BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20866_g2_i1 len=776 path=[1:0-630 632:631-707 709:708-775]

Length=776
                                                                      Score     E

ref|XP_009791952.1|  PREDICTED: glutaredoxin-C9-like                    152   3e-42   
ref|XP_009594330.1|  PREDICTED: glutaredoxin-C9-like                    151   7e-42   
ref|XP_002262673.1|  PREDICTED: glutaredoxin-C9                         146   6e-40   Vitis vinifera
emb|CDP15880.1|  unnamed protein product                                141   5e-38   
ref|XP_006348835.1|  PREDICTED: glutaredoxin-C9-like                    141   9e-38   
ref|XP_009607701.1|  PREDICTED: glutaredoxin-C9-like                    140   1e-37   
ref|XP_009767693.1|  PREDICTED: glutaredoxin-C9-like                    139   3e-37   
ref|XP_006366300.1|  PREDICTED: glutaredoxin-C9-like                    139   4e-37   
gb|ABK96346.1|  unknown                                                 136   4e-36   Populus trichocarpa x Populus deltoides
ref|XP_011043607.1|  PREDICTED: glutaredoxin-C9-like                    134   5e-35   
ref|XP_011047709.1|  PREDICTED: glutaredoxin-C9-like                    134   5e-35   
ref|XP_010323755.1|  PREDICTED: glutaredoxin-C9-like                    133   8e-35   
ref|XP_002310416.1|  hypothetical protein POPTR_0007s01400g             132   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_006372767.1|  hypothetical protein POPTR_0017s04860g             132   2e-34   
ref|XP_003607518.1|  Glutaredoxin-C9                                    132   3e-34   
ref|XP_010245570.1|  PREDICTED: glutaredoxin-C9-like                    130   7e-34   
ref|XP_010093967.1|  hypothetical protein L484_010533                   130   1e-33   
gb|KDP24071.1|  hypothetical protein JCGZ_25728                         129   2e-33   
ref|XP_010689814.1|  PREDICTED: glutaredoxin-C9-like                    129   2e-33   
ref|NP_001235378.1|  uncharacterized protein LOC100306716               130   2e-33   
ref|XP_010260343.1|  PREDICTED: glutaredoxin-C9-like                    129   2e-33   
ref|XP_008232053.1|  PREDICTED: glutaredoxin-C9-like                    129   5e-33   
ref|XP_007043710.1|  Glutaredoxin, putative                             127   1e-32   
ref|XP_007219160.1|  hypothetical protein PRUPE_ppa016347mg             126   3e-32   
gb|AFK35318.1|  unknown                                                 125   9e-32   
ref|XP_002509419.1|  glutaredoxin, grx, putative                        125   1e-31   Ricinus communis
ref|XP_007149799.1|  hypothetical protein PHAVU_005G099700g             125   1e-31   
emb|CAN60168.1|  hypothetical protein VITISV_003664                     120   1e-30   Vitis vinifera
gb|KDP21018.1|  hypothetical protein JCGZ_21489                         122   1e-30   
ref|XP_003543318.1|  PREDICTED: glutaredoxin-C9-like                    123   1e-30   
ref|XP_004248179.2|  PREDICTED: glutaredoxin-C9-like                    120   1e-30   
ref|XP_004505534.1|  PREDICTED: glutaredoxin-C9-like                    122   2e-30   
ref|XP_008455946.1|  PREDICTED: glutaredoxin-C9-like                    121   2e-30   
ref|XP_007132762.1|  hypothetical protein PHAVU_011G122900g             121   3e-30   
ref|XP_002517842.1|  glutaredoxin, grx, putative                        121   4e-30   Ricinus communis
ref|XP_006469072.1|  PREDICTED: glutaredoxin-C9-like                    120   6e-30   
ref|XP_002278515.1|  PREDICTED: glutaredoxin-C9                         120   1e-29   Vitis vinifera
gb|AFK37553.1|  unknown                                                 119   1e-29   
gb|KHN07783.1|  Glutaredoxin-C9                                         120   2e-29   
ref|XP_006446718.1|  hypothetical protein CICLE_v10017057mg             119   2e-29   
ref|NP_001274138.1|  glutaredoxin-C9-like                               119   2e-29   
ref|XP_010686392.1|  PREDICTED: glutaredoxin-C9-like                    118   3e-29   
ref|XP_006467721.1|  PREDICTED: glutaredoxin-C9-like                    118   3e-29   
ref|XP_009409082.1|  PREDICTED: monothiol glutaredoxin-S3-like          118   4e-29   
ref|NP_001240908.1|  uncharacterized protein LOC100792704               118   5e-29   
ref|XP_007025525.1|  Thioredoxin superfamily protein                    118   1e-28   
ref|NP_001235171.1|  uncharacterized protein LOC100527118               117   2e-28   
ref|XP_007148105.1|  hypothetical protein PHAVU_006G181300g             116   2e-28   
ref|XP_003546009.1|  PREDICTED: glutaredoxin-C9-like                    116   2e-28   
ref|XP_010052341.1|  PREDICTED: glutaredoxin-C9-like                    117   2e-28   
ref|XP_006449418.1|  hypothetical protein CICLE_v10017106mg             115   4e-28   
gb|KHN36670.1|  Glutaredoxin-C9                                         114   5e-28   
ref|XP_010111166.1|  hypothetical protein L484_015048                   114   1e-27   
gb|KHN08482.1|  Glutaredoxin-C9                                         114   1e-27   
gb|KHN27916.1|  Glutaredoxin-C9                                         113   1e-27   
ref|XP_003543019.1|  PREDICTED: glutaredoxin-C9-like                    112   3e-27   
ref|XP_010522588.1|  PREDICTED: monothiol glutaredoxin-S13              112   6e-27   
dbj|BAJ97010.1|  predicted protein                                      112   6e-27   
ref|XP_011027761.1|  PREDICTED: glutaredoxin-C9                         112   7e-27   
gb|EMT17993.1|  Monothiol glutaredoxin-S5                               112   8e-27   
gb|KGN63206.1|  hypothetical protein Csa_2G412500                       111   1e-26   
gb|EMT06809.1|  Monothiol glutaredoxin-S5                               111   1e-26   
ref|XP_003593663.1|  Glutaredoxin-C9                                    111   1e-26   
ref|XP_008371421.1|  PREDICTED: glutaredoxin-C9                         111   1e-26   
ref|XP_011001218.1|  PREDICTED: glutaredoxin-C9-like                    111   2e-26   
ref|XP_009352842.1|  PREDICTED: glutaredoxin-C9-like                    110   3e-26   
ref|XP_008225159.1|  PREDICTED: glutaredoxin-C9-like                    110   3e-26   
ref|XP_010035805.1|  PREDICTED: monothiol glutaredoxin-S5-like          112   3e-26   
ref|XP_006377423.1|  glutaredoxin-like family protein                   110   3e-26   
gb|KCW47268.1|  hypothetical protein EUGRSUZ_K01064                     111   4e-26   
ref|XP_002305107.2|  glutaredoxin-like family protein                   110   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010052261.1|  PREDICTED: glutaredoxin-C9-like                    110   5e-26   
ref|XP_008777321.1|  PREDICTED: monothiol glutaredoxin-S3-like          110   5e-26   
emb|CDO99478.1|  unnamed protein product                                110   6e-26   
ref|XP_008439802.1|  PREDICTED: glutaredoxin-C9                         109   9e-26   
ref|XP_002893532.1|  hypothetical protein ARALYDRAFT_473065             108   1e-25   
ref|NP_174170.1|  glutaredoxin-GRX480                                   108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008383678.1|  PREDICTED: glutaredoxin-C9-like                    108   2e-25   
ref|XP_004166934.1|  PREDICTED: glutaredoxin-C9-like                    108   2e-25   
ref|XP_009804127.1|  PREDICTED: glutaredoxin-C9-like                    108   2e-25   
ref|XP_006852569.1|  hypothetical protein AMTR_s00021p00206280          107   3e-25   
ref|XP_009344450.1|  PREDICTED: glutaredoxin-C9                         107   3e-25   
ref|NP_001274395.1|  glutaredoxin                                       107   4e-25   
ref|XP_011086033.1|  PREDICTED: glutaredoxin-C9-like                    107   4e-25   
dbj|BAJ98449.1|  predicted protein                                      107   5e-25   
emb|CDM83146.1|  unnamed protein product                                107   6e-25   
dbj|BAK00692.1|  predicted protein                                      107   6e-25   
ref|XP_006303410.1|  hypothetical protein CARUB_v10010616mg             106   7e-25   
gb|KHN09956.1|  Glutaredoxin-C9                                         106   8e-25   
ref|XP_003541520.1|  PREDICTED: glutaredoxin-C9-like                    106   1e-24   
ref|XP_011096368.1|  PREDICTED: glutaredoxin-C9-like                    105   1e-24   
ref|XP_010478225.1|  PREDICTED: glutaredoxin-C9                         106   1e-24   
ref|XP_004961217.1|  PREDICTED: monothiol glutaredoxin-S9-like          106   1e-24   
ref|XP_010911008.1|  PREDICTED: monothiol glutaredoxin-S9-like          106   2e-24   
ref|XP_009113659.1|  PREDICTED: glutaredoxin-C9-like isoform X2         105   2e-24   
ref|XP_010538185.1|  PREDICTED: glutaredoxin-C9                         105   2e-24   
ref|XP_007156490.1|  hypothetical protein PHAVU_003G290400g             105   3e-24   
ref|XP_010499378.1|  PREDICTED: glutaredoxin-C9-like                    105   3e-24   
emb|CDY30815.1|  BnaC05g21910D                                          104   3e-24   
ref|XP_004293899.1|  PREDICTED: glutaredoxin-C9-like                    103   1e-23   
ref|NP_001043812.1|  Os01g0667900                                       103   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EYU43367.1|  hypothetical protein MIMGU_mgv1a015804mg                103   2e-23   
ref|XP_009631625.1|  PREDICTED: uncharacterized protein LOC104121354    105   3e-23   
ref|XP_003569532.1|  PREDICTED: monothiol glutaredoxin-S5-like          102   4e-23   
ref|XP_010540469.1|  PREDICTED: glutaredoxin-C9-like                    102   4e-23   
ref|XP_010919211.1|  PREDICTED: monothiol glutaredoxin-S9-like          101   9e-23   
ref|XP_009406261.1|  PREDICTED: monothiol glutaredoxin-S9-like          101   1e-22   
ref|XP_008798271.1|  PREDICTED: monothiol glutaredoxin-S9-like          101   1e-22   
ref|XP_009102903.1|  PREDICTED: glutaredoxin-C9-like                    100   1e-22   
gb|KFK42729.1|  monothiol glutaredoxin-s13                              100   3e-22   
emb|CDX94626.1|  BnaC07g10320D                                        99.4    3e-22   
gb|ACG48030.1|  Grx_S2 - glutaredoxin subgroup III                    99.4    4e-22   Zea mays [maize]
ref|NP_001147414.1|  Grx_I1 - glutaredoxin subgroup III               99.8    5e-22   Zea mays [maize]
ref|XP_006305751.1|  hypothetical protein CARUB_v10010567mg           99.4    5e-22   
ref|XP_009416533.1|  PREDICTED: monothiol glutaredoxin-S9-like          100   5e-22   
dbj|BAK00667.1|  predicted protein                                    98.6    7e-22   
ref|XP_010904892.1|  PREDICTED: monothiol glutaredoxin-S3-like        99.0    8e-22   
emb|CDY15662.1|  BnaA07g08330D                                        98.2    9e-22   
ref|XP_010475016.1|  PREDICTED: monothiol glutaredoxin-S13-like       98.6    1e-21   
gb|EAY99027.1|  hypothetical protein OsI_20984                        97.4    2e-21   Oryza sativa Indica Group [Indian rice]
sp|P0C291.1|GRXS9_ORYSJ  RecName: Full=Monothiol glutaredoxin-S9      97.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388731.1|  PREDICTED: monothiol glutaredoxin-S9-like        96.7    4e-21   
ref|XP_008798206.1|  PREDICTED: monothiol glutaredoxin-S9-like        97.1    5e-21   
ref|XP_003565561.2|  PREDICTED: monothiol glutaredoxin-S3-like        95.5    6e-21   
ref|XP_006415650.1|  hypothetical protein EUTSA_v10009080mg           95.5    1e-20   
ref|XP_009111139.1|  PREDICTED: monothiol glutaredoxin-S13-like       95.9    1e-20   
emb|CDY18190.1|  BnaC05g02130D                                        95.5    1e-20   
gb|EYU28021.1|  hypothetical protein MIMGU_mgv1a023397mg              95.1    1e-20   
emb|CDX89861.1|  BnaA10g02210D                                        95.5    1e-20   
ref|XP_009119356.1|  PREDICTED: monothiol glutaredoxin-S13-like       95.1    2e-20   
ref|XP_009392430.1|  PREDICTED: monothiol glutaredoxin-S9-like        94.7    2e-20   
ref|XP_009118687.1|  PREDICTED: monothiol glutaredoxin-S13-like       95.1    2e-20   
ref|XP_002988222.1|  CC type glutaredoxin                             93.6    3e-20   
ref|XP_002440249.1|  hypothetical protein SORBIDRAFT_09g028500        94.7    3e-20   Sorghum bicolor [broomcorn]
ref|XP_006418197.1|  hypothetical protein EUTSA_v10008980mg           94.7    3e-20   
ref|XP_009792873.1|  PREDICTED: glutaredoxin-C9-like                  94.4    3e-20   
ref|XP_010231027.1|  PREDICTED: monothiol glutaredoxin-S9-like        94.4    3e-20   
ref|XP_002963851.1|  hypothetical protein SELMODRAFT_80143            92.4    5e-20   
ref|XP_004969481.1|  PREDICTED: monothiol glutaredoxin-S5-like        94.0    5e-20   
ref|XP_009611400.1|  PREDICTED: glutaredoxin-C9-like                  93.2    5e-20   
ref|XP_010482655.1|  PREDICTED: monothiol glutaredoxin-S13-like       94.0    6e-20   
ref|XP_010457402.1|  PREDICTED: monothiol glutaredoxin-S13            93.6    6e-20   
ref|NP_563691.1|  glutaredoxin ATGRXS13                               93.2    9e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783123.1|  PREDICTED: monothiol glutaredoxin-S3-like        93.6    9e-20   
emb|CDY10096.1|  BnaC08g43550D                                        93.2    1e-19   
gb|KDO49565.1|  hypothetical protein CISIN_1g046051mg                 92.8    1e-19   
dbj|BAD81621.1|  unknown protein                                      92.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042552.1|  Os01g0241400                                     92.4    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABK26004.1|  unknown                                               92.4    2e-19   Picea sitchensis
ref|XP_010327035.1|  PREDICTED: glutaredoxin-C9-like isoform X1       92.8    2e-19   
ref|XP_010327036.1|  PREDICTED: glutaredoxin-C9-like isoform X2       92.8    2e-19   
ref|XP_002991354.1|  CC type glutaredoxin                             90.9    3e-19   
ref|XP_008347995.1|  PREDICTED: glutaredoxin-C5-like                  90.5    6e-19   
gb|EPS71536.1|  hypothetical protein M569_03223                       89.4    7e-19   
emb|CDY44992.1|  BnaCnng12220D                                        91.7    9e-19   
ref|XP_002458286.1|  hypothetical protein SORBIDRAFT_03g030680        90.9    1e-18   Sorghum bicolor [broomcorn]
ref|XP_004171791.1|  PREDICTED: glutaredoxin-C1-like                  89.4    1e-18   
ref|XP_009346791.1|  PREDICTED: glutaredoxin-C1                       89.7    1e-18   
ref|XP_006361069.1|  PREDICTED: glutaredoxin-C9-like                  90.9    1e-18   
gb|AGX01496.1|  glutaredoxin                                          89.0    2e-18   
ref|NP_001152054.1|  Grx_I1 - glutaredoxin subgroup III               90.1    2e-18   Zea mays [maize]
ref|XP_004138799.1|  PREDICTED: glutaredoxin-C1-like                  89.0    2e-18   
tpg|DAA58202.1|  TPA: grx_I1-glutaredoxin subgroup III                89.7    2e-18   
ref|XP_001770429.1|  predicted protein                                87.8    3e-18   
gb|AFW83510.1|  grx_I1-glutaredoxin subgroup III                      89.0    3e-18   
ref|XP_008341254.1|  PREDICTED: glutaredoxin-C5-like                  88.2    4e-18   
ref|XP_009344217.1|  PREDICTED: glutaredoxin-C5-like                  87.8    4e-18   
ref|XP_002892183.1|  hypothetical protein ARALYDRAFT_470358           88.6    5e-18   
ref|XP_003561465.1|  PREDICTED: glutaredoxin-C9-like                  87.4    5e-18   
ref|NP_001147444.1|  LOC100281053                                     88.6    6e-18   Zea mays [maize]
ref|NP_001151360.1|  Grx_I1 - glutaredoxin subgroup III               88.2    7e-18   Zea mays [maize]
gb|EPS67459.1|  hypothetical protein M569_07317                       87.0    7e-18   
ref|XP_006438817.1|  hypothetical protein CICLE_v10033688mg           87.4    8e-18   
ref|XP_008441305.1|  PREDICTED: glutaredoxin-C1-like                  87.0    8e-18   
ref|XP_002303767.1|  hypothetical protein POPTR_0003s16540g           87.0    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011020819.1|  PREDICTED: glutaredoxin-C1-like                  87.0    9e-18   
ref|XP_009381029.1|  PREDICTED: monothiol glutaredoxin-S3             86.7    1e-17   
gb|KDO83116.1|  hypothetical protein CISIN_1g039295mg                 87.0    1e-17   
ref|XP_004304538.1|  PREDICTED: glutaredoxin-C7-like                  86.7    1e-17   
ref|XP_002299331.2|  hypothetical protein POPTR_0001s13440g           86.3    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010249120.1|  PREDICTED: glutaredoxin-C1-like                  85.5    3e-17   
ref|XP_010250605.1|  PREDICTED: glutaredoxin-C1-like                  85.5    3e-17   
gb|KDP41803.1|  hypothetical protein JCGZ_26821                       85.5    3e-17   
ref|XP_011036126.1|  PREDICTED: glutaredoxin-C1-like                  85.5    4e-17   
ref|XP_007031936.1|  Thioredoxin superfamily protein                  85.1    4e-17   
ref|XP_006836357.1|  hypothetical protein AMTR_s00092p00109090        85.1    4e-17   
ref|XP_007216287.1|  hypothetical protein PRUPE_ppa020474mg           85.1    4e-17   
gb|KDP26855.1|  hypothetical protein JCGZ_18013                       85.1    5e-17   
ref|XP_007043882.1|  Thioredoxin superfamily protein                  85.1    5e-17   
ref|XP_002272852.1|  PREDICTED: glutaredoxin-C1                       84.7    5e-17   Vitis vinifera
ref|XP_002514866.1|  glutaredoxin, grx, putative                      85.1    5e-17   Ricinus communis
ref|XP_004310231.1|  PREDICTED: glutaredoxin-C1-like                  85.1    6e-17   
ref|XP_006844586.1|  hypothetical protein AMTR_s00016p00206670        84.3    7e-17   
ref|XP_010024181.1|  PREDICTED: glutaredoxin-C1                       84.3    8e-17   
ref|XP_009336451.1|  PREDICTED: glutaredoxin-C1-like                  84.3    8e-17   
gb|AFK35832.1|  unknown                                               84.3    9e-17   
gb|KDO63867.1|  hypothetical protein CISIN_1g033109mg                 84.3    9e-17   
ref|XP_008389917.1|  PREDICTED: glutaredoxin-C1-like                  84.3    9e-17   
ref|XP_006483043.1|  PREDICTED: glutaredoxin-C5-like                  83.6    1e-16   
ref|XP_009402640.1|  PREDICTED: monothiol glutaredoxin-S9-like        85.1    1e-16   
ref|XP_006447012.1|  hypothetical protein CICLE_v10017534mg           84.0    1e-16   
ref|XP_004958945.1|  PREDICTED: glutaredoxin-C9-like                  83.6    1e-16   
ref|XP_004492160.1|  PREDICTED: glutaredoxin-C3-like                  84.0    1e-16   
ref|XP_008649997.1|  PREDICTED: monothiol glutaredoxin-S9-like        84.3    1e-16   
ref|XP_008459889.1|  PREDICTED: glutaredoxin-C1-like                  83.6    2e-16   
gb|AGX01499.1|  glutaredoxin                                          83.6    2e-16   
ref|XP_011086843.1|  PREDICTED: glutaredoxin-C5-like                  83.6    2e-16   
ref|XP_004140545.1|  PREDICTED: glutaredoxin-C3-like                  83.2    2e-16   
ref|XP_004244929.1|  PREDICTED: glutaredoxin-C9-like                  83.2    2e-16   
gb|KFK25638.1|  hypothetical protein AALP_AA8G140700                  83.6    2e-16   
ref|XP_003548512.1|  PREDICTED: glutaredoxin-C5-like                  83.2    2e-16   
ref|XP_006853862.1|  hypothetical protein AMTR_s00036p00111760        82.8    2e-16   
ref|XP_009803758.1|  PREDICTED: glutaredoxin-C7-like                  82.8    3e-16   
ref|XP_001763715.1|  predicted protein                                82.4    3e-16   
ref|XP_010460645.1|  PREDICTED: glutaredoxin-C9-like isoform X2       83.6    3e-16   
ref|XP_008652019.1|  PREDICTED: glutaredoxin-C9-like                  83.6    3e-16   
ref|XP_008222218.1|  PREDICTED: glutaredoxin-C1-like                  82.8    3e-16   
ref|XP_010680093.1|  PREDICTED: glutaredoxin-C3                       82.4    3e-16   
ref|XP_002300130.1|  glutaredoxin family protein                      82.4    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009801947.1|  PREDICTED: glutaredoxin-C5-like                  82.8    3e-16   
ref|XP_007227610.1|  hypothetical protein PRUPE_ppa021177mg           82.8    3e-16   
ref|XP_007213996.1|  hypothetical protein PRUPE_ppa014139mg           81.3    3e-16   
ref|XP_007161691.1|  hypothetical protein PHAVU_001G090300g           82.4    3e-16   
ref|XP_011045755.1|  PREDICTED: glutaredoxin-C1                       82.4    4e-16   
ref|XP_008791106.1|  PREDICTED: glutaredoxin-C1-like                  82.4    4e-16   
ref|XP_010460644.1|  PREDICTED: glutaredoxin-C9-like isoform X1       83.6    4e-16   
gb|EYU31846.1|  hypothetical protein MIMGU_mgv1a026975mg              82.8    4e-16   
ref|XP_003553278.1|  PREDICTED: glutaredoxin-C3-like                  82.4    4e-16   
ref|XP_009113658.1|  PREDICTED: glutaredoxin-C9-like isoform X1       83.6    4e-16   
emb|CAN67225.1|  hypothetical protein VITISV_043905                   81.6    5e-16   Vitis vinifera
ref|XP_008365353.1|  PREDICTED: glutaredoxin-C5-like                  82.0    5e-16   
ref|XP_002455626.1|  hypothetical protein SORBIDRAFT_03g014800        81.6    5e-16   Sorghum bicolor [broomcorn]
ref|XP_009592444.1|  PREDICTED: glutaredoxin-C5-like                  82.4    5e-16   
ref|XP_011098924.1|  PREDICTED: glutaredoxin-C1                       82.0    5e-16   
ref|XP_002264542.2|  PREDICTED: glutaredoxin-C1-like                  82.0    5e-16   Vitis vinifera
ref|XP_009613036.1|  PREDICTED: glutaredoxin-C7-like                  82.0    6e-16   
ref|XP_008779419.1|  PREDICTED: glutaredoxin-C1-like                  82.0    6e-16   
ref|XP_008775588.1|  PREDICTED: glutaredoxin-C1-like                  82.0    6e-16   
emb|CDP09532.1|  unnamed protein product                              82.0    6e-16   
ref|XP_011096607.1|  PREDICTED: glutaredoxin-C9-like                  82.4    6e-16   
emb|CBI21909.3|  unnamed protein product                              81.3    8e-16   
ref|XP_008340253.1|  PREDICTED: glutaredoxin-C1-like                  81.3    9e-16   
ref|XP_009349478.1|  PREDICTED: glutaredoxin-C1-like                  81.3    1e-15   
ref|XP_009790572.1|  PREDICTED: glutaredoxin-C9-like                  81.3    1e-15   
ref|XP_010540592.1|  PREDICTED: glutaredoxin-C9-like                  81.6    1e-15   
ref|XP_006346834.1|  PREDICTED: glutaredoxin-C9-like                  80.9    1e-15   
ref|XP_009362067.1|  PREDICTED: glutaredoxin-C6                       81.6    1e-15   
ref|XP_003622060.1|  N-hydroxycinnamoyl/benzoyltransferase            84.0    1e-15   
ref|XP_004239526.1|  PREDICTED: glutaredoxin-C1                       81.3    1e-15   
ref|XP_009609332.1|  PREDICTED: glutaredoxin-C9-like                  80.5    1e-15   
gb|EYU37410.1|  hypothetical protein MIMGU_mgv1a023394mg              80.9    2e-15   
ref|XP_009399249.1|  PREDICTED: glutaredoxin-C1-like                  79.7    2e-15   
ref|XP_008450140.1|  PREDICTED: glutaredoxin-C1-like                  80.5    2e-15   
ref|XP_009125958.1|  PREDICTED: glutaredoxin-C8                       80.9    2e-15   
ref|XP_009758965.1|  PREDICTED: glutaredoxin-C1-like                  80.5    2e-15   
ref|XP_011071245.1|  PREDICTED: glutaredoxin-C5-like                  80.5    2e-15   
gb|EPS67967.1|  hypothetical protein M569_06806                       80.5    2e-15   
ref|XP_006359084.1|  PREDICTED: glutaredoxin-C5-like                  80.5    2e-15   
gb|EYU33393.1|  hypothetical protein MIMGU_mgv1a023176mg              79.7    2e-15   
ref|XP_004228854.1|  PREDICTED: glutaredoxin-C1-like                  80.1    3e-15   
emb|CDX91084.1|  BnaC02g05130D                                        80.5    3e-15   
emb|CDP13384.1|  unnamed protein product                              80.5    3e-15   
ref|XP_006363780.1|  PREDICTED: glutaredoxin-C5-like                  79.7    3e-15   
ref|XP_007139286.1|  hypothetical protein PHAVU_008G016400g           80.1    3e-15   
ref|XP_002446324.1|  hypothetical protein SORBIDRAFT_06g014300        80.1    3e-15   Sorghum bicolor [broomcorn]
ref|XP_006288869.1|  hypothetical protein CARUB_v10002222mg           80.1    3e-15   
ref|XP_006578082.1|  PREDICTED: glutaredoxin-C6-like isoform X3       80.1    3e-15   
ref|XP_009408540.1|  PREDICTED: glutaredoxin-C9-like                  79.7    3e-15   
ref|XP_008784855.1|  PREDICTED: glutaredoxin-C9-like                  79.7    3e-15   
ref|XP_003524152.1|  PREDICTED: glutaredoxin-C9-like                  79.7    3e-15   
ref|XP_009421048.1|  PREDICTED: glutaredoxin-C5                       79.7    4e-15   
ref|NP_001150763.1|  Grx_C8 - glutaredoxin subgroup III               79.7    4e-15   Zea mays [maize]
ref|XP_010243568.1|  PREDICTED: monothiol glutaredoxin-S10-like       79.0    4e-15   
ref|XP_010538257.1|  PREDICTED: glutaredoxin-C9-like                  80.1    4e-15   
ref|XP_003522252.1|  PREDICTED: glutaredoxin-C6-like isoform X1       79.7    4e-15   
dbj|BAJ86342.1|  predicted protein                                    79.0    4e-15   
ref|XP_008674047.1|  PREDICTED: glutaredoxin-C1                       79.0    4e-15   
ref|XP_006578081.1|  PREDICTED: glutaredoxin-C6-like isoform X2       79.7    5e-15   
ref|XP_010492199.1|  PREDICTED: glutaredoxin-C8                       79.7    5e-15   
ref|XP_007138516.1|  hypothetical protein PHAVU_009G215800g           79.3    5e-15   
ref|XP_010420029.1|  PREDICTED: glutaredoxin-C8-like                  79.7    5e-15   
ref|XP_009593680.1|  PREDICTED: glutaredoxin-C1-like                  79.3    5e-15   
emb|CDX91918.1|  BnaC03g32200D                                        79.3    5e-15   
ref|XP_010246107.1|  PREDICTED: glutaredoxin-C9-like                  79.3    6e-15   
gb|EYU34823.1|  hypothetical protein MIMGU_mgv1a026293mg              78.6    6e-15   
ref|XP_004962841.1|  PREDICTED: putative glutaredoxin-C14-like        78.6    6e-15   
ref|XP_004148005.1|  PREDICTED: glutaredoxin-C1-like                  79.0    6e-15   
ref|XP_006450863.1|  hypothetical protein CICLE_v10009836mg           79.3    6e-15   
ref|XP_009134575.1|  PREDICTED: glutaredoxin-C7                       79.3    6e-15   
ref|XP_009386578.1|  PREDICTED: glutaredoxin-C5-like                  78.6    7e-15   
ref|XP_006574874.1|  PREDICTED: glutaredoxin-C3-like                  79.3    7e-15   
gb|KHN27195.1|  Glutaredoxin-C1                                       78.6    7e-15   
ref|NP_196911.1|  glutaredoxin ROXY2                                  79.3    7e-15   
ref|XP_010453518.1|  PREDICTED: glutaredoxin-C8-like                  79.0    7e-15   
ref|XP_004968750.1|  PREDICTED: glutaredoxin-C1-like                  77.8    9e-15   
ref|XP_006408562.1|  hypothetical protein EUTSA_v10022308mg           79.0    9e-15   
ref|XP_010524249.1|  PREDICTED: glutaredoxin-C8                       78.6    1e-14   
ref|XP_011019425.1|  PREDICTED: glutaredoxin-C6                       79.0    1e-14   
ref|XP_006603016.1|  PREDICTED: glutaredoxin-C5-like                  78.6    1e-14   
ref|XP_010925460.1|  PREDICTED: glutaredoxin-C7-like                  78.6    1e-14   
ref|XP_002519638.1|  glutaredoxin, grx, putative                      78.2    1e-14   
ref|XP_010496441.1|  PREDICTED: glutaredoxin-C7                       77.8    1e-14   
ref|XP_006664080.1|  PREDICTED: putative glutaredoxin-C14-like        77.4    1e-14   
ref|XP_008670904.1|  PREDICTED: putative glutaredoxin-C14             77.4    1e-14   
tpg|DAA42401.1|  TPA: hypothetical protein ZEAMMB73_785246            77.4    1e-14   
ref|XP_010942195.1|  PREDICTED: glutaredoxin-C9-like                  79.3    1e-14   
gb|KDP38002.1|  hypothetical protein JCGZ_04645                       78.2    1e-14   
ref|XP_002308552.2|  hypothetical protein POPTR_0006s24340g           78.6    1e-14   
emb|CBI30933.3|  unnamed protein product                              79.3    1e-14   
ref|XP_011085618.1|  PREDICTED: glutaredoxin-C9-like                  78.2    1e-14   
ref|XP_010432624.1|  PREDICTED: glutaredoxin-C6-like                  78.6    1e-14   
gb|KFK37654.1|  hypothetical protein AALP_AA3G011200                  78.2    2e-14   
ref|XP_011097396.1|  PREDICTED: glutaredoxin-C5                       77.0    2e-14   
ref|XP_003565027.1|  PREDICTED: putative glutaredoxin-C2              77.0    2e-14   
ref|XP_010655687.1|  PREDICTED: glutaredoxin-C1-like                  77.8    2e-14   
ref|XP_009399247.1|  PREDICTED: putative glutaredoxin-C14             77.0    2e-14   
ref|XP_010447297.1|  PREDICTED: glutaredoxin-C6-like                  78.2    2e-14   
ref|XP_008802104.1|  PREDICTED: glutaredoxin-C1-like                  77.0    2e-14   
ref|XP_010435683.1|  PREDICTED: glutaredoxin-C7-like                  77.8    2e-14   
gb|EMT19730.1|  Putative glutaredoxin-C14                             77.0    2e-14   
ref|XP_004228431.1|  PREDICTED: glutaredoxin-C1-like                  77.4    2e-14   
ref|XP_010437814.1|  PREDICTED: glutaredoxin-C6                       77.8    2e-14   
gb|ADE77735.1|  unknown                                               77.4    2e-14   
gb|EYU27873.1|  hypothetical protein MIMGU_mgv1a023197mg              77.0    3e-14   
ref|XP_007025024.1|  Glutaredoxin family protein                      77.0    3e-14   
ref|NP_001043047.1|  Os01g0368900                                     76.6    3e-14   
ref|XP_010496424.1|  PREDICTED: glutaredoxin-C7                       77.4    3e-14   
ref|XP_009408866.1|  PREDICTED: glutaredoxin-C7-like                  77.0    3e-14   
ref|XP_003567688.1|  PREDICTED: glutaredoxin-C1                       76.3    3e-14   
emb|CDX75319.1|  BnaA01g03830D                                        77.4    3e-14   
ref|XP_003535021.1|  PREDICTED: glutaredoxin-C9-like                  77.0    3e-14   
gb|AAM65800.1|  glutaredoxin-like protein                             77.4    3e-14   
ref|NP_195030.1|  glutaredoxin-C6                                     77.4    3e-14   
ref|XP_004134909.1|  PREDICTED: glutaredoxin-C9-like                  76.6    4e-14   
ref|XP_003526012.1|  PREDICTED: glutaredoxin-C6-like                  77.0    4e-14   
gb|ABF69995.1|  glutaredoxin family protein                           76.3    4e-14   
ref|XP_010904788.1|  PREDICTED: glutaredoxin-C1-like                  76.3    4e-14   
ref|XP_008351950.1|  PREDICTED: glutaredoxin-C6-like                  77.4    4e-14   
ref|XP_008799336.1|  PREDICTED: glutaredoxin-C1-like                  76.3    4e-14   
gb|EMT26366.1|  Monothiol glutaredoxin-S3                             77.8    4e-14   
ref|XP_002278652.1|  PREDICTED: glutaredoxin-C6                       76.6    5e-14   
ref|XP_009131384.1|  PREDICTED: glutaredoxin-C8-like                  77.4    5e-14   
gb|EMT31793.1|  Putative glutaredoxin-C14                             75.9    5e-14   
emb|CBI30620.3|  unnamed protein product                              74.7    5e-14   
emb|CDX78558.1|  BnaA03g04700D                                        76.6    5e-14   
ref|XP_010669383.1|  PREDICTED: glutaredoxin-C6-like                  76.6    5e-14   
gb|AHM25912.1|  glutaredoxin 2                                        76.3    6e-14   
ref|XP_004492070.1|  PREDICTED: glutaredoxin-C5-like                  76.3    6e-14   
ref|XP_004141321.1|  PREDICTED: glutaredoxin-C6-like                  76.3    6e-14   
ref|XP_009125089.1|  PREDICTED: glutaredoxin-C6                       76.6    6e-14   
emb|CDX68934.1|  BnaC01g05190D                                        76.6    6e-14   
ref|XP_004501464.1|  PREDICTED: glutaredoxin-C6-like                  75.9    6e-14   
ref|XP_009411702.1|  PREDICTED: glutaredoxin-C1-like                  75.5    7e-14   
ref|XP_003575736.1|  PREDICTED: putative glutaredoxin-C14             75.5    7e-14   
ref|XP_004492067.1|  PREDICTED: glutaredoxin-C5-like                  76.3    7e-14   
ref|XP_008677911.1|  PREDICTED: glutaredoxin-C10-like                 75.5    8e-14   
ref|NP_193305.1|  monothiol glutaredoxin-S3                           75.1    9e-14   
ref|XP_003575739.1|  PREDICTED: putative glutaredoxin-C14             75.1    9e-14   
ref|XP_009398966.1|  PREDICTED: glutaredoxin-C9-like                  75.9    9e-14   
emb|CDY13515.1|  BnaA03g52330D                                        76.3    9e-14   
ref|XP_002867210.1|  hypothetical protein ARALYDRAFT_491387           76.3    9e-14   
ref|XP_008796225.1|  PREDICTED: glutaredoxin-C1-like                  75.1    9e-14   
ref|XP_006284821.1|  hypothetical protein CARUB_v10006100mg           75.1    9e-14   
ref|XP_011071466.1|  PREDICTED: monothiol glutaredoxin-S5-like        75.1    1e-13   
ref|XP_004962839.1|  PREDICTED: putative glutaredoxin-C14-like        75.1    1e-13   
ref|XP_009138160.1|  PREDICTED: glutaredoxin-C6-like                  75.9    1e-13   
ref|XP_002870219.1|  glutaredoxin family protein                      75.1    1e-13   
ref|XP_004233840.1|  PREDICTED: monothiol glutaredoxin-S9-like        75.9    1e-13   
tpg|DAA43403.1|  TPA: hypothetical protein ZEAMMB73_785146            74.7    1e-13   
ref|XP_006284820.1|  hypothetical protein CARUB_v10006099mg           74.7    1e-13   
ref|XP_007161028.1|  hypothetical protein PHAVU_001G036900g           75.9    1e-13   
emb|CDY45025.1|  BnaA08g11940D                                        75.9    1e-13   
ref|XP_004962842.1|  PREDICTED: putative glutaredoxin-C14-like        74.7    1e-13   
ref|XP_009108818.1|  PREDICTED: glutaredoxin-C6-like isoform X2       75.9    1e-13   
ref|XP_006363784.1|  PREDICTED: glutaredoxin-C5-like                  75.1    1e-13   
ref|XP_006399915.1|  hypothetical protein EUTSA_v10015899mg           75.5    1e-13   
ref|NP_001066942.2|  Os12g0538600                                     74.7    1e-13   
ref|XP_009146815.1|  PREDICTED: monothiol glutaredoxin-S4             74.7    1e-13   
ref|XP_009108817.1|  PREDICTED: glutaredoxin-C6-like isoform X1       75.9    2e-13   
ref|XP_009108820.1|  PREDICTED: glutaredoxin-C6-like isoform X3       75.5    2e-13   
ref|XP_003547580.1|  PREDICTED: glutaredoxin-C9-like                  75.1    2e-13   
gb|EMS46251.1|  Putative glutaredoxin-C14                             74.3    2e-13   
ref|XP_006286199.1|  hypothetical protein CARUB_v10007765mg           74.3    2e-13   
ref|XP_010434934.1|  PREDICTED: monothiol glutaredoxin-S4             74.3    2e-13   
ref|XP_003575732.1|  PREDICTED: putative glutaredoxin-C14             74.3    2e-13   
ref|XP_009131678.1|  PREDICTED: monothiol glutaredoxin-S2             74.3    2e-13   
emb|CDY28280.1|  BnaC03g66790D                                        75.1    2e-13   
ref|XP_010434933.1|  PREDICTED: monothiol glutaredoxin-S5-like        74.3    2e-13   
ref|XP_009393864.1|  PREDICTED: glutaredoxin-C1-like                  75.1    2e-13   
ref|XP_006340236.1|  PREDICTED: glutaredoxin-C6-like                  75.1    2e-13   
ref|XP_010434931.1|  PREDICTED: monothiol glutaredoxin-S3             73.9    2e-13   
ref|XP_004498874.1|  PREDICTED: glutaredoxin-C6-like                  75.1    2e-13   
ref|XP_010440264.1|  PREDICTED: monothiol glutaredoxin-S4-like        73.9    2e-13   
ref|XP_010449907.1|  PREDICTED: monothiol glutaredoxin-S5-like        73.9    2e-13   
ref|XP_010434932.1|  PREDICTED: monothiol glutaredoxin-S3-like        73.9    2e-13   
ref|XP_010440263.1|  PREDICTED: monothiol glutaredoxin-S3-like        73.9    3e-13   
gb|KDO75421.1|  hypothetical protein CISIN_1g037432mg                 73.9    3e-13   
ref|XP_006284819.1|  hypothetical protein CARUB_v10006098mg           73.6    3e-13   
ref|NP_193304.1|  monothiol glutaredoxin-S5                           73.6    3e-13   
ref|XP_002870221.1|  glutaredoxin family protein                      73.6    3e-13   
ref|XP_006601226.1|  PREDICTED: glutaredoxin-C6-like                  74.7    3e-13   
ref|XP_006364326.1|  PREDICTED: monothiol glutaredoxin-S9-like        74.7    3e-13   
ref|XP_006449013.1|  hypothetical protein CICLE_v10017760mg           74.3    3e-13   
gb|KFK26098.1|  hypothetical protein AALP_AA8G202600                  73.6    3e-13   
ref|XP_010242238.1|  PREDICTED: glutaredoxin-C6-like                  74.7    3e-13   
gb|AEC03329.1|  glutaredoxin 2                                        74.7    3e-13   
ref|XP_008651112.1|  PREDICTED: glutaredoxin-C1-like                  75.5    3e-13   
ref|XP_010449909.1|  PREDICTED: monothiol glutaredoxin-S3-like        73.6    3e-13   
ref|XP_006412398.1|  hypothetical protein EUTSA_v10026405mg           75.1    3e-13   
gb|AEC03330.1|  glutaredoxin 2.1                                      74.3    4e-13   
ref|NP_193303.1|  monothiol glutaredoxin-S4                           73.2    4e-13   
ref|XP_009146825.1|  PREDICTED: monothiol glutaredoxin-S4-like        73.2    4e-13   
ref|XP_004968749.1|  PREDICTED: glutaredoxin-C1-like                  73.2    4e-13   
ref|XP_010262072.1|  PREDICTED: glutaredoxin-C6-like                  74.3    4e-13   
gb|KFK43355.1|  hypothetical protein AALP_AA1G115300                  73.2    4e-13   
gb|KFK43354.1|  hypothetical protein AALP_AA1G115200                  73.2    4e-13   
ref|XP_010555080.1|  PREDICTED: glutaredoxin-C10-like                 73.9    4e-13   
emb|CDY54294.1|  BnaC01g41930D                                        73.2    4e-13   
ref|XP_006284817.1|  hypothetical protein CARUB_v10006105mg           73.2    5e-13   
ref|XP_010904787.1|  PREDICTED: putative glutaredoxin-C14             73.2    5e-13   
ref|XP_008799330.1|  PREDICTED: glutaredoxin-C1-like                  73.2    5e-13   
ref|XP_008793216.1|  PREDICTED: glutaredoxin-C7-like                  74.3    5e-13   
ref|XP_006284824.1|  hypothetical protein CARUB_v10006103mg           73.2    5e-13   
ref|XP_007012304.1|  Thioredoxin superfamily protein                  74.3    5e-13   
gb|EMT12569.1|  Glutaredoxin-C1                                       73.2    5e-13   
ref|XP_006414472.1|  hypothetical protein EUTSA_v10027374mg           73.2    5e-13   
ref|XP_003621773.1|  Glutaredoxin                                     73.6    5e-13   
ref|XP_010449908.1|  PREDICTED: monothiol glutaredoxin-S3-like        72.8    5e-13   
dbj|BAJ89491.1|  predicted protein                                    72.8    5e-13   
ref|XP_008782514.1|  PREDICTED: glutaredoxin-C7-like                  73.6    6e-13   
ref|XP_006663086.1|  PREDICTED: glutaredoxin-C13-like                 72.8    6e-13   
gb|KFK29909.1|  hypothetical protein AALP_AA7G194200                  73.9    6e-13   
ref|XP_002870222.1|  glutaredoxin family protein                      72.8    6e-13   
emb|CDX70828.1|  BnaC03g09120D                                        72.8    6e-13   
gb|KFK24501.1|  hypothetical protein AALP_AAs55560U000100             72.4    7e-13   
ref|XP_008804595.1|  PREDICTED: glutaredoxin-C1                       74.3    7e-13   
ref|XP_003621763.1|  Glutaredoxin                                     73.2    7e-13   
ref|XP_010243570.1|  PREDICTED: glutaredoxin-C11-like                 72.4    7e-13   
ref|XP_009382560.1|  PREDICTED: glutaredoxin-C1-like                  72.4    8e-13   
gb|EMT12570.1|  Glutaredoxin-C1                                       72.4    8e-13   
gb|EMS62879.1|  Glutaredoxin-C1                                       72.4    8e-13   
ref|XP_006284827.1|  hypothetical protein CARUB_v10006107mg           72.4    8e-13   
ref|XP_009369121.1|  PREDICTED: monothiol glutaredoxin-S2-like        72.4    8e-13   
ref|XP_004492081.1|  PREDICTED: glutaredoxin-C5-like                  73.2    8e-13   
gb|AAM61544.1|  glutaredoxin-like protein                             72.4    8e-13   
ref|XP_009405878.1|  PREDICTED: glutaredoxin-C5-like                  73.2    8e-13   
gb|KFK22959.1|  hypothetical protein AALP_AAs50914U000200             72.4    9e-13   
ref|XP_002455625.1|  hypothetical protein SORBIDRAFT_03g014790        72.4    9e-13   
ref|XP_002870218.1|  glutaredoxin family protein                      72.4    9e-13   
ref|XP_010434937.1|  PREDICTED: monothiol glutaredoxin-S7             72.0    1e-12   
ref|XP_010054256.1|  PREDICTED: glutaredoxin-C9-like                  72.8    1e-12   
ref|XP_010070161.1|  PREDICTED: glutaredoxin-C9-like                  73.2    1e-12   
gb|EMT20536.1|  Putative glutaredoxin-C14                             72.0    1e-12   
ref|XP_008353232.1|  PREDICTED: monothiol glutaredoxin-S2-like        72.0    1e-12   
ref|XP_010449913.1|  PREDICTED: monothiol glutaredoxin-S7-like        72.0    1e-12   
gb|EMT22949.1|  Glutaredoxin-C1                                       72.0    1e-12   
ref|XP_011090919.1|  PREDICTED: monothiol glutaredoxin-S4-like        71.6    1e-12   
ref|XP_006414476.1|  hypothetical protein EUTSA_v10026878mg           71.6    1e-12   
ref|XP_006830226.1|  hypothetical protein AMTR_s00130p00050470        71.6    1e-12   
ref|XP_006284683.1|  hypothetical protein CARUB_v10005942mg           72.8    1e-12   
ref|XP_010549174.1|  PREDICTED: monothiol glutaredoxin-S4-like        71.2    1e-12   
ref|XP_008674046.1|  PREDICTED: glutaredoxin-C1-like                  71.6    1e-12   
ref|XP_010691740.1|  PREDICTED: glutaredoxin-C9-like                  72.4    1e-12   
ref|XP_009419009.1|  PREDICTED: putative glutaredoxin-C14             71.6    1e-12   
ref|NP_186849.1|  glutaredoxin-C7                                     72.4    2e-12   
ref|NP_193301.1|  monothiol glutaredoxin-S8                           71.6    2e-12   
emb|CDY02610.1|  BnaC02g08250D                                        71.2    2e-12   
ref|XP_010454112.1|  PREDICTED: monothiol glutaredoxin-S2-like        71.2    2e-12   
ref|XP_010098332.1|  Monothiol glutaredoxin-S2                        71.2    2e-12   
ref|XP_007136832.1|  hypothetical protein PHAVU_009G078100g           72.0    2e-12   
ref|XP_010434935.1|  PREDICTED: monothiol glutaredoxin-S7-like        71.2    2e-12   
gb|AAS47604.1|  At4g15670                                             71.6    2e-12   
gb|EPS64181.1|  glutaredoxin                                          71.2    2e-12   
gb|EMT00625.1|  hypothetical protein F775_42757                       71.2    2e-12   
ref|XP_003621774.1|  Glutaredoxin                                     72.0    2e-12   
ref|XP_006284826.1|  hypothetical protein CARUB_v10006106mg           71.2    2e-12   
ref|NP_193302.1|  monothiol glutaredoxin-S7                           70.9    3e-12   
ref|XP_008665182.1|  PREDICTED: putative glutaredoxin-C14             70.9    3e-12   
ref|XP_010420636.1|  PREDICTED: monothiol glutaredoxin-S2             70.9    3e-12   
ref|XP_010931999.1|  PREDICTED: glutaredoxin-C1                       70.9    3e-12   
gb|EMS62279.1|  Glutaredoxin-C1                                       70.9    3e-12   
ref|XP_009384168.1|  PREDICTED: putative glutaredoxin-C14             70.9    3e-12   
ref|XP_010524509.1|  PREDICTED: monothiol glutaredoxin-S4             70.9    3e-12   
ref|XP_002882152.1|  hypothetical protein ARALYDRAFT_477310           71.6    3e-12   
ref|XP_004971194.1|  PREDICTED: putative glutaredoxin-C2-like         70.9    3e-12   
ref|XP_002449931.1|  hypothetical protein SORBIDRAFT_05g025910        70.9    4e-12   
ref|XP_006644173.1|  PREDICTED: glutaredoxin-C1-like                  70.5    4e-12   
ref|XP_010449912.1|  PREDICTED: monothiol glutaredoxin-S7-like        70.5    4e-12   
emb|CDY13904.1|  BnaC09g39220D                                        70.5    4e-12   
emb|CDX70540.1|  BnaC03g06240D                                        71.2    4e-12   
ref|XP_002873906.1|  glutaredoxin family protein                      70.5    4e-12   
ref|XP_010915285.1|  PREDICTED: monothiol glutaredoxin-S2-like        71.2    4e-12   
ref|NP_001046942.1|  Os02g0512400                                     71.2    4e-12   
ref|XP_010558476.1|  PREDICTED: monothiol glutaredoxin-S2             70.5    4e-12   
ref|XP_004134195.1|  PREDICTED: monothiol glutaredoxin-S2-like        70.5    4e-12   
gb|KDP34085.1|  hypothetical protein JCGZ_07656                       71.6    4e-12   
ref|XP_007212743.1|  hypothetical protein PRUPE_ppa019446mg           70.5    5e-12   
ref|XP_011090920.1|  PREDICTED: monothiol glutaredoxin-S5-like        70.1    5e-12   
ref|XP_004488285.1|  PREDICTED: glutaredoxin-C9-like                  70.9    5e-12   
ref|XP_008225569.1|  PREDICTED: glutaredoxin-C9-like                  70.5    5e-12   



>ref|XP_009791952.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=138

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 115/156 (74%), Gaps = 18/156 (12%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEA+PYK W   P D + +  N+SS+ L+N+             E K   KNM+TE+AV
Sbjct  1    MQEALPYKLWQHFPTDFRTL--NKSSS-LLNQ-------------ESKGDVKNMITENAV  44

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFGR GCCM HV++ LL  LGVNPV+ +I+E+ E EV+ +LE+IGG GDR +  GLQFP
Sbjct  45   IVFGRCGCCMSHVIKCLLHFLGVNPVIYDIEEKYENEVVVKLENIGG-GDRKDG-GLQFP  102

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGG LFGGLDRIMAAHISGELTPVLKQAGALWL
Sbjct  103  AVFIGGELFGGLDRIMAAHISGELTPVLKQAGALWL  138



>ref|XP_009594330.1| PREDICTED: glutaredoxin-C9-like [Nicotiana tomentosiformis]
Length=138

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 115/156 (74%), Gaps = 18/156 (12%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEA+PYK+W   P D + +  N+SS+ L+N+             E K   KNM+TE+AV
Sbjct  1    MQEALPYKSWQNFPTDFRTL--NKSSS-LLNQ-------------ESKGDVKNMITENAV  44

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFG+RGCCM HV++ LL  LGVNPV+ +I+E+ E EV++ELE I G GDR +  GLQ P
Sbjct  45   IVFGQRGCCMSHVIKCLLHFLGVNPVIYDIEEKYENEVVKELEDISG-GDRKDG-GLQLP  102

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGG LFGGLDRIMAAHISGELTPVLKQAGALWL
Sbjct  103  AVFIGGELFGGLDRIMAAHISGELTPVLKQAGALWL  138



>ref|XP_002262673.1| PREDICTED: glutaredoxin-C9 [Vitis vinifera]
Length=141

 Score =   146 bits (368),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 15/156 (10%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEA+PYKTWL +PR+ +    N  + PL N+     +  +           NMV+E+AV
Sbjct  1    MQEALPYKTWLPIPREPRI---NTPTTPLHNQLLLPGTTNI----------TNMVSENAV  47

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFGRRGCCM HVV+RLL  LGVNP V E++EE E  V++EL  +G AG+  ++  +QFP
Sbjct  48   IVFGRRGCCMTHVVKRLLLGLGVNPAVCEVNEEDEIGVLDELGMVG-AGE-GKQGAVQFP  105

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGGRLFGGLDR+MAAHI+GEL P+LKQAGALWL
Sbjct  106  AVFIGGRLFGGLDRVMAAHITGELVPILKQAGALWL  141



>emb|CDP15880.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 114/157 (73%), Gaps = 5/157 (3%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEA+PYKTWL MPR  K    + S     +   S+SS++   +K  K   K+ + E+AV
Sbjct  1    MQEALPYKTWLPMPR--KESTLSLSIGKATSNGNSASSVHY--LKRSKAELKDTIKENAV  56

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG-LQF  257
            +VFG+RGCCM HVV+RLLQ LGVNP V E+D+E E EVI ELE I G G     +G +QF
Sbjct  57   IVFGKRGCCMSHVVKRLLQGLGVNPPVYEVDDEDENEVINELERINGGGGDDRDRGRVQF  116

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            PAVFIGG+LFGGLDRIMA HI+GELTP+LK+AGALWL
Sbjct  117  PAVFIGGQLFGGLDRIMATHITGELTPILKKAGALWL  153



>ref|XP_006348835.1| PREDICTED: glutaredoxin-C9-like [Solanum tuberosum]
Length=151

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSS-SSMYVDGVKEPKDGAKNMVTESA  437
            MQ+A+PYK+       C P+          ++  +S SS+YV G KE  +   N+V ++A
Sbjct  2    MQQALPYKS------SCLPITLRVHPNDRHHRVSTSNSSLYVKGSKEELN---NVVKDNA  52

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevi--eelesIGGAGDRAEKKGL  263
            V+V GRRGCCM HVV+RLL  LG NP + EI+EE E EV+   E   + G GDR E   L
Sbjct  53   VIVVGRRGCCMSHVVKRLLHCLGANPAIYEIEEEDENEVVDELENIIVAGGGDRKETGRL  112

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            QFPAVF+GG LFGGLDRIMAAHI+GELTPVLK+AGALWL
Sbjct  113  QFPAVFVGGELFGGLDRIMAAHITGELTPVLKKAGALWL  151



>ref|XP_009607701.1| PREDICTED: glutaredoxin-C9-like [Nicotiana tomentosiformis]
Length=156

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 14/163 (9%)
 Frame = -2

Query  613  MQEAIPYKTW---LTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            MQ+A+PYK+    LT+ +D KP+  NQ +    + + SS+SMYV G KE     KNMV +
Sbjct  1    MQQALPYKSSCLSLTL-QDPKPL--NQMNH-STSSSSSSTSMYVKGSKEE---LKNMVKD  53

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPv----vseideevekevieelesIGGAGDRAE  275
            +AV+V GRRGCCM HVV+RLLQ LG NP       + + EV  E+   + ++ G+ DR E
Sbjct  54   NAVIVVGRRGCCMSHVVKRLLQCLGANPAIYDIEEQDENEVIDELENIVAAVDGSDDRKE  113

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               LQ PAVF+GG LFGGLDRIMAAHI+GELTPVLKQAGALWL
Sbjct  114  GGRLQLPAVFVGGELFGGLDRIMAAHITGELTPVLKQAGALWL  156



>ref|XP_009767693.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=153

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 11/160 (7%)
 Frame = -2

Query  613  MQEAIPYKTW---LTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            MQ+A+PYK+    LT+ +D KP+  NQ +      + SS+ MYV G KE     KNMV +
Sbjct  1    MQQALPYKSSCLSLTL-KDPKPL--NQMNH-STTSSSSSTCMYVKGSKEE---LKNMVKD  53

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekeviee-lesIGGAGDRAEKKG  266
            +AV+V GRRGCCM HVV+RLLQ LG NP + +I+E+ E EVI+E    + G+ DR +   
Sbjct  54   NAVIVVGRRGCCMSHVVKRLLQCLGANPAIYDIEEQDENEVIDELENIVDGSDDRKKGGR  113

Query  265  LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            LQ PAVF+GG LFGGLDRIMAAHI+GELTPVLKQAGALWL
Sbjct  114  LQLPAVFVGGELFGGLDRIMAAHITGELTPVLKQAGALWL  153



>ref|XP_006366300.1| PREDICTED: glutaredoxin-C9-like [Solanum tuberosum]
Length=144

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 108/159 (68%), Gaps = 18/159 (11%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+A+PYK+W   P          +++  +NK   SSS+ ++ +   K   K MVTE+AV
Sbjct  1    MQDALPYKSWNFFP----------TNSTTLNK---SSSLMINQINYSKGNFKKMVTENAV  47

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIG---GAGDRAEKKGL  263
            +VF RRGCCM HV++RLLQ LG NPV+ +I+E+ E E I ELE IG   G GDR+    L
Sbjct  48   IVFRRRGCCMSHVIKRLLQCLGANPVMYDIEEKYENEAITELEDIGKIVGGGDRSLSSLL  107

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              PAVFIGG LFGGLDRIM AHISGEL P+LK AGALWL
Sbjct  108  --PAVFIGGELFGGLDRIMEAHISGELCPILKNAGALWL  144



>gb|ABK96346.1| unknown [Populus trichocarpa x Populus deltoides]
Length=154

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 109/159 (69%), Gaps = 8/159 (5%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNM---VTE  443
            MQ+AIPYK+W  +  + KP++     +P    AG  S+  V   +E   G+ NM   V E
Sbjct  1    MQQAIPYKSWPPLYTNNKPLI-----SPFQLIAGRHSNGGVVATQEVLKGSGNMSKMVQE  55

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGL  263
            +A++VF RRGCCM  V +RLL  LGVNP V EIDE  E  V+EELE I   G +  KK +
Sbjct  56   NAIIVFARRGCCMSLVAKRLLLGLGVNPAVYEIDEADEISVLEELEMICNDGGKGSKKKV  115

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            QFPA+FIGG+LFGGLD++MAAHISGEL P+LK+AGALWL
Sbjct  116  QFPALFIGGKLFGGLDKLMAAHISGELVPILKEAGALWL  154



>ref|XP_011043607.1| PREDICTED: glutaredoxin-C9-like [Populus euphratica]
Length=155

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 106/158 (67%), Gaps = 5/158 (3%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPYK+WL +  + KP++   S + L++   +  ++    V +       MV E+A+
Sbjct  1    MQQAIPYKSWLPLYTNNKPLI---SPSQLISHQRNGGAVAAQQVLKGSRNISEMVQENAI  57

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG--AGDRAEKKGLQ  260
            +VF RRGCCM HV +RLL  LGVNP V EIDE  E  V+EELE IG    G    K  +Q
Sbjct  58   IVFARRGCCMSHVAKRLLLGLGVNPAVYEIDEADEISVLEELEMIGNDIGGKGNNKNKVQ  117

Query  259  FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            FPA+FIGG+LFGGLD +MA HISGEL P+LK+AGALWL
Sbjct  118  FPALFIGGKLFGGLDTLMATHISGELVPILKEAGALWL  155



>ref|XP_011047709.1| PREDICTED: glutaredoxin-C9-like [Populus euphratica]
Length=153

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPYK+W  +  + KP++   S   L++   +   +  + V +       MV E+A+
Sbjct  1    MQQAIPYKSWQPLYTNNKPLI---SPFQLISHHNNGGVVATEEVLKGSGNMSKMVQENAI  57

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VF RRGCCM  V +RLL  LGVNP V EIDE  E   +EELE I   G +  KK +QFP
Sbjct  58   IVFARRGCCMSLVAKRLLLGLGVNPAVYEIDEADEISALEELEIICNDGGKGSKKKVQFP  117

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            A+FIGG+LFGGLD++MAAHISGEL P+LK+AGALWL
Sbjct  118  ALFIGGKLFGGLDKLMAAHISGELVPILKEAGALWL  153



>ref|XP_010323755.1| PREDICTED: glutaredoxin-C9-like [Solanum lycopersicum]
Length=148

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 100/158 (63%), Gaps = 13/158 (8%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+A+PYK+         P V        +N     S +YV G KE  +   N+V ++AV
Sbjct  2    MQQALPYKSSCI---SLTPRVDRHHRVSNIN-----SLLYVKGSKEELN---NVVKDNAV  50

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseide--evekevieelesIGGAGDRAEKKGLQ  260
            +V GRRGCCM HVV+RLL  LG NP + EI+E  E E     E   + G  DR +   LQ
Sbjct  51   IVVGRRGCCMSHVVKRLLHCLGANPAIYEIEEDDENEVVDELENIIVAGGSDRKDTGRLQ  110

Query  259  FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            FPAVF+GG LFGGLDRIMAAHI+GELTPVLK+AGALWL
Sbjct  111  FPAVFVGGELFGGLDRIMAAHITGELTPVLKKAGALWL  148



>ref|XP_002310416.1| hypothetical protein POPTR_0007s01400g [Populus trichocarpa]
 gb|EEE90866.1| hypothetical protein POPTR_0007s01400g [Populus trichocarpa]
Length=153

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPYK+W  +  + KP++   S   L+ +  +   +    V +       MV E+A+
Sbjct  1    MQQAIPYKSWPPLYTNNKPLI---SPFQLIARHNNGGVVATQEVLKGSGNMSKMVQENAI  57

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VF RRGCCM  V +RLL  LGVNP V EIDE  E  V+EELE I   G +  KK +QFP
Sbjct  58   IVFARRGCCMSLVAKRLLLGLGVNPAVYEIDEADEISVLEELEMICNDGGKGSKKKVQFP  117

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            A+FIGG+LFGGLD++MAAHISGEL P+LK+AGALWL
Sbjct  118  ALFIGGKLFGGLDKLMAAHISGELVPILKEAGALWL  153



>ref|XP_006372767.1| hypothetical protein POPTR_0017s04860g [Populus trichocarpa]
 gb|ERP50564.1| hypothetical protein POPTR_0017s04860g [Populus trichocarpa]
Length=155

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPYK+WL +  + KP++   S + L++   +   +    V +       MV E+A+
Sbjct  1    MQQAIPYKSWLPLYTNNKPLI---SPSQLISHHSNGGVVAAQEVLKGSRNISEMVQENAI  57

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG--AGDRAEKKGLQ  260
            +VF RRGCCM HV +RLL  LGVNP V EIDE  E  V+EELE IG    G    KK +Q
Sbjct  58   IVFARRGCCMSHVAKRLLLGLGVNPAVYEIDEADEISVLEELEMIGNDIGGKGNNKKKVQ  117

Query  259  FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            FPA+ IGG+LFGGLD +MA HISGEL P+LK+AGALWL
Sbjct  118  FPALVIGGKLFGGLDTLMATHISGELVPILKEAGALWL  155



>ref|XP_003607518.1| Glutaredoxin-C9 [Medicago truncatula]
 gb|AES89715.1| glutaredoxin-C1 protein [Medicago truncatula]
 gb|AFK38565.1| unknown [Medicago truncatula]
Length=155

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 11/161 (7%)
 Frame = -2

Query  613  MQEAIPYKTWL-----TMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMV  449
            MQ+AIPY++W      T     KP +   +         S      +  +E K    NMV
Sbjct  1    MQQAIPYRSWTHNTSTTHFNVIKPHILTTTKIHNTIDESSHRPSSFNFNEEDKTMFHNMV  60

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
            +E+AV+VF RRGCCM HVV+RLL  LGVNP V E++E+ E  +++ELESI      A ++
Sbjct  61   SENAVIVFARRGCCMSHVVKRLLLGLGVNPAVHEVEEKDEVGLVKELESI------ANEE  114

Query  268  GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             +QFPAVFIGG LFGGLDRIMA HISGEL P+LKQAGALWL
Sbjct  115  KVQFPAVFIGGNLFGGLDRIMATHISGELVPILKQAGALWL  155



>ref|XP_010245570.1| PREDICTED: glutaredoxin-C9-like [Nelumbo nucifera]
Length=142

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 103/156 (66%), Gaps = 14/156 (9%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY+ WL +       +G   + P ++   SS S             K MV+E+AV
Sbjct  1    MQQAIPYRNWLRVTAAADGPIGR--TPPAVHAETSSVS---------GKSVKGMVSENAV  49

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFG+RGCCM HV++RLL  LGVNP V E+DE  E  VI+EL ++GG  D       QFP
Sbjct  50   IVFGKRGCCMSHVMKRLLLGLGVNPAVCEVDEADEVRVIDELSTVGGGKDHGRP---QFP  106

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGG+LFGGLDR+M AHISG+L PVLKQAGALWL
Sbjct  107  AVFIGGKLFGGLDRLMGAHISGDLIPVLKQAGALWL  142



>ref|XP_010093967.1| hypothetical protein L484_010533 [Morus notabilis]
 gb|EXB54954.1| hypothetical protein L484_010533 [Morus notabilis]
Length=150

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 102/162 (63%), Gaps = 18/162 (11%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPYK+WL  P    P     + A +  +AG+  +          D   ++VTE+AV
Sbjct  1    MQQAIPYKSWL--PLHAAPTSLALNGADVRLQAGAGGN----------DRVTSLVTENAV  48

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG----  266
             VF RRGCCM HVV+ LL   G NP V E+DE  E  V  ELE+   AGDR  K      
Sbjct  49   TVFARRGCCMGHVVKHLLLGHGANPAVCELDEADEIAVAGELEAAIYAGDREGKASPGSR  108

Query  265  --LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              +QFPAVFIGGRLFGGLDR+MAAHISGEL P+LKQAGALWL
Sbjct  109  PTVQFPAVFIGGRLFGGLDRVMAAHISGELVPLLKQAGALWL  150



>gb|KDP24071.1| hypothetical protein JCGZ_25728 [Jatropha curcas]
Length=145

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (68%), Gaps = 21/161 (13%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNM---VTE  443
            MQ+AIPYK+WL +           +++P +   G++        KE   G++NM   V E
Sbjct  1    MQQAIPYKSWLPL----------YTTSPPIGVFGTNKG------KEFLKGSRNMANLVQE  44

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRA--EKK  269
            +A++VF RRGCCM HVV+RLL  LGVNP + EIDE+ E  V++ELE I G G+    + K
Sbjct  45   NAIIVFARRGCCMSHVVKRLLLGLGVNPPIYEIDEDDEAGVLQELEIIVGGGNSGADDDK  104

Query  268  GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             + FPAVFIGGRLFGGLDR+MA HISGEL P+LK+AGALWL
Sbjct  105  KVLFPAVFIGGRLFGGLDRLMATHISGELVPILKEAGALWL  145



>ref|XP_010689814.1| PREDICTED: glutaredoxin-C9-like [Beta vulgaris subsp. vulgaris]
Length=148

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 101/156 (65%), Gaps = 8/156 (5%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +A+PYKTW T   +  P     +S P  N   SSS+  V   +      K+++ E+AV
Sbjct  1    MYQALPYKTWHTT--NLFP-----ASPPFNNLFTSSSNGTVAKTRH-NTNMKSLIDENAV  52

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            ++FGRRGCCM HVVRRLL  LGVNP V ++DE+ E+ V +EL  +   G+      + FP
Sbjct  53   IIFGRRGCCMSHVVRRLLLGLGVNPNVYDVDEQDEQSVFDELNKMSPTGNAVNNCPVTFP  112

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             VFIGGR FG LDRI+A HI+GELTP+LK AGALWL
Sbjct  113  TVFIGGRWFGDLDRIIATHITGELTPILKDAGALWL  148



>ref|NP_001235378.1| uncharacterized protein LOC100306716 [Glycine max]
 gb|ACU15023.1| unknown [Glycine max]
 gb|KHM99714.1| Glutaredoxin-C9 [Glycine soja]
Length=173

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 108/175 (62%), Gaps = 21/175 (12%)
 Frame = -2

Query  613  MQEAIPYKTW--LTMPRDCKPVVGNQSSAPLMNKAGSSS---SMYVDGVKEPKDG-----  464
            MQ+AIPY++W  L  P +        S   L+  +  S+   S+  D   EP +      
Sbjct  1    MQQAIPYRSWQPLITPTNANTTHFTISPHTLVTFSTVSTTELSLKDDIGSEPNNNIHNSD  60

Query  463  ---------AKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekeviee  311
                       NMV ESA++VF RRGCCM HVV+RLL  LGVNP V E++E  E  V+ E
Sbjct  61   NPFFVSSKMVPNMVLESAIIVFARRGCCMSHVVKRLLLGLGVNPAVHEVEESDEVGVVRE  120

Query  310  lesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            LE+I GA +   K  +QFPAVFIGG+LFGGLD++MA HISGEL P+LK+AGALWL
Sbjct  121  LEAIVGANNGGNK--MQFPAVFIGGKLFGGLDKVMATHISGELVPILKEAGALWL  173



>ref|XP_010260343.1| PREDICTED: glutaredoxin-C9-like [Nelumbo nucifera]
Length=144

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 104/157 (66%), Gaps = 14/157 (9%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+A+PY+ WL +       +G  S A  M +A SS +             K MV+E+AV
Sbjct  1    MQQALPYRAWLPVGAS-GSAIGRASPAVHMEEASSSLA---------GKSVKGMVSENAV  50

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIG-GAGDRAEKKGLQF  257
            +VFG+RGCCM HV++RLL  LGVNP V E+DE  E  V+EEL ++G G  D       QF
Sbjct  51   IVFGKRGCCMCHVMKRLLLGLGVNPAVCEVDEADEVRVVEELATVGDGNKDHGRP---QF  107

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            PAVFIGGRLFGGLDR+M AHISG+L PVLKQAGALWL
Sbjct  108  PAVFIGGRLFGGLDRLMGAHISGDLIPVLKQAGALWL  144



>ref|XP_008232053.1| PREDICTED: glutaredoxin-C9-like [Prunus mume]
Length=152

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 99/160 (62%), Gaps = 12/160 (8%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNK----AGSSSSMYVDGVKEPKDGAKNMVT  446
            M +AIPYK+W          +G  ++ PL+ +    A ++    + G +      KNMV+
Sbjct  1    MHQAIPYKSWAP--------IGTTAAVPLIRRTNPTAVAAEDKIIQGTRNDHVMIKNMVS  52

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG  266
            E+AV+VF RRGCCM HVV+RLL   GVNP V E+DE  E EV    E     G    K  
Sbjct  53   ETAVIVFTRRGCCMGHVVQRLLLGHGVNPTVYEVDEGKEDEVAVAKELEMICGGSKSKAV  112

Query  265  LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            + FPAVFIGG LFGGL+ ++AAHISGEL PVLKQAGALWL
Sbjct  113  VMFPAVFIGGELFGGLESVIAAHISGELVPVLKQAGALWL  152



>ref|XP_007043710.1| Glutaredoxin, putative [Theobroma cacao]
 gb|EOX99541.1| Glutaredoxin, putative [Theobroma cacao]
Length=145

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 105/162 (65%), Gaps = 23/162 (14%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPL------MNKAGSSSSMYVDGVKEPKDGAKNM  452
            MQ+AIPYK+W   P  C     +++ + L      +++ G S  +             N+
Sbjct  1    MQQAIPYKSW---PLPCATTTSHRAPSTLGHNNLVLSRGGGSKDVL------------NI  45

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V E+AV+VF R+GCCM HVVRRLL  LGVNP V EID++ E  V+ ELE I   GD  +K
Sbjct  46   VLENAVIVFARKGCCMSHVVRRLLLALGVNPAVYEIDDKDEVGVLNELEMIC-KGDGKDK  104

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            K +Q PAVFIGGRLFGGLD++MA HISGEL PVLK AGALWL
Sbjct  105  K-VQLPAVFIGGRLFGGLDKVMATHISGELVPVLKDAGALWL  145



>ref|XP_007219160.1| hypothetical protein PRUPE_ppa016347mg [Prunus persica]
 gb|EMJ20359.1| hypothetical protein PRUPE_ppa016347mg [Prunus persica]
Length=152

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 97/160 (61%), Gaps = 12/160 (8%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNK----AGSSSSMYVDGVKEPKDGAKNMVT  446
            M +AIPYK+W          +G  +  PL+ +    A ++    + G +      KNMV+
Sbjct  1    MHQAIPYKSWAP--------IGTTTVVPLIRRPNPTAVAAEDKIIQGTRNDHVMIKNMVS  52

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG  266
            E+AV+VF RRGCCM HVV+RLL   GVNP + E+ E  E E+    E     G    K  
Sbjct  53   ETAVIVFTRRGCCMGHVVQRLLLGHGVNPTLYEVGEGKEDEIAVAKELEMICGGSKSKVV  112

Query  265  LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            + FPAVFIGG LFGGL+ ++AAHISGEL PVLKQAGALWL
Sbjct  113  VMFPAVFIGGELFGGLESVIAAHISGELVPVLKQAGALWL  152



>gb|AFK35318.1| unknown [Lotus japonicus]
Length=165

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 100/173 (58%), Gaps = 25/173 (14%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVV-----------------GNQSSAPLMNKAGSSSSMYVDG  485
            M +AIPY++W   P    P                    N S+    NK   S   + D 
Sbjct  1    MHQAIPYRSW--RPHHHNPTTSFTPHPLITQYSHITTNNNTSNDEDKNKNKKSDHSF-DS  57

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
                    + MV+E+AV+VFGRRGCCM HVV+RLL  LGVNP   E++E+ E +   ELE
Sbjct  58   SNNSGSMVRKMVSENAVIVFGRRGCCMSHVVKRLLLGLGVNPATHEVEEKDEVDFTRELE  117

Query  304  sIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +I   G     K LQFP VFIGG+LFGGL+R+MA HISGEL P+LKQAGALWL
Sbjct  118  AIIDDG-----KLLQFPVVFIGGKLFGGLERLMATHISGELVPLLKQAGALWL  165



>ref|XP_002509419.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF50806.1| glutaredoxin, grx, putative [Ricinus communis]
Length=146

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 106/156 (68%), Gaps = 10/156 (6%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEAIP++T++           + S+  L ++ G +  +  +G    ++  + +V E++V
Sbjct  1    MQEAIPFRTYI------PATATSGSNRQLPSRDGGNVLVLANG----ENYVQKLVLENSV  50

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFG+RGCCM HVV+RLL  LGVNP V E+DE+ E  +I+EL  I G  +R +   +QFP
Sbjct  51   IVFGKRGCCMCHVVKRLLLGLGVNPAVFEVDEKEETAIIDELSIIDGDTEREDGGQVQFP  110

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             VF+GG+LFGGL+R+MA HISGEL P+LK AGALWL
Sbjct  111  VVFVGGKLFGGLERVMATHISGELVPILKDAGALWL  146



>ref|XP_007149799.1| hypothetical protein PHAVU_005G099700g [Phaseolus vulgaris]
 gb|ESW21793.1| hypothetical protein PHAVU_005G099700g [Phaseolus vulgaris]
Length=157

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 99/161 (61%), Gaps = 9/161 (6%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGV-----KEPKDGAKNMV  449
            M +AIP+++W    R       + +  PL+  + + +    + V      + +    NMV
Sbjct  1    MHQAIPFRSW----RPLHNPTTHFTPLPLITHSHNDAHKKTNTVTTKTTHQEETMVLNMV  56

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
             E+AV V GRRGCCM HVV RLL  LGVNP V E++E  E  V  +LE+       A + 
Sbjct  57   WENAVTVVGRRGCCMSHVVNRLLLSLGVNPAVYEVEETDEATVTTQLEATVRTQGMAPQG  116

Query  268  GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             LQFPAVFIGG+LFGGLDRIMA HISGEL P+LKQAGALWL
Sbjct  117  KLQFPAVFIGGKLFGGLDRIMATHISGELVPLLKQAGALWL  157



>emb|CAN60168.1| hypothetical protein VITISV_003664 [Vitis vinifera]
Length=101

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            MV+E+AV+VFGRRGCCM HVV+RLL  LGVNP V E++EE E  V++EL  +G AG+  +
Sbjct  1    MVSENAVIVFGRRGCCMTHVVKRLLLGLGVNPAVCEVNEEDEIGVLDELGMVG-AGE-GK  58

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +  +QFPAVFIGGRLFGGLDR+MAAHI+GEL P+LKQAGALWL
Sbjct  59   QGAVQFPAVFIGGRLFGGLDRVMAAHITGELVPILKQAGALWL  101



>gb|KDP21018.1| hypothetical protein JCGZ_21489 [Jatropha curcas]
Length=150

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEAIP++T++  P      V N+   P     GS+S   V  +   ++  + +V E++V
Sbjct  1    MQEAIPFRTYI--PATATSGV-NRLFPP--RDGGSTSGGNVVELANGENYVQKLVLENSV  55

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFG+RGCCM HVV+RLL  LGVNP V E+DE+ E  VI EL  I G  D  +   +QFP
Sbjct  56   IVFGKRGCCMCHVVKRLLLGLGVNPTVFEVDEKEEAAVINELSIINGRKD-VDGGEVQFP  114

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             VF+GG+LFGGL+R+MA HISGEL P+LK+AGALWL
Sbjct  115  VVFVGGKLFGGLERVMATHISGELVPILKEAGALWL  150



>ref|XP_003543318.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=174

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 30/180 (17%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGS--------------------SSSMY  494
            M +AIPY++W    R       + +  PL+  + +                    SSS+ 
Sbjct  1    MHQAIPYRSW----RHLHNPTTHFTPLPLITHSHNDDDKKTKNIIVNNNNTINIHSSSVL  56

Query  493  VDGVKEPKDGAK---NMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideeveke  323
            V    + K+G K   NMV+E+AV+V  RRGCCM HVV+RLL  LGVNP V E++E+ E+ 
Sbjct  57   VS--PKEKEGMKMVLNMVSENAVIVIARRGCCMSHVVKRLLLGLGVNPAVYEVEEKDEEG  114

Query  322  vieelesIGGAGDRAEKKG-LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            V  +LE+   + D   ++G +QFP VFIGG+LFGGLDRIMA HISGEL P+LK+AGALWL
Sbjct  115  VATQLEATIRSDDGNTQQGKVQFPTVFIGGKLFGGLDRIMATHISGELVPILKKAGALWL  174



>ref|XP_004248179.2| PREDICTED: glutaredoxin-C9-like [Solanum lycopersicum]
Length=109

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 83/109 (76%), Gaps = 6/109 (6%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIG----GAG  287
            MVTE+AV+VF RRGCCM HV++RLLQ LG NPV+ +I+E+ E E I ELE IG    G G
Sbjct  1    MVTENAVIVFRRRGCCMSHVIKRLLQCLGANPVMYDIEEKYENEAITELEDIGKSIDGGG  60

Query  286  DRAEKKGLQ--FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            DR E + L    PAVFIGG LFGGLDRIM AHISGEL PVLK AGALWL
Sbjct  61   DRREDRSLSSPLPAVFIGGELFGGLDRIMEAHISGELCPVLKNAGALWL  109



>ref|XP_004505534.1| PREDICTED: glutaredoxin-C9-like [Cicer arietinum]
Length=151

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQS-SAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESA  437
            MQ+AIPY++W         V+   + +   ++     SS     ++  +    +MV+++A
Sbjct  1    MQQAIPYRSWTHTSTTHFNVINPHTLTKNKIHNTIDESSHKPSSLE--RTMVVSMVSDNA  58

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            ++VF R+GCCM HVV+RLL  LGVNP + E++E+ E +++ ELESI  + D      +QF
Sbjct  59   IIVFARQGCCMSHVVKRLLLGLGVNPAIHEVEEKDEVDMVRELESIIASDD----GKVQF  114

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            PAVFIGG+LFGGLDRIMA HISGEL P+LKQAGALWL
Sbjct  115  PAVFIGGKLFGGLDRIMATHISGELVPILKQAGALWL  151



>ref|XP_008455946.1| PREDICTED: glutaredoxin-C9-like [Cucumis melo]
Length=148

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 8/156 (5%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +AIPY++W ++  D K         P     G S+SM  +G    +D   + V+ESA 
Sbjct  1    MHQAIPYRSWQSI--DTKQTTLAMRP-PWAGSVGGSASMPSEGGGRRRDVVAS-VSESAA  56

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VF RRGCCM HVV+RLL  LG NP V E+DEE E  V++ELE    A  ++    LQ P
Sbjct  57   IVFARRGCCMSHVVKRLLLGLGANPAVYEVDEEHESGVLKELE----AFAKSSNVNLQLP  112

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGG LFGGLDR+MA HISG+L P+LKQAGALWL
Sbjct  113  AVFIGGTLFGGLDRVMATHISGDLVPILKQAGALWL  148



>ref|XP_007132762.1| hypothetical protein PHAVU_011G122900g [Phaseolus vulgaris]
 gb|ESW04756.1| hypothetical protein PHAVU_011G122900g [Phaseolus vulgaris]
Length=142

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 14/156 (9%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY++W       +P++   SS+P  +    +++  +           NMV E+AV
Sbjct  1    MQQAIPYRSW-------QPLI---SSSPTTHFTTINNTTNITPSFVSTKMVPNMVLENAV  50

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VF RRGCCM HVV RLL  LGVNP + E++E  E  V+ ELE+I G  +      +QFP
Sbjct  51   IVFARRGCCMSHVVNRLLLGLGVNPAMHEVEEHDEVGVVRELEAIVGGNENK----MQFP  106

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGG+LFGGLDR+MA HISGEL P+LK+A ALWL
Sbjct  107  AVFIGGKLFGGLDRVMATHISGELVPILKEARALWL  142



>ref|XP_002517842.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF44360.1| glutaredoxin, grx, putative [Ricinus communis]
Length=149

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 93/165 (56%), Gaps = 25/165 (15%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAK------NM  452
            MQ+AIPYK+WL                PL  K  S  +++       K   K      NM
Sbjct  1    MQQAIPYKSWL----------------PLYTKTTSPLTLFGTATTAAKQVLKGSTNMGNM  44

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNP---vvseideevekevieelesIGGAGDR  281
            V E+A++VF ++GCCM HVV+RLL  LGVNP    + E +E    + +E +       + 
Sbjct  45   VRENAIIVFAKKGCCMSHVVKRLLLGLGVNPPIFEIDEQEEISVLQELELIVDNNKDDNN  104

Query  280  AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 +Q PAVFIGGRLFGGLDR+MA HISGEL P+LK AGALWL
Sbjct  105  GNDDKVQLPAVFIGGRLFGGLDRLMATHISGELVPILKDAGALWL  149



>ref|XP_006469072.1| PREDICTED: glutaredoxin-C9-like [Citrus sinensis]
Length=152

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 103/167 (62%), Gaps = 26/167 (16%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPK----DGAKNMVT  446
            MQ+AIPYK+W             Q   PL + + S+SS     V+ P     D   +MV+
Sbjct  1    MQQAIPYKSW-------------QPFDPLSHSSVSTSSKR--AVRGPSINTTDVVSSMVS  45

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseide-------evekevieelesIGGAG  287
            E+AV+VF +RGCCM HVV+RLL  LG NP V E+DE           E+I    +  G+ 
Sbjct  46   ENAVIVFAKRGCCMSHVVKRLLLGLGANPCVYEVDEGDDEARVLDALEMIVNNNNSNGSH  105

Query  286  DRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            D  +++ +QFPAVFIGG+LFGGLDRIMA HI+GEL PVLK+A ALWL
Sbjct  106  DDRDRQKVQFPAVFIGGKLFGGLDRIMATHITGELIPVLKEAKALWL  152



>ref|XP_002278515.1| PREDICTED: glutaredoxin-C9 [Vitis vinifera]
Length=150

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 18/162 (11%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKN------M  452
            M +A+PY+TW+       P  G  SSA   +     S    DG   P  G K+      M
Sbjct  1    MHQALPYRTWV-------PTTGGGSSAGPSSATIEPS----DGPMNPGVGMKDVTCVTKM  49

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V+E+AV+VFGRRGCCM HVV RLL  LGVNP V E+DEE E  V++EL  +  AG+ A++
Sbjct  50   VSENAVIVFGRRGCCMCHVVMRLLLGLGVNPTVFEVDEEDEAAVVDELSRVI-AGEDAKE  108

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               QFPAVF+GG+LFGGL+R+MA HISGEL P+LK+AGALWL
Sbjct  109  GRPQFPAVFMGGQLFGGLERVMATHISGELVPILKKAGALWL  150



>gb|AFK37553.1| unknown [Medicago truncatula]
 gb|KEH39199.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=140

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 6/104 (6%)
 Frame = -2

Query  457  NMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRA  278
            NMV+E+AV+V G+RGCCM HVV+RLLQ LGVNP + E++EE ++ ++         G+  
Sbjct  43   NMVSENAVIVIGKRGCCMSHVVKRLLQSLGVNPAIHEVEEEKDEVIVARELESIIEGN--  100

Query  277  EKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                +QFP VFIGG+LFGGLDR+MA HISGEL P+LKQAGALWL
Sbjct  101  ----VQFPMVFIGGKLFGGLDRLMATHISGELVPLLKQAGALWL  140



>gb|KHN07783.1| Glutaredoxin-C9 [Glycine soja]
Length=176

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 106/178 (60%), Gaps = 24/178 (13%)
 Frame = -2

Query  613  MQEAIPYKTW--LTMPRDCKPVVGNQSSAPLMNKAGSSSSMYV------DGVK-EPKDG-  464
            MQ+AIPY++W  L  P +        S   L+  +  S++         D +  EP +  
Sbjct  1    MQQAIPYRSWQPLITPTNANTTHFTISPHTLVTFSTVSTTELSLKDDIGDNIGLEPNNNN  60

Query  463  ------------AKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekev  320
                          NMV E+A++VF  RGCCM HVV+RLL  LG NP V E++E  E  V
Sbjct  61   NGNSHFFISSKMVPNMVLENAIIVFASRGCCMSHVVKRLLLGLGANPAVHEVEESDEVGV  120

Query  319  ieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            + ELE+I GA +   K  +QFPAVFIGG+LFGGLDR+MA HISGEL P+LK+AGALWL
Sbjct  121  VRELEAIVGANNGGNK--MQFPAVFIGGKLFGGLDRVMATHISGELIPILKEAGALWL  176



>ref|XP_006446718.1| hypothetical protein CICLE_v10017057mg [Citrus clementina]
 gb|ESR59958.1| hypothetical protein CICLE_v10017057mg [Citrus clementina]
Length=153

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 99/168 (59%), Gaps = 27/168 (16%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPK----DGAKNMVT  446
            MQ+AIPYK+W             Q   PL + + S+SS     V+ P     D   +MV+
Sbjct  1    MQQAIPYKSW-------------QPFDPLSHSSVSTSSKR--AVRGPSINTTDVVSSMVS  45

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNP--------vvseideevekevieelesIGGA  290
            E+AV+VF +RGCCM HVV+RLL  LG NP               +  + ++    +  G+
Sbjct  46   ENAVIVFAKRGCCMSHVVKRLLLGLGANPCVYEVDEGDDEASVLDALEMIVNNNNNNNGS  105

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             D  +++ +QFPAVFIGG+LFGGLDRIMA HI+GEL PVLK+A ALWL
Sbjct  106  HDDRDRQKVQFPAVFIGGKLFGGLDRIMATHITGELIPVLKEAKALWL  153



>ref|NP_001274138.1| glutaredoxin-C9-like [Cucumis sativus]
 gb|AGX01498.1| glutaredoxin [Cucumis sativus]
Length=150

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +AIPY++W ++    +  +  +         GS++SM  +G    +D   + V+ESA 
Sbjct  1    MHQAIPYRSWQSIDTK-QTTLSMRPPWAATVVGGSAASMPSEGGGRRRDVVAS-VSESAA  58

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VF RRGCCM HVV+RLL  LG NP V E+DEE E  V++ELE    A  ++    LQ P
Sbjct  59   IVFARRGCCMSHVVKRLLLGLGANPAVYEVDEEQESGVLKELE----AFAKSSNVNLQLP  114

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVFIGG LFGGLDR+MA HISG+L P+LKQAGALWL
Sbjct  115  AVFIGGTLFGGLDRVMATHISGDLVPILKQAGALWL  150



>ref|XP_010686392.1| PREDICTED: glutaredoxin-C9-like [Beta vulgaris subsp. vulgaris]
Length=137

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 99/156 (63%), Gaps = 19/156 (12%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEA+P+K W T+     P+    S++ + N+ GS + + ++          N+V E+ V
Sbjct  1    MQEALPFKRWETL--TATPMA---SASHIGNEIGSDTIIKME----------NLVKENPV  45

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +VFG++GCCM HVVR+LL  LGVNP + EID  V + ++    S  G  +      LQ P
Sbjct  46   IVFGKKGCCMCHVVRKLLLGLGVNPPIFEIDGHVNESLMVSSFSNIGENNN----NLQLP  101

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             VF+GG LFGGL+++MA H+SGEL P+LKQAGALWL
Sbjct  102  VVFVGGELFGGLEKVMATHLSGELVPILKQAGALWL  137



>ref|XP_006467721.1| PREDICTED: glutaredoxin-C9-like [Citrus sinensis]
 gb|KDO77717.1| hypothetical protein CISIN_1g032368mg [Citrus sinensis]
Length=142

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 99/162 (61%), Gaps = 26/162 (16%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGA----KNMVT  446
            MQEAIPY+T++  P                  AG++SS    GV E  D A    + M+ 
Sbjct  1    MQEAIPYRTYIHGPA---------------VAAGNTSSARGGGVTEEADTAAKSVEKMLV  45

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG  266
            E+AV+V GR GCCM HVV+ LL   GVNP V E+ +  E  V++EL  I       E  G
Sbjct  46   ENAVLVLGRPGCCMCHVVKTLLLGHGVNPAVFEVADGDEAAVLDELSRI-----DVENGG  100

Query  265  --LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              +QFPAVF+GG+LFGGLDR+MA HISG+L P+LK+AGALWL
Sbjct  101  GIIQFPAVFVGGKLFGGLDRVMATHISGDLVPILKEAGALWL  142



>ref|XP_009409082.1| PREDICTED: monothiol glutaredoxin-S3-like [Musa acuminata subsp. 
malaccensis]
Length=146

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 96/160 (60%), Gaps = 18/160 (11%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY      P +        S AP   + G SS     GV E     K  V E+ V
Sbjct  1    MQQAIPYGNGRAWPSEVDL---TSSDAP---EFGESSK----GVGE----IKRAVEENPV  46

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGD----RAEKKG  266
            VV GRRGCCMVHVVR+LL   GVNPVV E+ E+ ++  +       GAGD    +A+  G
Sbjct  47   VVVGRRGCCMVHVVRKLLLGQGVNPVVCEVGEDADEAALMAGLQEAGAGDSGLPQAKASG  106

Query  265  LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               PAVF+GGRL GGLDR+MA HI+GEL P+LKQAGALWL
Sbjct  107  AGLPAVFVGGRLVGGLDRLMAVHIAGELVPILKQAGALWL  146



>ref|NP_001240908.1| uncharacterized protein LOC100792704 [Glycine max]
 gb|ACU23720.1| unknown [Glycine max]
Length=160

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 101/164 (62%), Gaps = 12/164 (7%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAK--------  458
            M +AIPY++W    R       + S  PL+  + +      + V    +           
Sbjct  1    MHQAIPYRSW----RPLHNPTTHFSPLPLIAHSHNDDDKMRNIVNNNNNNIHSSAGRMVL  56

Query  457  NMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRA  278
            NMV+E+AV+V GRRGCCM HVV+ LL  LGVNP V E++E+ E+ V ++LE    +    
Sbjct  57   NMVSENAVIVIGRRGCCMSHVVKHLLLGLGVNPAVYEVEEKDEEGVAKQLEETVRSDGNT  116

Query  277  EKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            ++  +QFPAVFIGG+LFGGLDRIMA HI GEL P+LK+AGALWL
Sbjct  117  QQGKVQFPAVFIGGKLFGGLDRIMATHIYGELVPILKKAGALWL  160



>ref|XP_007025525.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY28147.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=181

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 101/157 (64%), Gaps = 8/157 (5%)
 Frame = -2

Query  616  AMQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESA  437
            +MQEAI YK+ +           N SS+PL N  G S+S         ++    +V E+A
Sbjct  33   SMQEAISYKSHMA-------ATANGSSSPLRNSLGGSNSSGGLVANGTENSVTKLVLENA  85

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            V+VFGR+GCCM HVV+RLL   GVNP V E+DEE E+ V+ EL  I G         +QF
Sbjct  86   VIVFGRQGCCMCHVVKRLLLGHGVNPAVCEVDEEKEEAVLTELSRINGERGGERGG-VQF  144

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            PAVF+GG+LFGGLDR+M+ HISGEL P+LK AGALWL
Sbjct  145  PAVFVGGKLFGGLDRVMSTHISGELVPILKDAGALWL  181



>ref|NP_001235171.1| uncharacterized protein LOC100527118 [Glycine max]
 gb|ACU16165.1| unknown [Glycine max]
Length=172

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 103/177 (58%), Gaps = 26/177 (15%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDG----------  464
            MQ+AIPY++W   P          +   +     + S++   G+  PKD           
Sbjct  1    MQQAIPYRSW--QPLITHTSTTTTTHFTISPHTLTYSTVSPTGLS-PKDNIGLEPNNNNN  57

Query  463  -----------AKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevi  317
                         NMV E+A++VF  RGCCM HVV+RLL  LG NP V E++E  E  V+
Sbjct  58   GNSHFFISSKMVPNMVLENAIIVFASRGCCMSHVVKRLLLGLGANPAVHEVEESDEVGVV  117

Query  316  eelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             ELE+I GA +   K  +QFPAVFIGG+LFGGLDR+MA HISGEL P+LK+AGALWL
Sbjct  118  RELEAIVGANNGGNK--MQFPAVFIGGKLFGGLDRVMATHISGELIPILKEAGALWL  172



>ref|XP_007148105.1| hypothetical protein PHAVU_006G181300g [Phaseolus vulgaris]
 gb|ESW20099.1| hypothetical protein PHAVU_006G181300g [Phaseolus vulgaris]
Length=134

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 94/156 (60%), Gaps = 22/156 (14%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +AIPY+T       C P  G +  +   +  G + S   D           +V+E+AV
Sbjct  1    MHQAIPYRT-------CIPATGARDHS---HAGGIAESNGADPAT-----VATVVSENAV  45

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            V+ GRRGCCM HVV+RLLQ LGVNP V E+ E+ E  V   L         AE+  LQFP
Sbjct  46   VIIGRRGCCMCHVVKRLLQGLGVNPPVYEVHEDHEATVARYLFPHA-----AEE--LQFP  98

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVF+ G+LFGGL+R+MA HISGEL P+LK AGALWL
Sbjct  99   AVFLAGKLFGGLERVMATHISGELVPILKDAGALWL  134



>ref|XP_003546009.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=133

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 95/161 (59%), Gaps = 33/161 (20%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKE-----PKDGAKNMV  449
            M +AIPY+T +                      G+    +  G+KE     P + A  MV
Sbjct  1    MHQAIPYRTSIL--------------------TGTCDMAHAGGIKEFNLANPSNVAA-MV  39

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
            +ESAVV+ G+RGCCM HVV+RLLQ LGVNP V E+DE+ E  V   L   G        +
Sbjct  40   SESAVVIIGKRGCCMCHVVKRLLQGLGVNPPVYEVDEDHEAAVARHLFPQGA-------E  92

Query  268  GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             +QFPAVF+ G+LFGGL+R+MA HISGEL P+LK AGALWL
Sbjct  93   TVQFPAVFLAGKLFGGLERVMATHISGELIPILKDAGALWL  133



>ref|XP_010052341.1| PREDICTED: glutaredoxin-C9-like [Eucalyptus grandis]
 gb|KCW89584.1| hypothetical protein EUGRSUZ_A01868 [Eucalyptus grandis]
Length=174

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 81/114 (71%), Gaps = 16/114 (14%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            DG + +V+E+A++V GRRGCCM HVV+RLL  LGVNP V E+DEE EK          G 
Sbjct  71   DGVREVVSENALIVVGRRGCCMAHVVKRLLLGLGVNPAVYEVDEEEEK----------GV  120

Query  289  GDRAEK------KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             D  E+        +QFPAVFIGGRLFGGLDR+MA HISGEL P+L+QAGALWL
Sbjct  121  ADELERIGGGGGGEVQFPAVFIGGRLFGGLDRVMATHISGELVPILRQAGALWL  174



>ref|XP_006449418.1| hypothetical protein CICLE_v10017106mg [Citrus clementina]
 gb|ESR62658.1| hypothetical protein CICLE_v10017106mg [Citrus clementina]
Length=142

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 98/162 (60%), Gaps = 26/162 (16%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGA----KNMVT  446
            MQ+AIPY+T++  P                  AG++SS    G  E  D A    + M+ 
Sbjct  1    MQDAIPYRTYIHGPA---------------VAAGNTSSARGGGATEEADTAAKSVEKMLV  45

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG  266
            E+AV+V GR GCCM HVV+ LL   GVNP V E+ +  E  V++EL  I       E  G
Sbjct  46   ENAVLVLGRPGCCMCHVVKTLLLGHGVNPAVFEVADGDEAAVLDELSRI-----DVENGG  100

Query  265  --LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              +QFPAVF+GG+LFGGLDR+MA HISG+L P+LK+AGALWL
Sbjct  101  GIIQFPAVFVGGKLFGGLDRVMATHISGDLVPILKEAGALWL  142



>gb|KHN36670.1| Glutaredoxin-C9 [Glycine soja]
Length=104

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            MV+E+AV+V  RRGCCM HVV+RLL  LGVNP V E++E+ E+ V  +LE+   + D   
Sbjct  1    MVSENAVIVIARRGCCMSHVVKRLLLGLGVNPAVYEVEEKDEEGVATQLEATIRSDDGNT  60

Query  274  KKG-LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            ++G +QFP VFIGG+LFGGLDRIMA HISGEL P+LK+AGALWL
Sbjct  61   QQGKVQFPTVFIGGKLFGGLDRIMATHISGELVPILKKAGALWL  104



>ref|XP_010111166.1| hypothetical protein L484_015048 [Morus notabilis]
 gb|EXC30557.1| hypothetical protein L484_015048 [Morus notabilis]
Length=153

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 99/171 (58%), Gaps = 33/171 (19%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGA---KNMVTE  443
            MQ AIPY+TW+      +P        P  N +G          +EP  GA   + MV E
Sbjct  1    MQHAIPYRTWVPGWTAGEP-------RPPANVSG----------EEPIAGAGAVRAMVLE  43

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvv--------seideevekevieelesIGGA-  290
            +AVVVFGRRGCCM HV++RLL   GVNP V        + + EE+ K         GG  
Sbjct  44   NAVVVFGRRGCCMCHVLKRLLLGHGVNPPVFQVDEDGEAAVAEELSKVNTSNHVKKGGGI  103

Query  289  ---GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G+ +  K +QFP VF+GG++FGGL+R+MA HISGEL P+LK+AGALWL
Sbjct  104  DINGNESSNK-VQFPVVFVGGKVFGGLERVMATHISGELVPILKEAGALWL  153



>gb|KHN08482.1| Glutaredoxin-C9 [Glycine soja]
Length=134

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 10/121 (8%)
 Frame = -2

Query  496  YVDGVKEPK----DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideeve  329
            +  G+KE        A  MV+E+AVV+ G+RGCCM HVV+RLLQ LGVNP V E+DE+ E
Sbjct  20   HAGGIKESNGTYPSKAATMVSENAVVIIGKRGCCMCHVVKRLLQGLGVNPPVYEVDEDHE  79

Query  328  kevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALW  149
               +    S  GA      + +QFPAVF+ G+LFGGL+R+MA HISGEL P+LK AGALW
Sbjct  80   AAAVALHLSPQGA------ETVQFPAVFLAGKLFGGLERVMATHISGELVPILKDAGALW  133

Query  148  L  146
            L
Sbjct  134  L  134



>gb|KHN27916.1| Glutaredoxin-C9 [Glycine soja]
Length=103

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            MV+E+AV+V GRRGCCM HVV+ LL  LGVNP V E++E+ E+ V ++LE    +    +
Sbjct  1    MVSENAVIVIGRRGCCMSHVVKHLLLGLGVNPAVYEVEEKDEEGVAKQLEETVRSDGNTQ  60

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +  +QFPAVFIGG+LFGGLDRIMA HI GEL P+LK+AGALWL
Sbjct  61   QGKVQFPAVFIGGKLFGGLDRIMATHIYGELVPILKKAGALWL  103



>ref|XP_003543019.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=133

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = -2

Query  496  YVDGVKEPK----DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideeve  329
            +  G+KE        A  MV+E+AVV+ G+RGCCM HVV+RLLQ LGVNP V E+DE+ E
Sbjct  20   HAGGIKESNGTYPSKAATMVSENAVVIIGKRGCCMCHVVKRLLQGLGVNPPVYEVDEDHE  79

Query  328  kevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALW  149
              V   L   G        + +QFPAVF+ G+LFGGL+R+MA HISGEL P+LK AGALW
Sbjct  80   AAVALHLSPQGA-------ETVQFPAVFLAGKLFGGLERVMATHISGELVPILKDAGALW  132

Query  148  L  146
            L
Sbjct  133  L  133



>ref|XP_010522588.1| PREDICTED: monothiol glutaredoxin-S13 [Tarenaya hassleriana]
Length=154

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 93/161 (58%), Gaps = 12/161 (7%)
 Frame = -2

Query  613  MQEAIPYKT-WLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGA----KNMV  449
            MQ+AIPYK+ W+       P+ GN    P  N   SS   ++              + MV
Sbjct  1    MQKAIPYKSSWV-------PMYGNSVFNPRNNDGSSSPPSWLQPPSSSSTTTPAKRREMV  53

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
             ESAVVVF RRGCCM HVV+RL+   GVNP+V E+DE+      E  ++           
Sbjct  54   RESAVVVFARRGCCMGHVVKRLVLTHGVNPLVVEVDEDDPIVTSELGQNDDHHNKVISNS  113

Query  268  GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              + P VFIGG+LFGGL+ +MAAHI+G+L P+L+QAGALWL
Sbjct  114  KERLPVVFIGGKLFGGLETVMAAHINGDLVPILRQAGALWL  154



>dbj|BAJ97010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 90/159 (57%), Gaps = 23/159 (14%)
 Frame = -2

Query  613  MQEAIPYKT---WLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            M +AIPY +   W T P    P      +A     A +++S      +E   G +  V+E
Sbjct  1    MYQAIPYSSSRPWTTRP---SPPSAMAEAAVKTETAEAAAS------REDAAGVERAVSE  51

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGL  263
            S VVV GRR CC+ HVV+RLLQ LGVNP V E+ +E              AG   +    
Sbjct  52   SPVVVVGRRACCLTHVVKRLLQGLGVNPAVHEVADEAAL-----------AGVVPDGGEA  100

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              PAVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  101  ALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  139



>ref|XP_011027761.1| PREDICTED: glutaredoxin-C9 [Populus euphratica]
Length=156

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKD-GAKNMVTESA  437
            MQEAIP++ +          +  + S      A S+S+ +V  V   ++   + +V+E++
Sbjct  1    MQEAIPFRAYSPATTAGNRKLPGRDSRD-HGGANSTSAGHVLVVTNGQEYHVQKLVSENS  59

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            + +FG+RGCCM HVV++LL  LGVNP V E++E+ E  VI+ L  I G     +   +QF
Sbjct  60   IAIFGKRGCCMCHVVKKLLLGLGVNPPVFEVEEKEEDYVIKALSMINGDKGGKDADQVQF  119

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            P VF+GG+LFGGL+RIMA+HI+GEL P+LK AGALWL
Sbjct  120  PVVFVGGKLFGGLERIMASHITGELVPILKDAGALWL  156



>gb|EMT17993.1| Monothiol glutaredoxin-S5 [Aegilops tauschii]
Length=140

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 88/158 (56%), Gaps = 20/158 (13%)
 Frame = -2

Query  613  MQEAIPYKT--WLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTES  440
            M +AIPY        P   +P       A ++  AG  S    DG     +  +  V ES
Sbjct  1    MYQAIPYSAGRLPAWPPRSEP-------AEVVGAAGQESRRAGDG----GEAVRRAVAES  49

Query  439  AVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQ  260
             V+V GRRGCC+ HVV RLLQ LGVNP V E+ +E E             GD  ++  + 
Sbjct  50   PVLVVGRRGCCLSHVVERLLQGLGVNPAVHEVADEAELAAAVT-------GDAGDEAVVA  102

Query  259  FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             PAVF+GGRL GGLDR+MA HISGEL P+LK AGALWL
Sbjct  103  LPAVFVGGRLLGGLDRLMAVHISGELVPILKDAGALWL  140



>gb|KGN63206.1| hypothetical protein Csa_2G412500 [Cucumis sativus]
Length=129

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 5/123 (4%)
 Frame = -2

Query  514  GSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseidee  335
            GS++SM  +G    +D   + V+ESA +VF RRGCCM HVV+RLL  LG NP V E+DEE
Sbjct  12   GSAASMPSEGGGRRRDVVAS-VSESAAIVFARRGCCMSHVVKRLLLGLGANPAVYEVDEE  70

Query  334  vekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGA  155
             E  V++ELE    A  ++    LQ PAVFIGG LFGGLDR+MA HISG+L P+LKQAGA
Sbjct  71   QESGVLKELE----AFAKSSNVNLQLPAVFIGGTLFGGLDRVMATHISGDLVPILKQAGA  126

Query  154  LWL  146
            LWL
Sbjct  127  LWL  129



>gb|EMT06809.1| Monothiol glutaredoxin-S5 [Aegilops tauschii]
Length=138

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 18/156 (12%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +AIPY +  T P   +P    +++  +  +   +S+      +E   G +  V+ES V
Sbjct  1    MYQAIPYSS--TRPW-ARPSPAAEAAVAVKTETAEASAS-----REDAAGVERAVSESPV  52

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            VV GRR CC+ HVV+RLLQ LGVNP V E+ +E            G   D  E   L  P
Sbjct  53   VVVGRRACCLTHVVKRLLQGLGVNPAVHEVADEAALA--------GVVPDGGEAAAL--P  102

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  103  AVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  138



>ref|XP_003593663.1| Glutaredoxin-C9 [Medicago truncatula]
 gb|ABN08731.1| Thioredoxin fold [Medicago truncatula]
 gb|AES63914.1| glutaredoxin-C1 protein [Medicago truncatula]
Length=127

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 29/156 (19%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +AIPY+T ++      P+                      G+ E       MV+E+AV
Sbjct  1    MYQAIPYRTSVSTVTRNLPIT--------------------TGILE--SNVTTMVSENAV  38

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            ++ G RGCC+ HVV+RLLQ LGVNP V E+D++ E  V  +L     + + AE   +QFP
Sbjct  39   IIIGTRGCCLCHVVKRLLQGLGVNPPVYEVDQDHETAVAAQL-----STNTAET--VQFP  91

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVF+GG+L GGL+R+MA+HISGEL P+LK AGALWL
Sbjct  92   AVFVGGKLLGGLERVMASHISGELVPILKDAGALWL  127



>ref|XP_008371421.1| PREDICTED: glutaredoxin-C9 [Malus domestica]
 ref|XP_008345899.1| PREDICTED: glutaredoxin-C9-like [Malus domestica]
Length=140

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 95/157 (61%), Gaps = 23/157 (15%)
 Frame = -2

Query  607  EAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGA---KNMVTESA  437
            + IPY TW+   R                 AG ++    D  +E    A   + MV+E+A
Sbjct  4    QTIPYGTWIPGTR-----------------AGHATPSSRDASREQHLAAASVQKMVSENA  46

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            V V GRRGCCM HVV+RLL   GVNP V E+DEE E  V+ EL  + GA    ++   QF
Sbjct  47   VTVVGRRGCCMCHVVKRLLLGHGVNPTVFEVDEEDEIGVVVELRRLIGAD---QEDWPQF  103

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            P VF+GG+LFGGL+R+MA HI+GEL PVLKQAGALWL
Sbjct  104  PVVFVGGKLFGGLERVMATHITGELVPVLKQAGALWL  140



>ref|XP_011001218.1| PREDICTED: glutaredoxin-C9-like [Populus euphratica]
Length=152

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKE-PKDGAKNMVTESA  437
            MQEAIP++ +           GN+      +   ++SS +V  V    ++  + +V E++
Sbjct  1    MQEAIPFRAYSPATTS-----GNRRLPARDHGGANTSSGHVLVVTNGHQNHVQKLVLENS  55

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG--AGDRAEKKGL  263
            V+VFG+RGCCM HVV++LL  LGVNP V E++E+ E +VI+EL  I     GD  ++  +
Sbjct  56   VIVFGKRGCCMCHVVKKLLLGLGVNPPVFEVEEKEEDDVIKELSLINSDRGGDGVDQ--V  113

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            QFP VF+GG+LFGGL+R+MA HI+GEL P+LK AGALWL
Sbjct  114  QFPVVFVGGKLFGGLERVMATHITGELVPILKDAGALWL  152



>ref|XP_009352842.1| PREDICTED: glutaredoxin-C9-like [Pyrus x bretschneideri]
Length=140

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 93/154 (60%), Gaps = 17/154 (11%)
 Frame = -2

Query  607  EAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVV  428
            E IP  TW+          G +     ++  G  S  +V          + +V+E+AV V
Sbjct  4    ETIPQGTWIP---------GTRPGHAALSSRGVPSEQHVAAAS-----VQKLVSENAVTV  49

Query  427  FGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAV  248
             GRRGCCM HVV+RLL   GVNP V E+DE+ E  V+ EL  + G G   ++   QFP V
Sbjct  50   VGRRGCCMCHVVKRLLLGHGVNPTVFEVDEDDETGVVIELRKLTGEG---QEDWQQFPGV  106

Query  247  FIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            F+GG+LFGGL+R+MA HI+GEL PVLKQAGALWL
Sbjct  107  FVGGKLFGGLERVMATHITGELVPVLKQAGALWL  140



>ref|XP_008225159.1| PREDICTED: glutaredoxin-C9-like [Prunus mume]
Length=142

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 93/154 (60%), Gaps = 15/154 (10%)
 Frame = -2

Query  607  EAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVV  428
            +AIPY TW+              + P    + +        V       + +V+E+AV V
Sbjct  4    QAIPYGTWVP------------GTPPGHVSSSARDQQAAAVVSRSAASVQKLVSENAVTV  51

Query  427  FGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAV  248
             GRRGCCM HVV+RLL   GVNP V E+DE+ E  V+ EL  + G G   ++   QFPAV
Sbjct  52   VGRRGCCMCHVVKRLLLGHGVNPTVFEVDEDDESNVVVELRKLIGEG---QEDWPQFPAV  108

Query  247  FIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            F+GG+LFGGL+R+MA HISGEL PVLKQAGALWL
Sbjct  109  FVGGKLFGGLERVMATHISGELVPVLKQAGALWL  142



>ref|XP_010035805.1| PREDICTED: monothiol glutaredoxin-S5-like [Eucalyptus grandis]
Length=223

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 4/109 (4%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            ++  +  V ESAVVVFG+RGCCM HVV RLLQ  G NP V E  +E E  V+ ELE+I G
Sbjct  119  RESTRRAVAESAVVVFGKRGCCMSHVVNRLLQGHGANPAVREFGDEEEAAVVGELETISG  178

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             G    +  +QFPAVF+GG+LFGGLDR+M AHI+GEL P LK AGALWL
Sbjct  179  GG----RGVVQFPAVFVGGKLFGGLDRVMTAHITGELVPALKDAGALWL  223



>ref|XP_006377423.1| glutaredoxin-like family protein [Populus trichocarpa]
 gb|ERP55220.1| glutaredoxin-like family protein [Populus trichocarpa]
Length=152

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKE-PKDGAKNMVTESA  437
            MQEAIP++ +           GN+      +   ++SS +V  V    ++  + +V E++
Sbjct  1    MQEAIPFRAYSPATTS-----GNRRLPARDHGGANTSSGHVLVVTNGHENHVQKLVLENS  55

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            V+VFG+RGCCM HVV+RLL  LGVNP V E++E+ E +VI+EL  I           +QF
Sbjct  56   VIVFGKRGCCMCHVVKRLLLGLGVNPPVFEVEEKEEDDVIKELSMIDSDRGGEGVDQVQF  115

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            P VF+GG+LFGGL+R+MA HI+GEL P+LK AGALWL
Sbjct  116  PVVFVGGKLFGGLERVMATHITGELVPILKDAGALWL  152



>gb|KCW47268.1| hypothetical protein EUGRSUZ_K01064 [Eucalyptus grandis]
Length=173

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 4/109 (4%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            ++  +  V ESAVVVFG+RGCCM HVV RLLQ  G NP V E  +E E  V+ ELE+I G
Sbjct  69   RESTRRAVAESAVVVFGKRGCCMSHVVNRLLQGHGANPAVREFGDEEEAAVVGELETISG  128

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             G    +  +QFPAVF+GG+LFGGLDR+M AHI+GEL P LK AGALWL
Sbjct  129  GG----RGVVQFPAVFVGGKLFGGLDRVMTAHITGELVPALKDAGALWL  173



>ref|XP_002305107.2| glutaredoxin-like family protein [Populus trichocarpa]
 gb|EEE85618.2| glutaredoxin-like family protein [Populus trichocarpa]
Length=153

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDG-AKNMVTESA  437
            MQEAIP++ +          +  + S      A S+S+ +V  V   ++   + +V+E++
Sbjct  1    MQEAIPFRAYSPATTAGNRRLPGRDSRD-HGGANSTSAGHVLVVTNGQESHVQKLVSENS  59

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            + +FG+RGCCM HVV++LL  LGVNP V E++E+ E  VI+ L  I G  D  +   +QF
Sbjct  60   IAIFGKRGCCMCHVVKKLLLGLGVNPPVFEVEEKEEDYVIKALSMIKGGKDADQ---VQF  116

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            P VF+GG+LFGGL+RI+A+HI+GEL P+LK AGALWL
Sbjct  117  PVVFVGGKLFGGLERIIASHITGELVPILKDAGALWL  153



>ref|XP_010052261.1| PREDICTED: glutaredoxin-C9-like [Eucalyptus grandis]
 gb|KCW76201.1| hypothetical protein EUGRSUZ_D00589 [Eucalyptus grandis]
Length=155

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 95/163 (58%), Gaps = 15/163 (9%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY  ++       P        P++   G    M          G    V E+AV
Sbjct  1    MQKAIPYTAYIPASSGPPP--------PVVEGQGRPEGMPAAEEVTGSSGVGRAVAENAV  52

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK------  272
            +V GRRGCCM HV +RLL  LGVNP V E+D+  E  VI+EL+ + G   +         
Sbjct  53   MVIGRRGCCMCHVAKRLLLGLGVNPGVYEVDDAEEGVVIKELKGMIGTNGKDSDGGDGGD  112

Query  271  -KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             + LQFPAVF+GGRLFGGL+++MA HISGEL P+L++AGALWL
Sbjct  113  GQKLQFPAVFVGGRLFGGLEKVMATHISGELVPILREAGALWL  155



>ref|XP_008777321.1| PREDICTED: monothiol glutaredoxin-S3-like [Phoenix dactylifera]
Length=158

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 90/166 (54%), Gaps = 18/166 (11%)
 Frame = -2

Query  613  MQEAIPYKT---WLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            M++AIPY +   W     D   + G +        A   ++   D         + MV E
Sbjct  1    MKQAIPYSSGTAWAPRSDDGGAINGGRQPVEPTGMAARCAASGGD--------IRRMVEE  52

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideeveke-------vieelesIGGAGD  284
            + VVV GRRGCCMVHVVR LL   GVNP V E+ E+ ++                G  G 
Sbjct  53   NRVVVVGRRGCCMVHVVRSLLLGQGVNPTVCEVGEDADEAALIGELPTEMVARCGGDGGA  112

Query  283  RAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               ++G+  PAVF+GGRL GGLDR+MA HISGEL P+LKQAGALWL
Sbjct  113  HLRRQGMALPAVFVGGRLVGGLDRLMAVHISGELVPILKQAGALWL  158



>emb|CDO99478.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -2

Query  511  SSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideev  332
            SS S   DG+         +V+E+AV+ FGRRGCCM +VV++LL  LGVNP +  +DEE 
Sbjct  31   SSKSAENDGMTSSTSQVTRLVSENAVIAFGRRGCCMCYVVKQLLLGLGVNPTIFYVDEED  90

Query  331  ekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGAL  152
            E  +I+EL  I G  +      +QFPAVF+GG+LFGGL+R+MA HI+GEL P+L++A AL
Sbjct  91   EGAIIDELSKIAGVLEGDGNGKVQFPAVFVGGKLFGGLERVMATHITGELVPMLREARAL  150

Query  151  WL  146
            WL
Sbjct  151  WL  152



>ref|XP_008439802.1| PREDICTED: glutaredoxin-C9 [Cucumis melo]
Length=159

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 93/163 (57%), Gaps = 33/163 (20%)
 Frame = -2

Query  622  SMAMQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPK-DGAKNMVT  446
            ++ M +AIPY+TW+                     A +SSS       EP  DG + +V+
Sbjct  26   AIIMHQAIPYRTWI--------------------PAAASSS---RKAHEPSGDGVEKLVS  62

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKG  266
            ++AVVV  RRGCCM HV++ LL   G NP V  + EE E +        G  G+ A   G
Sbjct  63   KNAVVVLARRGCCMSHVLKLLLLGHGTNPAVVVVGEEDEVDTT------GEIGNFASAAG  116

Query  265  ---LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               +QFP VFIGG++FGGL+++MAAHISGEL P LK AGALWL
Sbjct  117  DGRVQFPVVFIGGKMFGGLEKVMAAHISGELVPALKDAGALWL  159



>ref|XP_002893532.1| hypothetical protein ARALYDRAFT_473065 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69791.1| hypothetical protein ARALYDRAFT_473065 [Arabidopsis lyrata subsp. 
lyrata]
Length=121

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 6/108 (6%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+AV+V GRRGCCM HVVRRLL  LGVNP V EI+EE E+EV+ ELE IGG 
Sbjct  20   ESVRMVVEENAVIVIGRRGCCMCHVVRRLLLGLGVNPAVLEIEEEREEEVLRELERIGG-  78

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            GD      ++ PAV++GGRLFGGLDR+MA HISGEL P+LK+ GALWL
Sbjct  79   GDT-----VKLPAVYVGGRLFGGLDRVMATHISGELVPILKEVGALWL  121



>ref|NP_174170.1| glutaredoxin-GRX480 [Arabidopsis thaliana]
 sp|Q9SGP6.1|GRXC9_ARATH RecName: Full=Glutaredoxin-C9; Short=AtGrxC9; AltName: Full=Protein 
ROXY 19 [Arabidopsis thaliana]
 gb|AAF16751.1|AC010155_4 F3M18.8 [Arabidopsis thaliana]
 gb|AAG40382.1|AF325030_1 At1g28480 [Arabidopsis thaliana]
 dbj|BAF01232.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABK32150.1| At1g28480 [Arabidopsis thaliana]
 gb|ACO50423.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE30981.1| glutaredoxin-GRX480 [Arabidopsis thaliana]
Length=137

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 80/106 (75%), Gaps = 3/106 (3%)
 Frame = -2

Query  463  AKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGD  284
             + +V E+AV+V GRRGCCM HVVRRLL  LGVNP V EIDEE E EV+ ELE+IG  G 
Sbjct  35   VRMVVEENAVIVIGRRGCCMCHVVRRLLLGLGVNPAVLEIDEEREDEVLSELENIGVQGG  94

Query  283  RAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                K    PAV++GGRLFGGLDR+MA HISGEL P+LK+ GALWL
Sbjct  95   GGTVK---LPAVYVGGRLFGGLDRVMATHISGELVPILKEVGALWL  137



>ref|XP_008383678.1| PREDICTED: glutaredoxin-C9-like [Malus domestica]
Length=139

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 91/154 (59%), Gaps = 18/154 (12%)
 Frame = -2

Query  607  EAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVV  428
            E IP  TW+   R       +    P      ++S              + +V+E+AV V
Sbjct  4    ETIPLGTWIPGTRPSH--AASSRDIPREQHVAAAS-------------VQKLVSENAVTV  48

Query  427  FGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAV  248
             GRRGCCM HVV+RLL   GVNP V E+DE+ E  V+ EL  + G G   ++   QFP V
Sbjct  49   VGRRGCCMCHVVKRLLLGHGVNPTVFEVDEDDETGVVIELRKLTGEG---QEDWQQFPVV  105

Query  247  FIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            F+GG+LFGGL+R+MA HI+GEL PVLKQAGALWL
Sbjct  106  FVGGKLFGGLERVMATHITGELVPVLKQAGALWL  139



>ref|XP_004166934.1| PREDICTED: glutaredoxin-C9-like [Cucumis sativus]
Length=131

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 89/157 (57%), Gaps = 27/157 (17%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPK-DGAKNMVTESA  437
            M +AIPY+TW+                     A +SSS       EP  DG + +V+++A
Sbjct  1    MHQAIPYRTWIP--------------------AAASSSCKA---HEPSGDGVEKLVSKNA  37

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            VVV  RRGCCM HV++ LL   G NP V  + EE E +   E+      G       +QF
Sbjct  38   VVVLARRGCCMSHVLKLLLLGHGANPAVVVVGEEDEVDTAGEIGKFASGGGDGR---VQF  94

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            P VFIGG++FGGL+R+MAAHISGEL P LK AGALWL
Sbjct  95   PMVFIGGKMFGGLERVMAAHISGELVPALKDAGALWL  131



>ref|XP_009804127.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=167

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 101/168 (60%), Gaps = 13/168 (8%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGN-----------QSSAPLMNKAGSSSSMYVDGVKEPKD  467
            MQ +IPY+ WL           +           +S +   N+  S+S    D       
Sbjct  1    MQRSIPYRNWLPSTTTTTTGGSSSTTSSGGSTLFESYSGESNETYSNSKRNQDKNSGIST  60

Query  466  GAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAG  287
            G   +V+E+A++V   RGCCM +V++ LL  LGVNP + E+++E E++V++EL  I G G
Sbjct  61   GVAKLVSENAIIVIATRGCCMCYVIKNLLLGLGVNPTIFEVNKEDEEDVMKELSRIVG-G  119

Query  286  DRAEKKGL-QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            D     G+ QFP VF+GG+LFGGL+R+M+ HISGEL P+LK+AGALWL
Sbjct  120  DEQNGGGIRQFPVVFVGGKLFGGLERVMSTHISGELIPILKEAGALWL  167



>ref|XP_006852569.1| hypothetical protein AMTR_s00021p00206280 [Amborella trichopoda]
 gb|ERN14036.1| hypothetical protein AMTR_s00021p00206280 [Amborella trichopoda]
Length=124

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 7/103 (7%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            MV+E++V+V GRR CCM HVV++LL  LGVNP V E++E  E E  E+     G G    
Sbjct  29   MVSENSVLVLGRRACCMCHVVKKLLLGLGVNPTVCELEEGAEAEEAEQALGRMGGGT---  85

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                Q PAVFIGGRL GGLDR+MAAHISGEL P+LKQAGALWL
Sbjct  86   ----QLPAVFIGGRLVGGLDRLMAAHISGELVPILKQAGALWL  124



>ref|XP_009344450.1| PREDICTED: glutaredoxin-C9 [Pyrus x bretschneideri]
Length=136

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 94/154 (61%), Gaps = 21/154 (14%)
 Frame = -2

Query  607  EAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVV  428
            + IPY TW+   R      G+ + +       ++S              + +V+E+AV V
Sbjct  4    QTIPYGTWIPGSR-----AGHATPSSREQHLAAAS-------------VQKLVSENAVTV  45

Query  427  FGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAV  248
             GRRGCCM HVV+RLL   GVNP V E+DEE E  V+ EL  + GA    ++   QFP V
Sbjct  46   VGRRGCCMCHVVKRLLLGHGVNPSVFEVDEEDETGVVAELRRLIGAD---QEDWPQFPVV  102

Query  247  FIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            F+GG+LFGGL+R+MA HI+GEL PVLKQAGALWL
Sbjct  103  FVGGKLFGGLERVMATHITGELVPVLKQAGALWL  136



>ref|NP_001274395.1| glutaredoxin [Cucumis sativus]
 gb|AGX01493.1| glutaredoxin [Cucumis sativus]
 gb|KGN49264.1| Glutaredoxin, grx [Cucumis sativus]
Length=131

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 89/157 (57%), Gaps = 27/157 (17%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPK-DGAKNMVTESA  437
            M +AIPY+TW+                     A +SSS       EP  DG + +V+++A
Sbjct  1    MHQAIPYRTWIP--------------------AAASSSCKAH---EPSGDGVEKLVSKNA  37

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            VVV  RRGCCM HV++ LL   G NP V  + EE E +   E+      G       +QF
Sbjct  38   VVVLARRGCCMSHVLKLLLLGHGANPAVVVVGEEDEVDTAGEIGKFASGGGDGR---VQF  94

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            P VFIGG++FGGL+++MAAHISGEL P LK AGALWL
Sbjct  95   PVVFIGGKMFGGLEKVMAAHISGELVPALKDAGALWL  131



>ref|XP_011086033.1| PREDICTED: glutaredoxin-C9-like [Sesamum indicum]
Length=144

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 95/159 (60%), Gaps = 18/159 (11%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY+ WL       P  G  ++ P     G+ +S   + + + K   + +V E+AV
Sbjct  1    MQKAIPYRDWL-------PTAGGSAAPP----PGNINSGEGETIGDAKS-VRKLVAENAV  48

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNP---vvseideevekevieelesIGGAGDRAEKKGL  263
            VVF RRGCCM HVV+ LL   GVNP    V + +E   K  + E+ S G AG+ A     
Sbjct  49   VVFARRGCCMCHVVKLLLHGHGVNPWIFDVDDQNEADVKNELSEIISKGAAGNSAVP---  105

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            Q PAVF+GG LFGGL+ IM AHISG+L P L++A ALWL
Sbjct  106  QLPAVFVGGELFGGLEDIMGAHISGDLVPRLREARALWL  144



>dbj|BAJ98449.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91350.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93547.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 86/162 (53%), Gaps = 30/162 (19%)
 Frame = -2

Query  613  MQEAIPYKT--WLTMPRDCKPVVGN----QSSAPLMNKAGSSSSMYVDGVKEPKDGAKNM  452
            M +AIPY        PR  +    +    Q  AP     G +               +  
Sbjct  1    MYQAIPYSAGRLAAWPRRSEQAEADGAAGQEGAPARGDGGEA--------------VRRA  46

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E E            AGD A  
Sbjct  47   VAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADEAELAAAV-------AGDEAV-  98

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              +  PAVF+GGRL GGLDR+MA HISGEL P+LK AGALWL
Sbjct  99   --VALPAVFVGGRLLGGLDRLMAVHISGELVPILKDAGALWL  138



>emb|CDM83146.1| unnamed protein product [Triticum aestivum]
 emb|CDM83631.1| unnamed protein product [Triticum aestivum]
Length=137

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 19/156 (12%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            M +AIPY +  T P   +P    +++  +  +   +++      +E   G +  V+ES V
Sbjct  1    MYQAIPYSS--TRPW-ARPSPAAEAAVAVKTETTEAAAS-----REDAAGVERAVSESPV  52

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            VV GRR CC+ HVV+RLLQ LGVNP V E+ +E              AG   +      P
Sbjct  53   VVVGRRACCLTHVVKRLLQGLGVNPAVHEVADEAAL-----------AGVVPDGGEAALP  101

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             VF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  102  VVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  137



>dbj|BAK00692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 72/108 (67%), Gaps = 10/108 (9%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  +  V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E E            A
Sbjct  41   EAVRRAVAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADEAELAAAV-------A  93

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            GD A    +  PAVF+GGRL GGLDR+MA HISGEL P+LK AGALWL
Sbjct  94   GDEAV---VALPAVFVGGRLLGGLDRLMAVHISGELVPILKDAGALWL  138



>ref|XP_006303410.1| hypothetical protein CARUB_v10010616mg [Capsella rubella]
 gb|EOA36308.1| hypothetical protein CARUB_v10010616mg [Capsella rubella]
Length=133

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 6/108 (6%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V ESAV+V GRRGCCM  VV+RLL  LGVNP V EIDEE E+EV+ ELE IGG 
Sbjct  32   ESVRTVVEESAVIVIGRRGCCMCLVVKRLLLGLGVNPAVLEIDEEREEEVLSELERIGG-  90

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            GD      ++ PAV++GGRLFGGLDR+MA HISGEL P+LK+ GALWL
Sbjct  91   GDT-----VKLPAVYVGGRLFGGLDRVMATHISGELVPILKEVGALWL  133



>gb|KHN09956.1| Glutaredoxin-C9 [Glycine soja]
Length=134

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = -2

Query  535  APLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNP-  359
            AP     G S + + + VK        MV+E+ V+V G RGCCM HVV++LLQ  GVNP 
Sbjct  12   APAGASGGPSGADHANVVK--------MVSENPVIVVGARGCCMCHVVQKLLQGQGVNPP  63

Query  358  -vvseideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGEL  182
                +  ++ +         +GG+ D + +  +QFPAVF+GG+ FGGL+R+MA HISGEL
Sbjct  64   VYEVDEGDQADLARELSRNIVGGSDDNSGET-MQFPAVFVGGKFFGGLERLMATHISGEL  122

Query  181  TPVLKQAGALWL  146
             P+LK AGALWL
Sbjct  123  VPILKDAGALWL  134



>ref|XP_003541520.1| PREDICTED: glutaredoxin-C9-like [Glycine max]
Length=136

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevi--eelesIGGAGDR  281
            MV+E+ V+V G RGCCM HVV++LLQ  GVNP V E+DE  + ++        IGG+ D 
Sbjct  33   MVSENPVIVVGARGCCMCHVVQKLLQGQGVNPPVYEVDEGDQADLARELSRNIIGGSDDN  92

Query  280  AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            + +  +QFPAVF+GG+ FGGL+R+MA HISGEL P+LK AGALWL
Sbjct  93   SGET-MQFPAVFVGGKFFGGLERLMATHISGELVPILKDAGALWL  136



>ref|XP_011096368.1| PREDICTED: glutaredoxin-C9-like [Sesamum indicum]
Length=128

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 92/156 (59%), Gaps = 28/156 (18%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY+ WL  P    P  GN SS       G + S+            + +V E+AV
Sbjct  1    MQQAIPYRGWL--PTAATPP-GNSSSG------GDTKSV------------RKLVAENAV  39

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            VVF R+GCCM HVV+ LL   GV+P +  +D++ E +VI E+  I  A         QFP
Sbjct  40   VVFARKGCCMCHVVKLLLHGHGVSPTIVHVDDQNEADVITEISEINSAAP-------QFP  92

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVF+GG LFGGL+ IM AHISGEL P L+QA ALWL
Sbjct  93   AVFVGGELFGGLEEIMGAHISGELVPRLRQARALWL  128



>ref|XP_010478225.1| PREDICTED: glutaredoxin-C9 [Camelina sativa]
Length=136

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 7/129 (5%)
 Frame = -2

Query  526  MNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvse  347
            MN  G S        +E  +  + +V E+AV+V GRRGCCM  VV+RLL  LGVNP V E
Sbjct  13   MNTVGESLRPLTLKTQENGESVRTLVEENAVIVIGRRGCCMCLVVKRLLLGLGVNPAVLE  72

Query  346  ideevekevieelesIG--GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPV  173
            IDEE E+EV+ ELE IG  G GD      ++ PAV++GGRLFGGLDR+MA  ISGEL P+
Sbjct  73   IDEEREEEVLSELEKIGVHGGGDT-----VKLPAVYVGGRLFGGLDRVMATLISGELVPI  127

Query  172  LKQAGALWL  146
            LK+ GALWL
Sbjct  128  LKEVGALWL  136



>ref|XP_004961217.1| PREDICTED: monothiol glutaredoxin-S9-like [Setaria italica]
Length=150

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 73/109 (67%), Gaps = 12/109 (11%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            ++  +  V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+  E E   I        
Sbjct  54   REEVRRAVAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVAGEAELAGIV------A  107

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AGD A       PAVF+GGRL GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  108  AGDVA------LPAVFVGGRLLGGLDRLMAVHISGELVPILKEAGALWL  150



>ref|XP_010911008.1| PREDICTED: monothiol glutaredoxin-S9-like [Elaeis guineensis]
Length=159

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 75/106 (71%), Gaps = 4/106 (4%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvv-seideevekevieelesIGGAGD  284
            + +V E+ V+V GRRGCCM HVV+RLL  LGVNP V    ++     V E  E  GG+G 
Sbjct  57   RRLVAENPVLVVGRRGCCMCHVVKRLLLGLGVNPAVFEVAEDAEAALVDELAEIAGGSGV  116

Query  283  RAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            R +   + FPAVFIGGRL GG+DR+MA HISG+L P+LK+AGALWL
Sbjct  117  RQQ---VLFPAVFIGGRLVGGIDRLMAVHISGDLVPILKEAGALWL  159



>ref|XP_009113659.1| PREDICTED: glutaredoxin-C9-like isoform X2 [Brassica rapa]
 emb|CDY34097.1| BnaA09g27230D [Brassica napus]
Length=137

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+A++V GRRGCCM HV++ LL  LGVNP V EID++ ++E +       G 
Sbjct  32   ENVRTLVEENALIVIGRRGCCMCHVIKSLLLGLGVNPAVLEIDDQEKEEEVMSELERIGV  91

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                E+  ++ PAV+IGGRLFGGLDR+MA HISGEL P+LK  GALWL
Sbjct  92   EGGRER--VKLPAVYIGGRLFGGLDRVMATHISGELVPILKDVGALWL  137



>ref|XP_010538185.1| PREDICTED: glutaredoxin-C9 [Tarenaya hassleriana]
Length=139

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 11/115 (10%)
 Frame = -2

Query  490  DGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekeviee  311
            D  +E +D  K +V E+AV+V GRRGCCM HVV+RLL  LGVNP V E+DE+   +V   
Sbjct  36   DADRENQDVGK-LVAENAVIVVGRRGCCMSHVVKRLLHGLGVNPAVHEVDEDSAFDVNGV  94

Query  310  lesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                  A           PA+++GG+LFGGLDR+M+ HISGEL P+LK+AGALWL
Sbjct  95   KFDETAA----------LPALYVGGKLFGGLDRVMSTHISGELVPILKEAGALWL  139



>ref|XP_007156490.1| hypothetical protein PHAVU_003G290400g [Phaseolus vulgaris]
 gb|ESW28484.1| hypothetical protein PHAVU_003G290400g [Phaseolus vulgaris]
Length=147

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 85/130 (65%), Gaps = 13/130 (10%)
 Frame = -2

Query  535  APLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPv  356
            AP     GS+++ + D VK        MV+E+ V+V G +GCCM HVV++LLQ LGVNP 
Sbjct  31   APPSEAGGSTAAAHADVVK--------MVSENPVIVVGTQGCCMCHVVQKLLQGLGVNPP  82

Query  355  vseideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTP  176
            V E+DE  E EV  EL      G R     +QFPAVF+ G+ FGGL+R+MA HISGEL P
Sbjct  83   VYEVDEGEEDEVAMELSRKVVGGGR-----VQFPAVFVSGKYFGGLERVMAKHISGELVP  137

Query  175  VLKQAGALWL  146
            +LK AGALWL
Sbjct  138  ILKDAGALWL  147



>ref|XP_010499378.1| PREDICTED: glutaredoxin-C9-like [Camelina sativa]
Length=136

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 7/129 (5%)
 Frame = -2

Query  526  MNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvse  347
            MN  G S        +E  +  + +V E+AV+V GRRGCCM  VV+RLL  LGVNP V E
Sbjct  13   MNTVGESLPPLTLKTQENGESVRTLVEENAVIVIGRRGCCMCLVVKRLLLGLGVNPAVLE  72

Query  346  ideevekevieelesIG--GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPV  173
            IDEE E+EV+ +LE IG  G G+      ++ PAV++GGRLFGGLDR+MA  ISGEL P+
Sbjct  73   IDEEREEEVLSDLEKIGVHGGGET-----VKLPAVYVGGRLFGGLDRVMATLISGELVPI  127

Query  172  LKQAGALWL  146
            LK+ GALWL
Sbjct  128  LKEVGALWL  136



>emb|CDY30815.1| BnaC05g21910D [Brassica napus]
Length=128

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 72/108 (67%), Gaps = 11/108 (10%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+A++V GRRGCCM HVV+ LL  LGVNP   E+  E+E+            
Sbjct  32   ENVRTLVEENALIVIGRRGCCMCHVVKSLLLGLGVNPAEEEVMSELER-----------I  80

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G    ++ ++ PAV+IGGRLFGGLDR+MA HISGEL P+LK  GALWL
Sbjct  81   GVEGGRERVKLPAVYIGGRLFGGLDRVMATHISGELVPILKDVGALWL  128



>ref|XP_004293899.1| PREDICTED: glutaredoxin-C9-like [Fragaria vesca subsp. vesca]
Length=143

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 88/156 (56%), Gaps = 16/156 (10%)
 Frame = -2

Query  607  EAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVV  428
            +AIPY +W              +S   ++       + V          + +V+E+AV+V
Sbjct  2    QAIPYGSW--------------ASGAHLSTTREQHDVSVSAPTTVAASVQKLVSENAVIV  47

Query  427  FGRRGCCMVHVVRRLLQVLGVNPvv-seideevekevieelesIGGAGDRAEKKGL-QFP  254
             GRRGCCM HVV RLL   GVNP V    +++    V+E  + +   GD +      QFP
Sbjct  48   VGRRGCCMSHVVTRLLLGHGVNPTVFDVDEDDEAAVVVELRKMMTIVGDESVIDNWPQFP  107

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             VF+GG+LFGGL+++MA HISGEL PVLK+AGALWL
Sbjct  108  VVFVGGKLFGGLEKVMATHISGELVPVLKEAGALWL  143



>ref|NP_001043812.1| Os01g0667900 [Oryza sativa Japonica Group]
 sp|Q5QLR2.1|GRXS5_ORYSJ RecName: Full=Monothiol glutaredoxin-S5 [Oryza sativa Japonica 
Group]
 dbj|BAD73655.1| glutaredoxin-like [Oryza sativa Japonica Group]
 dbj|BAD73683.1| glutaredoxin-like [Oryza sativa Japonica Group]
 dbj|BAF05726.1| Os01g0667900 [Oryza sativa Japonica Group]
 gb|EAY75307.1| hypothetical protein OsI_03198 [Oryza sativa Indica Group]
 dbj|BAG97196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=147

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 71/112 (63%), Gaps = 24/112 (21%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            +  V ES V+V GRRGCC++HVV+RLLQ LGVNP V E+                 AG+ 
Sbjct  53   RRAVAESPVLVVGRRGCCLIHVVKRLLQGLGVNPAVHEV-----------------AGEA  95

Query  280  AEK-------KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            A K       +    PAVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  96   ALKGVVPAGGEAAALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  147



>gb|EYU43367.1| hypothetical protein MIMGU_mgv1a015804mg [Erythranthe guttata]
Length=145

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 96/156 (62%), Gaps = 11/156 (7%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+A+P++ WLT            ++A   N   S S++   G       A+ +V E+AV
Sbjct  1    MQQALPFRDWLTTAGSGGGGRSAAAAAANANSV-SESTIGDAG------SARKLVAENAV  53

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            VVF RRGCCM HVV+ LL+  GVNP ++++DE+ E ++ +EL  I G G        Q P
Sbjct  54   VVFARRGCCMCHVVQLLLRGHGVNPSIADVDEQNEADLADELAKIAGDGSAVP----QLP  109

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVF+GG LFGGL+ +M AHISGEL P L++A ALWL
Sbjct  110  AVFVGGELFGGLEEVMGAHISGELVPRLREAKALWL  145



>ref|XP_009631625.1| PREDICTED: uncharacterized protein LOC104121354 [Nicotiana tomentosiformis]
Length=271

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V+E+A++V   RGCCM +VV+ LL  LGVNP + E++ E E+ V++EL  I G  ++ +
Sbjct  169  LVSENAIIVIATRGCCMCYVVKNLLLGLGVNPTIFEVNSEDEEAVMKELSRIVGGDEQND  228

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                QFP VF+GGRLFGG++R+M+ HISGEL P+LK+AGALWL
Sbjct  229  GGRWQFPVVFVGGRLFGGIERVMSTHISGELVPILKEAGALWL  271



>ref|XP_003569532.1| PREDICTED: monothiol glutaredoxin-S5-like [Brachypodium distachyon]
Length=149

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 83/159 (52%), Gaps = 13/159 (8%)
 Frame = -2

Query  613  MQEAIPYKT---WLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            M +AIPY T   WL             +    M    SS+       ++     K  V+E
Sbjct  1    MYQAIPYGTARPWLRPAPSSAAEAAAAAVVVKMETMASSTEARDQDTRD----VKRAVSE  56

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGL  263
            S VVV GRR CC+ HVV++LLQ LGVNP V E+ +E     +               +  
Sbjct  57   SPVVVVGRRACCLSHVVKQLLQGLGVNPAVHEVADEAALAGLVPPGPG------GGDEAA  110

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              PAVF+GG L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  111  ALPAVFVGGELLGGLDRLMAVHISGELVPILKKAGALWL  149



>ref|XP_010540469.1| PREDICTED: glutaredoxin-C9-like [Tarenaya hassleriana]
Length=140

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            D  + +V E+A++V GRRGCCM HVV+RLL  LGVNP+V ++DE+ E+ V++EL  I  +
Sbjct  31   DDVEKLVAENALIVIGRRGCCMSHVVKRLLLGLGVNPLVYDVDEDREEGVVQELVRINVS  90

Query  289  GDRAEKKG--LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G      G  +  PAV++GG+LFGGLD++M+ HISGEL P+LK+ GALWL
Sbjct  91   GVSGCGSGEKVALPAVYVGGKLFGGLDKVMSTHISGELVPILKEVGALWL  140



>ref|XP_010919211.1| PREDICTED: monothiol glutaredoxin-S9-like [Elaeis guineensis]
Length=159

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 96/165 (58%), Gaps = 15/165 (9%)
 Frame = -2

Query  613  MQEAIPY---KTWLTMPRDCKPVVGNQSSAPLMNKAGSS--SSMYVDGVKEPKDGAKNMV  449
            MQ+AIPY   +TW        P V +     + +    S           +   G + +V
Sbjct  1    MQQAIPYSSGRTWFA------PTVASNGIIHVTDNDRPSLDGPSTSSSSSDGGGGLRRLV  54

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
             E+ V+V GR+GCC+ HVV+RLL  LGVNP V E+ E+ +  ++EEL  I  AG      
Sbjct  55   AENPVLVVGRQGCCLCHVVKRLLHGLGVNPTVCEVAEDAKSALLEELAEIATAGGGGGGG  114

Query  268  GLQ----FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G+Q     PAVFIGGRL GGLDR+MA HISG+L P+LK+AGALWL
Sbjct  115  GVQQQVLCPAVFIGGRLVGGLDRLMAVHISGDLVPILKEAGALWL  159



>ref|XP_009406261.1| PREDICTED: monothiol glutaredoxin-S9-like [Musa acuminata subsp. 
malaccensis]
Length=169

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 9/107 (8%)
 Frame = -2

Query  466  GAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAG  287
            G + MV E+ VVV GRRGCCM HV RRLLQ LGVNP + E+ EE  +  +      GG  
Sbjct  72   GMRRMVAENPVVVVGRRGCCMCHVARRLLQGLGVNPALCELGEEAAEFEVA-----GGDL  126

Query  286  DRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             R +      P VF+GGRL GG+DR++A HI+GEL P+LK AGALWL
Sbjct  127  RRPD----MLPVVFVGGRLLGGIDRLVAVHITGELVPILKDAGALWL  169



>ref|XP_008798271.1| PREDICTED: monothiol glutaredoxin-S9-like [Phoenix dactylifera]
Length=159

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+ V+V GRRGCCM HVV+RLL  LGVNP V E+ E+ E  ++ EL  I  A    +
Sbjct  58   LVAENPVLVVGRRGCCMCHVVKRLLLGLGVNPAVFEVAEDAEAALVAELAEIAAAAGGVQ  117

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            ++ L FPAVFIGGRL GGLDR+MA HISG+L P+LK+AGALWL
Sbjct  118  QQVL-FPAVFIGGRLVGGLDRLMAVHISGDLVPILKEAGALWL  159



>ref|XP_009102903.1| PREDICTED: glutaredoxin-C9-like [Brassica rapa]
Length=136

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+AV+V GR+GCCM  VV+RLL  LGVNP V EIDE+ E EV+ ELE IG  
Sbjct  32   ESVRMLVEENAVMVIGRKGCCMCIVVKRLLFGLGVNPAVLEIDEKREVEVMSELEKIGAK  91

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              R   + +  PAV+IGG LFGGLDR+MA HISGEL P+LK+ GALWL
Sbjct  92   DGR---ETVMLPAVYIGGVLFGGLDRVMATHISGELVPILKEVGALWL  136



>gb|KFK42729.1| monothiol glutaredoxin-s13 [Arabis alpina]
Length=172

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +VTE+AVVVF RRGCCM HV +RLL   GVNP+V EIDEE        + S  G     +
Sbjct  73   LVTENAVVVFARRGCCMGHVAKRLLLTHGVNPLVVEIDEEDYNNADNIIVSDLGENMINK  132

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +K    P +FIGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  133  EK---LPVMFIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  172



>emb|CDX94626.1| BnaC07g10320D [Brassica napus]
Length=128

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+AV+V GR+GCCM  VV+RLL  LGVNP V EIDE+ EK            
Sbjct  32   ESVRTLVEENAVMVIGRKGCCMCLVVKRLLFGLGVNPAVLEIDEKREK-----------I  80

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G +  ++ +  PAV+IGG LFGGLDR+MA HISGEL P+LK+ GALWL
Sbjct  81   GVKGGRETVMLPAVYIGGMLFGGLDRVMATHISGELVPILKEVGALWL  128



>gb|ACG48030.1| Grx_S2 - glutaredoxin subgroup III [Zea mays]
Length=140

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            +  V E  V+V G+RGCC+ HVV+RLLQ LGVNP V E+ +  E ++I  +    G GD 
Sbjct  44   RRAVAECPVLVVGKRGCCLSHVVKRLLQGLGVNPAVHEVADGAEAKLIAGVVD--GGGDV  101

Query  280  AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            A       PAVF+GGRL GGLDR+MA HISG+L P+LK AGALWL
Sbjct  102  A------LPAVFVGGRLLGGLDRLMAVHISGDLVPILKDAGALWL  140



>ref|NP_001147414.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
 gb|ACG27432.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
 gb|ACN27791.1| unknown [Zea mays]
 gb|AFW81126.1| grx_I1-glutaredoxin subgroup III [Zea mays]
Length=153

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 8/105 (8%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            +  V E  V+V G+RGCC+ HVV+RLLQ LGVNP V E+ +  E ++I  +   GG    
Sbjct  57   RRAVAECPVLVVGKRGCCLSHVVKRLLQGLGVNPAVHEVADGAEAKLIAGVVDGGG----  112

Query  280  AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 +  PAVF+GGRL GGLDR+MA HISG+L P+LK AGALWL
Sbjct  113  ----DVALPAVFVGGRLLGGLDRLMAVHISGDLVPILKDAGALWL  153



>ref|XP_006305751.1| hypothetical protein CARUB_v10010567mg [Capsella rubella]
 gb|EOA38649.1| hypothetical protein CARUB_v10010567mg [Capsella rubella]
Length=148

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 94/161 (58%), Gaps = 18/161 (11%)
 Frame = -2

Query  613  MQEAI-PYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKN----MV  449
            MQ+AI PY++  T     K V GN    P   +  SSS++       PK  +K     +V
Sbjct  1    MQKAIRPYESSWT-----KTVPGNNICRPKNEEKPSSSTLSWLTSSSPKPASKRSSNLVV  55

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
             E+AVVVF RRGCCM HV +RLL   GVNP+V EI +E   E   +        D  EK 
Sbjct  56   MENAVVVFARRGCCMGHVAKRLLLTHGVNPLVVEIGDEEADENNYDNII----SDHKEK-  110

Query  268  GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  111  ---LPVMYIGGKLFGGLENLMAAHINGDLLPTLRQAGALWL  148



>ref|XP_009416533.1| PREDICTED: monothiol glutaredoxin-S9-like [Musa acuminata subsp. 
malaccensis]
Length=170

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvse----ideevekevieelesIGG  293
            + MV E+ VVV GRRGCCM HV RRLL  LGVNP V E       E    V E      G
Sbjct  64   RRMVAENPVVVVGRRGCCMCHVARRLLLGLGVNPTVCEFGDEAAGEAVSLVEEAAVFEAG  123

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             GD   ++    P VF+GGRL GGLDR++A HI+GEL P+LK+AGALWL
Sbjct  124  GGD--VRRLAILPVVFVGGRLLGGLDRLVAVHITGELVPILKEAGALWL  170



>dbj|BAK00667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 83/156 (53%), Gaps = 21/156 (13%)
 Frame = -2

Query  610  QEAIPYKTWLTMPRDCKPVVGNQSS-APLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            Q AIPY           P    QS  A +   AG       DG     +  +    ES V
Sbjct  3    QAAIPYSAGRL------PAWPRQSELAEVDGTAGQEGRRAGDG----GEAVRRAAAESPV  52

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFP  254
            +V GRRGCC+ HVV+ LL+ LGVNP V E+ +E E             GD A    +  P
Sbjct  53   LVVGRRGCCLSHVVKLLLRGLGVNPAVHEVADEAELAAAVT-------GDEAV---VALP  102

Query  253  AVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            AVF+GGRL GGLDR+MA HISGEL P+LK AGALWL
Sbjct  103  AVFVGGRLLGGLDRLMAVHISGELVPILKDAGALWL  138



>ref|XP_010904892.1| PREDICTED: monothiol glutaredoxin-S3-like [Elaeis guineensis]
Length=152

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 91/162 (56%), Gaps = 16/162 (10%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQ+AIPY       R       N    P +  A    +M    V    D  + +V E+ V
Sbjct  1    MQQAIPYSKGAAWVRR-----SNDGRRPPVEPA----AMAARCVASSGD-IRRVVEENPV  50

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevi------eelesIGGAGDRAEK  272
            VV GRRGCCMVHVVRRLL   GVNP V E+ E+ ++  +      E     G  G     
Sbjct  51   VVVGRRGCCMVHVVRRLLLGQGVNPTVCEVGEDADEAALIGELHPEMAAEGGDGGAHLRG  110

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +G+  PAVFIGGRL GGLDR+MA HISGEL P+LKQAGALWL
Sbjct  111  QGMVLPAVFIGGRLVGGLDRLMAVHISGELVPILKQAGALWL  152



>emb|CDY15662.1| BnaA07g08330D [Brassica napus]
Length=128

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 11/108 (10%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+AV+V GR+GCCM  VV+RLL  LGVNP V EIDE+ EK          GA
Sbjct  32   ESVRMLVEENAVMVIGRKGCCMCIVVKRLLFGLGVNPAVLEIDEKREKI---------GA  82

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             D  E   +  PAV+IGG LFGGLDR+MA HISGEL P+LK+ GALWL
Sbjct  83   KDGRET--VMLPAVYIGGVLFGGLDRVMATHISGELVPILKEVGALWL  128



>ref|XP_010475016.1| PREDICTED: monothiol glutaredoxin-S13-like [Camelina sativa]
Length=152

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 94/168 (56%), Gaps = 28/168 (17%)
 Frame = -2

Query  613  MQEAI-PYKT--WLTMPRDCKPVVGNQSSAP-LMNKAGSSSSMYVDGVKEPKDGAKN---  455
            MQ+AI PY++  W T       V GN    P   +K  SS+S+      +PK  + N   
Sbjct  1    MQKAIRPYESSSWTTT------VPGNSIFRPKTEDKPSSSTSLAWLTSPKPKPTSINAKR  54

Query  454  -----MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
                 +V E+AVVVF RRGCCM HV +RLL   GVNP+V EI E+ E             
Sbjct  55   SSNHLVVMENAVVVFARRGCCMGHVAKRLLLTHGVNPLVVEIGEDEEDNKY---------  105

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             D       + P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  106  -DNILSDKEKLPVMYIGGKLFGGLENLMAAHINGDLVPSLRQAGALWL  152



>gb|EAY99027.1| hypothetical protein OsI_20984 [Oryza sativa Indica Group]
Length=130

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            ++  +  V E  VVV GR GCC+ HVV+RLLQ LGVNP V E+  E E            
Sbjct  33   EEEVRRAVAECPVVVVGRSGCCLSHVVKRLLQGLGVNPAVHEVAGEAELAG---------  83

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                A   G+  PAVF+GGRL GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  84   --VVAGGGGVALPAVFVGGRLLGGLDRLMAVHISGELVPILKEAGALWL  130



>sp|P0C291.1|GRXS9_ORYSJ RecName: Full=Monothiol glutaredoxin-S9 [Oryza sativa Japonica 
Group]
Length=132

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            ++  +  V E  VVV GR GCC+ HVV+RLLQ LGVNP V E+  E E            
Sbjct  35   EEEVRRAVAECPVVVVGRSGCCLSHVVKRLLQGLGVNPAVHEVAGEAELAG---------  85

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                A   G+  PAVF+GGRL GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  86   --VVAGGGGVALPAVFVGGRLLGGLDRLMAVHISGELVPILKEAGALWL  132



>ref|XP_009388731.1| PREDICTED: monothiol glutaredoxin-S9-like [Musa acuminata subsp. 
malaccensis]
Length=142

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 87/160 (54%), Gaps = 23/160 (14%)
 Frame = -2

Query  613  MQEAIPY---KTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            MQ+AIPY   K W ++ R          +  L    G +  + V             V E
Sbjct  2    MQQAIPYSSGKAWPSLSR-------APEAWELKKIIGGAGEIRV------------AVEE  42

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR-AEKKG  266
            + VVV GR GC MVHVVRRLL   GVNPVV E+ E+ ++  I          +R      
Sbjct  43   NPVVVVGRSGCFMVHVVRRLLLGQGVNPVVCEVGEDADEAAIMASLPPEAHDERRTSAAT  102

Query  265  LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +  PAVF+GGRL GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  103  VTLPAVFVGGRLVGGLDRLMAVHISGELVPILKRAGALWL  142



>ref|XP_008798206.1| PREDICTED: monothiol glutaredoxin-S9-like [Phoenix dactylifera]
Length=162

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 97/168 (58%), Gaps = 18/168 (11%)
 Frame = -2

Query  613  MQEAIPY---KTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNM---  452
            MQ+A+PY   +TW        P   +     + +K   S             G + M   
Sbjct  1    MQQAVPYSSGRTWFA------PTAASNGIVHVTDKDRPSLDGPSTSSSSSDGGGRGMRRL  54

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE-  275
            V E+ V+V GR+GCC+ HVV++LL  LGVNP V E+ E+ E  ++EEL  I G G  +  
Sbjct  55   VAENPVLVVGRQGCCLCHVVKKLLLGLGVNPAVCEVAEDAEPALVEELAEIAGCGRGSGG  114

Query  274  -----KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 ++ + FPAVFIGGRL GGLDR+MA HISG+L P+LK+AGALWL
Sbjct  115  AGGGVQQPVLFPAVFIGGRLVGGLDRLMAVHISGDLVPILKEAGALWL  162



>ref|XP_003565561.2| PREDICTED: monothiol glutaredoxin-S3-like [Brachypodium distachyon]
Length=114

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 67/108 (62%), Gaps = 3/108 (3%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvsei---deevekevieelesIGGA  290
            +  V E  VVV GRRGCCM HV RRLL   G NP V E+          ++  L   G A
Sbjct  7    RRAVEEKPVVVVGRRGCCMAHVARRLLLGQGANPAVLEVGDDVVADPAALLVPLRPPGAA  66

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             D A      FPAVFIGGRL GGLDR+MA HI+GEL PVLKQAGALWL
Sbjct  67   KDAAAAAATFFPAVFIGGRLVGGLDRLMAMHIAGELVPVLKQAGALWL  114



>ref|XP_006415650.1| hypothetical protein EUTSA_v10009080mg [Eutrema salsugineum]
 gb|ESQ34003.1| hypothetical protein EUTSA_v10009080mg [Eutrema salsugineum]
Length=135

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+AV+V GRRGCCM HV+++LL  LGVNP V EIDEE E EV+ ELE IG  
Sbjct  31   ESVRTVVEENAVIVIGRRGCCMCHVLKKLLLGLGVNPAVHEIDEESEDEVMSELEKIGVE  90

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G     + ++ PAV+IGGRLFGGLDR+MAAHISG+L P+LK+ GALWL
Sbjct  91   GG---SETVELPAVYIGGRLFGGLDRVMAAHISGDLVPILKEVGALWL  135



>ref|XP_009111139.1| PREDICTED: monothiol glutaredoxin-S13-like [Brassica rapa]
Length=152

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            K+ +  +V E+AVVVF RRGCCM HV RRLL   GVNP    + E  +++    +   G 
Sbjct  51   KESSNVLVMENAVVVFARRGCCMGHVARRLLLTHGVNP---LVAEVDDEDENIIISEWGK  107

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 EK     P +FIGG++ GGL+ +MAAHISG+L P L+QAGALWL
Sbjct  108  TMINKEK----LPVMFIGGKMIGGLENLMAAHISGDLVPTLRQAGALWL  152



>emb|CDY18190.1| BnaC05g02130D [Brassica napus]
Length=155

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF RRGCCM HVV+RLL   GVNP+V EI EE   ++I         G    
Sbjct  59   LVMENAVVVFARRGCCMGHVVKRLLLTHGVNPLVVEIGEEDNSDIII-----SDLGKTVI  113

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             K    P +FIGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  114  NKE-NLPVMFIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  155



>gb|EYU28021.1| hypothetical protein MIMGU_mgv1a023397mg, partial [Erythranthe 
guttata]
Length=133

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 6/111 (5%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele-sIGGAGD  284
            + +V E++VVVF R+GCCM HVV+ LL   GVNP + +IDE+ E  +  +L   +GG G 
Sbjct  23   RELVAENSVVVFARKGCCMCHVVKLLLHGHGVNPTIVDIDEQNEAGIKNDLSRILGGGGV  82

Query  283  RAEKKG-----LQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 G      QFPAVF+GG LFGGL+ IM AHISGEL P L++A ALWL
Sbjct  83   DGANSGNSAAVPQFPAVFMGGELFGGLEEIMGAHISGELVPRLREARALWL  133



>emb|CDX89861.1| BnaA10g02210D [Brassica napus]
Length=155

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF R+GCCM HVV+RLL   GVNP+V EIDEE   ++I         G    
Sbjct  59   LVMENAVVVFARKGCCMGHVVKRLLLTHGVNPLVVEIDEEDNNDMII-----SDLGKTVI  113

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             K    P +FIGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  114  NKE-NLPVMFIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  155



>ref|XP_009119356.1| PREDICTED: monothiol glutaredoxin-S13-like [Brassica rapa]
Length=155

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 71/103 (69%), Gaps = 6/103 (6%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF R+GCCM HVV+RLL   GVNP+V EIDEE   ++I         G    
Sbjct  59   LVMENAVVVFARKGCCMGHVVKRLLLTHGVNPLVVEIDEEDNNDMII-----SDLGKTVI  113

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             K    P +FIGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  114  NKE-NLPVMFIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  155



>ref|XP_009392430.1| PREDICTED: monothiol glutaredoxin-S9-like [Musa acuminata subsp. 
malaccensis]
Length=144

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -2

Query  463  AKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvv------seideevekevieeles  302
             + MV E+ VVV GRR CCMV V RRLL  LGVNPVV      +   EE    V    E 
Sbjct  35   VRMMVAENPVVVVGRRSCCMVDVARRLLLGLGVNPVVREIGEEAAAVEEAAALVEAVAEV  94

Query  301  IGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             G  GDR  ++  + P VF+GGRL GGLDR++ AHI+G+L P+LK AGALWL
Sbjct  95   GGAGGDR--RRSSKLPVVFVGGRLLGGLDRLVTAHITGDLVPILKDAGALWL  144



>ref|XP_009118687.1| PREDICTED: monothiol glutaredoxin-S13-like [Brassica rapa]
 emb|CDY32516.1| BnaA09g50800D [Brassica napus]
Length=154

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+A VVF R+GCCM HV +RLL   GVNP+V EIDE         +  +G      E
Sbjct  56   LVMENAAVVFARKGCCMGHVAKRLLLTHGVNPLVVEIDEGDNNGDNIIMSELGNNVISKE  115

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            K     P +FIGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  116  K----LPVMFIGGKLFGGLENLMAAHINGDLGPTLRQAGALWL  154



>ref|XP_002988222.1| CC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ10641.1| CC type glutaredoxin [Selaginella moellendorffii]
Length=117

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 79/131 (60%), Gaps = 27/131 (21%)
 Frame = -2

Query  517  AGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseide  338
            A S+SS  V+ V++       +  E+AVV+F   GCCM HVV+RLL  LGVNPVV E+DE
Sbjct  7    AESTSSSAVEVVEK-------LAVENAVVIFSSSGCCMSHVVKRLLCGLGVNPVVFELDE  59

Query  337  evekevieelesIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELT  179
            E               G   EK   +F       P VFIGG+L GGLD++MA+HISGEL 
Sbjct  60   EKN-------------GPEIEKALARFTGISQVSPTVFIGGKLVGGLDKVMASHISGELV  106

Query  178  PVLKQAGALWL  146
            P LK+AGALWL
Sbjct  107  PQLKEAGALWL  117



>ref|XP_002440249.1| hypothetical protein SORBIDRAFT_09g028500 [Sorghum bicolor]
 gb|EES18679.1| hypothetical protein SORBIDRAFT_09g028500 [Sorghum bicolor]
Length=149

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 63/97 (65%), Gaps = 11/97 (11%)
 Frame = -2

Query  436  VVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF  257
            V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +   +            GD A       
Sbjct  64   VLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADAEAELAGVVD-----GGDVA------L  112

Query  256  PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            PAVF+GGRL GGLDR MA HISG+L P+LK AGALWL
Sbjct  113  PAVFVGGRLLGGLDRFMAVHISGDLVPILKDAGALWL  149



>ref|XP_006418197.1| hypothetical protein EUTSA_v10008980mg [Eutrema salsugineum]
 dbj|BAJ34139.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36550.1| hypothetical protein EUTSA_v10008980mg [Eutrema salsugineum]
Length=158

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 73/109 (67%), Gaps = 5/109 (5%)
 Frame = -2

Query  472  KDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            K  +  +V E+AVVVF RRGCCM HV +RLL   GVNP+V EID+E   +     +    
Sbjct  55   KKSSNLLVMENAVVVFARRGCCMGHVAKRLLLTHGVNPLVVEIDDEDNNDDSIIFDLGET  114

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              ++A     + P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  115  VINKA-----KLPVMYIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  158



>ref|XP_009792873.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=145

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 5/104 (5%)
 Frame = -2

Query  457  NMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRA  278
            N+V ESA++V   RGCCM  VV+ LL  LGVNP + ++D   E  ++EEL  I G G  A
Sbjct  47   NLVAESAIIVVATRGCCMCLVVKHLLLGLGVNPTIFDVDAAEEAAMLEELSRIEGGG--A  104

Query  277  EKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            ++K    PAVF+GG+L GG++++M  HISGEL P+LKQAGALWL
Sbjct  105  QEK---LPAVFVGGKLLGGVEKVMETHISGELVPLLKQAGALWL  145



>ref|XP_010231027.1| PREDICTED: monothiol glutaredoxin-S9-like [Brachypodium distachyon]
Length=140

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 63/99 (64%), Gaps = 15/99 (15%)
 Frame = -2

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGL  263
            S V+V GRRGCC+ HVV+RLLQ LGVNP V E+D +                      G 
Sbjct  57   SPVLVVGRRGCCLSHVVKRLLQGLGVNPAVREVDGDG---------------AALAGAGG  101

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              PAVF+GGRL GGLDR+MA HISGEL P+LK AGALWL
Sbjct  102  ALPAVFVGGRLLGGLDRLMAVHISGELVPILKDAGALWL  140



>ref|XP_002963851.1| hypothetical protein SELMODRAFT_80143 [Selaginella moellendorffii]
 ref|XP_002971801.1| CC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ27550.1| CC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ35722.1| hypothetical protein SELMODRAFT_80143 [Selaginella moellendorffii]
Length=103

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 70/109 (64%), Gaps = 14/109 (13%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            + MV+E+AVV+F    CCM HVV+ LL  LGVNP V E+DEE +          GG  + 
Sbjct  5    ERMVSENAVVIFSMSSCCMCHVVKSLLCSLGVNPTVYEMDEESD----------GGDMEE  54

Query  280  AEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            A  + +      P VFIGG+L GGLD++MAAHISG L P LK+AGALWL
Sbjct  55   ALARIMGDSQVVPTVFIGGKLIGGLDQVMAAHISGSLVPQLKEAGALWL  103



>ref|XP_004969481.1| PREDICTED: monothiol glutaredoxin-S5-like [Setaria italica]
Length=149

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 8/102 (8%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E            G     A  
Sbjct  56   VAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADEAALA--------GVVPAGAGA  107

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +    PAVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  108  EAAALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  149



>ref|XP_009611400.1| PREDICTED: glutaredoxin-C9-like [Nicotiana tomentosiformis]
Length=129

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 81/133 (61%), Gaps = 5/133 (4%)
 Frame = -2

Query  544  QSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGV  365
             SS+   N  GS+S               N+V E+A++V   RGCCM  VV+ LL  LGV
Sbjct  2    SSSSATKNGGGSTSRGSQPSESNMNTRLANLVAENAIIVVATRGCCMCLVVKHLLLGLGV  61

Query  364  NPvvseideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGE  185
            NP + EID E E  V+EEL  I G G +      + PAVF+GG+L GG++R+M  HISGE
Sbjct  62   NPTIFEIDAEEEAAVLEELSRIDGGGGQE-----KLPAVFVGGKLLGGVERVMETHISGE  116

Query  184  LTPVLKQAGALWL  146
            L P+LK+AGALWL
Sbjct  117  LVPLLKKAGALWL  129



>ref|XP_010482655.1| PREDICTED: monothiol glutaredoxin-S13-like [Camelina sativa]
Length=151

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF RRGCCM HV +RLL   GVNP+V EI E+ + +            D   
Sbjct  60   VVMENAVVVFARRGCCMGHVAKRLLLTHGVNPLVVEIGEDEDNKY-----------DNIL  108

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                + P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  109  SDKEKLPVMYIGGKLFGGLENLMAAHINGDLVPSLRQAGALWL  151



>ref|XP_010457402.1| PREDICTED: monothiol glutaredoxin-S13 [Camelina sativa]
Length=152

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF RRGCCM HV +RLL   GVNP+V EI E+ + +            D   
Sbjct  61   VVMENAVVVFARRGCCMGHVAKRLLLTHGVNPLVVEIGEDEDNKY-----------DNIL  109

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                + P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  110  SDKEKLPVMYIGGKLFGGLENLMAAHINGDLVPSLRQAGALWL  152



>ref|NP_563691.1| glutaredoxin ATGRXS13 [Arabidopsis thaliana]
 sp|Q84TF4.2|GRS13_ARATH RecName: Full=Monothiol glutaredoxin-S13; Short=AtGrxS13; AltName: 
Full=Protein ROXY 18 [Arabidopsis thaliana]
 gb|AAK59517.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34226.1| unknown protein [Arabidopsis thaliana]
 gb|AAM63783.1| unknown [Arabidopsis thaliana]
 dbj|BAF00376.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27623.1| glutaredoxin ATGRXS13 [Arabidopsis thaliana]
Length=150

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 66/103 (64%), Gaps = 11/103 (11%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF RRGCC+ HV +RLL   GVNPVV EI EE                D   
Sbjct  59   VVMENAVVVFARRGCCLGHVAKRLLLTHGVNPVVVEIGEED-----------NNNYDNIV  107

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                + P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  108  SDKEKLPMMYIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  150



>ref|XP_008783123.1| PREDICTED: monothiol glutaredoxin-S3-like [Phoenix dactylifera]
Length=162

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 95/170 (56%), Gaps = 22/170 (13%)
 Frame = -2

Query  613  MQEAIPY---KTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            MQ+AIPY   + W         V+G +++   +  A   ++   +         + +V E
Sbjct  1    MQQAIPYSNGRAWAPRRNGGGAVIGGRTAVEQVVVAARCATSGGE--------IRRVVEE  52

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel-----------esIG  296
            + VVV GRRGCCMVHVVRRLL   GVNP V E+ E+ ++  +               S G
Sbjct  53   NPVVVVGRRGCCMVHVVRRLLLGQGVNPTVCEVGEDADEAALIAELPPSMAASGAAGSGG  112

Query  295  GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                   ++G+  PAVFIGGRL GGLDR+MA HISGEL P+LKQAGALWL
Sbjct  113  DVVGHLRRQGMVLPAVFIGGRLVGGLDRLMAVHISGELVPILKQAGALWL  162



>emb|CDY10096.1| BnaC08g43550D [Brassica napus]
Length=154

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+A VVF R+GCCM HV +RLL   GVNP+V EIDE         +  +G      E
Sbjct  56   LVMENAAVVFARKGCCMGHVAKRLLLTHGVNPLVVEIDEGDNNGDNIIMSELGNNVISKE  115

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            K     P +FIGG+LFGGL+ +MAAHI+G+L P L++AGALWL
Sbjct  116  K----LPVMFIGGKLFGGLENLMAAHINGDLGPTLRRAGALWL  154



>gb|KDO49565.1| hypothetical protein CISIN_1g046051mg [Citrus sinensis]
Length=142

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 89/169 (53%), Gaps = 40/169 (24%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPK----DGAKNMVT  446
            MQ+AIPYK+W             Q   PL + + S+SS     V+ P     D   +MV+
Sbjct  1    MQQAIPYKSW-------------QPFDPLSHSSVSTSSKR--AVRGPSINTTDVVSSMVS  45

Query  445  ESAVVVFGRRGCCMVHVVRRLLQVLGVNP---------vvseideevekevieelesIGG  293
            E+AV+VF +RGCCM HVV+RLL  LG NP           + + + +E  V     + G 
Sbjct  46   ENAVIVFAKRGCCMSHVVKRLLLGLGANPCVYEVDEGDDEARVLDALEMIVNNNNNNNGS  105

Query  292  AGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              DR  +K            LFGGLDRIMA HI+GEL PVLK+A ALWL
Sbjct  106  HDDRDRQK------------LFGGLDRIMATHITGELIPVLKEAKALWL  142



>dbj|BAD81621.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD81651.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY73237.1| hypothetical protein OsI_01115 [Oryza sativa Indica Group]
 gb|EAZ11210.1| hypothetical protein OsJ_01065 [Oryza sativa Japonica Group]
Length=127

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 69/115 (60%), Gaps = 10/115 (9%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIG-----  296
            +  V E  VVV GRRGCCM HV RRLL   G NP V E+ ++ +   + +          
Sbjct  13   RRAVEEKPVVVVGRRGCCMAHVARRLLLGQGANPAVLEVGDDADPAALVDAALQARRRKD  72

Query  295  -----GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                  AGD      + FPAVFIGGRL GGLDR+MA H++GEL PVLKQAGALWL
Sbjct  73   GGDKAAAGDGGGGAAVAFPAVFIGGRLVGGLDRLMAMHMAGELVPVLKQAGALWL  127



>ref|NP_001042552.1| Os01g0241400 [Oryza sativa Japonica Group]
 sp|Q0JP62.1|GRXS3_ORYSJ RecName: Full=Monothiol glutaredoxin-S3 [Oryza sativa Japonica 
Group]
 dbj|BAF04466.1| Os01g0241400 [Oryza sativa Japonica Group]
 dbj|BAG98130.1| unnamed protein product [Oryza sativa Japonica Group]
Length=136

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 69/115 (60%), Gaps = 10/115 (9%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIG-----  296
            +  V E  VVV GRRGCCM HV RRLL   G NP V E+ ++ +   + +          
Sbjct  22   RRAVEEKPVVVVGRRGCCMAHVARRLLLGQGANPAVLEVGDDADPAALVDAALQARRRKD  81

Query  295  -----GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                  AGD      + FPAVFIGGRL GGLDR+MA H++GEL PVLKQAGALWL
Sbjct  82   GGDKAAAGDGGGGAAVAFPAVFIGGRLVGGLDRLMAMHMAGELVPVLKQAGALWL  136



>gb|ABK26004.1| unknown [Picea sitchensis]
Length=150

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            V+ P D  + + TE+AV+VF    CCM HVV+RLL  LGV+P V E+DEE E   +E++ 
Sbjct  43   VESPVDKIRRLTTENAVLVFSMTSCCMCHVVKRLLCSLGVHPTVCELDEEEEGVEMEKIL  102

Query  304  sIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                   ++       PAVFIGG L GGLDR+MA HI G+L P LK+A ALWL
Sbjct  103  RALVGAQKS-----SVPAVFIGGNLIGGLDRVMAMHIEGDLVPKLKEAKALWL  150



>ref|XP_010327035.1| PREDICTED: glutaredoxin-C9-like isoform X1 [Solanum lycopersicum]
Length=171

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideeve--kevieelesIGGAGDRA  278
            V+E A++V   RGCCM HVV+ LL  LGVNP + E++ E E   +    + + G      
Sbjct  68   VSEHAIIVVAIRGCCMCHVVKNLLLGLGVNPTIFEVNNEDEDDVKTELSIITSGVGDGGG  127

Query  277  EKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +    +FPAVF+GG LFGGL+R+++ HISGEL P+LK  GALWL
Sbjct  128  DGTTTEFPAVFVGGNLFGGLERVISTHISGELVPILKDVGALWL  171



>ref|XP_010327036.1| PREDICTED: glutaredoxin-C9-like isoform X2 [Solanum lycopersicum]
Length=166

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvv--seideevekevieelesIGGAGDRA  278
            V+E A++V   RGCCM HVV+ LL  LGVNP +     ++E + +    + + G      
Sbjct  63   VSEHAIIVVAIRGCCMCHVVKNLLLGLGVNPTIFEVNNEDEDDVKTELSIITSGVGDGGG  122

Query  277  EKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +    +FPAVF+GG LFGGL+R+++ HISGEL P+LK  GALWL
Sbjct  123  DGTTTEFPAVFVGGNLFGGLERVISTHISGELVPILKDVGALWL  166



>ref|XP_002991354.1| CC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ07466.1| CC type glutaredoxin [Selaginella moellendorffii]
Length=117

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 70/112 (63%), Gaps = 20/112 (18%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            + +  E+AVV+F   GCCM HVV+RLL  LGVNPVV E+DEE               G  
Sbjct  19   EKLAVENAVVIFSSSGCCMSHVVKRLLCGLGVNPVVFELDEEKN-------------GPE  65

Query  280  AEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             EK   +F       P VFIGG+L GGLD++MA+HISG+L P LK+AGALWL
Sbjct  66   IEKALARFTGISQVSPTVFIGGKLVGGLDQVMASHISGKLVPQLKEAGALWL  117



>ref|XP_008347995.1| PREDICTED: glutaredoxin-C5-like [Malus domestica]
Length=126

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 14/118 (12%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G+++P +  + M +ESAVV+F    CCM H ++RL   +GVNP V E+DE+         
Sbjct  19   GIEDPLERIERMASESAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPR-------  71

Query  307  esIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  72   ---GKDLERALMRLLGTSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  126



>gb|EPS71536.1| hypothetical protein M569_03223, partial [Genlisea aurea]
Length=100

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF RRGCCM HV++ LL   GV+P + ++DE+ E EV       G    R  
Sbjct  5    LVKENAVVVFARRGCCMCHVLKLLLNGHGVSPSIFDVDEKNEAEV-------GAQLRRIA  57

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 FPAVF+GG LFGGL+ IM AHI+GEL P L+QA ALWL
Sbjct  58   AGEPNFPAVFVGGELFGGLEEIMGAHIAGELVPRLRQARALWL  100



>emb|CDY44992.1| BnaCnng12220D [Brassica napus]
Length=193

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            +K+P +    +V E+A VVF R+GCCM HV +RLL   GVNP+V EIDE         + 
Sbjct  88   IKKPNNV---LVMENAAVVFARKGCCMGHVAKRLLLTHGVNPLVVEIDEGDNNGDNIIMS  144

Query  304  sIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             +G      EK     P +FIGG+LFGGL+ +MAAHI+G+L P L++AGALWL
Sbjct  145  ELGNNVISKEK----LPVMFIGGKLFGGLENLMAAHINGDLGPTLRRAGALWL  193



>ref|XP_002458286.1| hypothetical protein SORBIDRAFT_03g030680 [Sorghum bicolor]
 gb|EES03406.1| hypothetical protein SORBIDRAFT_03g030680 [Sorghum bicolor]
Length=168

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 67/102 (66%), Gaps = 11/102 (11%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E              AG     
Sbjct  78   VAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADESAL-----------AGVVPAA  126

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 PAVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  127  DAAALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  168



>ref|XP_004171791.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
Length=112

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 14/122 (11%)
 Frame = -2

Query  499  MYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekev  320
            M    +++P D  + +  E+AVVVF    CCM H ++RL   +GVNP V E+DE+     
Sbjct  1    MSTSSLEDPVDRIERLAAENAVVVFSVSTCCMCHAIKRLFCGMGVNPTVYELDEDPR---  57

Query  319  ieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGAL  152
                   GG  ++A  + L      P VFIGG+L G +DR+MA+HISG L P+LK AGAL
Sbjct  58   -------GGDMEKALMRLLGSSSPVPVVFIGGKLVGAMDRVMASHISGTLVPLLKDAGAL  110

Query  151  WL  146
            WL
Sbjct  111  WL  112



>ref|XP_009346791.1| PREDICTED: glutaredoxin-C1 [Pyrus x bretschneideri]
Length=126

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 14/118 (12%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G+++P +  + M +ESAVV+F    CCM H ++RL   +GVNP V E+DE+         
Sbjct  19   GMEDPLERIERMASESAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPR-------  71

Query  307  esIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  72   ---GKDLERALMRLLGTSSAVPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL  126



>ref|XP_006361069.1| PREDICTED: glutaredoxin-C9-like [Solanum tuberosum]
Length=180

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = -2

Query  526  MNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvv--  353
            MN  G   S Y +            ++E+A++V   RGCCM HVV+ LL  LGVNP +  
Sbjct  54   MNYVGDMRSRYKNSF--ITTSVAKSISENAIIVVALRGCCMCHVVKNLLLGLGVNPTIFE  111

Query  352  seideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPV  173
               ++E + +    +   GG           FPAVF+GG LFGGL+R+++ HISGEL P+
Sbjct  112  VNNEDEDDVKKELSIIVGGGGTGGGGGTTTAFPAVFVGGNLFGGLERVISTHISGELVPI  171

Query  172  LKQAGALWL  146
            LK  GALWL
Sbjct  172  LKDVGALWL  180



>gb|AGX01496.1| glutaredoxin [Cucumis sativus]
Length=112

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 14/122 (11%)
 Frame = -2

Query  499  MYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekev  320
            M    +++P D  + +  E+AVV+F    CCM H ++RL   +GVNP V E+DE+     
Sbjct  1    MSTSSLEDPVDRIERLAAENAVVIFSVSTCCMCHAIKRLFCGMGVNPTVYELDEDPR---  57

Query  319  ieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGAL  152
                   GG  ++A  + L      P VFIGG+L G +DR+MA+HISG L P+LK AGAL
Sbjct  58   -------GGDMEKALMRLLGSSSPVPVVFIGGKLVGAMDRVMASHISGTLVPLLKDAGAL  110

Query  151  WL  146
            WL
Sbjct  111  WL  112



>ref|NP_001152054.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
 gb|ACG45565.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
Length=160

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 66/102 (65%), Gaps = 8/102 (8%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V E  V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E     +            A  
Sbjct  67   VAERPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADESALAGLVPAG--------AGA  118

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 PAVF+GGRL GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  119  AAGALPAVFVGGRLLGGLDRLMAVHISGELVPILKKAGALWL  160



>ref|XP_004138799.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
 gb|KGN63150.1| hypothetical protein Csa_2G405010 [Cucumis sativus]
Length=124

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 14/122 (11%)
 Frame = -2

Query  499  MYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekev  320
            M    +++P D  + +  E+AVV+F    CCM H ++RL   +GVNP V E+DE+     
Sbjct  13   MSTSSLEDPVDRIERLAAENAVVIFSVSTCCMCHAIKRLFCGMGVNPTVYELDEDPR---  69

Query  319  ieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGAL  152
                   GG  ++A  + L      P VFIGG+L G +DR+MA+HISG L P+LK AGAL
Sbjct  70   -------GGDMEKALMRLLGSSSPVPVVFIGGKLVGAMDRVMASHISGTLVPLLKDAGAL  122

Query  151  WL  146
            WL
Sbjct  123  WL  124



>tpg|DAA58202.1| TPA: grx_I1-glutaredoxin subgroup III [Zea mays]
Length=159

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 66/102 (65%), Gaps = 8/102 (8%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V E  V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E     +            A  
Sbjct  66   VAERPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADESALAGLVPAG--------AGA  117

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 PAVF+GGRL GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  118  AAGALPAVFVGGRLLGGLDRLMAVHISGELVPILKKAGALWL  159



>ref|XP_001770429.1| predicted protein [Physcomitrella patens]
 gb|EDQ64766.1| predicted protein [Physcomitrella patens]
Length=102

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 13/108 (12%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            + +V E+AVVVF + GCCM HVV+RL   LGV P V E+DE  E          GG  ++
Sbjct  5    EKLVQENAVVVFSQSGCCMCHVVKRLFCSLGVGPTVHELDERKE----------GGDMEK  54

Query  280  AE---KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            A       +  P VF+GG+L GG+D +MAAH+SG L P LK+AGALWL
Sbjct  55   ALLRLNNKVALPTVFVGGKLVGGVDAVMAAHVSGNLVPRLKEAGALWL  102



>gb|AFW83510.1| grx_I1-glutaredoxin subgroup III [Zea mays]
Length=159

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 68/102 (67%), Gaps = 8/102 (8%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E            G     AE 
Sbjct  66   VAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADEAALA--------GVVPAGAEA  117

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 PAVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  118  AAAALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  159



>ref|XP_008341254.1| PREDICTED: glutaredoxin-C5-like [Malus domestica]
 ref|XP_009378005.1| PREDICTED: glutaredoxin-C5-like [Pyrus x bretschneideri]
 ref|XP_009350707.1| PREDICTED: glutaredoxin-C5-like [Pyrus x bretschneideri]
Length=126

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G+ +P +  + M +ESAVV+F    CCM H ++RL   +GVNP V E+DE+   + +E+ 
Sbjct  19   GMGDPMERIERMASESAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPRGKDLEK-  77

Query  307  esIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 A  R        P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  78   -----ALTRLLGTSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  126



>ref|XP_009344217.1| PREDICTED: glutaredoxin-C5-like [Pyrus x bretschneideri]
Length=126

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G+ +P +  + M +ESAVV+F    CCM H ++RL   +GVNP V E+DE+   + +E+ 
Sbjct  19   GMGDPMERIERMASESAVVIFSISSCCMCHAIKRLFCGMGVNPTVHELDEDPRGKDLEK-  77

Query  307  esIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 A  R        P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  78   -----ALTRLLGTSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  126



>ref|XP_002892183.1| hypothetical protein ARALYDRAFT_470358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68442.1| hypothetical protein ARALYDRAFT_470358 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 10/103 (10%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V E+AVVVF RRGCCM  V +RLL   GVNP+V EI EE                  ++
Sbjct  58   VVMENAVVVFARRGCCMGDVAKRLLLTHGVNPLVVEIGEEDNNNNY--------DNIISD  109

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            K+  + P ++IGG+LFGGL+ +MAAHI+G+L P L+QAGALWL
Sbjct  110  KE--KLPMMYIGGKLFGGLENLMAAHINGDLVPTLRQAGALWL  150



>ref|XP_003561465.1| PREDICTED: glutaredoxin-C9-like [Brachypodium distachyon]
Length=122

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 65/114 (57%), Gaps = 23/114 (20%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            M + SAVVVF   GCCM HVV+RLL  LGV P V E+D+             GGAG   +
Sbjct  21   MASGSAVVVFSASGCCMCHVVKRLLLGLGVGPAVYELDQL------------GGAGREIQ  68

Query  274  KK-----------GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                         G   P VF+GGRL GG+D++MA HI+G L P+LK AGALWL
Sbjct  69   AALAQLLPGSSNGGAVVPVVFVGGRLLGGVDKVMACHINGSLVPLLKDAGALWL  122



>ref|NP_001147444.1| LOC100281053 [Zea mays]
 gb|ACG27551.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
Length=158

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 68/102 (67%), Gaps = 8/102 (8%)
 Frame = -2

Query  451  VTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEK  272
            V ES V+V GRRGCC+ HVV+RLLQ LGVNP V E+ +E            G     AE 
Sbjct  65   VAESPVLVVGRRGCCLSHVVKRLLQGLGVNPAVHEVADEAALA--------GVVPAGAEA  116

Query  271  KGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 PAVF+GG+L GGLDR+MA HISGEL P+LK+AGALWL
Sbjct  117  AAAALPAVFVGGKLLGGLDRLMAVHISGELVPILKKAGALWL  158



>ref|NP_001151360.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
 gb|ACG42536.1| Grx_I1 - glutaredoxin subgroup III [Zea mays]
Length=148

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 83/170 (49%), Gaps = 36/170 (21%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVG--------------NQSSAPLMNKAGSSSSMYVDGVKE  476
            M +AIPY      PR   P +G               Q+S P   +A +      + V+ 
Sbjct  1    MYQAIPYSAGQPWPRP-APTIGPDVAEEEGLLAAAQQQASTPAEAEAAARMEEEEEQVR-  58

Query  475  PKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIG  296
                    V E  V+V G RGCC+ HVV+RLLQ LGVNP V E+                
Sbjct  59   ------RAVAECPVLVVGMRGCCLSHVVKRLLQGLGVNPAVHEVAGAEAD----------  102

Query  295  GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 A       PAVF+GGRL GGLDR+MAAHISG+L P+LK AGALWL
Sbjct  103  ----LAAAGVAALPAVFVGGRLLGGLDRLMAAHISGDLVPILKDAGALWL  148



>gb|EPS67459.1| hypothetical protein M569_07317, partial [Genlisea aurea]
Length=112

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 71/116 (61%), Gaps = 9/116 (8%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseidee--vekevie  314
            G ++P +    + + SAVV+F    CCM H V+RL   +GVNP V E+D++   ++    
Sbjct  4    GRQDPLERVARLASGSAVVIFSSSTCCMCHAVKRLFCGMGVNPTVYELDQDPRGKEIERA  63

Query  313  elesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                +GGAG          P VFIGGRL G +D++MA+HISG L P+LK+AGALWL
Sbjct  64   LSRLLGGAGS-------ALPVVFIGGRLIGAMDKVMASHISGTLVPLLKEAGALWL  112



>ref|XP_006438817.1| hypothetical protein CICLE_v10033688mg [Citrus clementina]
 gb|ESR52057.1| hypothetical protein CICLE_v10033688mg [Citrus clementina]
Length=139

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = -2

Query  481  KEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieeles  302
            +EP +    + +ESAVV+F    CCM H V+RL   +GVNP V EID +     IE +  
Sbjct  32   EEPMEKVARVASESAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYEIDHDPRGADIERVLM  91

Query  301  IGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               A   A    +  P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  92   RLLANSSA----VPVPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL  139



>ref|XP_008441305.1| PREDICTED: glutaredoxin-C1-like [Cucumis melo]
Length=124

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 71/117 (61%), Gaps = 14/117 (12%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            +++P D  + +  E+AVV+F    CCM H ++RL   +GVNP V E+DE+          
Sbjct  18   LEDPVDRIERLAAENAVVIFSVSTCCMCHAIKRLFCGMGVNPTVYELDEDPR--------  69

Query  304  sIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              GG  ++A  + L      P VF+GG+L G +DR+MA+HISG L P+LK AGALWL
Sbjct  70   --GGDMEKALMRLLGSSSPVPVVFVGGKLVGAMDRVMASHISGTLVPLLKDAGALWL  124



>ref|XP_002303767.1| hypothetical protein POPTR_0003s16540g [Populus trichocarpa]
 gb|EEE78746.1| hypothetical protein POPTR_0003s16540g [Populus trichocarpa]
Length=126

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +ESAVVVF    CCM H V+RL   +GVNP V E+D +            
Sbjct  22   DPLEKVARLASESAVVVFSISSCCMCHAVKRLFCGMGVNPTVYELDHDPR----------  71

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G+  EK  ++        P VFIGG+L G ++R+MA+HISG L P+LK+AGALWL
Sbjct  72   ---GEEIEKALMRLLGNSTSVPVVFIGGKLIGAMERVMASHISGTLVPLLKEAGALWL  126



>ref|XP_011020819.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=126

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +ESAVVVF    CCM H V+RL   +GVNP V E+D +            
Sbjct  22   DPLEKVARLASESAVVVFSISSCCMCHAVKRLFCGMGVNPTVYELDHDPR----------  71

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G+  EK  ++        P VFIGG+L G ++R+MA+HISG L P+LK+AGALWL
Sbjct  72   ---GEEIEKALMRLLGNSTSVPVVFIGGKLIGAMERVMASHISGTLVPLLKEAGALWL  126



>ref|XP_009381029.1| PREDICTED: monothiol glutaredoxin-S3 [Musa acuminata subsp. malaccensis]
Length=122

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -2

Query  424  GRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAVF  245
            GR GCCMVHVVRRLLQ  GVNPVV E+ E+ ++  +          D  +      PAVF
Sbjct  30   GRSGCCMVHVVRRLLQGQGVNPVVCEVGEDADEAALVSGLRGADDDDDIDLAAAALPAVF  89

Query  244  IGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +GGRL GGL+R++A HI+GEL P+LK+AGALWL
Sbjct  90   VGGRLVGGLERLVAVHIAGELVPILKRAGALWL  122



>gb|KDO83116.1| hypothetical protein CISIN_1g039295mg [Citrus sinensis]
Length=139

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = -2

Query  481  KEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieeles  302
            +EP +    + +ESAVV+F    CCM H V+RL   +GVNP V E+D +     IE +  
Sbjct  32   EEPMEKVARVASESAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDHDPRGADIERVLM  91

Query  301  IGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               A   A    +  P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  92   RLLANSSA----VPVPIVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL  139



>ref|XP_004304538.1| PREDICTED: glutaredoxin-C7-like [Fragaria vesca subsp. vesca]
Length=125

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 13/115 (11%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + M +ESAVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  20   DPLERIERMASESAVVIFSVSTCCMCHAIKRLFCGMGVNPTVYELDEDPRG---------  70

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + +      P VFIGG+L G +DR+MA+HI+G L P+LKQAGALWL
Sbjct  71   GKDLERALMRLMGTSNAVPVVFIGGKLVGTMDRVMASHINGSLVPLLKQAGALWL  125



>ref|XP_002299331.2| hypothetical protein POPTR_0001s13440g [Populus trichocarpa]
 gb|EEE84136.2| hypothetical protein POPTR_0001s13440g [Populus trichocarpa]
Length=126

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 67/120 (56%), Gaps = 20/120 (17%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            V +P +    + + SAVVVF    CCM H V+RL   +GVNP V E+D +          
Sbjct  20   VSDPLEKVARLASGSAVVVFSISSCCMCHAVKRLFCGMGVNPTVYELDHDPR--------  71

Query  304  sIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 G   EK  ++        P VFIGG+L G +DR+MA+HISG L P+LK+AGALWL
Sbjct  72   -----GKEIEKALMRLLGSSTSVPVVFIGGKLIGAMDRVMASHISGTLVPLLKEAGALWL  126



>ref|XP_010249120.1| PREDICTED: glutaredoxin-C1-like [Nelumbo nucifera]
Length=123

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 20/127 (16%)
 Frame = -2

Query  505  SSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevek  326
            S M    V +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+   
Sbjct  10   SYMPTRSVGDPLERVERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVYELDEDPR-  68

Query  325  evieelesIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLK  167
                        G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK
Sbjct  69   ------------GKEMEKALMRLLGSSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLK  116

Query  166  QAGALWL  146
            +AGALWL
Sbjct  117  EAGALWL  123



>ref|XP_010250605.1| PREDICTED: glutaredoxin-C1-like [Nelumbo nucifera]
Length=123

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 20/127 (16%)
 Frame = -2

Query  505  SSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevek  326
            S M    V +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+   
Sbjct  10   SYMPTRSVGDPLERVERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVYELDEDPR-  68

Query  325  evieelesIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLK  167
                        G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK
Sbjct  69   ------------GKEIEKALMRLLGSSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLK  116

Query  166  QAGALWL  146
            +AGALWL
Sbjct  117  EAGALWL  123



>gb|KDP41803.1| hypothetical protein JCGZ_26821 [Jatropha curcas]
Length=127

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  +++ +E+AVV+F    CCM H ++RL   +GVNP V E+D++            
Sbjct  23   DPLERIESLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVHELDQDPR----------  72

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LKQAGALWL
Sbjct  73   ---GKEMEKALMRLLGSSSAVPVVFIGGKLVGAMDRVMASHINGSLVPLLKQAGALWL  127



>ref|XP_011036126.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=126

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 68/120 (57%), Gaps = 20/120 (17%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            V +P +    + + SAVVVF    CCM H V+RL   +GVNP V E+D +          
Sbjct  20   VSDPLEKVARLASGSAVVVFSISSCCMCHAVKRLFCGMGVNPTVYELDHDPR--------  71

Query  304  sIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 G+  EK  ++        P VFIGG+L G ++R+MA+HISG L P+LK+AGALWL
Sbjct  72   -----GEEIEKALMRLLGNSTSVPVVFIGGKLIGAMERVMASHISGTLVPLLKEAGALWL  126



>ref|XP_007031936.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY02862.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=125

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 74/127 (58%), Gaps = 14/127 (11%)
 Frame = -2

Query  514  GSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseidee  335
            GS        V +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+
Sbjct  9    GSYVPTSTRSVGDPLERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVYELDED  68

Query  334  vekevieelesIGGAGDRAEKKGLQ----FPAVFIGGRLFGGLDRIMAAHISGELTPVLK  167
                        G   +RA  + L+     P VFIGG+L G +DR+MA+HI+G L P+LK
Sbjct  69   PR----------GKDMERALMRLLRSSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLK  118

Query  166  QAGALWL  146
            +AGALWL
Sbjct  119  EAGALWL  125



>ref|XP_006836357.1| hypothetical protein AMTR_s00092p00109090 [Amborella trichopoda]
 gb|ERM99210.1| hypothetical protein AMTR_s00092p00109090 [Amborella trichopoda]
Length=122

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 5/105 (5%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            + +  ESAVVVF  +GCCM HV R L   LGV+P V EI+E    + +         G  
Sbjct  23   QQVAGESAVVVFSDQGCCMCHVARSLFSSLGVSPAVHEIEEGWRGDEVRAALCRIAGGVE  82

Query  280  AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 +  PAVF+GGRL GGL+R++A HISG L P+LK+AGALWL
Sbjct  83   -----VALPAVFVGGRLVGGLERVVACHISGGLVPLLKEAGALWL  122



>ref|XP_007216287.1| hypothetical protein PRUPE_ppa020474mg [Prunus persica]
 ref|XP_008231071.1| PREDICTED: glutaredoxin-C5-like [Prunus mume]
 gb|EMJ17486.1| hypothetical protein PRUPE_ppa020474mg [Prunus persica]
Length=125

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + M +E+AVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  21   DPLERIERMASENAVVIFSVSSCCMCHAIKRLFCGMGVNPTVYELDEDPR----------  70

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  71   GKDLERALMRLLGTSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  125



>gb|KDP26855.1| hypothetical protein JCGZ_18013 [Jatropha curcas]
Length=125

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 69/119 (58%), Gaps = 18/119 (15%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            EP +    + +ESAVV+F    CCM H V+RL   +GVNP V EIDE+            
Sbjct  17   EPLERVVRLASESAVVIFSISSCCMCHAVKRLFCGMGVNPTVYEIDEDPR----------  66

Query  298  GGAGDRAEKKGL--------QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L          P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  67   GKEIERALMRLLGNFSYSSSAVPVVFIGGKLVGAIDRVMASHINGTLVPLLKEAGALWL  125



>ref|XP_007043882.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOX99713.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=124

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 17/134 (13%)
 Frame = -2

Query  526  MNKAGSSSSMYVDGVK---EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPv  356
            M+  G S   YV       +P +    + +ESAVV+F    CCM H V+RL   +GVNP 
Sbjct  1    MHYQGDSWGYYVPTRSMGSDPMERVVKLASESAVVIFSLSTCCMCHAVKRLFCGMGVNPT  60

Query  355  vseideevekevieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISG  188
            V E+D++            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G
Sbjct  61   VYELDQDPR----------GKEMERALMRLLGNSQAVPVVFIGGKLIGAMDRVMASHING  110

Query  187  ELTPVLKQAGALWL  146
             L P+LK AGALWL
Sbjct  111  TLVPLLKDAGALWL  124



>ref|XP_002272852.1| PREDICTED: glutaredoxin-C1 [Vitis vinifera]
Length=123

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 20/127 (16%)
 Frame = -2

Query  505  SSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevek  326
            S M    V +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+   
Sbjct  10   SYMPTRSVGDPLERIERLASENAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPR-  68

Query  325  evieelesIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLK  167
                        G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK
Sbjct  69   ------------GKEMEKALMRLLGSSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLK  116

Query  166  QAGALWL  146
             AGALWL
Sbjct  117  DAGALWL  123



>ref|XP_002514866.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF47420.1| glutaredoxin, grx, putative [Ricinus communis]
Length=128

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +ESAVV+F    CCM H V+RL   +GVNP V E+D++            
Sbjct  23   DPIERVVRLASESAVVIFSISSCCMCHAVKRLFCGMGVNPTVYELDQDPR----------  72

Query  298  GGAGDRAEKKGL-----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L       P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   GKEIERALMRLLGNYSSVVPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL  128



>ref|XP_004310231.1| PREDICTED: glutaredoxin-C1-like [Fragaria vesca subsp. vesca]
Length=130

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + ++SAVV+F    CCM H V+RL   +GVNP V E+D++            
Sbjct  26   DPLERVARLASKSAVVIFSLSSCCMCHAVKRLFCGMGVNPTVYELDQDPR----------  75

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  76   GKEIERALMRLLGNSSAVPVVFIGGKLIGAMDRVMASHINGSLVPLLKEAGALWL  130



>ref|XP_006844586.1| hypothetical protein AMTR_s00016p00206670 [Amborella trichopoda]
 gb|ERN06261.1| hypothetical protein AMTR_s00016p00206670 [Amborella trichopoda]
Length=113

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + +  E+AVV+F    CCM H V+RL   +GVNP V E+DE+            
Sbjct  9    DPLERVERLAAENAVVIFSISSCCMCHAVKRLFCGMGVNPTVYELDEDPR----------  58

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   EK  ++        PAVFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  59   ---GKEMEKALVRLLGSSQAVPAVFIGGKLIGPMDRVMASHINGSLVPLLKEAGALWL  113



>ref|XP_010024181.1| PREDICTED: glutaredoxin-C1 [Eucalyptus grandis]
 gb|KCW60633.1| hypothetical protein EUGRSUZ_H03357 [Eucalyptus grandis]
Length=126

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 77/131 (59%), Gaps = 9/131 (7%)
 Frame = -2

Query  526  MNKAGSSSSMYVDG---VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPv  356
            M+    S S Y+     V +P +  + M  ESAVV+F    CCM H V+ L   +GVNP 
Sbjct  1    MHYQTESWSTYLPAARPVGDPVERIERMAAESAVVIFSVSTCCMCHAVKSLFCGMGVNPT  60

Query  355  vseideeve-kevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELT  179
            V E+D +   KE+ + L  + GA   A       P VFIGG+L G +DR+MA+HI+G L 
Sbjct  61   VHELDHDPRGKELEKALARLSGAPPSA-----AVPVVFIGGKLVGAMDRVMASHINGTLV  115

Query  178  PVLKQAGALWL  146
            P+LK+AGALWL
Sbjct  116  PLLKEAGALWL  126



>ref|XP_009336451.1| PREDICTED: glutaredoxin-C1-like [Pyrus x bretschneideri]
Length=127

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + ++SAVV+F    CCM H V+RL   +GVNP V E+D++            
Sbjct  23   DPLERVARLASKSAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDQDPR----------  72

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   GKEIERALMRLLGTSSAVPVVFIGGKLIGAMDRVMASHINGSLVPLLKEAGALWL  127



>gb|AFK35832.1| unknown [Medicago truncatula]
Length=124

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 69/115 (60%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  20   DPLERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPAVHELDEDPR----------  69

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA HI+G L P+LKQAGALWL
Sbjct  70   GKELERALMRLLGTSNVVPVVFIGGKLIGTMDRVMACHINGSLVPLLKQAGALWL  124



>gb|KDO63867.1| hypothetical protein CISIN_1g033109mg [Citrus sinensis]
Length=127

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + + +E+AVV+F    CCM H V+RL   +GVNP V E+DE+ +          
Sbjct  23   DPLEHIERLASENAVVIFSISSCCMCHAVKRLFCGMGVNPTVYELDEDPK----------  72

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   ---GKDMEKALMRLLGTSPAVPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGALWL  127



>ref|XP_008389917.1| PREDICTED: glutaredoxin-C1-like [Malus domestica]
Length=127

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + ++SAVV+F    CCM H V+RL   +GVNP V E+D++            
Sbjct  23   DPLERVARLASKSAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDQDPR----------  72

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   GKEIERALMRLLGTSSAVPVVFIGGKLIGAMDRVMASHINGSLVPLLKEAGALWL  127



>ref|XP_006483043.1| PREDICTED: glutaredoxin-C5-like [Citrus sinensis]
Length=105

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 60/107 (56%), Gaps = 16/107 (15%)
 Frame = -2

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR----  281
            +ESAVV+F    CCM H V+RL   +GVNP               + +  G   +R    
Sbjct  9    SESAVVIFSVSSCCMCHAVKRLFCGMGVNP----------TVYEIDHDPRGADIERVLMR  58

Query  280  --AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              A    +  P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  59   LLANSSAVPVPVVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL  105



>ref|XP_009402640.1| PREDICTED: monothiol glutaredoxin-S9-like [Musa acuminata subsp. 
malaccensis]
Length=169

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 5/109 (5%)
 Frame = -2

Query  469  DGA-KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGG  293
            DGA K MV E+ VVV  +RGCC+ H  RRLL  LGVNP V E+ EE              
Sbjct  57   DGAMKQMVAENPVVVVAQRGCCICHAARRLLLGLGVNPAVCEVGEEAAAAGEATALVEAA  116

Query  292  AGDRA----EKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAG  158
            A   A     +     P VF+GGRL GGLDR++A HI+GEL P+LK+AG
Sbjct  117  AEIEALGGHRRPPAMLPVVFVGGRLLGGLDRLVAVHITGELVPILKEAG  165



>ref|XP_006447012.1| hypothetical protein CICLE_v10017534mg [Citrus clementina]
 ref|XP_006468831.1| PREDICTED: glutaredoxin-C3-like [Citrus sinensis]
 gb|ESR60252.1| hypothetical protein CICLE_v10017534mg [Citrus clementina]
Length=127

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + + +E+AVV+F    CCM H V+RL   +GVNP V E+DE+ +          
Sbjct  23   DPLEHIERLASENAVVIFSISSCCMCHAVKRLFCGMGVNPTVYELDEDPK----------  72

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   ---GKDMEKALMRLLGTSPAVPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGALWL  127



>ref|XP_004958945.1| PREDICTED: glutaredoxin-C9-like, partial [Setaria italica]
Length=115

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 64/111 (58%), Gaps = 18/111 (16%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            M + +AVVVF   GCCM HVV+RLL  LGV P V E+D+              G G   +
Sbjct  15   MASGNAVVVFSASGCCMCHVVKRLLLGLGVGPTVYELDQLGSS----------GGGREIQ  64

Query  274  KKGLQF--------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                Q         P VF+GGRL GG++++MA HI+G L P+LKQAGALWL
Sbjct  65   AALAQLLPPGQPAVPVVFVGGRLLGGVEKVMACHINGTLVPLLKQAGALWL  115



>ref|XP_004492160.1| PREDICTED: glutaredoxin-C3-like [Cicer arietinum]
Length=133

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 70/120 (58%), Gaps = 20/120 (17%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            + +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+          
Sbjct  27   IGDPLERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVHELDEDPR--------  78

Query  304  sIGGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 G+  E+  ++        P VFIGG+L G +DR+MA HI+G L P+LKQAGALWL
Sbjct  79   -----GNELERALMRLIGTNNVVPVVFIGGQLIGTMDRVMACHINGTLVPLLKQAGALWL  133



>ref|XP_008649997.1| PREDICTED: monothiol glutaredoxin-S9-like [Zea mays]
 gb|AFW79163.1| grx_I1-glutaredoxin subgroup III [Zea mays]
Length=144

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 82/159 (52%), Gaps = 18/159 (11%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGN---QSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTE  443
            M +AIPY      PR   P +G    +    L      +S+      +  ++  +  V E
Sbjct  1    MYQAIPYSAGQPWPRP-APTIGPDVAEEEGLLAASQQQASTPAEAAARVEEEEVRRAVAE  59

Query  442  SAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGL  263
              V+V G RGCC+ HVV+RLLQ LGVNP V E+                     A     
Sbjct  60   CPVLVVGVRGCCLSHVVKRLLQGLGVNPAVHEVAGAEAD--------------LAAAGVA  105

Query  262  QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              PAVF+GGRL GGLDR+MAAHISG+L P+LK AGALWL
Sbjct  106  ALPAVFVGGRLLGGLDRLMAAHISGDLVPILKDAGALWL  144



>ref|XP_008459889.1| PREDICTED: glutaredoxin-C1-like [Cucumis melo]
Length=128

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 15/117 (13%)
 Frame = -2

Query  481  KEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieeles  302
            ++P D    +  ESAVV+F    CCM H ++RLL  +GV+P V E+D +           
Sbjct  22   RDPVDRVIRLAAESAVVIFSVSSCCMCHALKRLLCGMGVSPTVYELDHDPR---------  72

Query  301  IGGAGDRAEKKGL-----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             G   +RA  + +       P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   -GKDIERALMRLVGATSPPVPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGALWL  128



>gb|AGX01499.1| glutaredoxin [Cucumis sativus]
 gb|KGN46432.1| hypothetical protein Csa_6G092540 [Cucumis sativus]
Length=128

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 15/117 (13%)
 Frame = -2

Query  481  KEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieeles  302
            ++P D    +  ESAVV+F    CCM H ++RLL  +GV+P V E+D +           
Sbjct  22   RDPVDRVIRLAAESAVVIFSVSSCCMCHALKRLLCGMGVSPTVYELDHDPR---------  72

Query  301  IGGAGDRAEKKGL-----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             G   +RA  + +       P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   -GKDIERALMRLVGATSPPVPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGALWL  128



>ref|XP_011086843.1| PREDICTED: glutaredoxin-C5-like [Sesamum indicum]
Length=125

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 6/114 (5%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G  +P +    + + SAVV+F    CCM H V+RL   +GVNP V E+D++   + IE  
Sbjct  18   GSGDPLERVVRLASGSAVVIFSVSTCCMCHAVKRLFCGMGVNPTVYELDQDPRGKEIER-  76

Query  307  esIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 A  R    G   P VFIGG+L G +DR+MA+HISG L P+LK+AGALWL
Sbjct  77   -----ALSRLLGGGSAVPVVFIGGKLIGAMDRVMASHISGTLVPLLKEAGALWL  125



>ref|XP_004140545.1| PREDICTED: glutaredoxin-C3-like [Cucumis sativus]
 ref|XP_004170597.1| PREDICTED: glutaredoxin-C3-like [Cucumis sativus]
Length=115

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 15/117 (13%)
 Frame = -2

Query  481  KEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieeles  302
            ++P D    +  ESAVV+F    CCM H ++RLL  +GV+P V E+D +           
Sbjct  9    RDPVDRVIRLAAESAVVIFSVSSCCMCHALKRLLCGMGVSPTVYELDHDPR---------  59

Query  301  IGGAGDRAEKKGL-----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             G   +RA  + +       P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  60   -GKDIERALMRLVGATSPPVPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGALWL  115



>ref|XP_004244929.1| PREDICTED: glutaredoxin-C9-like [Solanum lycopersicum]
Length=126

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 80/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  526  MNKAGSSSSMYVDG---VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPv  356
            M     SSSM + G   ++   +  + +V+ +AVVVF   GCCM HVV++LL  LGV P 
Sbjct  1    MQVVKESSSMRMVGESRMESIYERVRLLVSGNAVVVFTMSGCCMCHVVKQLLFGLGVGPT  60

Query  355  vseideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTP  176
            + E+D +V  + I  L     AGD  ++     PAVF+GG+  GG++ +MA HI+G L P
Sbjct  61   IVELDRDVAGKEIHALLFQL-AGDGQQQP---VPAVFVGGKFLGGIETVMACHINGTLVP  116

Query  175  VLKQAGALWL  146
            +LKQAGALWL
Sbjct  117  LLKQAGALWL  126



>gb|KFK25638.1| hypothetical protein AALP_AA8G140700 [Arabis alpina]
Length=139

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 63/105 (60%), Gaps = 0/105 (0%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            ++M +ESAVV+F    CCM H V+RL + +GV+P V E+D       I         G  
Sbjct  35   ESMASESAVVIFSVSTCCMCHAVKRLFRGMGVSPAVHELDLHPNGVEIHRTLLRLLGGGG  94

Query  280  AEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                 +  P VFIGG++ G ++R+MA+HI+G L P+LK AGALWL
Sbjct  95   GASSPVGLPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGALWL  139



>ref|XP_003548512.1| PREDICTED: glutaredoxin-C5-like [Glycine max]
Length=134

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 14/117 (12%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            V +P +  + + +ESAVV+F    CCM H ++RL   +GVNP               + +
Sbjct  28   VGDPLERIERLASESAVVIFSVSTCCMCHAIKRLFCGMGVNP----------TVHELDED  77

Query  304  sIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              G   +RA  + L      P VFIGG+L G +DR+MA HI+G L P+LK+AGALWL
Sbjct  78   PRGKDLERALMRLLGTPSVVPVVFIGGKLVGTMDRVMACHINGTLVPLLKEAGALWL  134



>ref|XP_006853862.1| hypothetical protein AMTR_s00036p00111760 [Amborella trichopoda]
 gb|ERN15329.1| hypothetical protein AMTR_s00036p00111760 [Amborella trichopoda]
Length=123

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 18/127 (14%)
 Frame = -2

Query  517  AGSSSSMYVDGVKEPKDG---AKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvse  347
            A S+S++      E +     AK ++ E+ V++F    CCM HV++RLL  LGV+P V E
Sbjct  12   ALSTSALSTTAASETETACERAKRLIEENPVIIFSNPSCCMCHVMKRLLLTLGVHPTVIE  71

Query  346  ideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLK  167
             D++                 RA    L  PAVFIGG L GGL+ +M  H+SG+L   LK
Sbjct  72   SDDDAL---------------RALSSSLSAPAVFIGGELVGGLESLMGLHLSGDLLTRLK  116

Query  166  QAGALWL  146
             +GALWL
Sbjct  117  DSGALWL  123



>ref|XP_009803758.1| PREDICTED: glutaredoxin-C7-like [Nicotiana sylvestris]
Length=123

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 9/111 (8%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + M + +AVV+F    CCM H +++L   +GVNP V E+DE    E        
Sbjct  22   DPLEEVQGMASRNAVVIFSNNTCCMCHAIKKLFCGMGVNPTVYELDENSSWEQ-------  74

Query  298  GGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              A           P VFIGG+L G +D +MAAHI+G L P+LK+AGALWL
Sbjct  75   --ALMSLLGSSSSLPVVFIGGKLVGAMDSVMAAHINGTLVPLLKEAGALWL  123



>ref|XP_001763715.1| predicted protein [Physcomitrella patens]
 gb|EDQ71357.1| predicted protein [Physcomitrella patens]
Length=102

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 65/111 (59%), Gaps = 19/111 (17%)
 Frame = -2

Query  460  KNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDR  281
            + +V E+AVVVF +  CCM HVV+RL   LGV P V E+DE                G  
Sbjct  5    EKLVQENAVVVFSQSRCCMCHVVKRLFCNLGVGPTVHELDERK-------------EGVD  51

Query  280  AEKKGLQF------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             EK  L+       P VF+GG+L GG+D +MAAH+SG L P LK+AGALWL
Sbjct  52   MEKALLRLNNTVVLPTVFVGGKLVGGVDAVMAAHVSGNLVPRLKEAGALWL  102



>ref|XP_010460645.1| PREDICTED: glutaredoxin-C9-like isoform X2 [Camelina sativa]
Length=152

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 73/112 (65%), Gaps = 3/112 (3%)
 Frame = -2

Query  526  MNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvse  347
            MN  G S        +E  +  + +V E+AV+V GRRGCCM  VV+RLL  LGVNP V E
Sbjct  39   MNTVGESLRPLTLKTQENGESVRTLVEENAVIVIGRRGCCMCLVVKRLLLGLGVNPTVLE  98

Query  346  ideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHIS  191
            IDEE E+EV+ ELE IG  G R   K    PAV++GGRLFGGLDR+MA  IS
Sbjct  99   IDEEREEEVLSELEKIGVHGGRETVK---LPAVYVGGRLFGGLDRVMATLIS  147



>ref|XP_008652019.1| PREDICTED: glutaredoxin-C9-like [Zea mays]
 tpg|DAA59548.1| TPA: hypothetical protein ZEAMMB73_481275 [Zea mays]
Length=159

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 65/112 (58%), Gaps = 19/112 (17%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            M   +AVVVF   GCCM HVV+RLL  LGV P V E+D+             GG G R  
Sbjct  58   MAGGNAVVVFSASGCCMCHVVKRLLLGLGVGPTVYELDQMAA----------GGGGGREI  107

Query  274  KKGL---------QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +  L           P VF+GGRL GG++++MA HI+G L P+LKQAGALWL
Sbjct  108  QAALAQLLPPGQPPLPVVFVGGRLLGGVEKVMACHINGTLVPLLKQAGALWL  159



>ref|XP_008222218.1| PREDICTED: glutaredoxin-C1-like [Prunus mume]
Length=127

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    +  +SAVV+F    CCM H V+RL   +GVNP               + +  
Sbjct  23   DPLERVARLAAKSAVVIFSVSSCCMCHAVKRLFCGMGVNP----------TVYELDQDPR  72

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   GKEIERALMRLLGNSPAVPVVFIGGKLIGTMDRVMASHINGSLVPLLKEAGALWL  127



>ref|XP_010680093.1| PREDICTED: glutaredoxin-C3 [Beta vulgaris subsp. vulgaris]
Length=109

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 20/108 (19%)
 Frame = -2

Query  448  TESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKK  269
            +E+AVV+F +  CCM H ++RL   +GVNP V ++D                 G+  EK 
Sbjct  15   SENAVVIFSKSSCCMCHAIQRLFCGMGVNPTVHDLDM-------------DPWGEDMEKA  61

Query  268  GLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             +         P VF+GG+L G +DR+MA+HI+G L P+LKQAGALWL
Sbjct  62   LMLLLTTPNPVPVVFVGGQLLGAMDRVMASHINGSLVPLLKQAGALWL  109



>ref|XP_002300130.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE84935.1| glutaredoxin family protein [Populus trichocarpa]
Length=123

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  19   DPLERIGRLASENAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPR----------  68

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  69   ---GKEMEKALMRLLGSSSAVPVVFIGGKLVGAMDRVMASHINGSLVPLLKEAGALWL  123



>ref|XP_009801947.1| PREDICTED: glutaredoxin-C5-like [Nicotiana sylvestris]
Length=132

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 20/132 (15%)
 Frame = -2

Query  529  LMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvs  350
            +  + GSSSS       +P +    + + SAVV+F    CCM H V+RL   +GV+P V 
Sbjct  17   IATRRGSSSS------SDPLERVVRLASGSAVVIFSVSTCCMCHAVKRLFCGMGVHPTVY  70

Query  349  eideevekevieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGEL  182
            E+D++ +          G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L
Sbjct  71   ELDQDPK----------GNEMERALSRLLGNAPAVPVVFIGGKLIGAMDRVMASHINGTL  120

Query  181  TPVLKQAGALWL  146
             P+LK+AGALWL
Sbjct  121  VPLLKEAGALWL  132



>ref|XP_007227610.1| hypothetical protein PRUPE_ppa021177mg [Prunus persica]
 gb|EMJ28809.1| hypothetical protein PRUPE_ppa021177mg [Prunus persica]
Length=126

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    +  +SAVV+F    CCM H V+RL   +GVNP               + +  
Sbjct  22   DPLERVARLAAKSAVVIFSVSSCCMCHAVKRLFCGMGVNP----------TVYELDQDPR  71

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  72   GKEIERALMRLLGNSPAVPVVFIGGKLIGTMDRVMASHINGSLVPLLKEAGALWL  126



>ref|XP_007213996.1| hypothetical protein PRUPE_ppa014139mg [Prunus persica]
 gb|EMJ15195.1| hypothetical protein PRUPE_ppa014139mg [Prunus persica]
Length=84

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = -2

Query  406  MVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLF  227
            M HVV+RLL   GVNP V E+DE+ E +V+ EL  + G G   ++   QFP VF+GG+LF
Sbjct  1    MCHVVKRLLLGHGVNPTVFEVDEDDESDVVVELRKLIGEG---QEDWPQFPVVFVGGKLF  57

Query  226  GGLDRIMAAHISGELTPVLKQAGALWL  146
            GGL+R+MA HISGEL PVLKQAGALWL
Sbjct  58   GGLERVMATHISGELVPVLKQAGALWL  84



>ref|XP_007161691.1| hypothetical protein PHAVU_001G090300g [Phaseolus vulgaris]
 gb|ESW33685.1| hypothetical protein PHAVU_001G090300g [Phaseolus vulgaris]
Length=126

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 14/117 (12%)
 Frame = -2

Query  484  VKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele  305
            V +P +  + + +E+AVV+F    CCM H ++RL   +GVNP               + +
Sbjct  20   VGDPLERIERLASENAVVIFSVSTCCMCHAIKRLFCGMGVNP----------TVHELDED  69

Query  304  sIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              G   +RA  + L      P VFIGG+L G +DR+MA HI+G L P+LK+AGALWL
Sbjct  70   PRGKDLERALMRLLGSPSVVPVVFIGGKLVGTMDRVMACHINGTLVPLLKEAGALWL  126



>ref|XP_011045755.1| PREDICTED: glutaredoxin-C1 [Populus euphratica]
 ref|XP_011015327.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=123

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 20/118 (17%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  19   DPLERIGRLASENAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPR----------  68

Query  298  GGAGDRAEKKGLQF-------PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   EK  ++        P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  69   ---GKEMEKALMRLLGSSSAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  123



>ref|XP_008791106.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
 ref|XP_010929596.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=128

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideev--ekevie  314
            G  +P +  + +  ESAVV+F    CCM H V+RL + +GV+P V E+DE+   +     
Sbjct  18   GRMDPLERVERLAAESAVVIFSVSTCCMCHAVKRLFRGMGVSPTVYELDEDPRGKDMERA  77

Query  313  elesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
                +G AG          P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  78   LARLLGAAGGPP-----AVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  128



>ref|XP_010460644.1| PREDICTED: glutaredoxin-C9-like isoform X1 [Camelina sativa]
Length=176

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 73/112 (65%), Gaps = 3/112 (3%)
 Frame = -2

Query  526  MNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvse  347
            MN  G S        +E  +  + +V E+AV+V GRRGCCM  VV+RLL  LGVNP V E
Sbjct  39   MNTVGESLRPLTLKTQENGESVRTLVEENAVIVIGRRGCCMCLVVKRLLLGLGVNPTVLE  98

Query  346  ideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHIS  191
            IDEE E+EV+ ELE IG  G R   K    PAV++GGRLFGGLDR+MA  IS
Sbjct  99   IDEEREEEVLSELEKIGVHGGRETVK---LPAVYVGGRLFGGLDRVMATLIS  147



>gb|EYU31846.1| hypothetical protein MIMGU_mgv1a026975mg [Erythranthe guttata]
Length=140

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = -2

Query  481  KEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieeles  302
              P +  + M + +AVV+F    CCM H V+RL   +GV+P V EID++  ++   E   
Sbjct  33   DHPLERIQKMASANAVVIFSISTCCMCHAVKRLFSGMGVSPTVHEIDQDPTRQADLETAL  92

Query  301  IGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +   G  +       PAVFIGG+L G +D +MA+HISG L P+LKQAGALWL
Sbjct  93   LRLLGGGSSP----VPAVFIGGKLVGSMDSVMASHISGTLVPLLKQAGALWL  140



>ref|XP_003553278.1| PREDICTED: glutaredoxin-C3-like [Glycine max]
Length=132

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + + +ESAVV+F    CCM H ++RL   +GVNP               + +  
Sbjct  28   DPLERIERLASESAVVIFSVSTCCMCHAIKRLFCGMGVNP----------TVHELDEDPR  77

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA HI+G L P+LK+AGALWL
Sbjct  78   GKDLERALMRLLGTPSVVPVVFIGGKLVGTMDRVMACHINGTLVPLLKEAGALWL  132



>ref|XP_009113658.1| PREDICTED: glutaredoxin-C9-like isoform X1 [Brassica rapa]
Length=178

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            +  + +V E+A++V GRRGCCM HV++ LL  LGVNP V EID++ ++E +       G 
Sbjct  32   ENVRTLVEENALIVIGRRGCCMCHVIKSLLLGLGVNPAVLEIDDQEKEEEVMSELERIGV  91

Query  289  GDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGE-----LTPVLKQAGA  155
                E+  ++ PAV+IGGRLFGGLDR+MA HIS       + P+ ++ GA
Sbjct  92   EGGRER--VKLPAVYIGGRLFGGLDRVMATHISANSSLISIYPIKRKKGA  139



>emb|CAN67225.1| hypothetical protein VITISV_043905 [Vitis vinifera]
 emb|CBI38163.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +E+AVV+F    CCM H V+RL   +GVNP               + +  
Sbjct  3    DPLERVARLASENAVVIFSLSSCCMCHAVKRLFCGMGVNP----------TVYELDQDPR  52

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +D +MA+HI+G L P+LK+AGALWL
Sbjct  53   GKEIERALMRLLGNSPAVPVVFIGGKLVGSMDSVMASHINGTLVPLLKEAGALWL  107



>ref|XP_008365353.1| PREDICTED: glutaredoxin-C5-like [Malus domestica]
Length=126

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 14/118 (12%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G+++P +  + MV+E+AVV+   R CCM H ++RL   +GVNP V E+DE+ +       
Sbjct  19   GMEDPLEHIERMVSENAVVILSIRSCCMCHAIKRLFCGMGVNPTVCELDEDPK-------  71

Query  307  esIGGAGDRAEKKGLQ----FPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   +RA  + L      P VFI G+L   +DR+M +HI+G   P+L +AGALWL
Sbjct  72   ---GKDLERALMRRLTTSSTVPIVFISGKLVSAMDRVMVSHINGTFVPLLIEAGALWL  126



>ref|XP_002455626.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
 gb|EES00746.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
Length=103

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 64/112 (57%), Gaps = 14/112 (13%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGA  290
            D    + ++ AVV+F    CCM H V RL + LGVNP V E+D++            G  
Sbjct  2    DRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDQDPR----------GKE  51

Query  289  GDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             D+A  + L      PAVFIGGRL G  DR+M+ H+SG L P+L+ AGALW+
Sbjct  52   MDKALARLLGRNPAVPAVFIGGRLVGSTDRVMSLHLSGNLVPLLRNAGALWV  103



>ref|XP_009592444.1| PREDICTED: glutaredoxin-C5-like [Nicotiana tomentosiformis]
Length=132

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 20/132 (15%)
 Frame = -2

Query  529  LMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvs  350
            +  + GSSSS       +P +    + + SAVV+F    CCM H V+RL   +GV+P V 
Sbjct  17   IATRRGSSSS------SDPLERVVRLASGSAVVIFSVSTCCMCHAVKRLFCGMGVHPTVY  70

Query  349  eideevekevieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGEL  182
            E+D++ +          G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L
Sbjct  71   ELDQDPK----------GKEMERALSRLLGNAPAVPVVFIGGKLIGAMDRVMASHINGTL  120

Query  181  TPVLKQAGALWL  146
             P+LK+AGALWL
Sbjct  121  VPLLKEAGALWL  132



>ref|XP_011098924.1| PREDICTED: glutaredoxin-C1 [Sesamum indicum]
Length=129

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + M + SAVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  25   DPFERIERMASASAVVMFSMSTCCMCHALKRLFCGMGVNPTVYEVDEDPR----------  74

Query  298  GGAGDRAEKK----GLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA K+        P VFIGG+L G +D +MA+HISG L P+LK+AGALWL
Sbjct  75   GNELERALKRLSGGTSAVPLVFIGGKLVGAMDSVMASHISGTLVPLLKEAGALWL  129



>ref|XP_002264542.2| PREDICTED: glutaredoxin-C1-like [Vitis vinifera]
Length=131

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + +E+AVV+F    CCM H V+RL   +GVNP               + +  
Sbjct  27   DPLERVARLASENAVVIFSLSSCCMCHAVKRLFCGMGVNP----------TVYELDQDPR  76

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +D +MA+HI+G L P+LK+AGALWL
Sbjct  77   GKEIERALMRLLGNSPAVPVVFIGGKLVGSMDSVMASHINGTLVPLLKEAGALWL  131



>ref|XP_009613036.1| PREDICTED: glutaredoxin-C7-like [Nicotiana tomentosiformis]
Length=123

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 9/111 (8%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + M + +AVV+F    CCM H +++L   +GVNP V E+DE    E        
Sbjct  22   DPLEEIQRMASRNAVVIFSNNTCCMCHAIKKLFCGMGVNPTVYELDENPSWEQ-------  74

Query  298  GGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
              A           P VFIGG+L G +D +MAAHI+G L P+LK+AGALWL
Sbjct  75   --ALMSLLGSSSSLPVVFIGGKLVGAMDSVMAAHINGTLVPLLKEAGALWL  123



>ref|XP_008779419.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=126

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 70/119 (59%), Gaps = 15/119 (13%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G  +P +  + +  ESAVV+F    CCM H V+RL   +GV+P V E+DE+         
Sbjct  18   GRADPLERVERLAAESAVVIFSVSTCCMCHAVKRLFCGMGVSPTVYELDEDPR-------  70

Query  307  esIGGAGDRAEKKGL-----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   +RA  + L       P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  71   ---GKEMERALARLLGGGPPAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  126



>ref|XP_008775588.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
 ref|XP_010908168.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=126

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 70/119 (59%), Gaps = 15/119 (13%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieel  308
            G  +P +  + +  ESAVV+F    CCM H V+RL   +GV+P V E+DE+         
Sbjct  18   GRADPLERVERLAAESAVVIFSVSTCCMCHAVKRLFCGMGVSPTVYELDEDPR-------  70

Query  307  esIGGAGDRAEKKGL-----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               G   +RA  + L       P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  71   ---GKEMERALARLLGGGPPAVPVVFIGGKLVGAMDRVMASHINGTLVPLLKEAGALWL  126



>emb|CDP09532.1| unnamed protein product [Coffea canephora]
Length=133

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 78/146 (53%), Gaps = 24/146 (16%)
 Frame = -2

Query  556  VVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQ  377
            VV   SS P M+K G S S+ +  ++   +  + + + +AVV+F   GCCM HVV++LL 
Sbjct  3    VVKESSSIP-MDKPGESHSLGLR-MESIYEKVRLLASGNAVVIFTMSGCCMCHVVKQLLF  60

Query  376  VLGVNPvvseideevekevieelesIGGAGDRAEKKGLQF---------PAVFIGGRLFG  224
             LGV P + E+D                AG       LQ          PAVF+GG+  G
Sbjct  61   GLGVAPTIVELDH-------------DAAGREIHSLLLQLSGKTQQQPVPAVFVGGKFLG  107

Query  223  GLDRIMAAHISGELTPVLKQAGALWL  146
            G++ +MA HI+G L P+LK AGALWL
Sbjct  108  GIETVMACHINGSLVPLLKDAGALWL  133



>ref|XP_011096607.1| PREDICTED: glutaredoxin-C9-like [Sesamum indicum]
Length=146

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 68/110 (62%), Gaps = 5/110 (5%)
 Frame = -2

Query  469  DGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieele--sIG  296
            D    +V+ +AVVVF   GCCM HVV++LL  LGV P + E+D +     I  L     G
Sbjct  40   DKLTALVSNNAVVVFTITGCCMCHVVKQLLFGLGVGPTIVELDRDASGTDIHALLFRLSG  99

Query  295  GAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
             AG + +   L  PAVF+GG+  GG++ +MA HI+G L P+L+ AGALWL
Sbjct  100  AAGVQPQ---LVVPAVFVGGKFLGGIESVMACHINGTLVPLLRDAGALWL  146



>emb|CBI21909.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 13/85 (15%)
 Frame = -2

Query  613  MQEAIPYKTWLTMPRDCKPVVGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAV  434
            MQEA+PYKTWL +PR+ +    N  + PL N+      + + G         NMV+E+AV
Sbjct  1    MQEALPYKTWLPIPREPR---INTPTTPLHNQ------LLLPGTT----NITNMVSENAV  47

Query  433  VVFGRRGCCMVHVVRRLLQVLGVNP  359
            +VFGRRGCCM HVV+RLL  LGVNP
Sbjct  48   IVFGRRGCCMTHVVKRLLLGLGVNP  72



>ref|XP_008340253.1| PREDICTED: glutaredoxin-C1-like [Malus domestica]
Length=127

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + ++SAVV+F    CCM H V+RL   +GVN                + +  
Sbjct  23   DPLEXVARLASKSAVVIFSVSSCCMCHAVKRLFCGMGVN----------TTVYELDQDPR  72

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   GKEIERALMRLLGNSSAVPVVFIGGKLVGAMDRVMASHINGSLVPLLKEAGALWL  127



>ref|XP_009349478.1| PREDICTED: glutaredoxin-C1-like [Pyrus x bretschneideri]
Length=127

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +    + ++SAVV+F    CCM H V+RL   +GVN                + +  
Sbjct  23   DPLERVARLASKSAVVIFSVSSCCMCHAVKRLFCGMGVN----------TTVYELDQDPR  72

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA+HI+G L P+LK+AGALWL
Sbjct  73   GKEIERALMRLLGNSSAVPVVFIGGKLLGAMDRVMASHINGSLVPLLKEAGALWL  127



>ref|XP_009790572.1| PREDICTED: glutaredoxin-C9-like [Nicotiana sylvestris]
Length=130

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 8/136 (6%)
 Frame = -2

Query  553  VGNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQV  374
            V  +S++ +   AG S  M    ++   +  + +V+ +AVVVF   GCCM HVV++LL  
Sbjct  3    VVKESTSSMRIGAGESRRM----MESVYERVRFLVSGNAVVVFTMSGCCMCHVVKQLLFG  58

Query  373  LGVNPvvseideevekevieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHI  194
            LGV P + EID +   + I  L     AGD  ++     PAVF+GG+  GG++ +MA HI
Sbjct  59   LGVGPTIVEIDRDSAGKEIHALLFQL-AGDGQQQP---VPAVFVGGKFLGGIETVMACHI  114

Query  193  SGELTPVLKQAGALWL  146
            +G L P+LK+AGALWL
Sbjct  115  NGTLVPLLKEAGALWL  130



>ref|XP_010540592.1| PREDICTED: glutaredoxin-C9-like [Tarenaya hassleriana]
Length=136

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 66/118 (56%), Gaps = 9/118 (8%)
 Frame = -2

Query  487  GVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvsei----deevekev  320
            GV    +  + +  E+AVVVF   GCCM  VV+RLL  LGV P V E+          +V
Sbjct  24   GVPTAYEAVRRLAGENAVVVFSTSGCCMCTVVKRLLFGLGVGPTVVELDLLPSSSAASDV  83

Query  319  ieelesIGGAGDRAEKKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
               L  + G G  +       PA+F+GG+  GG+D +MA HI+G L P+LK AGALWL
Sbjct  84   HAVLFHLSGCGKMSP-----IPAIFVGGKFLGGIDTLMACHINGSLIPLLKDAGALWL  136



>ref|XP_006346834.1| PREDICTED: glutaredoxin-C9-like [Solanum tuberosum]
Length=117

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V+ +AVVVF   GCCM HVV++LL  LGV P + E+D +V  + I  L     AGD  +
Sbjct  19   LVSGNAVVVFTISGCCMCHVVKQLLFGLGVGPTIVELDRDVAGKEIHALLFQL-AGDGQQ  77

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +     PAVF+GG+  GG++ +MA HI+G L P+LKQAGALWL
Sbjct  78   QP---VPAVFVGGKFLGGIETVMACHINGTLVPLLKQAGALWL  117



>ref|XP_009362067.1| PREDICTED: glutaredoxin-C6 [Pyrus x bretschneideri]
Length=151

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 71/121 (59%), Gaps = 9/121 (7%)
 Frame = -2

Query  508  SSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideeve  329
            SS++ +D  +  +   + +++E  V++F R  CCM HV+++LL  LGV+P V E+D++  
Sbjct  37   SSTLSIDVAESAETRIRRLISEHPVIIFSRNSCCMCHVMKKLLATLGVHPTVIELDDDEI  96

Query  328  kevieelesIGGAGDRAEKKGLQF-PAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGAL  152
              +           D+ +++     PAVFIGG   GGL+ ++A H+SG L P L Q GAL
Sbjct  97   AALPH--------DDQEQQQACNTPPAVFIGGTCVGGLESLVALHLSGHLVPKLVQVGAL  148

Query  151  W  149
            W
Sbjct  149  W  149



>ref|XP_003622060.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES78278.1| glutaredoxin-C3-like protein [Medicago truncatula]
Length=301

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 68/115 (59%), Gaps = 14/115 (12%)
 Frame = -2

Query  478  EPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesI  299
            +P +  + + +E+AVV+F    CCM H ++RL   +GVNP V E+DE+            
Sbjct  20   DPLERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPAVHELDEDPR----------  69

Query  298  GGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            G   +RA  + L      P VFIGG+L G +DR+MA HI+G L P+LKQAGALW 
Sbjct  70   GKELERALMRLLGTSNVVPVVFIGGKLIGTMDRVMACHINGSLVPLLKQAGALWF  124



>ref|XP_004239526.1| PREDICTED: glutaredoxin-C1 [Solanum lycopersicum]
Length=131

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 73/139 (53%), Gaps = 23/139 (17%)
 Frame = -2

Query  550  GNQSSAPLMNKAGSSSSMYVDGVKEPKDGAKNMVTESAVVVFGRRGCCMVHVVRRLLQVL  371
            GN  S  +  +  SSSS       +P +    + + SAVV+F    CCM H V+RL   +
Sbjct  12   GNYHS--IETRCASSSS-------DPLERVIRLASGSAVVIFSMSTCCMCHAVKRLFCGM  62

Query  370  GVNPvvseideevekevieelesIGGAGDRAEKKGL----QFPAVFIGGRLFGGLDRIMA  203
            GV+P               + +  G   +RA  + L      P VFIGG+L G +DR+MA
Sbjct  63   GVHP----------TVYELDQDPKGKDMERALSRLLGNSPAVPVVFIGGKLIGAMDRVMA  112

Query  202  AHISGELTPVLKQAGALWL  146
            +HI+G L P+LK+AGALWL
Sbjct  113  SHINGTLVPLLKEAGALWL  131



>ref|XP_009609332.1| PREDICTED: glutaredoxin-C9-like [Nicotiana tomentosiformis]
Length=109

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = -2

Query  454  MVTESAVVVFGRRGCCMVHVVRRLLQVLGVNPvvseideevekevieelesIGGAGDRAE  275
            +V+ +AVVVF   GCCM HVV++LL  LGV P + E+D +   + I  L     AGD  +
Sbjct  11   LVSGNAVVVFTMSGCCMCHVVKQLLFGLGVGPTIVELDRDSAGKEIHALLFQL-AGDGQQ  69

Query  274  KKGLQFPAVFIGGRLFGGLDRIMAAHISGELTPVLKQAGALWL  146
            +     PAVF+GG+  GG++ +MA HI+G L P+LK+AGALWL
Sbjct  70   QP---VPAVFVGGKFLGGIETVMACHINGTLVPLLKEAGALWL  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1376900468608