (42%), Positives = 235/370 (64%), Gaps = 13/370 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+TK+GAKP+   D T A+  AW +AC S   +KV+IP+GT+   +   +GPC +  I
Sbjct  29    VFDITKYGAKPNA--DITAALASAWKEACASTTPSKVLIPKGTYGLTQSNLKGPCKS-SI  85

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              ++++GT+ A  D+     +   ++E+V  + V+G G ++G+G+  W  +     K    
Sbjct  86    ELQLEGTVQASVDVK---GDGLLLLEYVDQLTVSGTGVVDGQGKTAWGKNDCHLKKICTK  142

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
             LP++L F  V  S + DI  ++SK +H  +  C +     + ITAPG+SPNTDGIH+  S
Sbjct  143   LPMNLKFNFVTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITAPGNSPNTDGIHVGDS  202

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
               +N+ +  + TGDDC+S+G     ++++ VTCGPGHGISIGSLGK   E ++ GVTV+ 
Sbjct  203   EQINILNTNIATGDDCISVGISNKQIVISDVTCGPGHGISIGSLGKYTNEKELVGVTVKK  262

Query  536   CTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEASK  369
             C L GTTNG RIKT+  S     AS + FEDI + NV+ P++IDQ+Y   N  NRK  SK
Sbjct  263   CKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNRKVPSK  322

Query  368   VKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCVNA  189
             +K+  V F+NIRGT++    A+ L+CSQ+ PCE VE+ADID+  +  +G  +K ++C N 
Sbjct  323   IKISKVSFKNIRGTSATPV-AVKLVCSQSNPCEGVEVADIDLTYSGSEG-PIK-SQCANV  379

Query  188   ETIVKGKRNP  159
             + ++ GK+NP
Sbjct  380   KPVISGKQNP  389



>dbj|BAK04982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/344 (45%), Positives = 209/344 (61%), Gaps = 13/344 (4%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             IFD+TK GA  DGK D +  +  AW  AC +   A V++P+G FL G + F GPC    +
Sbjct  50    IFDITKLGATSDGKTDCSKEIQEAWKSACGAAEQATVLVPKGEFLVGPLNFSGPCKGD-V  108

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              I+I GT++  +DL  Y    W  I  V  + +TG GTI+G+G +V+  D +     A  
Sbjct  109   KIQIDGTLLGTNDLPKYDGGSWINILKVENLVITGSGTIDGQGTNVYTKDPE-----AQA  163

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P SL+   V    +  I  +NSK FH+ +    D  V  L ITAPG+SPNTDGIHI  S
Sbjct  164   FPNSLVLDFVKNGTVSGITLLNSKFFHINIYKSEDVKVENLTITAPGNSPNTDGIHIGDS  223

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
             +N+NVT   +GTGDDC+SIG G++ + VTRVTCGPG GIS+G LG+   E DV  VTV++
Sbjct  224   SNINVTGATIGTGDDCISIGGGSSRIRVTRVTCGPGQGISVGCLGRYKDEKDVSDVTVKD  283

Query  536   CTLIGTTNGARIKTYR-ASPQLKASGIIFEDIMLHNVTRPIIIDQDY-----NSKNRKEA  375
             C L  +TNG RIKTY  A   + AS + FE+I + +V  PIIIDQ+Y      +   K  
Sbjct  284   CVLRSSTNGVRIKTYEDAVKSITASNLTFENIKMEDVANPIIIDQNYCPEKVCTAKSKSK  343

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDI  243
             S V +KDV FRNI GT+S    A+SL+CS   PC  V+L D+++
Sbjct  344   SAVTVKDVIFRNITGTSSTPE-AVSLLCSDKQPCSGVDLIDVNV  386



>ref|XP_006486583.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
 gb|KDO68374.1| hypothetical protein CISIN_1g047315mg [Citrus sinensis]
Length=417

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/372 (41%), Positives = 234/372 (63%), Gaps = 9/372 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPC-TAKR  1080
             + +V  FGA+ DG+ D + A   AW +AC + GA  +++P GT+L G + F GPC     
Sbjct  45    LVNVKDFGARADGRTDDSKAFEAAWKEACETTGAVTLLVPHGTYLIGPIKFAGPCKNVSN  104

Query  1079  IVIEIKGTMVADSDLSVYTSNY-WFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNA  903
             I +++KG ++A ++LS Y     W     V G+ +TGGGT +GRG   W ++      N 
Sbjct  105   ITVQMKGYLIASTNLSEYRFGAGWVEFGGVEGLTLTGGGTFDGRGAKAWPYNGCPTHFNC  164

Query  902   PLLPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHIS  723
              LLP ++ F  + ++ +  I  VNSK FH+ + +C +F  SK++I+AP +SPNTDGIHI 
Sbjct  165   KLLPTNVKFVAMKKTIVRRITSVNSKSFHIALVECKNFRGSKIKISAPANSPNTDGIHIE  224

Query  722   GSTNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTV  543
              S++V+V+   +GTGDDC+S+G G + + +  +TCGPGHGIS+GSLG+   E DV+G+ V
Sbjct  225   RSSSVHVSRSHIGTGDDCISVGQGNSEVTIASITCGPGHGISVGSLGRYPNEGDVRGLVV  284

Query  542   RNCTLIGTTNGARIKTYRASP-QLKASGIIFEDIMLHNVTRPIIIDQDY---NSKNRKEA  375
             R+ T+ GT NG RIKT+  SP    A+ + FE+I+++NV+ PIIIDQ Y    S   K  
Sbjct  285   RDSTMTGTMNGVRIKTWANSPGSSAATNMTFENIIMNNVSNPIIIDQAYCPFTSCPTKPP  344

Query  374   SKVKLKDVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKGVHLKPNKCV  195
             S+VKL D+ F+NIRGT+S    A++L CS+ +PC+++ L ++ +  ++G+      + C 
Sbjct  345   SRVKLSDIYFKNIRGTSSSAV-AVALECSKGIPCQNIYLENVHLDLSSGE--KQPTSSCK  401

Query  194   NAETIVKGKRNP  159
             N E    G + P
Sbjct  402   NVEAKYIGTQVP  413



>emb|CDY37460.1| BnaC08g45980D [Brassica napus]
Length=419

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 220/345 (64%), Gaps = 7/345 (2%)
 Frame = -1

Query  1256  IFDVTKFGAKPDGKGDSTMAMIRAWNKACHSRGAAKVVIPRGTFLAGEVVFQGPCTAKRI  1077
             +FD+TKFGA  DG  ++  A + AW + C S   A +++P G +LAG V+F GPC + R+
Sbjct  50    VFDITKFGAVGDGATNTFKAFLNAWIQVCDSAVPATLLVPAGQYLAGPVIFAGPCKS-RV  108

Query  1076  VIEIKGTMVADSDLSVYTSNYWFIIEHVAGVEVTGGGTINGRGEDVWQFDADEKIKNAPL  897
              +E++GT++A +  S Y +  WF+ E +  + +TG GT NG+GED+W+    +K  N  L
Sbjct  109   TVEVQGTIIATT--SGYATPEWFLFERINDILLTGTGTFNGKGEDIWKEGCGKK-TNCNL  165

Query  896   LPVSLIFQGVNRSGIHDIKFVNSKGFHMKVSDCNDFNVSKLRITAPGDSPNTDGIHISGS  717
              P SL F+ +    +  I  VNSK FHM +      N+  +++ AP +SPNTDGIH+S +
Sbjct  166   PPTSLKFRNLKNLEVSGITSVNSKAFHMFLVKTEFVNIHNIKLLAPAESPNTDGIHLSNA  225

Query  716   TNVNVTDLVVGTGDDCVSIGDGTTNLLVTRVTCGPGHGISIGSLGKRAQETDVKGVTVRN  537
              +V++T+  + TGDDCVSIG G+ N+ +  + CGPGHGIS+GSLGK  +E DV G+ V N
Sbjct  226   DHVSITNSKMATGDDCVSIGRGSNNVTIQGIICGPGHGISVGSLGKYKKEEDVSGIHVSN  285

Query  536   CTLIGTTNGARIKTYRASPQLKASGIIFEDIMLHNVTRPIIIDQDYNSKNRKEASKVKLK  357
             CT+I T NG RIKT+  S   +A+ I FE+I + +V  PIIIDQ+Y S  R   S+V + 
Sbjct  286   CTMIQTDNGLRIKTWGGSDPSRAADIKFENIQMQSVKNPIIIDQNYGS--RGGDSQVAVS  343

Query  356   DVRFRNIRGTASKKHPAISLICSQTVPCEDVELADIDIVSAAGKG  222
             DV F NIRGT   ++  + L CS++VPC  V + D+++     KG
Sbjct  344   DVLFSNIRGTTITQN-VVQLNCSKSVPCAGVNVVDVNLNYVGKKG  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3851970174216