BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20913_g1_i1 len=397 path=[823:0-396]

Length=397
                                                                      Score     E

ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   63.2    4e-09   
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   62.8    6e-09   
gb|KGN49290.1|  hypothetical protein Csa_6G519430                     62.4    6e-09   
gb|EMT08653.1|  GDSL esterase/lipase                                  62.4    9e-09   
ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   62.0    1e-08   
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   60.8    3e-08   
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg              60.5    4e-08   
ref|NP_001050176.1|  Os03g0365900                                     58.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   60.5    4e-08   
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   60.1    4e-08   
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   60.1    5e-08   
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                  60.1    5e-08   
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  60.1    5e-08   
dbj|BAJ86481.1|  predicted protein                                    60.1    5e-08   
emb|CDY15655.1|  BnaA07g08260D                                        60.1    5e-08   
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   60.1    6e-08   
ref|XP_003593740.1|  GDSL esterase/lipase                             59.7    7e-08   
gb|KHN08455.1|  GDSL esterase/lipase                                  57.0    1e-07   
gb|EAY90132.1|  hypothetical protein OsI_11698                        58.5    2e-07   Oryza sativa Indica Group [Indian rice]
gb|EAZ27028.1|  hypothetical protein OsJ_10957                        58.5    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   58.5    2e-07   
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  58.5    2e-07   
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3     58.5    2e-07   
ref|NP_973932.1|  GDSL esterase/lipase                                58.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   58.2    2e-07   
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925  58.9    2e-07   
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  58.5    2e-07   
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  58.2    2e-07   
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   58.2    2e-07   
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645  58.9    2e-07   
emb|CDP21061.1|  unnamed protein product                              58.2    2e-07   
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   57.8    3e-07   
emb|CDO99485.1|  unnamed protein product                              57.8    3e-07   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850        57.8    3e-07   Sorghum bicolor [broomcorn]
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910        57.4    4e-07   
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479  58.2    4e-07   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   57.4    4e-07   
ref|NP_001241470.1|  uncharacterized protein LOC100816865             57.4    4e-07   
gb|AFW80395.1|  esterase                                              57.4    4e-07   
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   57.4    4e-07   
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650        57.4    4e-07   
ref|NP_001149156.1|  esterase precursor                               57.4    5e-07   Zea mays [maize]
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  57.0    5e-07   
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  57.0    5e-07   
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   57.0    5e-07   
ref|XP_010911731.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   55.8    5e-07   
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...  57.0    5e-07   
dbj|BAK06902.1|  predicted protein                                    56.6    7e-07   
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   56.6    7e-07   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   56.6    7e-07   
gb|KFK44739.1|  hypothetical protein AALP_AA1G296700                  53.5    8e-07   
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg           57.0    8e-07   
ref|NP_001042396.1|  Os01g0215700                                     56.6    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   56.6    8e-07   
dbj|BAA94228.1|  putative esterase                                    56.2    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010540491.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  56.2    9e-07   
gb|EEE54111.1|  hypothetical protein OsJ_00875                        56.2    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  56.2    1e-06   
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   56.2    1e-06   
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  56.2    1e-06   
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   56.2    1e-06   
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   56.2    1e-06   
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...  56.2    1e-06   
emb|CDX94634.1|  BnaC07g10240D                                        56.2    1e-06   
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  56.2    1e-06   
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   55.8    1e-06   
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   55.8    1e-06   
ref|XP_008358656.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   54.3    1e-06   
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592  56.6    1e-06   
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   55.8    1e-06   
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910        55.8    1e-06   
gb|AAF24548.2|AC007508_11  F1K23.17                                   56.6    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   55.8    1e-06   
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   55.8    1e-06   
ref|XP_009390675.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   55.8    1e-06   
ref|XP_002893538.1|  predicted protein                                56.2    2e-06   
emb|CDO96753.1|  unnamed protein product                              55.5    2e-06   
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  55.5    2e-06   
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   55.5    2e-06   
ref|NP_973930.1|  GDSL esterase/lipase                                55.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   55.5    2e-06   
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                  56.2    2e-06   
gb|AAL86351.1|  putative lipase                                       54.3    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460977.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   53.1    2e-06   
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   55.1    2e-06   
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950        55.1    2e-06   Sorghum bicolor [broomcorn]
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   55.1    2e-06   
ref|NP_174181.1|  GDSL esterase/lipase                                55.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879083.1|  predicted protein                                55.1    3e-06   
ref|NP_174179.3|  GDSL esterase/lipase                                55.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849723.1|  GDSL esterase/lipase                                55.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564314.1|  GDSL esterase/lipase                                54.7    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001172232.1|  Os01g0215500                                     52.0    3e-06   
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...  55.1    3e-06   
gb|EYU28066.1|  hypothetical protein MIMGU_mgv1a009376mg              54.7    3e-06   
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like   54.7    3e-06   
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   54.7    3e-06   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   54.7    3e-06   
gb|ACF85857.1|  unknown                                               54.7    3e-06   Zea mays [maize]
ref|XP_003593744.1|  GDSL esterase/lipase                             54.7    3e-06   
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   54.7    3e-06   
emb|CDO96754.1|  unnamed protein product                              54.7    3e-06   
ref|NP_001150078.1|  esterase                                         54.7    3e-06   Zea mays [maize]
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   54.7    4e-06   
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  54.3    4e-06   
gb|AAF24544.2|AC007508_7  F1K23.13                                    55.1    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580        54.3    4e-06   Vitis vinifera
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   54.3    5e-06   
emb|CDY43309.1|  BnaC03g58810D                                        54.3    5e-06   
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   54.3    5e-06   
ref|NP_973931.1|  GDSL esterase/lipase                                53.9    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg           53.9    5e-06   
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   53.9    5e-06   
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   54.3    5e-06   
ref|XP_009409412.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   53.9    5e-06   
gb|KHN08453.1|  GDSL esterase/lipase                                  53.5    6e-06   
ref|XP_003593742.1|  GDSL esterase/lipase                             53.9    6e-06   
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor   53.9    6e-06   
ref|NP_001057786.1|  Os06g0531900                                     53.9    6e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CBI30663.3|  unnamed protein product                              54.7    6e-06   
ref|NP_174180.1|  GDSL esterase/lipase                                53.9    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EMT00808.1|  GDSL esterase/lipase                                  53.9    6e-06   
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   53.9    7e-06   
ref|XP_006658887.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   53.9    7e-06   
emb|CDO96749.1|  unnamed protein product                              53.9    7e-06   
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600        53.9    7e-06   
dbj|BAK07773.1|  predicted protein                                    53.5    7e-06   
emb|CDY48195.1|  BnaA04g15590D                                        53.5    7e-06   
dbj|BAJ93038.1|  predicted protein                                    51.6    7e-06   
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910        53.5    8e-06   
gb|EMT19408.1|  GDSL esterase/lipase                                  53.5    8e-06   
ref|XP_002893540.1|  predicted protein                                54.3    8e-06   
ref|NP_174186.1|  GDSL esterase/lipase                                53.5    8e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77066.1|  BnaC04g38610D                                        53.5    8e-06   
emb|CDX90163.1|  BnaA08g18210D                                        53.5    9e-06   
gb|AAM65183.1|  lipase, putative                                      53.5    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDP21068.1|  hypothetical protein JCGZ_21539                       53.5    9e-06   
gb|AFW80393.1|  hypothetical protein ZEAMMB73_871175                  53.1    9e-06   
dbj|BAF02148.1|  putative lipase                                      53.1    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   53.1    9e-06   
gb|KDO77812.1|  hypothetical protein CISIN_1g018031mg                 52.8    9e-06   
ref|NP_174182.1|  GDSL esterase/lipase                                53.5    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043728.2|  Os01g0651000                                     51.2    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   53.1    1e-05   
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   53.1    1e-05   
ref|XP_003593736.1|  GDSL esterase/lipase                             53.1    1e-05   
ref|NP_174188.1|  lipase ARAB-1                                       53.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655774.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   53.1    1e-05   
gb|EMT13774.1|  GDSL esterase/lipase                                  50.4    1e-05   
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   53.1    1e-05   
gb|EMT01787.1|  GDSL esterase/lipase                                  53.1    1e-05   
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   53.1    1e-05   
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                 52.8    1e-05   
gb|KHN08454.1|  GDSL esterase/lipase                                  53.5    1e-05   
gb|KGN49292.1|  hypothetical protein Csa_6G519450                     52.8    1e-05   
ref|XP_004491864.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   52.8    1e-05   
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   52.8    1e-05   
ref|NP_001172484.1|  Os01g0651400                                     50.1    1e-05   
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   52.8    1e-05   
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  52.8    2e-05   
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   52.8    2e-05   
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   52.8    2e-05   
ref|XP_009397450.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   52.8    2e-05   
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  52.8    2e-05   
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   52.8    2e-05   
gb|AFW80390.1|  esterase                                              52.4    2e-05   
ref|XP_008655643.1|  PREDICTED: GDSL esterase/lipase At1g28590-like   52.4    2e-05   
ref|XP_004959853.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   52.4    2e-05   
ref|XP_003638491.1|  GDSL esterase/lipase                             52.4    2e-05   
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   52.4    2e-05   
ref|XP_003566944.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   52.4    2e-05   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                   52.4    2e-05   
emb|CDY43308.1|  BnaC03g58800D                                        52.4    2e-05   
gb|KHN18921.1|  GDSL esterase/lipase                                  51.6    2e-05   
ref|XP_009608032.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...  52.4    2e-05   
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg           52.4    2e-05   
gb|EEC70166.1|  hypothetical protein OsI_00887                        52.4    2e-05   Oryza sativa Indica Group [Indian rice]
gb|EMT01150.1|  GDSL esterase/lipase                                  52.4    2e-05   
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   52.4    2e-05   
emb|CDO96755.1|  unnamed protein product                              52.4    2e-05   
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...  52.4    2e-05   
ref|XP_006844515.1|  hypothetical protein AMTR_s00016p00147040        51.2    2e-05   
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like   52.4    2e-05   
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  52.4    2e-05   
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  52.4    2e-05   
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136  52.8    2e-05   
gb|KEH34272.1|  GDSL-like lipase/acylhydrolase                        52.4    2e-05   
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg           52.4    2e-05   
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   52.0    2e-05   
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...  52.0    2e-05   
gb|KEH34273.1|  GDSL-like lipase/acylhydrolase                        52.0    2e-05   
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200        52.4    2e-05   
gb|KCW76149.1|  hypothetical protein EUGRSUZ_D00526                   48.9    3e-05   
ref|NP_001172233.1|  Os01g0216900                                     52.0    3e-05   
gb|EEE55084.1|  hypothetical protein OsJ_02825                        51.2    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ37226.1|  hypothetical protein OsJ_21564                        52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01210.1|  hypothetical protein OsI_23235                        52.0    3e-05   Oryza sativa Indica Group [Indian rice]
gb|EEE54110.1|  hypothetical protein OsJ_00874                        52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD73016.1|  putative esterase                                    52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ12911.1|  hypothetical protein OsJ_02834                        52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD44668.1|  putative lipase                                      52.0    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   52.0    3e-05   
ref|NP_180304.1|  GDSL esterase/lipase                                52.0    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252  52.4    3e-05   
dbj|BAK05815.1|  predicted protein                                    52.0    3e-05   
dbj|BAJ97605.1|  predicted protein                                    51.6    3e-05   
gb|EEC70171.1|  hypothetical protein OsI_00893                        52.0    3e-05   Oryza sativa Indica Group [Indian rice]
dbj|BAB89203.1|  lipase-like                                          51.6    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like   51.6    3e-05   
emb|CDX94632.1|  BnaC07g10260D                                        51.6    3e-05   
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g           51.6    3e-05   
ref|XP_003560500.1|  PREDICTED: acetylajmalan esterase-like           51.6    3e-05   
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078           51.6    3e-05   
emb|CDM80951.1|  unnamed protein product                              50.8    3e-05   
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                   51.6    4e-05   
ref|XP_002317430.2|  hypothetical protein POPTR_0011s07610g           50.4    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   51.6    4e-05   
ref|XP_009413843.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   51.6    4e-05   
ref|NP_001150126.1|  esterase precursor                               51.6    4e-05   Zea mays [maize]
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910        51.6    4e-05   
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein              51.6    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  51.6    4e-05   
ref|NP_199403.1|  GDSL esterase/lipase                                51.6    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EAY75182.1|  hypothetical protein OsI_03072                        51.2    4e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001172483.1|  Os01g0649400                                     51.2    4e-05   
ref|XP_006643905.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   51.2    4e-05   
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  51.6    4e-05   
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   51.6    4e-05   
ref|XP_006415634.1|  hypothetical protein EUTSA_v10009717mg           51.2    4e-05   
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600        51.2    4e-05   Sorghum bicolor [broomcorn]
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   51.2    4e-05   
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   51.2    4e-05   
ref|XP_006646152.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   51.2    4e-05   
dbj|BAD68794.1|  lipase-like                                          51.2    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23216.1|  GDSL esterase/lipase                                  51.2    5e-05   
emb|CDX90162.1|  BnaA08g18220D                                        51.2    5e-05   
ref|XP_006387672.1|  hypothetical protein POPTR_0686s00200g           49.3    5e-05   
emb|CDM81086.1|  unnamed protein product                              51.2    5e-05   
ref|XP_002454933.1|  hypothetical protein SORBIDRAFT_03g001670        51.2    5e-05   Sorghum bicolor [broomcorn]
ref|XP_002461107.1|  hypothetical protein SORBIDRAFT_02g040890        51.2    5e-05   Sorghum bicolor [broomcorn]
dbj|BAK05007.1|  predicted protein                                    51.2    5e-05   
gb|EMT23218.1|  GDSL esterase/lipase                                  50.8    5e-05   
gb|EEE54108.1|  hypothetical protein OsJ_00868                        50.8    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042390.1|  Os01g0214600                                     50.8    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550        51.2    5e-05   
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.8    6e-05   
ref|XP_004968624.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   50.8    6e-05   
dbj|BAK01569.1|  predicted protein                                    50.8    6e-05   
ref|XP_007214461.1|  hypothetical protein PRUPE_ppa023988mg           51.2    6e-05   
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1               50.8    6e-05   
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein       50.8    6e-05   
gb|ACF83155.1|  unknown                                               50.8    6e-05   Zea mays [maize]
ref|NP_001042400.2|  Os01g0216500                                     48.1    6e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CDY64716.1|  BnaCnng44670D                                        50.8    6e-05   
ref|NP_001151215.1|  LOC100284848 precursor                           50.8    6e-05   Zea mays [maize]
ref|NP_001056858.1|  Os06g0157000                                     50.8    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655809.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.8    6e-05   
dbj|BAD69424.1|  putative lipase                                      50.8    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   50.8    6e-05   
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                  50.8    6e-05   
ref|XP_006651412.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   50.8    7e-05   
gb|EEE65121.1|  hypothetical protein OsJ_20187                        50.8    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.8    7e-05   
ref|XP_002457138.1|  hypothetical protein SORBIDRAFT_03g001860        50.8    7e-05   Sorghum bicolor [broomcorn]
emb|CDY63998.1|  BnaA07g36520D                                        50.8    7e-05   
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   50.8    7e-05   
gb|AAX62802.1|  lipase 2                                              50.8    7e-05   Brassica napus [oilseed rape]
emb|CDY15658.1|  BnaA07g08290D                                        50.8    7e-05   
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   50.8    7e-05   
gb|EMT22799.1|  GDSL esterase/lipase                                  50.8    7e-05   
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.4    7e-05   
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like   50.4    7e-05   
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  50.4    8e-05   
emb|CDM83767.1|  unnamed protein product                              50.4    8e-05   
ref|XP_006645636.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.4    8e-05   
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.4    8e-05   
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein       50.4    8e-05   Populus trichocarpa [western balsam poplar]
emb|CDP21060.1|  unnamed protein product                              49.7    8e-05   
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...  50.4    8e-05   
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   50.4    8e-05   
ref|NP_001043718.2|  Os01g0649200                                     48.1    8e-05   
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   50.4    8e-05   
gb|KEH38721.1|  GDSL-like lipase/acylhydrolase                        50.4    9e-05   
emb|CDY30819.1|  BnaC05g21950D                                        50.4    9e-05   
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924  50.8    9e-05   
ref|XP_009409411.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.4    9e-05   
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.4    9e-05   
gb|KEH38722.1|  GDSL-like lipase/acylhydrolase                        50.4    9e-05   
ref|XP_010250902.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   50.4    9e-05   
gb|EAY96951.1|  hypothetical protein OsI_18870                        50.1    9e-05   
gb|AAS91011.1|  putative lipase                                       50.1    9e-05   
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.1    9e-05   
ref|XP_003635692.1|  GDSL esterase/lipase                             50.1    1e-04   
ref|XP_004958488.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   50.4    1e-04   
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670        50.4    1e-04   
ref|NP_001054912.2|  Os05g0209600                                     50.1    1e-04   
emb|CDO96751.1|  unnamed protein product                              50.1    1e-04   
gb|KEH17251.1|  GDSL-like lipase/acylhydrolase                        50.1    1e-04   
ref|XP_003635688.1|  GDSL esterase/lipase                             50.1    1e-04   
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  50.4    1e-04   
gb|KEH17248.1|  GDSL-like lipase/acylhydrolase                        50.1    1e-04   
ref|XP_006281867.1|  hypothetical protein CARUB_v10028062mg           49.7    1e-04   
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...  50.1    1e-04   
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   50.4    1e-04   
ref|XP_004971835.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   50.1    1e-04   
gb|EMT01182.1|  GDSL esterase/lipase                                  50.1    1e-04   
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase               50.1    1e-04   
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                   50.1    1e-04   
ref|XP_004510075.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.1    1e-04   
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   50.1    1e-04   
ref|XP_007212997.1|  hypothetical protein PRUPE_ppa022774mg           47.4    1e-04   
gb|EAZ12915.1|  hypothetical protein OsJ_02838                        49.7    1e-04   
ref|XP_004516452.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.1    1e-04   
ref|XP_010042460.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   48.1    1e-04   
ref|XP_004516453.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.1    1e-04   
ref|XP_007138099.1|  hypothetical protein PHAVU_009G1802000g          49.7    1e-04   
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...  50.1    1e-04   
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   50.1    1e-04   
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   49.7    1e-04   
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.1    1e-04   
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   50.1    1e-04   
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   49.7    1e-04   
ref|XP_009380501.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   49.7    1e-04   
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910        49.7    1e-04   
ref|XP_006603997.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   49.7    1e-04   
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   49.7    1e-04   
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like   49.7    1e-04   
ref|XP_003537084.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   50.1    1e-04   
gb|KEH33412.1|  GDSL-like lipase/acylhydrolase                        49.7    1e-04   
ref|XP_006645844.1|  PREDICTED: GDSL esterase/lipase LIP-4-like       49.7    1e-04   
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   49.7    1e-04   
gb|EAY75193.1|  hypothetical protein OsI_03085                        49.7    1e-04   
gb|AES71072.2|  GDSL-like lipase/acylhydrolase                        49.7    1e-04   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                   49.7    2e-04   
gb|EAY99756.1|  hypothetical protein OsI_21741                        48.9    2e-04   
ref|XP_002439449.1|  hypothetical protein SORBIDRAFT_09g006580        49.3    2e-04   
ref|XP_003600821.1|  GDSL esterase/lipase                             49.7    2e-04   
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...  49.7    2e-04   
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g           49.7    2e-04   
gb|EEE55083.1|  hypothetical protein OsJ_02823                        49.7    2e-04   
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650        49.7    2e-04   
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like   49.3    2e-04   
ref|XP_002450232.1|  hypothetical protein SORBIDRAFT_05g002280        49.3    2e-04   
ref|NP_001054914.2|  Os05g0210400                                     49.3    2e-04   
gb|EAY96955.1|  hypothetical protein OsI_18874                        49.3    2e-04   
gb|EAY75181.1|  hypothetical protein OsI_03071                        49.3    2e-04   
gb|EEE62726.1|  hypothetical protein OsJ_17529                        49.3    2e-04   
dbj|BAJ85333.1|  predicted protein                                    49.3    2e-04   
ref|NP_001042399.1|  Os01g0216400                                     49.3    2e-04   
gb|ACR37954.1|  unknown                                               48.9    2e-04   
dbj|BAJ98364.1|  predicted protein                                    49.3    2e-04   
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   49.3    2e-04   
gb|AFW75581.1|  hypothetical protein ZEAMMB73_865053                  45.8    2e-04   
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  49.3    2e-04   
gb|AFW69252.1|  alpha-L-fucosidase 2                                  49.3    2e-04   
gb|EMT30304.1|  GDSL esterase/lipase                                  49.3    2e-04   
ref|XP_007020868.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  47.8    2e-04   
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  49.3    2e-04   
gb|AAM22723.1|AC092388_7  putative lipase                             49.3    2e-04   
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280        49.3    2e-04   
ref|XP_004236316.1|  PREDICTED: GDSL esterase/lipase At3g48460        48.9    2e-04   
gb|EAZ35882.1|  hypothetical protein OsJ_20183                        48.9    2e-04   
gb|ADQ08655.1|  GDSL-lipase                                           48.9    2e-04   
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like   48.9    2e-04   
gb|ADQ08656.1|  GDSL-lipase                                           48.9    2e-04   
gb|KHN34101.1|  GDSL esterase/lipase                                  48.9    3e-04   
ref|XP_003565527.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.9    3e-04   
ref|NP_001176138.1|  Os10g0394000                                     47.4    3e-04   
gb|EMT33597.1|  GDSL esterase/lipase                                  48.9    3e-04   
gb|KHN34100.1|  GDSL esterase/lipase                                  48.9    3e-04   
ref|XP_010042817.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   47.4    3e-04   
ref|XP_002450231.1|  hypothetical protein SORBIDRAFT_05g002270        48.9    3e-04   
ref|NP_001056855.1|  Os06g0156600                                     48.9    3e-04   
dbj|BAK05927.1|  predicted protein                                    48.9    3e-04   
gb|EMT24134.1|  GDSL esterase/lipase                                  48.9    3e-04   
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.9    3e-04   
gb|AFK42362.1|  unknown                                               48.9    3e-04   
ref|XP_006656658.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.9    3e-04   
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...  48.9    3e-04   
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   48.9    3e-04   
ref|XP_003593737.1|  GDSL esterase/lipase                             48.9    3e-04   
dbj|BAJ92568.1|  predicted protein                                    48.9    3e-04   
gb|KHN31271.1|  GDSL esterase/lipase                                  48.9    3e-04   
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor   48.9    3e-04   
dbj|BAK04206.1|  predicted protein                                    48.5    3e-04   
ref|XP_007138118.1|  hypothetical protein PHAVU_009G181700g           48.5    3e-04   
ref|XP_011072984.1|  PREDICTED: GDSL esterase/lipase At3g48460        48.5    3e-04   
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.5    3e-04   
ref|XP_008675274.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  48.5    3e-04   
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.5    3e-04   
ref|XP_002456055.1|  hypothetical protein SORBIDRAFT_03g029610        48.5    3e-04   
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.5    4e-04   
ref|NP_001151231.1|  alpha-L-fucosidase 2 precursor                   48.5    4e-04   
ref|XP_004966154.1|  PREDICTED: acetylajmalan esterase-like           48.5    4e-04   
ref|XP_007025435.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  48.5    4e-04   
tpg|DAA58335.1|  TPA: hypothetical protein ZEAMMB73_102185            48.5    4e-04   
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                  48.5    4e-04   
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   48.5    4e-04   
dbj|BAD73006.1|  putative esterase                                    48.5    4e-04   
tpg|DAA58339.1|  TPA: hypothetical protein ZEAMMB73_636863            47.8    4e-04   
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.5    4e-04   
ref|XP_010503477.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   48.5    4e-04   
ref|XP_007020867.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  47.8    4e-04   
ref|XP_010515164.1|  PREDICTED: GDSL esterase/lipase At3g48460        48.5    4e-04   
emb|CDY30822.1|  BnaC05g21980D                                        48.5    4e-04   
ref|XP_010426341.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   48.5    4e-04   
ref|NP_001043721.1|  Os01g0649900                                     48.5    4e-04   
gb|EMT23758.1|  GDSL esterase/lipase                                  48.5    4e-04   
gb|EAZ40836.1|  hypothetical protein OsJ_25314                        48.1    4e-04   
gb|EAZ04881.1|  hypothetical protein OsI_27063                        48.5    4e-04   
ref|NP_001060434.1|  Os07g0642200                                     48.5    4e-04   
gb|EAZ11025.1|  hypothetical protein OsJ_00869                        48.1    4e-04   
ref|NP_001042391.1|  Os01g0214800                                     48.1    4e-04   
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878  48.5    5e-04   
ref|NP_190416.1|  GDSL esterase/lipase                                48.1    5e-04   
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.1    5e-04   
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.1    5e-04   
ref|XP_004515399.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.1    5e-04   
gb|ACU18341.1|  unknown                                               47.4    5e-04   
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   48.1    5e-04   
gb|AAX59709.1|  lipase 1                                              48.1    5e-04   
gb|EMT16610.1|  GDSL esterase/lipase                                  48.1    5e-04   
emb|CDP15060.1|  unnamed protein product                              48.1    5e-04   
gb|KCW76151.1|  hypothetical protein EUGRSUZ_D00528                   47.8    5e-04   
ref|XP_008675273.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...  48.1    5e-04   
gb|EMT30305.1|  GDSL esterase/lipase                                  48.1    6e-04   
dbj|BAG94628.1|  unnamed protein product                              47.8    6e-04   
dbj|BAJ90120.1|  predicted protein                                    47.8    6e-04   
ref|XP_003561093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   47.8    6e-04   
ref|XP_008675275.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   47.8    6e-04   
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like   47.8    6e-04   
gb|EMT28147.1|  GDSL esterase/lipase                                  47.8    6e-04   
ref|XP_010026792.1|  PREDICTED: GDSL esterase/lipase At3g48460        47.8    6e-04   
ref|XP_006404256.1|  hypothetical protein EUTSA_v10010448mg           47.8    6e-04   
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930        47.8    6e-04   
ref|XP_008675276.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   47.8    6e-04   
ref|XP_008656709.1|  PREDICTED: GDSL esterase/lipase At1g28600-like   47.8    6e-04   
ref|XP_006351456.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   47.8    7e-04   
emb|CDX94633.1|  BnaC07g10250D                                        47.8    7e-04   
gb|ACF80567.1|  unknown                                               44.7    7e-04   
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   47.8    7e-04   
gb|EEC70553.1|  hypothetical protein OsI_01706                        47.8    7e-04   
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   47.8    7e-04   
dbj|BAD73014.1|  putative esterase                                    47.8    7e-04   
gb|EAZ11036.1|  hypothetical protein OsJ_00880                        47.8    7e-04   
gb|EEC70173.1|  hypothetical protein OsI_00899                        47.8    7e-04   
gb|EEE54472.1|  hypothetical protein OsJ_01574                        47.8    8e-04   
ref|NP_174440.2|  GDSL esterase/lipase                                47.8    8e-04   
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...  47.8    8e-04   
tpg|DAA52848.1|  TPA: hypothetical protein ZEAMMB73_895572            47.8    8e-04   
ref|NP_001031122.1|  GDSL esterase/lipase                             47.8    8e-04   
dbj|BAD95190.1|  hypothetical protein                                 47.8    8e-04   
gb|AAG60153.1|AC074360_18  lipase, putative                           47.4    8e-04   
ref|XP_006656415.1|  PREDICTED: acetylajmalan esterase-like           47.8    8e-04   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...  47.4    8e-04   
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg           47.4    8e-04   
ref|XP_008673536.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...  47.4    8e-04   
ref|XP_009415142.1|  PREDICTED: uncharacterized protein LOC103996...  47.4    9e-04   
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  47.8    9e-04   
gb|KHN34384.1|  GDSL esterase/lipase                                  47.4    0.001   
tpg|DAA58326.1|  TPA: hypothetical protein ZEAMMB73_004372            47.0    0.001   
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   47.4    0.001   
emb|CDO96752.1|  unnamed protein product                              47.4    0.001   
ref|XP_003525626.1|  PREDICTED: GDSL esterase/lipase At3g48460-like   47.4    0.001   
gb|EPS71267.1|  hypothetical protein M569_03493                       47.4    0.001   
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like   47.4    0.001   
ref|XP_009421257.1|  PREDICTED: GDSL esterase/lipase At5g45910-like   47.4    0.001   
gb|ACN36764.1|  unknown                                               46.2    0.001   
emb|CDY15657.1|  BnaA07g08280D                                        47.4    0.001   



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
 ref|XP_004155633.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=397

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            D+PS +V+WDG+HLTEAAY  IA GLL GPYT P     CI+
Sbjct  344  DDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSCII  385



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKG-SRG  143
            + PSS+V+WDG+HLTEAAY  IA+GLL GPY  P + E C   G S+G
Sbjct  334  NNPSSYVSWDGVHLTEAAYRLIAKGLLQGPYAIPRMNELCSFDGLSKG  381



>gb|KGN49290.1| hypothetical protein Csa_6G519430 [Cucumis sativus]
Length=326

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            D+PS +V+WDG+HLTEAAY  IA GLL GPYT P     CI+
Sbjct  273  DDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSCII  314



>gb|EMT08653.1| GDSL esterase/lipase [Aegilops tauschii]
Length=416

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEAAY AIA  +LHGPYTSP +
Sbjct  381  DPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  415



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKG-SRG  143
            + PSS V+WDG+HLTEAAY  IA+GLL GPYT P + E C   G S+G
Sbjct  333  NNPSSHVSWDGVHLTEAAYRWIAKGLLQGPYTIPKINELCSFDGLSKG  380



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSD  161
            D+PS +VNWDG+H+TEAAY  IA+GLL GPY  P     C+    +    SSD
Sbjct  333  DDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCLSSELKKNNGSSD  385



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D+PSSF +WDG+H TEAAY  IAQGL  GPYT+P V
Sbjct  339  DDPSSFASWDGLHFTEAAYRLIAQGLFDGPYTTPRV  374



>ref|NP_001050176.1| Os03g0365900 [Oryza sativa Japonica Group]
 gb|ABF96125.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12090.1| Os03g0365900 [Oryza sativa Japonica Group]
 dbj|BAG91407.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            EPS +++WDG+HLTEAAY  IA+G+LHGPYT P +   C
Sbjct  166  EPSRYISWDGLHLTEAAYHYIARGVLHGPYTEPAIPTRC  204



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D PSS+V+WDG+HLTEAAY+ IA+GLL GPYT P +
Sbjct  333  DTPSSYVSWDGVHLTEAAYKLIAKGLLQGPYTIPQM  368



>ref|XP_003565548.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=373

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            ++PS++ NWDG+HLTEAAY AIA  +LHGPYTSP +
Sbjct  337  EDPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  372



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKG  134
            D PSS+V+WDG+HLTEAAY+ IA+GLL GPYT P +      KG
Sbjct  336  DTPSSYVSWDGVHLTEAAYKLIAEGLLQGPYTIPQMNNGLCNKG  379



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDH  164
            +PS +VNWDG+HLTEAAY  I++GLL GPY  PH+   CI    +  ++   H
Sbjct  335  DPSKYVNWDGVHLTEAAYRWISEGLLKGPYAIPHLDMSCISSKVKNNESLDTH  387



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRG  143
            D+PS  + WDG+HLTEAAY  IAQGL+ GPY  P     C++  S G
Sbjct  328  DDPSKHIGWDGVHLTEAAYRIIAQGLIKGPYCLPRFNTLCLINTSYG  374



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEAAY AIA  +LHGPYTSP +
Sbjct  347  DPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  381



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSD  161
            D+PS +VNWDG+H+TEAAY  IA+GLL GPY  P     C+    +    SSD
Sbjct  333  DDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCLSSELKKNNGSSD  385



>ref|XP_008439763.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=398

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            D+PS +V+WDG+HLTEAAY  IA  +L GPYT P     CI+
Sbjct  345  DDPSKYVSWDGVHLTEAAYRLIANAILQGPYTHPKFTTSCIM  386



>ref|XP_003593740.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63991.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=387

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRG  143
            D+PS ++ WDG+H TEAAY  IA GL+ GPY+ P +   C +  S G
Sbjct  333  DDPSQYITWDGVHFTEAAYRLIANGLIKGPYSVPQLSNLCFMNVSYG  379



>gb|KHN08455.1| GDSL esterase/lipase [Glycine soja]
Length=182

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRG  143
            D+PS  + WD +HLTEAAY  IA+GL+ GPY  P +   C++  S G
Sbjct  132  DDPSKHIGWDNVHLTEAAYRIIAEGLMKGPYCLPQINTSCLMNVSSG  178



>gb|EAY90132.1| hypothetical protein OsI_11698 [Oryza sativa Indica Group]
Length=391

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            EPS +++WDG+HLTEAAY  IA+G+LHGPYT P +   C
Sbjct  351  EPSRYISWDGLHLTEAAYHYIARGVLHGPYTEPAIPTRC  389



>gb|EAZ27028.1| hypothetical protein OsJ_10957 [Oryza sativa Japonica Group]
Length=392

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            EPS +++WDG+HLTEAAY  IA+G+LHGPYT P +   C
Sbjct  352  EPSRYISWDGLHLTEAAYHYIARGVLHGPYTEPAIPTRC  390



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            ++PSS+V+WDGIHLTEAAY  IA+GL+ GPY  P +   C
Sbjct  337  EDPSSYVSWDGIHLTEAAYRLIAEGLIRGPYAVPSIKHSC  376



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            ++PS++V WDG+HLTEAAY  IAQGLL GP+T+P + + C
Sbjct  333  NDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  372



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            ++PS++V WDG+HLTEAAY  IAQGLL GP+T+P + + C
Sbjct  317  NDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  356



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            +PS +VNWDG+H+TEAAY+ IA GLL GPYT P  +  C+
Sbjct  332  DPSKYVNWDGVHMTEAAYKWIADGLLKGPYTIPSFHWLCL  371



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             +PSS+VNWDGIHLTEAAY  IA+GL+HG +T P
Sbjct  333  KDPSSYVNWDGIHLTEAAYRYIAKGLIHGQFTKP  366



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            D+PS +V WDG+HLTEAAY  IA+G+L GPY  P    FC+
Sbjct  747  DDPSKYVAWDGVHLTEAAYRLIAEGILKGPYAVPPFDWFCL  787


 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS FVNWDGIH+TEAAY  I++GLL+GPY  P
Sbjct  338  DPSEFVNWDGIHMTEAAYRWISEGLLNGPYAIP  370



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            ++PS++V WDG+HLTEAAY  IAQGLL GP+T+P + + C
Sbjct  345  NDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  384



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++PS +V WDGIH+TEAAY+ IA GLL GPYTSP     C+
Sbjct  337  NDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCL  377



>ref|XP_008383648.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Malus domestica]
 ref|XP_008349210.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Malus domestica]
Length=367

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             +PSS+VNWDGIHLTEAAY  IA+GL+HG +T P
Sbjct  333  KDPSSYVNWDGIHLTEAAYRYIAEGLIHGQFTKP  366



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 6/57 (11%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRM  173
            D+PS +VNWDG+H TEAAY+ IA GLL GPYT+P +   C       A  SS H R+
Sbjct  733  DDPSLYVNWDGMHFTEAAYKWIALGLLKGPYTTPPLSTVC------PALISSSHGRL  783



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHL  167
            D+PS +V WDG+HLTEAAY+ IA GLL GP+++P +   C L     A TSS  L
Sbjct  342  DDPSLYVCWDGLHLTEAAYQLIAGGLLQGPFSTPPMNTICAL-----ASTSSGLL  391



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            ++PS +V+WDG+HLTEAAY+ IAQGLL GP T+P + + C
Sbjct  333  NDPSRYVSWDGMHLTEAAYKTIAQGLLEGPDTTPPITQAC  372



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            PS +++WDGIHLTEAAY  +A+GLL GPYT+P +   C
Sbjct  345  PSLYISWDGIHLTEAAYRFMAKGLLEGPYTTPRINPLC  382



>ref|XP_002457137.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
 gb|EES02257.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
Length=379

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEAAY AIA  +L+GPYTSP +
Sbjct  344  DPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  378



>ref|XP_004234095.1| PREDICTED: GDSL esterase/lipase At5g45910 [Solanum lycopersicum]
Length=368

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + SSF NWDGIHLTEAAY  IA+GLL+GP+TSP +
Sbjct  326  DASSFTNWDGIHLTEAAYHHIAKGLLNGPFTSPSL  360



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 4/61 (7%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI----LKGSRGAQTSSDHLRM  173
            +PS +V WDG+HLTEAAY  IA+G+L GPYT P     C+    +K + G+  + + LR 
Sbjct  766  DPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCLSSRKIKNNGGSSDTGNSLRS  825

Query  174  N  176
            N
Sbjct  826  N  826


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +V WDG+H+TEAAY  I+ G+L GPY  P
Sbjct  338  DPSKYVAWDGVHMTEAAYRLISDGILKGPYAVP  370



>ref|XP_004968625.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=374

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEAAY AIA  +L+GPYTSP +
Sbjct  339  DPSAYANWDGVHLTEAAYHAIANSILNGPYTSPRL  373



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRG  143
            D+PS  + WD +HLTEAAY  +A+GL+ GPY  P +   C++  S G
Sbjct  336  DDPSKHIGWDSVHLTEAAYRIVAEGLIKGPYCLPQINTLCLMNVSSG  382



>gb|AFW80395.1| esterase [Zea mays]
Length=367

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEAAY AIA  +L+GPYTSP +
Sbjct  332  DPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  366



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +P+ FV WDG HLTEAAYE I++GLL GPY +P + + C
Sbjct  351  DPAKFVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  389



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKG  134
              PS +VNWDG HLTEA Y  +AQGLL+GPYTSP     C+  G
Sbjct  324  QNPSVYVNWDGYHLTEATYRKMAQGLLNGPYTSPAFDWSCLGSG  367



>ref|NP_001149156.1| esterase precursor [Zea mays]
 gb|ACG34406.1| esterase precursor [Zea mays]
Length=370

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEAAY AIA  +L+GPYTSP +
Sbjct  335  DPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  369



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++PS +V WDGIH+TEAAY+ IA GLL GPYTSP     C+
Sbjct  323  NDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCL  363



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +VNWDGIH+TEAAY+ IA+GLL GPY +P
Sbjct  334  NDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATP  367



>ref|XP_008812188.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=377

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +++WDG+HLTEAAY  IA+GLL GPYT+P +   C
Sbjct  313  DPSKYISWDGVHLTEAAYGNIARGLLEGPYTAPPMIRAC  351



>ref|XP_010911731.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Elaeis guineensis]
Length=226

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+HLTEAAY  IA GLL G YT+P + + C
Sbjct  162  DPSKYVSWDGLHLTEAAYREIALGLLQGSYTTPSMNQVC  200



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +VNWDGIH+TEAAY+ IA+GLL GPY +P
Sbjct  337  NDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATP  370



>dbj|BAK06902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            +PS +V+WDG+H+TEA Y+ +A+G+LHGP+  P +   C L
Sbjct  353  DPSRYVSWDGLHMTEAVYKIMARGMLHGPFAKPSIMSTCKL  393



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRMNI  179
            ++PS +V WDGIH+TEAAY+ IA G+L GPY  P     C+   +      +D+  +NI
Sbjct  346  NDPSKYVGWDGIHMTEAAYKLIADGILQGPYAIPPFNWSCLNSETNKKSLDTDYSLINI  404



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILK  131
            ++PS ++ WDGIHLTEAAY+ IA GL++GPY  P     C + 
Sbjct  338  EDPSQYIGWDGIHLTEAAYKLIADGLINGPYCVPQFSNLCFMN  380



>gb|KFK44739.1| hypothetical protein AALP_AA1G296700 [Arabis alpina]
Length=100

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            PS +VNWDG HLTEAAY  +AQG+L+GPY +P
Sbjct  48   PSEYVNWDGYHLTEAAYWKMAQGILNGPYATP  79



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            D+PS +VNWDG+H+TE AY  IA+GLL GPY+ P
Sbjct  340  DDPSKYVNWDGVHMTETAYRLIAEGLLKGPYSIP  373


 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++P+ +VNWDG+HLTE+AY  IA+GLL GPY  P
Sbjct  699  NDPTKYVNWDGVHLTESAYRLIAEGLLKGPYAIP  732



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEA Y AIA  +L+GPYTSP +
Sbjct  343  DPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  377



>ref|XP_006643908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=377

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEA Y AIA  +L+GPYTSP +
Sbjct  342  DPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  376



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEA Y AIA  +L+GPYTSP +
Sbjct  339  DPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>ref|XP_010540491.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X3 [Tarenaya 
hassleriana]
Length=321

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSD  161
            D PS +VNWDG HLTE AY  IA+GLL GPY  P    +C     + +    D
Sbjct  264  DNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCFDSKLQNSSPDKD  316



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS++ NWDG+HLTEA Y AIA  +L+GPYTSP +
Sbjct  339  DPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++PS +V WDGIH+TEAAY+ +A G+L GPYTSP     C+
Sbjct  337  NDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSPPFNWTCL  377



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            PSS+VNWDG HLTEAAY  IA GLL GPYT+P
Sbjct  331  PSSYVNWDGFHLTEAAYHFIATGLLEGPYTTP  362



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            D PS +VNWDG HLTE AY  IA+GLL GPY  P    +C
Sbjct  309  DNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYC  348



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +V WDGIH+TEAAY+++A GLL GPY +P
Sbjct  337  NDPSKYVAWDGIHMTEAAYKSMADGLLKGPYATP  370



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V WDG HLTEAAYE I++GLL GPY +P + + C
Sbjct  354  DPSKYVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  392



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            D PS +VNWDG HLTE AY  IA+GLL GPY  P    +C
Sbjct  336  DNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYC  375



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +VNWDG+H+TEAAY  IA+GLL GPY  P
Sbjct  340  DPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIP  372



>ref|XP_010915610.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=405

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++V WDGIHLTEAAY  IA GLL+GP+  P
Sbjct  329  DPSTYVGWDGIHLTEAAYRFIAMGLLNGPFADP  361



>ref|XP_010915609.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=366

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             +PS++V+WDGIH TEAA+ +IA GLLHGPYT P +
Sbjct  325  KDPSTYVSWDGIHSTEAAHRSIAMGLLHGPYTDPPI  360



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRG  143
            D+PS  + WDG+HLTEAAY  IA+GL+ GPY+ P     C    S G
Sbjct  326  DDPSKHIGWDGVHLTEAAYRFIAKGLIKGPYSLPQFSTLCFRNVSFG  372



>ref|XP_008358656.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Malus domestica]
Length=208

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            + P+ F++WDG+H TEAAY  IA+GLL+G YT P +   C+
Sbjct  165  ENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQISTLCV  205



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +VNWDGIH+TEAAY  I++GLL+GPY  P
Sbjct  337  NDPSKYVNWDGIHMTEAAYRWISEGLLNGPYAIP  370


 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +V WDG+HLTEAAY  +A+G+L+GPY  P
Sbjct  744  NDPSKYVAWDGVHLTEAAYRLMAEGILNGPYAVP  777



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++PS +V WDGIH+TEAAY+ +A GLL GPY SP     C+
Sbjct  337  NDPSKYVAWDGIHMTEAAYKLMADGLLKGPYASPPFNWTCL  377



>ref|XP_009784633.1| PREDICTED: GDSL esterase/lipase At5g45910 [Nicotiana sylvestris]
Length=366

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            + S F NWDGIHLTEAAY  IA+GLL+GP+TSP
Sbjct  324  DSSKFANWDGIHLTEAAYHHIAKGLLNGPFTSP  356



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 4/57 (7%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC----ILKGSRGAQTSSDH  164
            +PS +V WDG+H+TEAAY+ IA G+L+GPY +P     C    I K S   QT+  H
Sbjct  332  DPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCLRSEIKKESLYNQTTCQH  388


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            D+PS +VN+DGIH+TEAAY  I++GLL GPY  P     C+
Sbjct  757  DDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCL  797



>ref|XP_008777733.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Phoenix dactylifera]
Length=375

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +++WDG+HLTEAAY  IA+GLL GPY +P +   C
Sbjct  335  DPSKYISWDGVHLTEAAYGNIARGLLEGPYATPPIARAC  373



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+H+TEA Y +IA GLLHGP+ +P +   C
Sbjct  356  DPSRYVHWDGLHMTEATYRSIASGLLHGPFAAPAIGSTC  394



>ref|XP_009390675.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D+ S+ VNWDGIH+TEAA+ AIA G LHGPY  P +
Sbjct  378  DDVSTHVNWDGIHMTEAAHRAIADGWLHGPYVDPPI  413



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++PS +VNWDGIH+TEAAY  I++GLL GPY  P     C+
Sbjct  756  NDPSKYVNWDGIHMTEAAYRWISEGLLKGPYAIPTFNWSCL  796


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            +PS +V WDG+H+TE AY+ IA G+L GPY  P     C+
Sbjct  332  DPSKYVGWDGVHMTEGAYKWIADGILKGPYAIPPFGRSCL  371



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            D+PS +V WDG+HLTEAAY  IA+ LL GPY+   +  FC
Sbjct  354  DDPSLYVAWDGLHLTEAAYRFIARRLLQGPYSGLRINRFC  393



>ref|XP_010455497.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +V WDGIH+TEAAY+ +A G+L GPYTSP
Sbjct  324  NDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSP  357



>ref|XP_006367777.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Solanum tuberosum]
Length=368

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + SSF NWDGIHLTEAAY  IA+GLL+GP+ SP +
Sbjct  326  DASSFANWDGIHLTEAAYHHIAKGLLNGPFISPSL  360



>ref|NP_973930.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30995.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=317

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
            D+PS +V+WDG+H+TEAAY  +A+G+L GPY  P     C+    +  Q S
Sbjct  263  DDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAIPPFDWSCLSSEIKNTQNS  313



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            ++PS +V WDGIHLTEAAY  IAQGLL G Y +P + + C
Sbjct  333  NDPSKYVCWDGIHLTEAAYGTIAQGLLEGSYATPPITQAC  372



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +VNWDG+HLTEAAY  +A GLL+GPY  P
Sbjct  334  NDPSKYVNWDGVHLTEAAYRWLADGLLNGPYAIP  367


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  6     EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             +PS +V+WDG HLTE+ Y  IA GLL GPYT P
Sbjct  1315  DPSKYVHWDGSHLTESTYRWIAMGLLEGPYTIP  1347



>gb|AAL86351.1| putative lipase [Arabidopsis thaliana]
Length=243

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            D+PS +VN+DGIH+TEAAY  I++GLL GPY  P
Sbjct  177  DDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIP  210



>ref|XP_010460977.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=180

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++PS +V WDGIH+TEAAY+ +A GLL GPY +P     C+
Sbjct  122  NDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATPPFNWSCL  162



>ref|XP_004965533.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=400

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PSS+V+WDGIH+TEAAY+ +A G L+GPY  P +
Sbjct  364  PSSYVSWDGIHMTEAAYKKVADGWLNGPYAEPPI  397



>ref|XP_002438501.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
 gb|EER89868.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
Length=399

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PSS+V+WDGIH+TEAAY+ +A G L+GPY  P +
Sbjct  363  PSSYVSWDGIHMTEAAYKKVADGWLNGPYAEPPI  396



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRM  173
            +PSS+ +WDG+HLTEAAY  IA GLL GP   P + + C     + +  S+D L++
Sbjct  317  DPSSYASWDGLHLTEAAYRTIANGLLKGPLAVPSLNQTC--PNVQQSSASTDTLKL  370



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            D+PS +VN+DGIH+TEAAY  I++GLL GPY  P     C+
Sbjct  337  DDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCL  377



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +VNWDGIH+TEAAY+ I++G+L GPY  P
Sbjct  336  DPSKYVNWDGIHMTEAAYKCISEGILKGPYAIP  368



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
            D+PS +V+WDG+H+TEAAY  +A+G+L GPY  P     C+    +  Q S
Sbjct  335  DDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAIPPFDWSCLSSEIKNTQNS  385



>ref|NP_849723.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31010.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGS  137
             PS +VNWDG HLTEAAY+ +A+G+L+GPY +P     C+  G+
Sbjct  336  NPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCLGSGT  379



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGS  137
             PS +VNWDG HLTEAAY+ +A+G+L+GPY +P     C+  G+
Sbjct  337  NPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCLGSGT  380



>ref|NP_001172232.1| Os01g0215500 [Oryza sativa Japonica Group]
 dbj|BAH90962.1| Os01g0215500 [Oryza sativa Japonica Group]
Length=94

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++VNWDG+HLTEAAY  +A G L GPY +P
Sbjct  50   DPSAYVNWDGVHLTEAAYHHVADGWLRGPYANP  82



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG HLTEAAY AIA GLL G YT+P +   C
Sbjct  346  DPSKYVSWDGSHLTEAAYRAIALGLLQGSYTTPSMSRAC  384



>gb|EYU28066.1| hypothetical protein MIMGU_mgv1a009376mg [Erythranthe guttata]
Length=344

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
             +PSS+V+WDG+HLTEAAY +IA  LL G +T P +   C
Sbjct  289  KDPSSYVSWDGVHLTEAAYRSIATSLLRGSFTVPQLQSVC  328



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILK  131
            D+PS  + WD +H TEAAY  IA+GL+ GPY  P    FC++ 
Sbjct  341  DDPSKHIGWDSVHFTEAAYRIIAEGLIKGPYCLPQFNTFCLMN  383



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PSS ++WDGIHLTEAAYE IA+ LL GP+  P +   C
Sbjct  330  DPSSSISWDGIHLTEAAYETIARSLLEGPHAKPPITRAC  368



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +P+++ NWDGIHLTEAAY  IA+GL+ GP+T+P
Sbjct  333  DPTTYANWDGIHLTEAAYRHIAKGLIEGPFTNP  365



>gb|ACF85857.1| unknown [Zea mays]
 gb|AFW86784.1| esterase [Zea mays]
Length=397

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PSS+V+WDGIH+TEAAY  +A G L+GPY  P +
Sbjct  361  PSSYVSWDGIHMTEAAYRKVANGWLNGPYAQPPI  394



>ref|XP_003593744.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63995.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=360

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS++ NWDGIHLTEAAY  IA+GL++GP++ P
Sbjct  317  EDPSTYTNWDGIHLTEAAYRHIAKGLINGPFSIP  350



>ref|XP_008783908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=413

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++V+WD IHLTEAAY ++A GLL GPY  P
Sbjct  328  DPSTYVSWDSIHLTEAAYHSMAMGLLQGPYADP  360



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            D+P  +V+WDG+HLTEAAY  IA+GLL GP+++P +   C
Sbjct  345  DDPPLYVSWDGLHLTEAAYRWIARGLLEGPFSTPPINTVC  384



>ref|NP_001150078.1| esterase [Zea mays]
 gb|ACG37721.1| esterase precursor [Zea mays]
Length=397

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PSS+V+WDGIH+TEAAY  +A G L+GPY  P +
Sbjct  361  PSSYVSWDGIHMTEAAYRKVADGWLNGPYAQPPI  394



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 5/56 (9%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL-----KGSRGAQTS  155
            ++PS +V WDGIH+TEAAY+++A GLL GPY +P     C+      K S   QTS
Sbjct  337  NDPSKYVAWDGIHMTEAAYKSMADGLLKGPYATPPFSWSCLSSKIKNKNSLDKQTS  392



>ref|XP_010915611.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010915612.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Elaeis 
guineensis]
Length=346

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++V WDGIHLTEAAY  IA GLL+GP+  P
Sbjct  270  DPSTYVGWDGIHLTEAAYRFIAMGLLNGPFADP  302



>gb|AAF24544.2|AC007508_7 F1K23.13 [Arabidopsis thaliana]
Length=1411

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSR  140
             PS +VNWDG HLTEAAY+ +A+G+L+GPY +P     C+   SR
Sbjct  635  NPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCLGSESR  679


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             PS +VNWDG HLTEAAY+ + +G+L+GPY +P
Sbjct  338  NPSEYVNWDGYHLTEAAYQKMTEGILNGPYATP  370



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            D+PS +V+WDG+HLTEAAY+ IA GLL  PYT P +   CI
Sbjct  322  DDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             PS +VNWDG HLTEAAY  IA GLL+GPY +P
Sbjct  338  NPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATP  370



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             PS +VNWDG HLTEAAY  IA GLL+GPY +P
Sbjct  338  NPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATP  370



>ref|XP_004296391.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Fragaria vesca 
subsp. vesca]
Length=366

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             +PSS+ NWDGIHLT+AAY  IA+GL+HG +T P
Sbjct  332  KDPSSYANWDGIHLTQAAYSHIAKGLIHGKFTIP  365



>ref|NP_973931.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30997.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=309

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
            D+PS +V WDG+H+TEAAY  +A+G+L+GPY  P     C   G + + +S
Sbjct  257  DDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSCRSSGVKNSGSS  307



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + PS+  NWDGIHLTEAAY  +A GL+HGP+ +P +
Sbjct  326  ENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + PS+  NWDGIHLTEAAY  +A GL+HGP+ +P +
Sbjct  326  ENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSD  161
            ++P+ ++NWDG HLTEAAY+ + + LL GP+T+P +  FC    S  AQ S +
Sbjct  337  EDPNQYINWDGYHLTEAAYKWMTKSLLEGPFTNPPINSFCPFDISE-AQVSKN  388



>ref|XP_009409412.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=360

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEF  119
            +P++ V+WDGIH+TEAA+  IAQG LHGPY +P +  F
Sbjct  319  DPTTHVSWDGIHMTEAAHRIIAQGWLHGPYVNPPILSF  356



>gb|KHN08453.1| GDSL esterase/lipase [Glycine soja]
Length=296

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++ NWDGIHLTEAAY  IA+GL++GP++ P
Sbjct  254  DPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYP  286



>ref|XP_003593742.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63993.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=374

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++ NWDGIHLTEAAY  IA+GL++GP++ P
Sbjct  332  DPSTYTNWDGIHLTEAAYRHIAKGLINGPFSIP  364



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++ NWDGIHLTEAAY  IA+GL++GP++ P
Sbjct  333  DPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYP  365



>ref|NP_001057786.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAD54230.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19700.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAG87915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PSS+V+WDGIH+TEAAY  +A G L+GPY  P +
Sbjct  360  PSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPI  393



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            D+PS +V+WDG+HLTEAAY+ IA GLL  PYT P +   CI
Sbjct  322  DDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
            D+PS +V WDG+H+TEAAY  +A+G+L+GPY  P     C   G + + +S
Sbjct  338  DDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSCRSSGVKNSGSS  388



>gb|EMT00808.1| GDSL esterase/lipase [Aegilops tauschii]
Length=395

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+HLTEAAY+ +A G+L GP+  P +   C
Sbjct  353  DPSRYVSWDGVHLTEAAYKIMAHGMLDGPFAMPPIMSTC  391



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++ NWDGIHLTEAAY  IA+GL++GP++ P
Sbjct  332  DPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYP  364



>ref|XP_006658887.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=385

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS ++NWDG+H+TEAAY  +A+G+L GP+  P +   C
Sbjct  345  DPSRYINWDGLHMTEAAYRIMARGILDGPFADPPIMSRC  383



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            +PS +++WDG H TEAAY  I + LL GPYT+PH+   C L
Sbjct  341  QPSLYISWDGAHCTEAAYRFITKSLLEGPYTAPHINSSCSL  381



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            D+PS +V+WDG HLTEAAY  + +GLL GPYT P     C +
Sbjct  342  DDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCFI  383



>dbj|BAK07773.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS+FVNWDGIH TEA Y  IA+G LHGP+  P +
Sbjct  306  DPSAFVNWDGIHYTEATYRFIAEGWLHGPFADPPI  340



>emb|CDY48195.1| BnaA04g15590D [Brassica napus]
Length=400

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            + PS++ NWDGIHLTEAAY  IA GL+ G +T P
Sbjct  356  ENPSTYANWDGIHLTEAAYRHIATGLISGRFTKP  389



>dbj|BAJ93038.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=158

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  122  DPHNYLIWDGIHLTEAAYRSIANGWLKGPYCSPRI  156



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             +PSS+ NWDGIHLTEAAY  IA+GL+HG + +P
Sbjct  328  KDPSSYANWDGIHLTEAAYGHIAKGLIHGRFATP  361



>gb|EMT19408.1| GDSL esterase/lipase [Aegilops tauschii]
Length=326

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
              PS++V+WDGIH+TEAAY  +A G L+GPY SP + +
Sbjct  289  SNPSAYVSWDGIHMTEAAYRMVANGWLNGPYASPPIMK  326



>ref|XP_002893540.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1392

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6     EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
              PS +VNWDG HLTEA Y+ +AQ LL+GPYT+P
Sbjct  990   NPSEYVNWDGYHLTEATYQKMAQDLLNGPYTTP  1022


 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGS  137
             PS +VNWDG HLTEAAY+ +A+G+L+GPY  P     C+  GS
Sbjct  338  NPSEYVNWDGYHLTEAAYKKMAEGILNGPYAIPSFDWSCLGSGS  381


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  6     EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
              PS +VNWDG HLTEA ++ +AQ LL+GPY +P     C   GS   + S
Sbjct  1340  NPSEYVNWDGYHLTEATHQKMAQVLLNGPYATPAFDWSCFSFGSVDKEYS  1389



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             PS +VNWDG HLTEA Y+ +AQGLL+G YT+P
Sbjct  339  NPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTP  371



>emb|CDX77066.1| BnaC04g38610D [Brassica napus]
Length=402

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            + PS++ NWDGIHLTEAAY  IA GL+ G +T P
Sbjct  358  ENPSTYANWDGIHLTEAAYRHIATGLISGRFTKP  391



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             PS +VNWDG HLTEAAY  IA GLL+GPY +P
Sbjct  338  NPSEYVNWDGYHLTEAAYHKIAHGLLNGPYATP  370



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
             +PS +V WDG+H+TEAAY+ IA G+L+GPY +P     C+
Sbjct  331  KDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371



>gb|KDP21068.1| hypothetical protein JCGZ_21539 [Jatropha curcas]
Length=367

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEF  119
             PS++ NWDGIHLTEAAY  IA GL++G +++P + +F
Sbjct  328  NPSTYANWDGIHLTEAAYRIIAMGLINGSFSTPPLTKF  365



>gb|AFW80393.1| hypothetical protein ZEAMMB73_871175 [Zea mays]
Length=350

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             PS++VNWDG+HLTEAAY  +A G L GPY +P V
Sbjct  312  NPSAYVNWDGVHLTEAAYHRVADGWLRGPYANPPV  346



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             PS +VNWDG HLTEA Y+ +AQGLL+G YT+P
Sbjct  307  NPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTP  339



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            + PS F+NWDG+H TEAAY  + + LL G YT P +   C+
Sbjct  337  ENPSQFINWDGMHCTEAAYRLMTKALLQGNYTFPRLASLCV  377



>gb|KDO77812.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=286

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + PS+  NWDGIHLTE+AY  +A GL+HGP+ +P +
Sbjct  250  ENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  285



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
             +PS +V WDG+H+TEAAY+ IA G+L+GPY +P     C+
Sbjct  331  KDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371



>ref|NP_001043728.2| Os01g0651000 [Oryza sativa Japonica Group]
 dbj|BAF05642.2| Os01g0651000, partial [Oryza sativa Japonica Group]
Length=172

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +P SF NWDG+H+TE AY  IA G+L+GP+  P +   C
Sbjct  134  DPGSFANWDGVHMTEKAYHVIADGVLNGPFADPPLLHSC  172



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            +PS  V WDG+HLT+AAYE IA+GLL G Y S  + + C+L
Sbjct  344  DPSKHVCWDGMHLTDAAYEIIARGLLQGSYASAPITQACLL  384



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +V WDGIH+TEAAY+ +A GLL GPY +P
Sbjct  329  NDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATP  362



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            D+PS ++ WDG+HLTEAAY  IA G+++GP + P     C
Sbjct  347  DDPSQYIGWDGVHLTEAAYRLIADGIINGPCSVPQFSNLC  386



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGS  137
             PS +VNWDG HLTEAAY+ + +G+L+GPY +P     C+  G+
Sbjct  338  NPSEYVNWDGYHLTEAAYQKMTEGILNGPYATPAFDWSCLGSGT  381



>ref|XP_008655774.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Zea mays]
 gb|AFW80394.1| hypothetical protein ZEAMMB73_230114 [Zea mays]
Length=376

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
             PS++VNWDG+HLTEAAY  +A G L GPY +P + +
Sbjct  338  NPSAYVNWDGVHLTEAAYHRVADGWLRGPYANPPILD  374



>gb|EMT13774.1| GDSL esterase/lipase [Aegilops tauschii]
Length=105

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEF  119
            +PS++V+WDGIH+T+AAY+A+++ + HG Y  P +  F
Sbjct  61   DPSAYVSWDGIHMTQAAYKAMSRLIYHGRYLQPQILSF  98



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +V WDG+HLTEAAY  IA+G+L GPYT P
Sbjct  313  DPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIP  345



>gb|EMT01787.1| GDSL esterase/lipase [Aegilops tauschii]
Length=369

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
              PS+FVNWDGIH TEA Y  IA+G LHGP+  P +
Sbjct  328  KNPSAFVNWDGIHYTEATYRFIAEGWLHGPFADPPI  363



>ref|XP_006656143.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=403

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PSS+V+WDGIH+TEAAY  +A G L+GPY  P +
Sbjct  368  PSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPI  401



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + PS+  NWDGIHLTE+AY  +A GL+HGP+ +P +
Sbjct  326  ENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  361



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            D+PS +V+WDG HLTEAAY  + +GLL GPYT P     C +
Sbjct  651  DDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCFI  692



>gb|KGN49292.1| hypothetical protein Csa_6G519450 [Cucumis sativus]
Length=349

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 5/57 (9%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRM  173
            D+PS +V+WDGIHLTEAAYE +A  +++G +T P     C+ +      TSS  L++
Sbjct  297  DDPSKYVSWDGIHLTEAAYELMATSIVNGSFTFPQFSLSCLQRN-----TSSQLLQL  348



>ref|XP_004491864.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=373

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS  ++WDG HLTEAAY+ IA+GL+ GP+T+P +
Sbjct  331  DPSKLIDWDGAHLTEAAYKLIAKGLVEGPFTNPSL  365



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILK  131
            D+P+SFVNWDGIH TEA Y+ I + ++ G Y+ P    FC L 
Sbjct  334  DDPTSFVNWDGIHYTEATYKLIFESIIEGSYSYPSFKAFCYLN  376



>ref|NP_001172484.1| Os01g0651400 [Oryza sativa Japonica Group]
 dbj|BAH91214.1| Os01g0651400, partial [Oryza sativa Japonica Group]
Length=81

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS++V+WDG H TEA Y+ IA G+LHGP+ SP
Sbjct  38   EDPSTYVSWDGTHPTEAVYKLIADGVLHGPHASP  71



>ref|XP_003568743.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=367

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  331  DPQNYLIWDGIHLTEAAYRSIANGWLKGPYCSPRI  365



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            + PS +VNWDG+H TEAA + IAQGL  G YT PH+   C
Sbjct  354  ENPSLYVNWDGLHCTEAANKWIAQGLWEGSYTHPHIKTIC  393



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PSS+V WDG+H+TEAAY  IA GLL GP   P +   C
Sbjct  376  DPSSYVTWDGMHMTEAAYRKIATGLLEGPNAVPPILNTC  414



>ref|XP_004134931.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=380

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRMN  176
            D+PS +V+WDGIHLTEAAYE +A  +++G +T P     C+ +      TSS  L++ 
Sbjct  328  DDPSKYVSWDGIHLTEAAYELMATSIVNGSFTFPQFSLSCLQRN-----TSSQLLQLQ  380



>ref|XP_009397450.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397451.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
             +PS +V+WDGIHLTEAAY  IA G L GPY +P + +
Sbjct  319  SDPSMYVSWDGIHLTEAAYRLIANGWLKGPYANPPILQ  356



>ref|XP_004155631.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g28570-like 
[Cucumis sativus]
Length=380

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRMN  176
            D+PS +V+WDGIHLTEAAYE +A  +++G +T P     C+ +      TSS  L++ 
Sbjct  328  DDPSKYVSWDGIHLTEAAYELMATSIVNGSFTFPQFSLSCLQRN-----TSSQLLQLQ  380



>ref|XP_010068245.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             +PS+ + WDG+HLTEAAY  +A+GLL GP+TSP +
Sbjct  330  KDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>gb|AFW80390.1| esterase [Zea mays]
Length=376

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             PS++VNWDG+HLTEAAY  +A G L GPY +P +
Sbjct  338  NPSAYVNWDGVHLTEAAYHRVADGWLRGPYANPPI  372



>ref|XP_008655643.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Zea mays]
 gb|AFW80068.1| hypothetical protein ZEAMMB73_825219 [Zea mays]
Length=376

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             PS++VNWDG+HLTEAAY  +A G L GPY +P +
Sbjct  338  NPSAYVNWDGVHLTEAAYHRVADGWLRGPYANPPI  372



>ref|XP_004959853.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=383

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+H TEAAY  +A+G+L GP+ +P +   C
Sbjct  343  DPSRYVSWDGLHFTEAAYREMARGMLDGPFATPAIMSGC  381



>ref|XP_003638491.1| GDSL esterase/lipase [Medicago truncatula]
 gb|KEH37652.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=361

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS ++NWDG HLTEAAY  IA+GL+ GP+ +P
Sbjct  319  DPSKYINWDGPHLTEAAYRQIAKGLVEGPFANP  351



>ref|XP_010068248.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             +PS+ + WDG+HLTEAAY  +A+GLL GP+TSP +
Sbjct  330  KDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>ref|XP_003566944.2| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=359

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +P++F +WDG+H+TE AY  IA G+LHGP+ +P +   C
Sbjct  321  DPANFASWDGMHMTEKAYNGIADGVLHGPFANPPLLNSC  359



>gb|KCW63207.1| hypothetical protein EUGRSUZ_G00824, partial [Eucalyptus grandis]
Length=349

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS+ + WDG+HLTEAAY  +A+GLL GP+TSP +
Sbjct  313  DPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  347



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLR  170
             PS +VNWDG HLTEA ++ +A GLL GPY +P     C+   S   ++S   L+
Sbjct  338  NPSEYVNWDGYHLTEATHQKMAHGLLKGPYATPAFDWSCLGSASVDTESSFTKLK  392



>gb|KHN18921.1| GDSL esterase/lipase [Glycine soja]
Length=229

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCIL  128
            D+ S +V+WDG HLTEAAY  + +GLL GPYT P     C +
Sbjct  175  DDASQYVSWDGYHLTEAAYRLMTKGLLDGPYTIPKFNVSCFI  216



>ref|XP_009608032.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Nicotiana 
tomentosiformis]
Length=340

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            + S F NWDGIHLTEAAY  IA+GLL+G +TSP
Sbjct  298  DSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSP  330



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            + PS F+NWDG+H TEAAY  + + LL G YT P +   C+
Sbjct  350  ENPSQFINWDGMHSTEAAYRLMTKALLQGNYTFPRLASLCV  390



>gb|EEC70166.1| hypothetical protein OsI_00887 [Oryza sativa Indica Group]
Length=397

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  361  DPENYLVWDGIHLTEAAYRSIADGWLSGPYCSPAI  395



>gb|EMT01150.1| GDSL esterase/lipase [Aegilops tauschii]
Length=343

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
             P++  NWDGIH+TE AY  IA G+LHGPY +P +   C
Sbjct  305  SPANCANWDGIHMTEKAYNVIADGVLHGPYANPPLLHSC  343



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS FV WDG HLT+AA E +A+GLL GPY  P + + C
Sbjct  349  DPSMFVFWDGTHLTDAASEIVARGLLEGPYADPPIIQTC  387



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             PS+  NWDGIHLTEAAY  +A GL++GP++SP +
Sbjct  334  SPSAHANWDGIHLTEAAYRYVAMGLINGPFSSPSL  368



>ref|XP_009608031.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X1 [Nicotiana 
tomentosiformis]
Length=366

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            + S F NWDGIHLTEAAY  IA+GLL+G +TSP
Sbjct  324  DSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSP  356



>ref|XP_006844515.1| hypothetical protein AMTR_s00016p00147040 [Amborella trichopoda]
 gb|ERN06190.1| hypothetical protein AMTR_s00016p00147040 [Amborella trichopoda]
Length=218

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            D+PS + NWDGIHLTEAAY+ IA  LL G +T P
Sbjct  168  DDPSLYTNWDGIHLTEAAYKVIATALLSGEFTHP  201



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
             PSS ++WDGIHLTEAAY  IA+GLL GPYT P +   C
Sbjct  343  SPSSQISWDGIHLTEAAYRVIARGLL-GPYTIPSLSRSC  380



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSS  158
             PS +VNWDG HLTEA ++ +A GLL+GPY SP     C+  GS    T S
Sbjct  338  NPSEYVNWDGYHLTEATHQKMAHGLLNGPYASPAFDWSCL--GSASVDTKS  386



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSS  158
             PS +VNWDG HLTEA ++ +A GLL+GPY SP     C+  GS    T S
Sbjct  335  NPSEYVNWDGYHLTEATHQKMAHGLLNGPYASPAFDWSCL--GSASVDTKS  383



>ref|XP_009413940.1| PREDICTED: uncharacterized protein LOC103995136 [Musa acuminata 
subsp. malaccensis]
Length=731

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P ++V+WDGIHLTEAAY  IA G L+GPY +P +
Sbjct  695  DPDTYVSWDGIHLTEAAYRLIADGWLNGPYANPPI  729



>gb|KEH34272.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=395

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS ++NWDG HLTEA+Y+ IA+GL+ GP+ +P
Sbjct  353  DPSKYINWDGSHLTEASYKLIAKGLVEGPFANP  385



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
             PS +VNWDG HLTEA ++ IA GLL+GPY +P     CI   S   + S
Sbjct  340  NPSEYVNWDGYHLTEATHQKIAHGLLNGPYATPAFDWSCIGSASVDTEYS  389



>ref|XP_003565496.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=380

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
            +P++ VNWDGIHLTE AYE IA G L GPY  P + +
Sbjct  340  DPAAHVNWDGIHLTEPAYERIADGWLRGPYAHPRILK  376



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSS  158
             PS +VNWDG HLTEA ++ +A GLL+GPY SP     C+  GS    T S
Sbjct  335  NPSEYVNWDGYHLTEATHQKMAHGLLNGPYASPAFDWSCL--GSASVDTKS  383



>gb|KEH34273.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|KEH34274.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|KEH34275.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|KEH34276.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=388

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +PS ++NWDG HLTEA+Y+ IA+GL+ GP+ +P +
Sbjct  346  DPSKYINWDGSHLTEASYKLIAKGLVEGPFANPSL  380



>ref|XP_006853138.1| hypothetical protein AMTR_s00038p00165200 [Amborella trichopoda]
 gb|ERN14605.1| hypothetical protein AMTR_s00038p00165200 [Amborella trichopoda]
Length=744

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            ++PSS V+WDGIHLTEAAY+++ Q LL G  T PH+
Sbjct  700  NDPSSHVSWDGIHLTEAAYKSMVQSLLCGGLTYPHI  735



>gb|KCW76149.1| hypothetical protein EUGRSUZ_D00526, partial [Eucalyptus grandis]
Length=70

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS+FV+WDGIHLTEAAY  +++ L +G +TSP
Sbjct  33   EDPSAFVDWDGIHLTEAAYHFVSKRLFYGGFTSP  66



>ref|NP_001172233.1| Os01g0216900 [Oryza sativa Japonica Group]
 dbj|BAH90963.1| Os01g0216900 [Oryza sativa Japonica Group]
Length=383

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P++F++WDGIHLTEAAY  I+ G LHGPY  P +
Sbjct  343  DPAAFISWDGIHLTEAAYARISAGWLHGPYAHPPI  377



>gb|EEE55084.1| hypothetical protein OsJ_02825 [Oryza sativa Japonica Group]
Length=254

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D+PS + +WDG H +EAAY+ IA GLL GPYT P +
Sbjct  194  DDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  229



>gb|EAZ37226.1| hypothetical protein OsJ_21564 [Oryza sativa Japonica Group]
Length=379

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
             PSS+V+WDGIH+TEAAY  +A G L+GPY  P + +
Sbjct  343  NPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPILK  379



>gb|EAZ01210.1| hypothetical protein OsI_23235 [Oryza sativa Indica Group]
Length=379

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
             PSS+V+WDGIH+TEAAY  +A G L+GPY  P + +
Sbjct  343  NPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPILK  379



>gb|EEE54110.1| hypothetical protein OsJ_00874 [Oryza sativa Japonica Group]
Length=376

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++VNWDG+HLTEAAY  +A G L GPY +P
Sbjct  332  DPSAYVNWDGVHLTEAAYHHVADGWLRGPYANP  364



>dbj|BAD73016.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73029.1| hypothetical protein OsI_00901 [Oryza sativa Indica Group]
 gb|EAZ11038.1| hypothetical protein OsJ_00882 [Oryza sativa Japonica Group]
Length=409

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P++F++WDGIHLTEAAY  I+ G LHGPY  P +
Sbjct  369  DPAAFISWDGIHLTEAAYARISAGWLHGPYAHPPI  403



>gb|EAZ12911.1| hypothetical protein OsJ_02834 [Oryza sativa Japonica Group]
Length=381

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +P SF NWDG+H+TE AY  IA G+L+GP+  P +   C
Sbjct  343  DPGSFANWDGVHMTEKAYHVIADGVLNGPFADPPLLHSC  381



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +VNWDGIH+TEAAY+ I++G+L GPY  P
Sbjct  332  DPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIP  364



>ref|XP_004984286.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=385

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS  ++WDG+HLTEAAY+ +A G+L GPY +P +   C
Sbjct  345  DPSRHISWDGVHLTEAAYQFVAGGVLDGPYAAPPILSKC  383



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +VNWDGIH+TEAAY+ I++G+L GPY  P
Sbjct  336  DPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIP  368



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHG  89
            +PSS+VNWDGIHLTEAAY  IA+GL+HG
Sbjct  393  DPSSYVNWDGIHLTEAAYRYIAKGLIHG  420


 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            + P+ F++WDG+H TEAAY  IA+GLL+  YT P +   C+
Sbjct  788  ENPAQFISWDGLHSTEAAYRWIAKGLLNRNYTVPQISALCV  828


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            + P+ F++WDG+H TEAAY  IA+GLL+G YT P +
Sbjct  323  ENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQI  358



>dbj|BAK05815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
             P++  NWDGIH+TE AY  IA G+LHGPY +P +   C
Sbjct  331  SPANAANWDGIHMTEKAYNIIADGVLHGPYANPPLLHSC  369



>dbj|BAJ97605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  326  DPHNYLIWDGIHLTEAAYRSIANGWLKGPYCSPRI  360



>gb|EEC70171.1| hypothetical protein OsI_00893 [Oryza sativa Indica Group]
Length=377

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS++VNWDG+HLTEAAY  +A G L GPY +P
Sbjct  333  DPSAYVNWDGVHLTEAAYHHVADGWLRGPYANP  365



>dbj|BAB89203.1| lipase-like [Oryza sativa Japonica Group]
 gb|EEC71189.1| hypothetical protein OsI_03081 [Oryza sativa Indica Group]
Length=370

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +P SF NWDG+H+TE AY  IA G+L+GP+  P +   C
Sbjct  332  DPGSFANWDGVHMTEKAYHVIADGVLNGPFADPPLLHSC  370



>ref|XP_003559896.2| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=387

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+H+TEA Y  +A+GLL GP+  P +   C
Sbjct  347  DPSKYVSWDGLHMTEAVYRIMARGLLDGPFAMPPIMSRC  385



>emb|CDX94632.1| BnaC07g10260D [Brassica napus]
Length=382

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTSSDHLRM  173
            +PS +V+WD +H+TEAAY  +A+G+L GPY  P  +E+  L        SSD  R+
Sbjct  327  DPSKYVSWDSVHMTEAAYRCMAEGVLKGPYAIPP-FEWSCLNPETKNSGSSDTKRI  381



>ref|XP_007148063.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
 gb|ESW20057.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
Length=370

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS+  NWDGIHLTEAAY  IA+GL++GP++ P
Sbjct  328  DPSTHANWDGIHLTEAAYRYIAKGLIYGPFSYP  360



>ref|XP_003560500.1| PREDICTED: acetylajmalan esterase-like [Brachypodium distachyon]
Length=380

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSR  140
            EPS++++WDGIH+T+AAY+A+++ + HG Y  P +  F   KG +
Sbjct  336  EPSAYLSWDGIHMTQAAYKAMSRLIYHGRYLQPQILNFPEKKGKK  380



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +V WDG+HLTEAAY  +A+G+L GPY  P
Sbjct  338  NDPSKYVAWDGVHLTEAAYRLMAEGILKGPYAIP  371



>emb|CDM80951.1| unnamed protein product [Triticum aestivum]
Length=231

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D P  + +WDG+H TE +Y AIA GLL GPYT P +
Sbjct  171  DNPQKYASWDGLHPTETSYRAIADGLLRGPYTQPPI  206



>gb|KCW63215.1| hypothetical protein EUGRSUZ_G00835, partial [Eucalyptus grandis]
Length=345

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
             +PS+ + WDG+HLTEAAY  +A+GLL GP+TSP
Sbjct  312  KDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSP  345



>ref|XP_002317430.2| hypothetical protein POPTR_0011s07610g, partial [Populus trichocarpa]
 gb|EEE98042.2| hypothetical protein POPTR_0011s07610g, partial [Populus trichocarpa]
Length=210

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGS  137
            D+PS +VNWDGIH TEAAY+ I + ++ G Y+ P     C L G 
Sbjct  161  DDPSFYVNWDGIHYTEAAYKLIFESVIEGSYSFPSFKALCNLDGK  205



>ref|XP_008371712.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Malus 
domestica]
Length=434

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            + P+ F++WDGIH TEAAY+ I   LL G YT P +   C+
Sbjct  391  ENPAEFISWDGIHFTEAAYKWITNALLKGNYTDPRISSLCV  431



>ref|XP_009413843.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P++ V+WDGIH+TEAA+  IAQG LHGPY  P +
Sbjct  319  DPTTHVSWDGIHMTEAAHRIIAQGWLHGPYVDPPI  353



>ref|NP_001150126.1| esterase precursor [Zea mays]
 gb|ACG37953.1| esterase precursor [Zea mays]
Length=376

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
             PS +VNWDG+HLTEAAY  +A G L GPY +P +
Sbjct  338  NPSVYVNWDGVHLTEAAYHRVADGWLRGPYANPPI  372



>ref|XP_009140758.1| PREDICTED: GDSL esterase/lipase At5g45910 [Brassica rapa]
Length=380

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            + PS++ NWDGIHLTEAAY  IA GL+ G +T P
Sbjct  336  ENPSTYANWDGIHLTEAAYRHIATGLISGRFTKP  369



>gb|AAM62801.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
Length=368

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS++ NWDGIHLTEAAY  IA GL+ G +T P
Sbjct  332  EDPSTYANWDGIHLTEAAYRHIATGLISGRFTMP  365



>ref|XP_004969330.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Setaria 
italica]
Length=380

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            D+PS++ +WDG H TEA Y+ IA G+LHGPY SP
Sbjct  340  DDPSTYGSWDGTHPTEAVYKVIADGVLHGPYASP  373



>ref|NP_199403.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FJ45.1|GDL83_ARATH RecName: Full=GDSL esterase/lipase At5g45910; AltName: Full=Extracellular 
lipase At5g45910; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09319.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AED95314.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=372

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS++ NWDGIHLTEAAY  IA GL+ G +T P
Sbjct  336  EDPSTYANWDGIHLTEAAYRHIATGLISGRFTMP  369



>gb|EAY75182.1| hypothetical protein OsI_03072 [Oryza sativa Indica Group]
Length=310

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D+PS + +WDG H +EAAY+ IA GLL GPYT P +
Sbjct  250  DDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  285



>ref|NP_001172483.1| Os01g0649400 [Oryza sativa Japonica Group]
 dbj|BAH91213.1| Os01g0649400 [Oryza sativa Japonica Group]
Length=306

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D+PS + +WDG H +EAAY+ IA GLL GPYT P +
Sbjct  246  DDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  281



>ref|XP_006643905.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=348

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  312  DPENYLVWDGIHLTEAAYRSIADGWLRGPYCSPAI  346



>ref|XP_004969329.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Setaria 
italica]
Length=381

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            D+PS++ +WDG H TEA Y+ IA G+LHGPY SP
Sbjct  341  DDPSTYGSWDGTHPTEAVYKVIADGVLHGPYASP  374



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +PS +V WDG+H+TEAAY  I++G+L GPY +P
Sbjct  341  DPSKYVTWDGVHMTEAAYSLISEGILKGPYAAP  373



>ref|XP_006415634.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
 gb|ESQ33987.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
Length=390

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGS  137
             PS +V+WDG H TEA Y  +AQGLL+GPY +P     C+  GS
Sbjct  344  NPSEYVHWDGYHSTEATYRKMAQGLLNGPYATPAFNWSCLGSGS  387



>ref|XP_002439451.1| hypothetical protein SORBIDRAFT_09g006600 [Sorghum bicolor]
 gb|EES17881.1| hypothetical protein SORBIDRAFT_09g006600 [Sorghum bicolor]
Length=395

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEF  119
            EPS+ V+WDGIHLTEAAY+ IA G L+G Y  P + + 
Sbjct  356  EPSAHVHWDGIHLTEAAYKYIADGWLNGLYAYPSILDL  393



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PSS V+WDGIHLTEAAY  IA  LL GP+ +P +   C
Sbjct  332  DPSSSVSWDGIHLTEAAYGTIASSLLEGPHANPPLTRAC  370



>ref|XP_011086014.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Sesamum indicum]
Length=373

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            +P+++ NWDGIHLTE+AY  I  GL++GP+T P
Sbjct  331  DPTTYANWDGIHLTESAYRVITMGLVNGPFTHP  363



>ref|XP_006646152.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=372

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +P SF NWDG+H+TE AY  IA G+L+GP+  P +   C
Sbjct  334  DPGSFANWDGLHMTEKAYHVIADGVLNGPFADPPLLHSC  372



>dbj|BAD68794.1| lipase-like [Oryza sativa Japonica Group]
Length=370

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            D+PS + +WDG H +EAAY+ IA GLL GPYT P +
Sbjct  310  DDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  345



>gb|EMT23216.1| GDSL esterase/lipase [Aegilops tauschii]
Length=389

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++NWDGIHLTEAAY +IA G L GPY  P +
Sbjct  353  DPENYLNWDGIHLTEAAYRSIAYGWLTGPYCVPAI  387



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILKGSRGAQTS  155
             PS +VNWDG HLTEA ++ +A GLL+GPY +P     C+   S   ++S
Sbjct  338  NPSEYVNWDGYHLTEATHQKMAHGLLNGPYATPAFDWSCLGSASVDTESS  387



>ref|XP_006387672.1| hypothetical protein POPTR_0686s00200g, partial [Populus trichocarpa]
 gb|ERP46586.1| hypothetical protein POPTR_0686s00200g, partial [Populus trichocarpa]
Length=164

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCILK  131
            D+P+SFVNWDGIH TEA Y+ I + ++ G  + P    FC L 
Sbjct  118  DDPTSFVNWDGIHYTEATYKLIFESIIEGSNSYPSFKAFCNLN  160



>emb|CDM81086.1| unnamed protein product [Triticum aestivum]
Length=367

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+HLTEA Y+ +A G+L GP+  P +   C
Sbjct  325  DPSRYVSWDGVHLTEATYKIMAHGMLDGPFAMPPIVSTC  363



>ref|XP_002454933.1| hypothetical protein SORBIDRAFT_03g001670 [Sorghum bicolor]
 gb|EES00053.1| hypothetical protein SORBIDRAFT_03g001670 [Sorghum bicolor]
Length=378

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
            +PS++VNWDGIHLTEAA   +A G L GPY  P + +
Sbjct  339  DPSAYVNWDGIHLTEAANRRVADGWLRGPYAHPPILD  375



>ref|XP_002461107.1| hypothetical protein SORBIDRAFT_02g040890 [Sorghum bicolor]
 gb|EER97628.1| hypothetical protein SORBIDRAFT_02g040890 [Sorghum bicolor]
Length=395

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFC  122
            +PS +V+WDG+H+TEA Y  +A+GLL GP+  P +   C
Sbjct  354  DPSRYVSWDGLHMTEAVYRIMARGLLDGPFAQPPIMATC  392



>dbj|BAK05007.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++NWDGIHLTEAAY +IA G L GPY  P +
Sbjct  331  DPENYLNWDGIHLTEAAYRSIAYGWLTGPYCVPAI  365



>gb|EMT23218.1| GDSL esterase/lipase [Aegilops tauschii]
Length=337

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
            D+PS+  NWDG+HLTEAAY  IA+G L+GP+  P + E
Sbjct  299  DDPSNHWNWDGVHLTEAAYGHIAKGWLYGPFADPPILE  336



>gb|EEE54108.1| hypothetical protein OsJ_00868 [Oryza sativa Japonica Group]
Length=347

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  311  DPENYLVWDGIHLTEAAYRSIADGWLSGPYCSPAI  345



>ref|NP_001042390.1| Os01g0214600 [Oryza sativa Japonica Group]
 dbj|BAD73004.1| putative esterase [Oryza sativa Japonica Group]
 dbj|BAD73162.1| putative esterase [Oryza sativa Japonica Group]
 dbj|BAF04304.1| Os01g0214600 [Oryza sativa Japonica Group]
Length=349

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  313  DPENYLVWDGIHLTEAAYRSIADGWLSGPYCSPAI  347



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSP  104
            ++PS +V WDGIH+TEAA++ +A GLL GPY +P
Sbjct  337  NDPSKYVAWDGIHMTEAAHKLMADGLLKGPYATP  370



>ref|XP_006645634.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=379

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    PSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            PS++VNWDGIHLTEAAY  +A G L GPY  P +
Sbjct  340  PSAYVNWDGIHLTEAAYHHVADGWLRGPYAHPPI  373



>ref|XP_004968624.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Setaria italica]
Length=372

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
            +PS++VNWDGIHLTEAA   IA G L GPY  P + +
Sbjct  333  DPSAYVNWDGIHLTEAANHRIADGWLRGPYAHPPILD  369



>dbj|BAK01569.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYE  116
            D+PS+  NWDG+HLTEAAY  IA+G L+GP+  P + E
Sbjct  331  DDPSNHWNWDGVHLTEAAYGHIAKGWLYGPFADPPILE  368



>ref|XP_007214461.1| hypothetical protein PRUPE_ppa023988mg [Prunus persica]
 gb|EMJ15660.1| hypothetical protein PRUPE_ppa023988mg [Prunus persica]
Length=458

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  3    DEPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHVYEFCI  125
            ++P+ F+NWDG+  TEAAY  IA+ L+ G YT+P +   C+
Sbjct  415  EKPAQFINWDGMRSTEAAYRWIAKALVQGNYTAPRIATLCV  455



>ref|XP_008655072.1| PREDICTED: LOC100284848 isoform X1 [Zea mays]
 gb|AFW82123.1| hypothetical protein ZEAMMB73_197874 [Zea mays]
Length=369

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    EPSSFVNWDGIHLTEAAYEAIAQGLLHGPYTSPHV  110
            +P +++ WDGIHLTEAAY +IA G L GPY SP +
Sbjct  333  DPGNYLIWDGIHLTEAAYRSIADGWLKGPYCSPPI  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512400555856