BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20832_g1_i1 len=1679 path=[1:0-319 321:320-1507 1509:1508-1678]

Length=1679
                                                                      Score     E

emb|CDP09489.1|  unnamed protein product                                273   1e-82   
ref|XP_011090046.1|  PREDICTED: squamosa promoter-binding-like pr...    266   5e-80   
ref|XP_009607851.1|  PREDICTED: squamosa promoter-binding-like pr...    253   3e-75   
gb|EYU31932.1|  hypothetical protein MIMGU_mgv1a009702mg                253   8e-75   
ref|XP_009793968.1|  PREDICTED: squamosa promoter-binding-like pr...    247   4e-73   
ref|XP_006361510.1|  PREDICTED: squamosa promoter-binding-like pr...    246   9e-73   
gb|AEB71564.1|  squamosa promoter binding protein-like protein          245   1e-72   
ref|XP_004229775.1|  PREDICTED: squamosa promoter-binding-like pr...    244   4e-72   
ref|XP_006361511.1|  PREDICTED: squamosa promoter-binding-like pr...    243   8e-72   
ref|XP_003633906.1|  PREDICTED: squamosa promoter-binding-like pr...    242   3e-71   
ref|XP_004248549.1|  PREDICTED: squamosa promoter-binding-like pr...    240   1e-70   
ref|XP_007052207.1|  Squamosa promoter binding protein-like 8           240   4e-70   
ref|XP_002511636.1|  LIGULELESS1 protein, putative                      238   6e-70   Ricinus communis
emb|CBI16614.3|  unnamed protein product                                241   8e-70   
gb|EPS73836.1|  hypothetical protein M569_00920                         239   9e-70   
ref|XP_006348003.1|  PREDICTED: squamosa promoter-binding-like pr...    238   1e-69   
gb|AIE89801.1|  SQUAMOSA promoter binding protein-like 12               238   1e-69   
gb|KDP28816.1|  hypothetical protein JCGZ_14587                         235   2e-68   
gb|KHG07983.1|  Squamosa promoter-binding-like protein 8                234   5e-68   
ref|XP_009593420.1|  PREDICTED: squamosa promoter-binding-like pr...    229   4e-67   
ref|XP_010258891.1|  PREDICTED: squamosa promoter-binding-like pr...    229   2e-66   
gb|AFC17960.1|  squamosa promoter binding protein-like 8                229   4e-66   
emb|CAB56568.1|  squamosa promoter binding protein-homologue 3          228   6e-66   Antirrhinum majus [garden snapdragon]
ref|XP_006375255.1|  hypothetical protein POPTR_0014s05680g             226   5e-65   
ref|XP_007218335.1|  hypothetical protein PRUPE_ppa008560mg             225   2e-64   
ref|XP_010264333.1|  PREDICTED: squamosa promoter-binding-like pr...    224   3e-64   
ref|XP_011033165.1|  PREDICTED: squamosa promoter-binding-like pr...    224   4e-64   
ref|XP_002301256.2|  hypothetical protein POPTR_0002s14320g             221   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_011017436.1|  PREDICTED: squamosa promoter-binding-like pr...    220   1e-62   
ref|XP_004510110.1|  PREDICTED: squamosa promoter-binding-like pr...    218   3e-62   
ref|XP_004510109.1|  PREDICTED: squamosa promoter-binding-like pr...    217   2e-61   
ref|XP_003626693.1|  Squamosa promoter binding protein                  215   7e-61   
ref|XP_006445349.1|  hypothetical protein CICLE_v10021106mg             214   9e-61   
ref|XP_006445348.1|  hypothetical protein CICLE_v10021106mg             215   1e-60   
ref|XP_009782499.1|  PREDICTED: squamosa promoter-binding-like pr...    214   1e-60   
ref|XP_009782498.1|  PREDICTED: squamosa promoter-binding-like pr...    214   1e-60   
ref|XP_003521087.1|  PREDICTED: squamosa promoter-binding-like pr...    215   2e-60   
ref|XP_006445347.1|  hypothetical protein CICLE_v10021106mg             213   4e-60   
ref|XP_007134545.1|  hypothetical protein PHAVU_010G056000g             208   3e-58   
ref|XP_002892031.1|  hypothetical protein ARALYDRAFT_470069             205   4e-57   
ref|XP_004308485.1|  PREDICTED: squamosa promoter-binding-like pr...    202   3e-56   
ref|XP_010089258.1|  Squamosa promoter-binding-like protein 8           204   4e-56   
ref|XP_009373190.1|  PREDICTED: squamosa promoter-binding-like pr...    203   4e-56   
ref|XP_003530168.1|  PREDICTED: squamosa promoter-binding-like pr...    200   5e-55   
ref|XP_008375792.1|  PREDICTED: squamosa promoter-binding-like pr...    197   6e-54   
dbj|BAC42797.1|  putative squamosa promoter binding protein 8 SPL8      192   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AGP03031.1|  SQUAMOSA promoter binding protein-like protein 8        191   1e-51   
ref|XP_006305139.1|  hypothetical protein CARUB_v10009506mg             191   2e-51   
ref|XP_009119750.1|  PREDICTED: squamosa promoter-binding-like pr...    190   2e-51   
ref|XP_010480322.1|  PREDICTED: squamosa promoter-binding-like pr...    186   3e-51   
gb|KDO85638.1|  hypothetical protein CISIN_1g020302mg                   184   3e-50   
ref|XP_010496481.1|  PREDICTED: squamosa promoter-binding-like pr...    182   7e-50   
emb|CDY38043.1|  BnaCnng09040D                                          184   2e-49   
ref|XP_008458127.1|  PREDICTED: squamosa promoter-binding-like pr...    182   9e-49   
ref|XP_009118853.1|  PREDICTED: squamosa promoter-binding-like pr...    182   3e-48   
ref|XP_010056422.1|  PREDICTED: squamosa promoter-binding-like pr...    182   3e-48   
ref|XP_010692128.1|  PREDICTED: squamosa promoter-binding-like pr...    178   2e-47   
gb|KCW73147.1|  hypothetical protein EUGRSUZ_E01600                     177   8e-47   
ref|XP_010540239.1|  PREDICTED: squamosa promoter-binding-like pr...    175   2e-46   
emb|CDX90071.1|  BnaA10g00110D                                          174   9e-46   
ref|XP_004140489.1|  PREDICTED: squamosa promoter-binding-like pr...    171   8e-45   
ref|XP_010479450.1|  PREDICTED: squamosa promoter-binding-like pr...    171   2e-44   
ref|XP_004163755.1|  PREDICTED: squamosa promoter-binding-like pr...    169   4e-44   
ref|XP_007140981.1|  hypothetical protein PHAVU_008G157200g             162   2e-41   
ref|XP_008232622.1|  PREDICTED: squamosa promoter-binding-like pr...    160   3e-41   
ref|XP_010497828.1|  PREDICTED: squamosa promoter-binding-like pr...    150   9e-40   
gb|KHN18030.1|  Squamosa promoter-binding-like protein 8                145   3e-38   
gb|KCW73148.1|  hypothetical protein EUGRSUZ_E01600                     150   6e-38   
ref|XP_010913684.1|  PREDICTED: squamosa promoter-binding-like pr...    149   5e-37   
ref|XP_010913682.1|  PREDICTED: squamosa promoter-binding-like pr...    151   5e-37   
ref|XP_008781929.1|  PREDICTED: squamosa promoter-binding-like pr...    151   8e-37   
ref|XP_008775519.1|  PREDICTED: squamosa promoter-binding-like pr...    150   1e-36   
ref|XP_010928678.1|  PREDICTED: squamosa promoter-binding-like pr...    150   1e-36   
emb|CDY15132.1|  BnaC05g00110D                                          144   7e-36   
ref|XP_009408821.1|  PREDICTED: squamosa promoter-binding-like pr...    147   9e-36   
ref|XP_009408055.1|  PREDICTED: squamosa promoter-binding-like pr...    145   4e-35   
gb|AGI62063.1|  SQUAMOSA promoter-binding-like 15                       142   3e-34   
ref|XP_006845685.1|  hypothetical protein AMTR_s00019p00235390          139   4e-34   
gb|EMT31506.1|  Squamosa promoter-binding-like protein 5                140   3e-33   
gb|AHW57567.1|  squamosa promoter-binding-like protein 21               141   3e-33   
ref|XP_006418484.1|  hypothetical protein EUTSA_v10008083mg             134   5e-33   
gb|ABM67301.1|  SBP-domain protein 7                                    142   5e-33   Physcomitrella patens
emb|CAI91303.1|  squamosa promoter binding protein 1                    142   7e-33   Physcomitrella patens
ref|XP_004965676.1|  PREDICTED: squamosa promoter-binding-like pr...    139   1e-32   
gb|KHN34486.1|  Squamosa promoter-binding-like protein 8                134   1e-32   
ref|XP_001769751.1|  predicted protein                                  142   2e-32   
ref|XP_001779155.1|  predicted protein                                  142   3e-32   
ref|XP_006656320.1|  PREDICTED: squamosa promoter-binding-like pr...    138   3e-32   
ref|XP_001775629.1|  predicted protein                                  140   6e-32   
ref|XP_002437398.1|  hypothetical protein SORBIDRAFT_10g026200          137   7e-32   Sorghum bicolor [broomcorn]
ref|XP_009398934.1|  PREDICTED: squamosa promoter-binding-like pr...    134   1e-31   
ref|XP_009398983.1|  PREDICTED: squamosa promoter-binding-like pr...    135   1e-31   
ref|XP_003560391.1|  PREDICTED: squamosa promoter-binding-like pr...    135   2e-31   
ref|NP_001058261.1|  Os06g0659100                                       134   5e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AHW57571.1|  squamosa promoter-binding-like protein 22               134   5e-31   
gb|EEE66160.1|  hypothetical protein OsJ_22229                          134   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389111.1|  PREDICTED: squamosa promoter-binding-like pr...    130   2e-30   
ref|XP_009391170.1|  PREDICTED: squamosa promoter-binding-like pr...    130   2e-30   
ref|XP_002451645.1|  hypothetical protein SORBIDRAFT_04g005180          132   2e-30   Sorghum bicolor [broomcorn]
gb|ACF78942.1|  unknown                                                 132   4e-30   Zea mays [maize]
ref|NP_001105656.1|  SBP-domain protein4                                132   4e-30   Zea mays [maize]
gb|AFW76141.1|  squamosa promoter-binding protein-like (SBP domai...    132   5e-30   
gb|EMS47142.1|  Squamosa promoter-binding-like protein 10               131   5e-30   
emb|CAI91302.1|  squamosa promoter binding protein 4                    131   1e-29   Physcomitrella patens
gb|AHW57563.1|  squamosa promoter-binding-like protein 20               129   1e-29   
ref|XP_001761751.1|  predicted protein                                  132   2e-29   
ref|XP_010934135.1|  PREDICTED: squamosa promoter-binding-like pr...    127   7e-29   
dbj|BAK07638.1|  predicted protein                                      127   8e-29   
ref|XP_010919591.1|  PREDICTED: squamosa promoter-binding-like pr...    127   8e-29   
ref|XP_008802805.1|  PREDICTED: squamosa promoter-binding-like pr...    127   1e-28   
ref|NP_001105116.1|  SBP-domain protein3                                127   1e-28   Zea mays [maize]
ref|XP_006838199.1|  hypothetical protein AMTR_s00106p00144050          125   1e-28   
ref|XP_008796149.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-28   
ref|XP_001782674.1|  predicted protein                                  129   2e-28   
gb|ABM67304.1|  SBP-domain protein 12                                   126   4e-28   Physcomitrella patens
dbj|BAD38344.1|  putative SBP-domain protein                            125   8e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397654.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-27   
ref|NP_001106077.1|  SBP-domain protein1                                123   4e-27   Zea mays [maize]
gb|AFW70372.1|  squamosa promoter-binding protein-like (SBP domai...    123   4e-27   
gb|ACG39009.1|  SBP-domain protein 1                                    123   4e-27   Zea mays [maize]
gb|KHN01962.1|  Squamosa promoter-binding-like protein 8                119   5e-27   
ref|XP_008680933.1|  PREDICTED: SBP-domain protein1 isoform X2          123   7e-27   
ref|XP_003571005.1|  PREDICTED: squamosa promoter-binding-like pr...    121   8e-27   
ref|XP_004951719.1|  PREDICTED: squamosa promoter-binding-like pr...    121   2e-26   
ref|XP_004951720.1|  PREDICTED: squamosa promoter-binding-like pr...    121   2e-26   
ref|XP_002991886.1|  hypothetical protein SELMODRAFT_7674               113   2e-26   
ref|XP_002980130.1|  hypothetical protein SELMODRAFT_17777              113   3e-26   
gb|AFW66312.1|  squamosa promoter-binding protein-like (SBP domai...    120   4e-26   
gb|AFW66313.1|  squamosa promoter-binding protein-like (SBP domai...    119   5e-26   
ref|NP_001132280.1|  squamosa promoter-binding protein-like (SBP ...    119   5e-26   Zea mays [maize]
gb|ACG32386.1|  hypothetical protein                                    119   5e-26   Zea mays [maize]
ref|XP_010256977.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-25   
ref|XP_004960135.1|  PREDICTED: protein LIGULELESS 1-like               118   1e-25   
gb|EAY95872.1|  hypothetical protein OsI_17738                          117   1e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001105543.1|  protein LIGULELESS 1                               118   1e-25   Zea mays [maize]
tpg|DAA35605.1|  TPA: liguleless1                                       118   2e-25   
ref|XP_010549292.1|  PREDICTED: squamosa promoter-binding-like pr...    119   2e-25   
gb|EMS48286.1|  Squamosa promoter-binding-like protein 8                115   2e-25   
ref|XP_010240547.1|  PREDICTED: squamosa promoter-binding-like pr...    118   2e-25   
emb|CAJ41454.1|  liguleless-like protein                                116   2e-25   Hordeum vulgare [barley]
ref|XP_001756639.1|  predicted protein                                  121   2e-25   
gb|EAZ32258.1|  hypothetical protein OsJ_16462                          117   2e-25   Oryza sativa Japonica Group [Japonica rice]
sp|Q01KM7.1|SPL8_ORYSI  RecName: Full=Squamosa promoter-binding-l...    117   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_008680934.1|  PREDICTED: SBP-domain protein1 isoform X3          119   3e-25   
ref|XP_008680932.1|  PREDICTED: SBP-domain protein1 isoform X1          119   3e-25   
ref|XP_006652941.1|  PREDICTED: squamosa promoter-binding-like pr...    117   3e-25   
ref|XP_010252163.1|  PREDICTED: squamosa promoter-binding-like pr...    118   3e-25   
dbj|BAM78642.1|  squamosa promoter-binding-like protein 8               117   3e-25   
ref|NP_001054119.1|  Os04g0656500                                       117   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009402494.1|  PREDICTED: squamosa promoter-binding-like pr...    120   5e-25   
gb|AHW57568.1|  squamosa promoter-binding-like protein 8                117   5e-25   
ref|XP_004981153.1|  PREDICTED: squamosa promoter-binding-like pr...    119   7e-25   
ref|XP_004134953.1|  PREDICTED: squamosa promoter-binding protein...    110   7e-25   
ref|XP_008439842.1|  PREDICTED: squamosa promoter-binding protein 1     110   1e-24   
ref|XP_007018638.1|  Squamosa promoter binding protein-like 14          119   1e-24   
ref|XP_003551421.1|  PREDICTED: squamosa promoter-binding-like pr...    115   1e-24   
ref|XP_010941481.1|  PREDICTED: squamosa promoter-binding-like pr...    118   1e-24   
dbj|BAK01070.1|  predicted protein                                      118   1e-24   
gb|KHN31114.1|  Squamosa promoter-binding-like protein 9                115   1e-24   
ref|XP_008663682.1|  PREDICTED: protein LIGULELESS 1-like               115   1e-24   
ref|XP_002466159.1|  hypothetical protein SORBIDRAFT_01g002530          118   2e-24   Sorghum bicolor [broomcorn]
ref|XP_009401512.1|  PREDICTED: squamosa promoter-binding-like pr...    118   2e-24   
ref|XP_002447251.1|  hypothetical protein SORBIDRAFT_06g031290          115   2e-24   Sorghum bicolor [broomcorn]
gb|AFW76142.1|  squamosa promoter-binding protein-like (SBP domai...    115   2e-24   
gb|ABO80946.1|  SBP                                                     112   2e-24   Medicago truncatula
ref|XP_010278483.1|  PREDICTED: squamosa promoter-binding-like pr...    115   3e-24   
ref|XP_009420463.1|  PREDICTED: squamosa promoter-binding-like pr...    110   3e-24   
gb|EMT28202.1|  Squamosa promoter-binding-like protein 6                117   3e-24   
gb|ABM67302.1|  SBP-domain protein 9                                    116   5e-24   Physcomitrella patens
ref|XP_010252166.1|  PREDICTED: squamosa promoter-binding-like pr...    114   5e-24   
ref|XP_003541730.1|  PREDICTED: squamosa promoter-binding protein...    108   6e-24   
gb|EMS54388.1|  Squamosa promoter-binding-like protein 6                116   7e-24   
ref|XP_006390174.1|  hypothetical protein EUTSA_v10018054mg             116   8e-24   
ref|XP_008463797.1|  PREDICTED: squamosa promoter-binding protein...    108   8e-24   
ref|XP_010539753.1|  PREDICTED: squamosa promoter-binding-like pr...    116   8e-24   
ref|XP_002972440.1|  hypothetical protein SELMODRAFT_59543              105   8e-24   
gb|ABM67300.1|  SBP-domain protein 6                                    115   9e-24   Physcomitrella patens
ref|XP_001761750.1|  predicted protein                                  115   9e-24   
ref|XP_003563064.1|  PREDICTED: squamosa promoter-binding-like pr...    116   1e-23   
ref|XP_004293885.1|  PREDICTED: squamosa promoter-binding protein...    108   1e-23   
ref|XP_010537252.1|  PREDICTED: squamosa promoter-binding-like pr...    115   1e-23   
gb|EPS60112.1|  hypothetical protein M569_14693                         107   1e-23   
gb|ACF87887.1|  unknown                                                 111   1e-23   Zea mays [maize]
ref|NP_001105115.1|  SBP-domain protein2                                113   1e-23   Zea mays [maize]
gb|AFK42236.1|  unknown                                                 107   1e-23   
ref|XP_010270607.1|  PREDICTED: squamosa promoter-binding-like pr...    115   1e-23   
ref|XP_001775628.1|  predicted protein                                  115   1e-23   
gb|ABM67305.1|  SBP-domain protein 13                                   115   1e-23   Physcomitrella patens
ref|NP_001236309.1|  uncharacterized protein LOC100527199               107   1e-23   
ref|XP_006648367.1|  PREDICTED: squamosa promoter-binding-like pr...    112   2e-23   
ref|XP_008437792.1|  PREDICTED: squamosa promoter-binding-like pr...    111   2e-23   
gb|KHN09987.1|  Squamosa promoter-binding protein 1                     106   2e-23   
ref|XP_008437791.1|  PREDICTED: squamosa promoter-binding-like pr...    111   2e-23   
emb|CDP20025.1|  unnamed protein product                                111   2e-23   
gb|AGI62049.1|  SQUAMOSA promoter-binding-like 1                        107   2e-23   
ref|XP_004133774.1|  PREDICTED: squamosa promoter-binding-like pr...    111   2e-23   
ref|XP_008810376.1|  PREDICTED: squamosa promoter-binding protein...    107   3e-23   
ref|XP_008799143.1|  PREDICTED: squamosa promoter-binding-like pr...    114   3e-23   
ref|XP_008796104.1|  PREDICTED: squamosa promoter-binding-like pr...    111   3e-23   
dbj|BAM15480.1|  SBP-box protein                                        111   4e-23   
gb|AIE89804.1|  SQUAMOSA promoter binding protein-like 15               105   4e-23   
ref|XP_009593604.1|  PREDICTED: squamosa promoter-binding-like pr...    106   4e-23   
ref|XP_004146058.1|  PREDICTED: squamosa promoter-binding-like pr...    107   4e-23   
ref|XP_008810336.1|  PREDICTED: squamosa promoter-binding-like pr...    114   4e-23   
ref|XP_009393147.1|  PREDICTED: squamosa promoter-binding-like pr...    114   5e-23   
ref|XP_002961226.1|  hypothetical protein SELMODRAFT_28630              103   5e-23   
emb|CAI91301.1|  squamosa promoter binding protein 3                    113   6e-23   Physcomitrella patens
ref|XP_002282598.1|  PREDICTED: squamosa promoter-binding-like pr...    107   6e-23   Vitis vinifera
ref|XP_010278485.1|  PREDICTED: squamosa promoter-binding-like pr...    111   6e-23   
emb|CAB56569.1|  squamosa promoter binding protein-homologue 4          108   6e-23   Antirrhinum majus [garden snapdragon]
ref|XP_004488737.1|  PREDICTED: squamosa promoter-binding-like pr...    106   7e-23   
ref|XP_009760116.1|  PREDICTED: squamosa promoter-binding protein 1     105   7e-23   
ref|XP_001775627.1|  predicted protein                                  113   7e-23   
ref|XP_010538149.1|  PREDICTED: squamosa promoter-binding-like pr...    111   7e-23   
emb|CBI24049.3|  unnamed protein product                                109   7e-23   
ref|XP_010534410.1|  PREDICTED: squamosa promoter-binding-like pr...    113   7e-23   
ref|XP_010534402.1|  PREDICTED: squamosa promoter-binding-like pr...    113   8e-23   
ref|XP_011042488.1|  PREDICTED: squamosa promoter-binding-like pr...    110   8e-23   
emb|CDP07242.1|  unnamed protein product                                113   8e-23   
gb|KEH24442.1|  squamosa promoter-binding-like protein                  113   8e-23   
ref|XP_007043985.1|  Squamosa promoter binding protein-like 2, pu...    111   8e-23   
ref|XP_004488736.1|  PREDICTED: squamosa promoter-binding-like pr...    106   8e-23   
gb|KDP20990.1|  hypothetical protein JCGZ_21461                         105   9e-23   
ref|XP_002280160.1|  PREDICTED: squamosa promoter-binding-like pr...    110   9e-23   Vitis vinifera
ref|XP_002514905.1|  LIGULELESS1 protein, putative                      111   9e-23   Ricinus communis
ref|XP_004155257.1|  PREDICTED: protein AATF-like                       112   1e-22   
gb|EEC72603.1|  hypothetical protein OsI_06074                          109   1e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_004297083.1|  PREDICTED: squamosa promoter-binding-like pr...    112   1e-22   
ref|XP_002302512.1|  hypothetical protein POPTR_0002s14330g             109   1e-22   Populus trichocarpa [western balsam poplar]
gb|EMT11741.1|  Squamosa promoter-binding-like protein 10               107   1e-22   
gb|EEE56429.1|  hypothetical protein OsJ_05597                          109   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943949.1|  PREDICTED: squamosa promoter-binding protein...    105   1e-22   
ref|XP_010943552.1|  PREDICTED: squamosa promoter-binding-like pr...    110   1e-22   
gb|ADY75712.1|  SPL3-like protein                                       104   1e-22   
ref|XP_010943550.1|  PREDICTED: squamosa promoter-binding-like pr...    110   1e-22   
gb|AES82254.2|  squamosa promoter-binding-like protein                  112   1e-22   
ref|XP_010943549.1|  PREDICTED: squamosa promoter-binding-like pr...    110   1e-22   
ref|XP_010943551.1|  PREDICTED: squamosa promoter-binding-like pr...    110   1e-22   
gb|KEH38697.1|  squamosa promoter-binding-like protein                  105   1e-22   
gb|AGI62059.1|  SQUAMOSA promoter-binding-like 11                       112   1e-22   
ref|XP_002510746.1|  Squamosa promoter-binding protein, putative        112   1e-22   Ricinus communis
ref|XP_003626036.1|  SQUAMOSA promoter binding protein                  112   1e-22   
gb|AGI62051.1|  SQUAMOSA promoter-binding-like 3                        110   1e-22   
ref|XP_003547153.1|  PREDICTED: squamosa promoter-binding protein...    104   2e-22   
ref|NP_001046066.2|  Os02g0177300                                       110   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002275728.1|  PREDICTED: squamosa promoter-binding protein...    105   2e-22   Vitis vinifera
gb|EYU33445.1|  hypothetical protein MIMGU_mgv1a005903mg                110   2e-22   
ref|XP_011017438.1|  PREDICTED: squamosa promoter-binding-like pr...    109   2e-22   
ref|XP_010932155.1|  PREDICTED: squamosa promoter-binding-like pr...    112   2e-22   
ref|XP_006375256.1|  hypothetical protein POPTR_0014s05690g             109   2e-22   
sp|Q0E3F8.1|SPL5_ORYSJ  RecName: Full=Squamosa promoter-binding-l...    110   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABL89185.1|  squamosa promoter binding protein-like protein          103   2e-22   Capsicum annuum
ref|XP_011027797.1|  PREDICTED: squamosa promoter-binding-like pr...    104   2e-22   
ref|XP_008813721.1|  PREDICTED: squamosa promoter-binding-like pr...    112   2e-22   
ref|XP_011017583.1|  PREDICTED: squamosa promoter-binding-like pr...    109   2e-22   
ref|XP_010057392.1|  PREDICTED: squamosa promoter-binding-like pr...    103   2e-22   
ref|XP_008666603.1|  PREDICTED: uncharacterized protein LOC100272...    112   2e-22   
ref|XP_011017579.1|  PREDICTED: squamosa promoter-binding-like pr...    110   2e-22   
ref|XP_002304686.2|  hypothetical protein POPTR_0003s17120g             110   2e-22   Populus trichocarpa [western balsam poplar]
emb|CDP14246.1|  unnamed protein product                                108   2e-22   
ref|XP_011020736.1|  PREDICTED: squamosa promoter-binding-like pr...    110   2e-22   
gb|KDP26813.1|  hypothetical protein JCGZ_17971                         109   3e-22   
ref|XP_006367482.1|  PREDICTED: squamosa promoter-binding protein...    104   3e-22   
ref|XP_009392758.1|  PREDICTED: squamosa promoter-binding-like pr...    109   3e-22   
emb|CDX88299.1|  BnaC06g37430D                                          111   3e-22   
ref|XP_011020735.1|  PREDICTED: squamosa promoter-binding-like pr...    110   3e-22   
ref|XP_006403270.1|  hypothetical protein EUTSA_v10003215mg             108   3e-22   
ref|XP_010682751.1|  PREDICTED: squamosa promoter-binding-like pr...    109   3e-22   
ref|XP_010260271.1|  PREDICTED: squamosa promoter-binding protein 1     104   3e-22   
ref|NP_001051808.1|  Os03g0833300                                       111   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017580.1|  PREDICTED: squamosa promoter-binding-like pr...    109   3e-22   
ref|XP_007148144.1|  hypothetical protein PHAVU_006G183900g             103   3e-22   
ref|XP_010102696.1|  Squamosa promoter-binding-like protein 12          109   3e-22   
ref|XP_006306653.1|  hypothetical protein CARUB_v10008169mg             111   3e-22   
ref|XP_010919590.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-22   
ref|XP_010694791.1|  PREDICTED: squamosa promoter-binding-like pr...    111   4e-22   
ref|XP_006856376.1|  hypothetical protein AMTR_s00047p00197010          108   4e-22   
ref|XP_011017576.1|  PREDICTED: squamosa promoter-binding-like pr...    109   4e-22   
ref|XP_010556133.1|  PREDICTED: squamosa promoter-binding-like pr...    108   4e-22   
ref|XP_010556129.1|  PREDICTED: squamosa promoter-binding-like pr...    108   4e-22   
ref|XP_009622640.1|  PREDICTED: squamosa promoter-binding protein 1     103   4e-22   
emb|CDY32959.1|  BnaA09g16340D                                          108   4e-22   
gb|KHN29773.1|  Squamosa promoter-binding-like protein 1                111   4e-22   
ref|XP_010672614.1|  PREDICTED: squamosa promoter-binding-like pr...    111   4e-22   
ref|XP_003534999.1|  PREDICTED: squamosa promoter-binding-like pr...    110   4e-22   
ref|XP_010927295.1|  PREDICTED: squamosa promoter-binding-like pr...    110   4e-22   
ref|XP_010927297.1|  PREDICTED: squamosa promoter-binding-like pr...    110   4e-22   
gb|AGP03034.1|  SQUAMOSA promoter binding protein-like protein 11       107   4e-22   
dbj|BAJ34640.1|  unnamed protein product                                110   5e-22   
ref|XP_006416342.1|  hypothetical protein EUTSA_v10006656mg             110   5e-22   
ref|XP_009626190.1|  PREDICTED: squamosa promoter-binding-like pr...    103   5e-22   
ref|XP_006372253.1|  hypothetical protein POPTR_0018s14680g             108   5e-22   
ref|XP_009620617.1|  PREDICTED: squamosa promoter-binding-like pr...    108   5e-22   
gb|KDO85287.1|  hypothetical protein CISIN_1g001317mg                   110   5e-22   
ref|XP_009114006.1|  PREDICTED: squamosa promoter-binding-like pr...    107   5e-22   
ref|XP_009386067.1|  PREDICTED: squamosa promoter-binding-like pr...    107   5e-22   
ref|XP_009356783.1|  PREDICTED: squamosa promoter-binding protein...    104   5e-22   
ref|XP_004510032.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-22   
emb|CDY43604.1|  BnaC09g17430D                                          107   5e-22   
ref|XP_006605456.1|  PREDICTED: squamosa promoter-binding-like pr...    110   5e-22   
ref|XP_010929104.1|  PREDICTED: squamosa promoter-binding protein...    103   5e-22   
gb|ADL36826.1|  SPL domain class transcription factor                   104   5e-22   
ref|XP_003555217.1|  PREDICTED: squamosa promoter-binding-like pr...    110   5e-22   
ref|XP_009397190.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    103   5e-22   
ref|XP_007212177.1|  hypothetical protein PRUPE_ppa012607mg             103   5e-22   
ref|XP_009381227.1|  PREDICTED: squamosa promoter-binding-like pr...    110   5e-22   
ref|XP_009381220.1|  PREDICTED: squamosa promoter-binding-like pr...    110   5e-22   
gb|KEH37736.1|  squamosa promoter-binding-like protein                  110   5e-22   
ref|XP_006838197.1|  hypothetical protein AMTR_s00106p00142470          106   5e-22   
gb|KDO85286.1|  hypothetical protein CISIN_1g001317mg                   110   6e-22   
ref|XP_008386198.1|  PREDICTED: squamosa promoter-binding protein 1     103   6e-22   
ref|XP_010675500.1|  PREDICTED: squamosa promoter-binding-like pr...    105   6e-22   
ref|XP_006303847.1|  hypothetical protein CARUB_v10012577mg             110   6e-22   
emb|CBI30036.3|  unnamed protein product                                107   6e-22   
ref|XP_009781601.1|  PREDICTED: squamosa promoter-binding-like pr...    103   6e-22   
gb|KDO85285.1|  hypothetical protein CISIN_1g001317mg                   110   6e-22   
ref|XP_009340759.1|  PREDICTED: squamosa promoter-binding protein...    103   6e-22   
ref|XP_004145609.1|  PREDICTED: squamosa promoter-binding-like pr...    110   6e-22   
ref|XP_006650854.1|  PREDICTED: squamosa promoter-binding-like pr...    110   6e-22   
dbj|BAM15475.1|  SBP-box protein                                        102   7e-22   
ref|XP_002519316.1|  Squamosa promoter-binding protein, putative        110   7e-22   
gb|KDP28324.1|  hypothetical protein JCGZ_14095                         110   7e-22   
ref|XP_004172805.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    110   7e-22   
ref|XP_002890420.1|  hypothetical protein ARALYDRAFT_472338             110   7e-22   
ref|XP_009793310.1|  PREDICTED: squamosa promoter-binding-like pr...    110   7e-22   
gb|KDP45880.1|  hypothetical protein JCGZ_15324                         104   7e-22   
ref|XP_007138555.1|  hypothetical protein PHAVU_009G219200g             110   7e-22   
ref|XP_009620616.1|  PREDICTED: squamosa promoter-binding-like pr...    108   7e-22   
gb|KDP22599.1|  hypothetical protein JCGZ_26430                         106   7e-22   
ref|XP_004243367.2|  PREDICTED: squamosa promoter-binding-like pr...    102   7e-22   
gb|KHG19114.1|  Squamosa promoter-binding-like protein 14               110   8e-22   
ref|XP_006653653.1|  PREDICTED: squamosa promoter-binding-like pr...    105   8e-22   
ref|XP_004308484.1|  PREDICTED: squamosa promoter-binding-like pr...    107   8e-22   
ref|XP_010091413.1|  Squamosa promoter-binding-like protein 1           110   8e-22   
sp|Q38741.1|SBP1_ANTMA  RecName: Full=Squamosa promoter-binding p...    102   8e-22   
ref|XP_007159345.1|  hypothetical protein PHAVU_002G230300g             103   8e-22   
ref|XP_011070914.1|  PREDICTED: squamosa promoter-binding-like pr...    106   8e-22   
ref|XP_011083361.1|  PREDICTED: squamosa promoter-binding-like pr...    110   9e-22   
gb|KDO85283.1|  hypothetical protein CISIN_1g001317mg                   109   1e-21   
emb|CDP13348.1|  unnamed protein product                                107   1e-21   
ref|XP_011043824.1|  PREDICTED: squamosa promoter-binding protein...    103   1e-21   
ref|XP_010108163.1|  Squamosa promoter-binding protein 1                102   1e-21   
gb|AES97184.2|  squamosa promoter-binding-like protein                  108   1e-21   
ref|XP_011011624.1|  PREDICTED: squamosa promoter-binding-like pr...    109   1e-21   
ref|XP_003614226.1|  Squamosa promoter binding protein                  108   1e-21   
ref|XP_009353416.1|  PREDICTED: squamosa promoter-binding-like pr...    109   1e-21   
gb|KEH19523.1|  squamosa promoter-binding-like protein                  103   1e-21   
gb|AIL95846.1|  SQUAMOSA promoter binding-like transcription factor     109   1e-21   
ref|XP_008390494.1|  PREDICTED: squamosa promoter-binding-like pr...    109   1e-21   
gb|KDO85284.1|  hypothetical protein CISIN_1g001317mg                   109   1e-21   
ref|XP_011086813.1|  PREDICTED: squamosa promoter-binding-like pr...    107   1e-21   
gb|KDO81890.1|  hypothetical protein CISIN_1g011640mg                   106   1e-21   
gb|KHN04162.1|  Squamosa promoter-binding-like protein 17               106   1e-21   
ref|XP_009396218.1|  PREDICTED: squamosa promoter-binding-like pr...    107   1e-21   
ref|XP_006438016.1|  hypothetical protein CICLE_v10031391mg             106   1e-21   
gb|KHG30434.1|  Squamosa promoter-binding-like protein 12               108   1e-21   
ref|XP_003540122.1|  PREDICTED: squamosa promoter-binding protein...    103   1e-21   
ref|XP_009396217.1|  PREDICTED: squamosa promoter-binding-like pr...    107   1e-21   
gb|KDP36723.1|  hypothetical protein JCGZ_08014                         109   1e-21   
ref|XP_008453037.1|  PREDICTED: squamosa promoter-binding-like pr...    109   1e-21   
gb|KDO81885.1|  hypothetical protein CISIN_1g011640mg                   106   1e-21   
gb|KHN15472.1|  Squamosa promoter-binding protein 1                     102   1e-21   
ref|XP_003526029.1|  PREDICTED: squamosa promoter-binding protein...    102   1e-21   
gb|AIE89794.1|  SQUAMOSA promoter binding protein-like 5                107   1e-21   
gb|KHN18285.1|  Squamosa promoter-binding protein 1                     102   1e-21   
gb|KDO81888.1|  hypothetical protein CISIN_1g011640mg                   106   1e-21   
ref|XP_009398957.1|  PREDICTED: squamosa promoter-binding protein...    102   1e-21   
ref|XP_011016273.1|  PREDICTED: squamosa promoter-binding-like pr...    107   1e-21   
ref|XP_010459792.1|  PREDICTED: squamosa promoter-binding-like pr...    109   1e-21   
emb|CDP14818.1|  unnamed protein product                                103   1e-21   
gb|KHN09887.1|  Squamosa promoter-binding-like protein 12               109   1e-21   
ref|XP_007052205.1|  Squamosa promoter-binding-like protein 10, p...    107   1e-21   
gb|KHG05980.1|  Squamosa promoter-binding-like protein 1                109   1e-21   
ref|XP_008787304.1|  PREDICTED: squamosa promoter-binding-like pr...    105   1e-21   
ref|XP_009359778.1|  PREDICTED: squamosa promoter-binding-like pr...    109   1e-21   
ref|XP_006582910.1|  PREDICTED: uncharacterized protein LOC100789...    101   1e-21   
gb|AIE89798.1|  SQUAMOSA promoter binding protein-like 9                109   2e-21   
gb|EYU46873.1|  hypothetical protein MIMGU_mgv1a000744mg                109   2e-21   
ref|XP_008223487.1|  PREDICTED: squamosa promoter-binding-like pr...    109   2e-21   
ref|XP_007037628.1|  LIGULELESS1 protein, putative                      108   2e-21   
ref|XP_009392815.1|  PREDICTED: squamosa promoter-binding-like pr...    102   2e-21   
ref|XP_010928443.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    106   2e-21   
gb|AGP03037.1|  SQUAMOSA promoter binding protein-like protein 14       109   2e-21   
gb|AGP03039.1|  SQUAMOSA promoter binding protein-like protein 16       109   2e-21   
ref|XP_002974817.1|  hypothetical protein SELMODRAFT_59884            99.4    2e-21   
gb|AIL95869.1|  SQUAMOSA promoter binding-like transcription factor     106   2e-21   
ref|XP_006378563.1|  hypothetical protein POPTR_0010s16370g             109   2e-21   
gb|AIL95862.1|  SQUAMOSA promoter binding-like transcription factor     108   2e-21   
ref|XP_010655960.1|  PREDICTED: squamosa promoter-binding-like pr...    107   2e-21   
ref|XP_007225380.1|  hypothetical protein PRUPE_ppa000792mg             108   2e-21   
ref|XP_011071328.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    108   2e-21   
gb|AIE89790.1|  SQUAMOSA promoter binding protein-like 1                108   2e-21   
emb|CDX95958.1|  BnaA07g27730D                                          105   2e-21   
ref|XP_002963733.1|  hypothetical protein SELMODRAFT_28629            99.4    2e-21   
ref|XP_007035970.1|  Squamosa promoter-binding protein, putative ...    108   2e-21   
gb|KDO81879.1|  hypothetical protein CISIN_1g011640mg                   107   2e-21   
ref|XP_002887647.1|  hypothetical protein ARALYDRAFT_895541             108   2e-21   
ref|XP_011099860.1|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
gb|KDO85282.1|  hypothetical protein CISIN_1g001317mg                   108   2e-21   
gb|KHN29960.1|  Squamosa promoter-binding-like protein 6                105   2e-21   
ref|XP_006438013.1|  hypothetical protein CICLE_v10031391mg             107   2e-21   
ref|XP_003520534.1|  PREDICTED: squamosa promoter-binding-like pr...    105   2e-21   
ref|XP_010477356.1|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
ref|XP_010477355.1|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
ref|XP_004248108.1|  PREDICTED: squamosa promoter-binding protein...    100   2e-21   
ref|XP_011033246.1|  PREDICTED: squamosa promoter-binding-like pr...    105   2e-21   
emb|CDY47812.1|  BnaC07g17030D                                          107   2e-21   
ref|XP_002887224.1|  hypothetical protein ARALYDRAFT_339154             106   2e-21   
ref|XP_003547557.2|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
gb|KHN47586.1|  Squamosa promoter-binding-like protein 7                103   2e-21   
ref|XP_006370233.1|  hypothetical protein POPTR_0001s40870g             102   2e-21   
emb|CDY50300.1|  BnaA02g14580D                                          105   2e-21   
ref|XP_011002133.1|  PREDICTED: squamosa promoter-binding-like pr...    106   2e-21   
gb|AGP03026.1|  SQUAMOSA promoter binding protein-like protein 2        106   2e-21   
ref|XP_006494445.1|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
ref|XP_006494443.1|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
ref|XP_006435483.1|  hypothetical protein CICLE_v10000100mg             108   2e-21   
gb|KDO85288.1|  hypothetical protein CISIN_1g001317mg                   108   2e-21   
ref|XP_002271312.2|  PREDICTED: squamosa promoter-binding-like pr...    107   2e-21   
ref|XP_006300490.1|  hypothetical protein CARUB_v10020369mg             106   2e-21   
ref|XP_009127706.1|  PREDICTED: squamosa promoter-binding-like pr...    105   2e-21   
ref|XP_004300082.1|  PREDICTED: squamosa promoter-binding-like pr...    108   2e-21   
ref|XP_008225122.1|  PREDICTED: squamosa promoter-binding-like pr...    101   3e-21   
ref|XP_002273784.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
ref|XP_010664039.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
gb|AGP03029.1|  SQUAMOSA promoter binding protein-like protein 6        105   3e-21   
gb|ACG60678.1|  unknown protein                                         104   3e-21   
ref|XP_008390370.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
ref|XP_010061247.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
ref|XP_006850048.1|  hypothetical protein AMTR_s00022p00198330          105   3e-21   
ref|XP_003518080.1|  PREDICTED: squamosa promoter-binding-like pr...    105   3e-21   
ref|XP_008795751.1|  PREDICTED: squamosa promoter-binding-like pr...    105   3e-21   
ref|XP_009105462.1|  PREDICTED: squamosa promoter-binding-like pr...    104   3e-21   
ref|XP_008795752.1|  PREDICTED: squamosa promoter-binding-like pr...    105   3e-21   
ref|XP_008367070.1|  PREDICTED: squamosa promoter-binding protein...    102   3e-21   
ref|XP_009410346.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
ref|XP_006573218.1|  PREDICTED: squamosa promoter-binding-like pr...    104   3e-21   
ref|XP_007133260.1|  hypothetical protein PHAVU_011G164800g             102   3e-21   
ref|XP_003528599.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
ref|XP_007025578.1|  Squamosa promoter binding protein-like 3           100   3e-21   
ref|XP_010471812.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
ref|XP_010471811.1|  PREDICTED: squamosa promoter-binding-like pr...    108   3e-21   
emb|CDX87584.1|  BnaA07g32890D                                          108   3e-21   
ref|XP_002451519.1|  hypothetical protein SORBIDRAFT_04g003175          106   3e-21   
emb|CAN77427.1|  hypothetical protein VITISV_001736                     106   3e-21   
ref|XP_004505078.1|  PREDICTED: squamosa promoter-binding protein...    100   3e-21   
ref|XP_009106325.1|  PREDICTED: squamosa promoter-binding-like pr...    108   4e-21   
ref|XP_002532343.1|  LIGULELESS1 protein, putative                      104   4e-21   
ref|XP_009400684.1|  PREDICTED: squamosa promoter-binding-like pr...    105   4e-21   
ref|XP_003560169.2|  PREDICTED: squamosa promoter-binding-like pr...    101   4e-21   
ref|XP_006280495.1|  hypothetical protein CARUB_v10026434mg             104   4e-21   
ref|XP_006397898.1|  hypothetical protein EUTSA_v10001295mg             108   4e-21   
ref|XP_003517942.1|  PREDICTED: squamosa promoter-binding-like pr...    104   4e-21   
ref|XP_009415426.1|  PREDICTED: squamosa promoter-binding-like pr...    105   4e-21   
ref|NP_173522.1|  squamosa promoter binding-like protein 14             108   4e-21   
gb|AIL95848.1|  SQUAMOSA promoter binding-like transcription factor     100   4e-21   
emb|CDY57212.1|  BnaC04g44230D                                          100   4e-21   
ref|XP_009415427.1|  PREDICTED: squamosa promoter-binding-like pr...    105   4e-21   
ref|XP_004297084.1|  PREDICTED: squamosa promoter-binding-like pr...    108   4e-21   
ref|XP_006646870.1|  PREDICTED: squamosa promoter-binding-like pr...    106   4e-21   
ref|XP_007153485.1|  hypothetical protein PHAVU_003G039600g             106   4e-21   
ref|XP_010044819.1|  PREDICTED: squamosa promoter-binding-like pr...    106   4e-21   
ref|XP_006591581.1|  PREDICTED: squamosa promoter-binding-like pr...    102   4e-21   
dbj|BAH80551.1|  transcription factor squamosa promoter binding p...    106   4e-21   
ref|XP_006397897.1|  hypothetical protein EUTSA_v10001295mg             107   4e-21   
ref|XP_007021544.1|  Squamosa promoter binding protein-like 3 iso...    103   4e-21   
ref|XP_004488200.1|  PREDICTED: squamosa promoter-binding-like pr...    108   4e-21   
gb|AGE09564.1|  SPL2-like protein                                       106   4e-21   
ref|XP_009101793.1|  PREDICTED: squamosa promoter-binding-like pr...    105   4e-21   
ref|XP_003543233.1|  PREDICTED: squamosa promoter-binding protein...    101   4e-21   
ref|XP_009353414.1|  PREDICTED: squamosa promoter-binding-like pr...    107   4e-21   
ref|XP_008790476.1|  PREDICTED: squamosa promoter-binding-like pr...    107   4e-21   
ref|XP_006467766.1|  PREDICTED: squamosa promoter-binding-like pr...    101   4e-21   
ref|XP_008392088.1|  PREDICTED: squamosa promoter-binding-like pr...    105   4e-21   
ref|XP_009419165.1|  PREDICTED: squamosa promoter-binding-like pr...    104   4e-21   
ref|XP_009602314.1|  PREDICTED: squamosa promoter-binding protein...    100   5e-21   
ref|XP_009419166.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-21   
ref|XP_009353415.1|  PREDICTED: squamosa promoter-binding-like pr...    107   5e-21   
ref|XP_006280496.1|  hypothetical protein CARUB_v10026434mg             105   5e-21   
ref|XP_006361029.1|  PREDICTED: squamosa promoter-binding protein...    100   5e-21   
gb|EMT19900.1|  Squamosa promoter-binding-like protein 17               105   5e-21   
gb|EPS60588.1|  hypothetical protein M569_14215                       99.4    5e-21   
ref|XP_011043410.1|  PREDICTED: squamosa promoter-binding-like pr...    100   5e-21   
gb|AHW57562.1|  squamosa promoter-binding-like protein 17               104   5e-21   
ref|XP_010035775.1|  PREDICTED: squamosa promoter-binding protein...    101   5e-21   
ref|XP_004504410.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    105   5e-21   
ref|XP_010036477.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-21   
dbj|BAJ86264.1|  predicted protein                                      105   5e-21   
ref|XP_009776998.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-21   
gb|KDO77620.1|  hypothetical protein CISIN_1g032310mg                   100   5e-21   
gb|AIS93133.1|  squamosa promoter binding protein                       104   5e-21   
ref|XP_009763062.1|  PREDICTED: squamosa promoter-binding protein...  99.8    5e-21   
ref|XP_010928832.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-21   
ref|XP_004304380.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-21   
ref|XP_010037257.1|  PREDICTED: squamosa promoter-binding-like pr...    106   5e-21   
ref|XP_009376108.1|  PREDICTED: squamosa promoter-binding-like pr...    104   5e-21   
ref|XP_011096328.1|  PREDICTED: squamosa promoter-binding protein 1   99.8    6e-21   
ref|XP_011078637.1|  PREDICTED: squamosa promoter-binding-like pr...    105   6e-21   
ref|XP_010943698.1|  PREDICTED: squamosa promoter-binding-like pr...    107   6e-21   
ref|XP_007149828.1|  hypothetical protein PHAVU_005G101900g             100   6e-21   



>emb|CDP09489.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 225/318 (71%), Gaps = 24/318 (8%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDYEWGN SA VMF+GD++   A  +RQ FDPYG Q  G          +LV  +AH++
Sbjct  1     MLDYEWGNPSA-VMFTGDDSTQDADQNRQLFDPYGTQNFGEATA------ALVHQNAHYS  53

Query  1291  GADHLQLFHH--HHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA  1118
              A H Q   +  HHP +  GQ ++AH  SL+DPRA  GA++        HQ  +LS E A
Sbjct  54    AAAHHQHTGNPFHHPHDPQGQSSNAHFSSLFDPRAAYGASSFNPH----HQASMLSLEPA  109

Query  1117  G---FVVVPKSEPL-GGVEFSGAS-LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN  953
             G   F+V+PKSEP+ GG +F+ A  +GLNLGGRTYFSS+EDDFV+RLYRRSR V+ GS N
Sbjct  110   GSTGFMVIPKSEPVVGGADFTAAGRIGLNLGGRTYFSSSEDDFVSRLYRRSRVVEPGSVN  169

Query  952   TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
             +PRCQAEGCNADLT+AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSEFDNG
Sbjct  170   SPRCQAEGCNADLTNAKHYHRRHKVCEFHSKAATVIASGLTQRFCQQCSRFHLLSEFDNG  229

Query  772   KRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsganssps  593
             KRSCR+RLADHNRRRRK+ QQ  +     N  H   N++ S +D             S S
Sbjct  230   KRSCRKRLADHNRRRRKSQQQQQQP----NQEHCNTNSKKSPNDNT--RSPPDSGAHSSS  283

Query  592   vtvavspPRMSIDCFGQR  539
             VTVAVSPPR+S+DCF QR
Sbjct  284   VTVAVSPPRISLDCFRQR  301



>ref|XP_011090046.1| PREDICTED: squamosa promoter-binding-like protein 8 [Sesamum 
indicum]
Length=326

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 216/318 (68%), Gaps = 21/318 (7%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WGN S ++M S +E A  ++ +R  FDPY                + V P  HFA
Sbjct  1     MLDYGWGNPS-SIMLSAEENAQDSEPNRPVFDPYATHPFSETA-------NFVNPEPHFA  52

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA--  1118
                H  +  H     Q    N+ H  + YD RAY  +A++    H +    +L+ E A  
Sbjct  53    AVPHHHIPFH---HPQTPNSNT-HFSTFYDSRAYTASASSYPHPHQAPPASMLTLEPAAP  108

Query  1117  -GFVVVPKSEPL-GGVEFSG---ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN  953
              GF+VVPKSEP+ GG+EF+    + +GLNLGGRTYF+S+EDDFVNRLYRRSR ++ GS N
Sbjct  109   TGFMVVPKSEPMVGGLEFNAEYNSRIGLNLGGRTYFASSEDDFVNRLYRRSRILEPGSVN  168

Query  952   TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
             +PRCQAEGCNADLTHAKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSEFDNG
Sbjct  169   SPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNG  228

Query  772   KRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsganssps  593
             KRSCR+RLADHNRRRRK+ Q  N+E   NN   L +NA NSSS+ L R         S S
Sbjct  229   KRSCRKRLADHNRRRRKSQQLSNQENN-NNKSQLENNAPNSSSENLTR-SPPDSGAHSSS  286

Query  592   vtvavspPRMSIDCFGQR  539
             VTVA+SPPR+S+DCFG R
Sbjct  287   VTVAISPPRISLDCFGHR  304



>ref|XP_009607851.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nicotiana 
tomentosiformis]
 ref|XP_009607852.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nicotiana 
tomentosiformis]
 ref|XP_009607853.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nicotiana 
tomentosiformis]
Length=308

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 212/332 (64%), Gaps = 46/332 (14%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDE-TAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAH-  1298
             MLDY+WG QS+ VM SG+E      QNH QFFDP+       F +      SL+ P  H 
Sbjct  1     MLDYDWGEQSS-VMLSGEEPNQENDQNHHQFFDPFANTSHQTFTENP----SLLNPQQHH  55

Query  1297  FAGADHLQLFHHH-HPGEQAGQENSAHL--CSLYDPRayggaaaaaAFQHGSHQVP----  1139
             F    H Q  H   HP          HL   SLYDPR            + +H  P    
Sbjct  56    FLNTSHQQQNHQFFHP----------HLNNTSLYDPRCAYETT-----NYNTHHPPTQGS  100

Query  1138  ---LLSQEAAGFVVVPKSEP--LGGV----EFSGAS-LGLNLGGRTYFSSAEDDFVNRLY  989
                L  Q   GF++VPKSEP  +GG     +F+  S +GLNLGGRTYFSS+EDDFVNRLY
Sbjct  101   MPSLHQQPNTGFIMVPKSEPQFMGGAPGVRDFASTSRIGLNLGGRTYFSSSEDDFVNRLY  160

Query  988   RRSRAVDAGS--FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
             RR+RAV  G    NTPRCQAEGCNADLTHAKHYHRRHKVCEFH+KAATVIA GLTQRFCQ
Sbjct  161   RRTRAVVEGGSVVNTPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQ  220

Query  814   QCSRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTL  635
             QCSRFH+LSEFDNGKRSCR+RLADHNRRRRKN Q        N+    LD+ +NSSSD+L
Sbjct  221   QCSRFHLLSEFDNGKRSCRKRLADHNRRRRKNQQANIE----NSNKSQLDSTRNSSSDSL  276

Query  634   ARspsdsgansspsvtvavspPRMSIDCFGQR  539
             AR         S SVTVA+SPPR+S+DCF QR
Sbjct  277   AR-SPPDSGAHSSSVTVAISPPRISLDCFRQR  307



>gb|EYU31932.1| hypothetical protein MIMGU_mgv1a009702mg [Erythranthe guttata]
Length=334

 Score =   253 bits (645),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 179/331 (54%), Positives = 223/331 (67%), Gaps = 38/331 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WGN S ++M SGD+    +  +R  FDPY  Q      +       +  P  H  
Sbjct  1     MLDYGWGNPS-SIMLSGDDNHQDSDQNRSIFDPYATQNFSDAANF------MNPPETHHY  53

Query  1291  GA--------DHLQL-FHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQV-  1142
              A        +H QL FHH +P        S H  S YD  +   +AAA+++QH  H   
Sbjct  54    SAVPTNDNPHNHHQLPFHHQNPNS------SNHFTSFYD--SRAYSAAASSYQHHPHAAA  105

Query  1141  ---PLLSQEAAG----FVVVPKSEPL--GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLY  989
                 +L+ E AG    +++VPKSEP+  GG+E++ + +GLNLGGRTYF+S+EDDFVNRLY
Sbjct  106   AAASMLTLEPAGGQTGYMMVPKSEPVNVGGLEYN-SRIGLNLGGRTYFASSEDDFVNRLY  164

Query  988   RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
             RRSRA++ GS N+PRCQAEGCNADLTHAKHYHRRHKVC+FH+KA+TVIA GLTQRFCQQC
Sbjct  165   RRSRALEPGSMNSPRCQAEGCNADLTHAKHYHRRHKVCDFHSKASTVIAAGLTQRFCQQC  224

Query  808   SRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDN-AQNSSSDTLA  632
             SRFH+LSEFDNGKRSCR+RLADHNRRRRK+ Q        N +H L+++ A NSSS+ LA
Sbjct  225   SRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQPSQENP--NKSHQLIESTATNSSSENLA  282

Query  631   RspsdsgansspsvtvavspPRMSIDCFGQR  539
                     + S SVTVAVSPPR+S+DCFGQR
Sbjct  283   TRSPPDSGHHSSSVTVAVSPPRISLDCFGQR  313



>ref|XP_009793968.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nicotiana 
sylvestris]
Length=300

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 217/322 (67%), Gaps = 34/322 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDE-TAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAH-  1298
             MLDY+WG QS+ VM SG+E      QNH  FFDP+       F +      SL+ P  H 
Sbjct  1     MLDYDWGEQSS-VMLSGEEANQGNDQNHHHFFDPFANTSHQTFTENP----SLLNPQQHH  55

Query  1297  FAGADHLQLFHHHHPGEQAGQENSAHL--CSLYDPRayggaaaaaAFQHGSHQVPLLSQE  1124
             F  A H Q        +Q  Q    HL   +LYDPRAY  +     +      +P L Q+
Sbjct  56    FLNATHQQ--------QQNHQFFHPHLNNTTLYDPRAYETS-----YNPTQGSMPSLHQQ  102

Query  1123  A-AGFVVVPKSEP--LGGV-EFSGAS-LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGS  959
                GF++VPKSEP  +GGV +F+  S +GLNLGGRTYFSS+EDDFVNRLYRR+RAV  G 
Sbjct  103   PNTGFIMVPKSEPQFMGGVRDFASTSRIGLNLGGRTYFSSSEDDFVNRLYRRTRAVVEGG  162

Query  958   --FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSE  785
                NTPRCQAEGCNADLTHAKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSE
Sbjct  163   SVVNTPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSE  222

Query  784   FDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgan  605
             FDNGKRSCR+RLADHNRRRRKN Q     +  N + H   + +NSSSD+LAR        
Sbjct  223   FDNGKRSCRKRLADHNRRRRKNQQANIENS--NKSQH--GSTRNSSSDSLAR-SPPDSGA  277

Query  604   sspsvtvavspPRMSIDCFGQR  539
              S SVTVA+SPPR+S+DCFGQR
Sbjct  278   HSSSVTVAISPPRISLDCFGQR  299



>ref|XP_006361510.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X1 [Solanum tuberosum]
Length=293

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 203/324 (63%), Gaps = 45/324 (14%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WG QS+ VM S DE       +R FFDPYG       ++          P  HF 
Sbjct  1     MLDYNWGEQSS-VMLSNDEQNQENDQNRDFFDPYGPNTQTFTENPY--------PHQHFP  51

Query  1291  GADHL--QLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA  1118
                    Q FH         Q N     +LYDPR Y          +  H    + Q+ +
Sbjct  52    TIQQQNHQFFH--------TQNNPT---TLYDPRGYETC-------YTPHPQSSILQQNS  93

Query  1117  GFVVVPKSEPL------GGVEFSGAS----LGLNLGGRTYFSSAEDDFVNRLYRRSRAVD  968
             GF+VVPKSEP       GG++F  +S    +GLNLGGRTYFSS+EDDFVNRLYRRSRAV+
Sbjct  94    GFMVVPKSEPHQFVGSGGGIDFGSSSNSSRIGLNLGGRTYFSSSEDDFVNRLYRRSRAVE  153

Query  967   AGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVL  791
              GS  NTPRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+L
Sbjct  154   TGSIMNTPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLL  213

Query  790   SEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsg  611
             SEFDNGKRSCR+RLADHNRRRRKN Q        N+    LD+ +NS S TLAR      
Sbjct  214   SEFDNGKRSCRKRLADHNRRRRKNQQANLE----NSNKSQLDSTRNSPSHTLAR-SPADS  268

Query  610   ansspsvtvavspPRMSIDCFGQR  539
                  SVTVA+SPPR+S+D F QR
Sbjct  269   GAHCSSVTVAISPPRISLDVFRQR  292



>gb|AEB71564.1| squamosa promoter binding protein-like protein [Solanum chacoense]
Length=293

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 203/324 (63%), Gaps = 45/324 (14%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WG QS+ VM S DE       +R FFDPYG       ++          P  HF 
Sbjct  1     MLDYNWGEQSS-VMLSNDEQNQENDQNRDFFDPYGPNTQTFTENPY--------PHQHFP  51

Query  1291  GADHL--QLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA  1118
                    Q FH         Q N     +LYDPR Y          +  H    + Q+ +
Sbjct  52    TIQQQNHQFFH--------TQNNPT---TLYDPRGYETC-------YTPHPQSSILQQNS  93

Query  1117  GFVVVPKSEPL------GGVEFSGAS----LGLNLGGRTYFSSAEDDFVNRLYRRSRAVD  968
             GF+VVPKSEP       GG++F  +S    +GLNLGGRTYFSS+EDDFVNRLYRRSRAV+
Sbjct  94    GFMVVPKSEPHQFVGSGGGIDFGSSSNSSRIGLNLGGRTYFSSSEDDFVNRLYRRSRAVE  153

Query  967   AGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVL  791
              GS  NTPRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+L
Sbjct  154   IGSIMNTPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLL  213

Query  790   SEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsg  611
             SEFDNGKRSCR+RLADHNRRRRKN Q        N+    LD+ +NS S TLAR      
Sbjct  214   SEFDNGKRSCRKRLADHNRRRRKNQQANLE----NSNKSQLDSTRNSPSHTLAR-SPADS  268

Query  610   ansspsvtvavspPRMSIDCFGQR  539
                  SVTVA+SPPR+S+D F QR
Sbjct  269   GAHCSSVTVAISPPRISLDVFRQR  292



>ref|XP_004229775.1| PREDICTED: squamosa promoter-binding-like protein 8 [Solanum 
lycopersicum]
Length=299

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 161/246 (65%), Gaps = 29/246 (12%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA--QNHRQFFDPYggqqtggfddaaaagGSLVGPSAH  1298
             MLDYEW NQS+  MF+ D+       QN+ QF DP                      + H
Sbjct  1     MLDYEWENQSS-FMFTSDQNTQEENDQNNNQFLDPQAHFPHITSYQHPQQQQQQQLQNPH  59

Query  1297  FAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLS-QEA  1121
             F             P  QA   N+  + S+YDPRAYG           +H   +LS Q  
Sbjct  60    F-------------PQFQATPNNTHLISSMYDPRAYGVPYTQ------THDTSMLSLQPT  100

Query  1120  AGFVVVPKSEPL--GGV-EFSGAS--LGLNLGGRTYF-SSAEDDFVNRLYRRSRAVDAGS  959
              GF+VVPKSEP   GG+ +FS +S  +GLNLGGRTYF SS+EDDFVNRLYRR+RAVDAGS
Sbjct  101   GGFMVVPKSEPQFGGGIHDFSSSSSRIGLNLGGRTYFASSSEDDFVNRLYRRTRAVDAGS  160

Query  958   FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
              N+P+CQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFHVLSEFD
Sbjct  161   VNSPKCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHVLSEFD  220

Query  778   NGKRSC  761
             NGKRSC
Sbjct  221   NGKRSC  226



>ref|XP_006361511.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X2 [Solanum tuberosum]
Length=290

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 202/324 (62%), Gaps = 48/324 (15%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WG QS+ VM S DE       +R FFDPYG       ++          P  HF 
Sbjct  1     MLDYNWGEQSS-VMLSNDEQNQENDQNRDFFDPYGPNTQTFTENPY--------PHQHFP  51

Query  1291  GADHL--QLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA  1118
                    Q FH         Q N     +LYDPR Y          +  H    + Q+ +
Sbjct  52    TIQQQNHQFFH--------TQNNPT---TLYDPRGYETC-------YTPHPQSSILQQNS  93

Query  1117  GFVVVPKSEPL------GGVEFSGAS----LGLNLGGRTYFSSAEDDFVNRLYRRSRAVD  968
             GF+VVPKSEP       GG++F  +S    +GLNLGGRTYFSS+EDDFVNRLYRRSRAV+
Sbjct  94    GFMVVPKSEPHQFVGSGGGIDFGSSSNSSRIGLNLGGRTYFSSSEDDFVNRLYRRSRAVE  153

Query  967   AGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVL  791
              GS  NTPRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+L
Sbjct  154   TGSIMNTPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLL  213

Query  790   SEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsg  611
             SEFDNGKRSCR+RLADHNRRRRKN Q        N+    LD+ +NS S TLA       
Sbjct  214   SEFDNGKRSCRKRLADHNRRRRKNQQANLE----NSNKSQLDSTRNSPSHTLA----TDS  265

Query  610   ansspsvtvavspPRMSIDCFGQR  539
                  SVTVA+SPPR+S+D F QR
Sbjct  266   GAHCSSVTVAISPPRISLDVFRQR  289



>ref|XP_003633906.1| PREDICTED: squamosa promoter-binding-like protein 8 [Vitis vinifera]
 ref|XP_010661346.1| PREDICTED: squamosa promoter-binding-like protein 8 [Vitis vinifera]
Length=304

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 207/324 (64%), Gaps = 52/324 (16%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDYEWGN S  +M SGDE    +   RQ FD Y    T            LV P+  F 
Sbjct  1     MLDYEWGNPSP-IMLSGDEPPQDSDQTRQIFDHYHQTFTD----------GLVAPATAF-  48

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVP---LLSQEA  1121
                    FHH        Q   AH+ SLYDPRA           + ++Q P   +LS E 
Sbjct  49    -------FHHQ------SQPQPAHIHSLYDPRA-----------YHTYQAPPPAMLSLEP  84

Query  1120  AG---------FVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLY-RRSRAV  971
                        F+VVPKSE +       A +GLNLGGRTYFSS EDDFVNRLY RRSR  
Sbjct  85    VAGTSAGGGTGFMVVPKSEEMVPAADFTARIGLNLGGRTYFSS-EDDFVNRLYQRRSRPA  143

Query  970   DAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVL  791
             + G  N+PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TV A GLTQRFCQQCSRFH+L
Sbjct  144   EPGLTNSPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVFAAGLTQRFCQQCSRFHLL  203

Query  790   SEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsg  611
             SEFDNGKRSCR+RLADHNRRRRK+ Q        +  H  L+NA+NSSSD + RSP DSG
Sbjct  204   SEFDNGKRSCRKRLADHNRRRRKSQQPIQDNHKLHQHH--LENARNSSSDNITRSPPDSG  261

Query  610   ansspsvtvavspPRMSIDCFGQR  539
             A+SS SVTVAVSPPRM++DCF QR
Sbjct  262   AHSSSSVTVAVSPPRMTLDCFRQR  285



>ref|XP_004248549.1| PREDICTED: squamosa promoter-binding-like protein 8 [Solanum 
lycopersicum]
Length=293

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 197/325 (61%), Gaps = 47/325 (14%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WG QS+ VM S DE     + +R+FFDPYG       ++          P  HF 
Sbjct  1     MLDYNWGEQSS-VMLSNDEQNQENEQNREFFDPYGPNTQTYTENPY--------PHQHFP  51

Query  1291  GADHL--QLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA  1118
                H   Q FH         Q N     +LYDPR+Y          H   Q  +L Q+ +
Sbjct  52    NIQHQNHQFFH--------TQNNPT---TLYDPRSYETCYTP----HPHPQSSML-QQNS  95

Query  1117  GFVVVPKSEPL------GGVEFSGAS---LGLNLGGRTYFSSAED-DFVNRLYRRSRAVD  968
             GF+VVPKSEP        G++F  +S   +GLNLGGRTYFSS+ED DFVNRLYRRSRAV+
Sbjct  96    GFMVVPKSEPNQFVGNGSGIDFGSSSSSRIGLNLGGRTYFSSSEDHDFVNRLYRRSRAVE  155

Query  967   -AGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHV  794
              AGS  NTPRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA G+TQRFCQQCSRFH+
Sbjct  156   TAGSIMNTPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGITQRFCQQCSRFHL  215

Query  793   LSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsds  614
             LSEFDNGKRSC               ++ N++    N++   D   NS SDTLAR     
Sbjct  216   LSEFDNGKRSC-----RKRLADHNRRRRKNQQANLENSNK--DTTTNSPSDTLAR-SPAD  267

Query  613   gansspsvtvavspPRMSIDCFGQR  539
                   SVTVA+SPPR+S+D F QR
Sbjct  268   SGAHCSSVTVAISPPRISLDVFRQR  292



>ref|XP_007052207.1| Squamosa promoter binding protein-like 8 [Theobroma cacao]
 gb|EOX96364.1| Squamosa promoter binding protein-like 8 [Theobroma cacao]
Length=330

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 220/325 (68%), Gaps = 28/325 (9%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDYEWGN SA ++ SG+E    +  +RQ FD Y    T           +L+   +H  
Sbjct  1     MLDYEWGNPSA-IILSGEEPNQESDPNRQIFDHYATTTTTQQSFNE----TLL---SHQH  52

Query  1291  GADHLQLFHHHHPGE-QAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAA-  1118
                     H H+P + QA  +  A L SLYDPRAY G +A     + +    LLS +   
Sbjct  53    STAFSHQHHFHNPNQAQAQPQTHAPLHSLYDPRAYSGTSA-----YSTPHPSLLSLDPVS  107

Query  1117  -------GFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAG  962
                    G+ +VPK+E +   V+F+ A +GLNLGGRTYFSSAEDDFVNRLYRRSR  D  
Sbjct  108   GAGGSGCGYFLVPKTEEVSRPVDFT-ARIGLNLGGRTYFSSAEDDFVNRLYRRSRPGDPS  166

Query  961   SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
             S N+PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSEF
Sbjct  167   STNSPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEF  226

Query  781   DNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHH----LLDNAQNSSSDTLARspsds  614
             DNGKRSCR+RLADHNRRRRK+ QQ  ++   NN  +    LL+N +NSS+D   RSP DS
Sbjct  227   DNGKRSCRKRLADHNRRRRKSQQQQQQQQQPNNQENQKPLLLENGRNSSADNPPRSPPDS  286

Query  613   gansspsvtvavspPRMSIDCFGQR  539
             G  SS SVTVAVSPPRMS+DCF QR
Sbjct  287   GIQSSSSVTVAVSPPRMSLDCFRQR  311



>ref|XP_002511636.1| LIGULELESS1 protein, putative [Ricinus communis]
 gb|EEF50305.1| LIGULELESS1 protein, putative [Ricinus communis]
Length=302

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 203/312 (65%), Gaps = 32/312 (10%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             ML+YEWGN S T+M +G+E +     +RQ FD Y  Q              L  P+A   
Sbjct  1     MLEYEWGNPS-TIMLTGEEQSQDPDQNRQIFDHYTAQSFNDNL--------LAQPAA---  48

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAGF  1112
                   LFHH +P +         + SLYDPRA    A           +P  +     +
Sbjct  49    -----SLFHHPNPHQ---------VNSLYDPRASSYTAPHHPSLLSLDPIPTHTAPCPSY  94

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
              +VPK+E +   +   + +GLNLGGRTYFSSAEDDFVNRLYRRSR V+ GS N PRCQAE
Sbjct  95    FLVPKTEQVTRPQDYTSRIGLNLGGRTYFSSAEDDFVNRLYRRSRPVEPGSSNAPRCQAE  154

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSCrrr  752
             GCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSEFDNGKRSCR+R
Sbjct  155   GCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKR  214

Query  751   ladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsds-gansspsvtvavs  575
             LADHNRRRRK+ Q  +     N +H   + A NSSS+ L RSP DS   NSS SVTVAVS
Sbjct  215   LADHNRRRRKSHQINHDA---NKSH--PETATNSSSENLPRSPQDSGTHNSSSSVTVAVS  269

Query  574   pPRMSIDCFGQR  539
             PPRM +DCF QR
Sbjct  270   PPRMFLDCFRQR  281



>emb|CBI16614.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   241 bits (615),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 213/337 (63%), Gaps = 52/337 (15%)
 Frame = -2

Query  1510  LLDSGVRMSERDAMLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaa  1331
             L ++ V+   +  MLDYEWGN S  +M SGDE    +   RQ FD Y    T        
Sbjct  72    LWNNVVKPELQWEMLDYEWGNPSP-IMLSGDEPPQDSDQTRQIFDHYHQTFTD-------  123

Query  1330  agGSLVGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGS  1151
                 LV P+  F        FHH        Q   AH+ SLYDPRA           + +
Sbjct  124   ---GLVAPATAF--------FHHQ------SQPQPAHIHSLYDPRA-----------YHT  155

Query  1150  HQVP---LLSQEAAG---------FVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDD  1007
             +Q P   +LS E            F+VVPKSE +       A +GLNLGGRTYFSS EDD
Sbjct  156   YQAPPPAMLSLEPVAGTSAGGGTGFMVVPKSEEMVPAADFTARIGLNLGGRTYFSS-EDD  214

Query  1006  FVNRLY-RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLT  830
             FVNRLY RRSR  + G  N+PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TV A GLT
Sbjct  215   FVNRLYQRRSRPAEPGLTNSPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVFAAGLT  274

Query  829   QRFCQQCSRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNS  650
             QRFCQQCSRFH+LSEFDNGKRSCR+RLADHNRRRRK+ Q        +  H  L+NA+NS
Sbjct  275   QRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQPIQDNHKLHQHH--LENARNS  332

Query  649   SSDTLARspsdsgansspsvtvavspPRMSIDCFGQR  539
             SSD + RSP DSGA+SS SVTVAVSPPRM++DCF QR
Sbjct  333   SSDNITRSPPDSGAHSSSSVTVAVSPPRMTLDCFRQR  369



>gb|EPS73836.1| hypothetical protein M569_00920 [Genlisea aurea]
Length=320

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 204/321 (64%), Gaps = 35/321 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WG  S+T++ + +E +      RQ FDPY                  V P AH  
Sbjct  1     MLDYGWGTPSSTIL-TPEENSGTESETRQVFDPYAAAVNFSDAH------GFVSPEAH--  51

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL---LSQEA  1121
              + H    HH+HP      +++AHL   Y               +GS Q P    L+ E 
Sbjct  52    -SSHFAALHHNHPLHFQHPQSNAHLQGFYS-----------GVPYGSQQHPPAAPLTLEP  99

Query  1120  AGFVVVPKSEP-------LGGVEFSG---ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAV  971
               ++VVPKSEP        GG EFSG   + +GLNLGGRTYF+S +DDFV+RLYRRSR  
Sbjct  100   E-YMVVPKSEPPGSGTGTGGGYEFSGEFNSRIGLNLGGRTYFASTDDDFVSRLYRRSRIF  158

Query  970   DAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVL  791
             D+ + N PRCQAEGCNADLTHAKHYHRRHKVCEFH+KAATVIA G TQRFCQQCSRFHVL
Sbjct  159   DSVAVNAPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGTTQRFCQQCSRFHVL  218

Query  790   SEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsg  611
             SEFDNGKRSCR+RLADHNRRRRK+ Q     TA         +  NSSS+ L+RSP DSG
Sbjct  219   SEFDNGKRSCRKRLADHNRRRRKSHQSNQESTASKTLAENAASTPNSSSENLSRSPPDSG  278

Query  610   ansspsvtvavspPRMSIDCF  548
              +S+ SVTVA+SPPRMS+DCF
Sbjct  279   LHSTSSVTVAISPPRMSLDCF  299



>ref|XP_006348003.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Solanum 
tuberosum]
Length=302

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 166/258 (64%), Gaps = 53/258 (21%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA--QNHRQFFDPYggqqtggfddaaaagGSLVGPSAH  1298
             MLDYEW NQSA  MF+ D+       QN+ QF DP                       AH
Sbjct  1     MLDYEWENQSA-FMFTSDQNTQEENDQNNNQFLDP----------------------QAH  37

Query  1297  FAGADHLQLFHHHHPGE------------QAGQENSAHLCSLYDPRayggaaaaaAFQHG  1154
             F    H+  + H    +            QA   N+  + S+YDPRAYG +         
Sbjct  38    FP---HITNYQHQQQQQQQQLQNPQFPQFQATPNNTHLISSMYDPRAYGVSYTQ------  88

Query  1153  SHQVPLLS-QEAAGFVVVPKSEPL--GGV-EFSGAS--LGLNLGGRTYF-SSAEDDFVNR  995
             +H+  +LS Q   GF+VVPKSEP   GG+ +FS +S  +GLNLGGRTYF SS+EDDFVNR
Sbjct  89    THETSMLSLQPTGGFMVVPKSEPQFGGGIHDFSSSSSRIGLNLGGRTYFASSSEDDFVNR  148

Query  994   LYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
             LYRR+R VD+GS N+P+CQAEGCNADLTHAKHYHRRHKVCEFH+KAATVIA GLTQRFCQ
Sbjct  149   LYRRTREVDSGSVNSPKCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQ  208

Query  814   QCSRFHVLSEFDNGKRSC  761
             QCSRFHVLSEFDNGKRSC
Sbjct  209   QCSRFHVLSEFDNGKRSC  226



>gb|AIE89801.1| SQUAMOSA promoter binding protein-like 12, partial [Salvia miltiorrhiza]
Length=312

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 158/241 (66%), Gaps = 22/241 (9%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY WGN S ++M SGDET   ++ +R  FDPY  Q             S   P  HFA
Sbjct  1     MLDYGWGNPS-SIMLSGDETGQDSEPNRPVFDPYSSQSFSDAA-------SFANPDNHFA  52

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAGF  1112
              A      H      Q    N AH  S Y          AA + + +  + L  + AA +
Sbjct  53    AAAAHHHHHLPFHTPQTPSSN-AHFTSFY-------GGGAAPYPNPASMLTL--EPAAAY  102

Query  1111  VVVPKSEPL-GGVEFSG---ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPR  944
              VVPKSEP+ GG EF+    + +GLNLGGRTYF+S+EDDFVNRLYRRSR ++ GS N+PR
Sbjct  103   SVVPKSEPMVGGFEFNAEYNSRIGLNLGGRTYFASSEDDFVNRLYRRSRILEPGSVNSPR  162

Query  943   CQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRS  764
             CQAEGCNADLTHAKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSEFDNGKRS
Sbjct  163   CQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRS  222

Query  763   C  761
             C
Sbjct  223   C  223



>gb|KDP28816.1| hypothetical protein JCGZ_14587 [Jatropha curcas]
Length=305

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 165/314 (53%), Positives = 200/314 (64%), Gaps = 33/314 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             ML+YEWGN S T++ SGDE       +RQ FD Y  Q                  + +  
Sbjct  1     MLEYEWGNPS-TMILSGDEPTQDPDQNRQIFDHYTAQSF----------------NDNLV  43

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQV-PLLSQEAAG  1115
                   LFH         Q  +  + SLYDPR Y G ++     H    + P+ +  AAG
Sbjct  44    PQPTTTLFH---------QPTTHQVNSLYDPRGYAGPSSYTPSHHSLLSLDPITNPAAAG  94

Query  1114  --FVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRC  941
               + +VPK+E +       A +GLNLGGRTYFSSAEDDFVNRLYRRSR V+ GS + PRC
Sbjct  95    PSYFLVPKTEEVSRPADYTARIGLNLGGRTYFSSAEDDFVNRLYRRSRPVEPGSTSAPRC  154

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             QAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSEFDNGKRSC
Sbjct  155   QAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSC  214

Query  760   rrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgansspsvtva  581
              R+    + RRR+   Q N+ET  ++     ++ +NSSS+   RSP DSG N+S SVTVA
Sbjct  215   -RKRLADHNRRRRKSHQINQETHKSSQQ---ESGRNSSSENPTRSPPDSGVNNSSSVTVA  270

Query  580   vspPRMSIDCFGQR  539
             VSPPRM +DCF QR
Sbjct  271   VSPPRMFLDCFKQR  284



>gb|KHG07983.1| Squamosa promoter-binding-like protein 8 [Gossypium arboreum]
Length=327

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 177/317 (56%), Positives = 209/317 (66%), Gaps = 15/317 (5%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggf-ddaaaagGSLVGPSAHF  1295
             ML+YEWGN S+ +M SG+ETA     +RQ F  Y    T            S   P+   
Sbjct  1     MLEYEWGNPSS-IMLSGEETAQEPDPNRQLFHHYATTTTTTHHQPYNETLLSHHNPTVF-  58

Query  1294  AGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGS----HQVPLLSQ  1127
                 H  LFH+  P +    ++ A L SLYDP +Y   +A +   H S      V  +  
Sbjct  59    ---SHQNLFHN--PNQAQPPQHPATLHSLYDPHSYSATSAYST-AHASLLSLDPVSAVGG  112

Query  1126  EAAGFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT  950
                G+ +VPK+E +   V+F+ A +GLNLGGRTYFSSAEDDFVNRLYRRSR  D  S N+
Sbjct  113   SGGGYFLVPKTEEVSRPVDFT-ARIGLNLGGRTYFSSAEDDFVNRLYRRSRPGDLSSTNS  171

Query  949   PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
             PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSEFDNGK
Sbjct  172   PRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGK  231

Query  769   RSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgansspsv  590
             RSCR+RLADHNRRRRK+ QQ    T  +  H  L++  N S D   RSP DSG  SS SV
Sbjct  232   RSCRKRLADHNRRRRKSQQQQPNTTQEHQKHLQLESGGNPSCDNPPRSPPDSGVQSSSSV  291

Query  589   tvavspPRMSIDCFGQR  539
             TVA SPPR+S+DCF QR
Sbjct  292   TVAASPPRISLDCFRQR  308



>ref|XP_009593420.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nicotiana 
tomentosiformis]
 ref|XP_009593422.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nicotiana 
tomentosiformis]
Length=246

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 158/255 (62%), Gaps = 54/255 (21%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDYEWG         G+ET      + QFFDP+                  V P AHF 
Sbjct  1     MLDYEWG--------IGEETTQETDQNDQFFDPF------------------VNPHAHFP  34

Query  1291  GADHLQLFHHHHPGEQAGQ--------------ENSAHLCSLYDPRayggaaaaaAFQHG  1154
                +       HP ++  Q               N+ H  SLY+P       +     H 
Sbjct  35    PISN-------HPDQRQQQQQIQNHQFPQFQTTPNNNHFNSLYNPHTNDVPYSQT---HH  84

Query  1153  SHQVPLLSQEAAGF-VVVPKSEP--LGGVEFSGAS-LGLNLGGRTYFSSAEDDFVNRLYR  986
             +  + L    +AGF +V+PKSEP  +GG++F+  S +GLNLGGRTYF+S+EDDFVNRL+R
Sbjct  85    TSMLSLQPTGSAGFNMVLPKSEPQFVGGIDFTNTSRIGLNLGGRTYFASSEDDFVNRLFR  144

Query  985   RSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
             R+RAV+ GS N+P+CQA+GCNADLTHAKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCS
Sbjct  145   RTRAVEGGSVNSPKCQADGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCS  204

Query  805   RFHVLSEFDNGKRSC  761
             RFHVLSEFDNGKRSC
Sbjct  205   RFHVLSEFDNGKRSC  219



>ref|XP_010258891.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nelumbo 
nucifera]
Length=304

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 158/243 (65%), Gaps = 37/243 (15%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDY+WGN SA ++ SG+E A  +   RQ FD Y                +L G     +
Sbjct  1     MLDYQWGNPSA-MLLSGEEPAQDSDQTRQIFDQYNQ--------------TLAG-----S  40

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAG-  1115
                H   F  H P +Q  Q+N  HL SLYD R          +     Q P   +  AG 
Sbjct  41    FLSHATSFSSH-PFQQPQQQNQTHLQSLYDSRP---------YSLAYPQQPPPPEHVAGP  90

Query  1114  --FVVVPKSEPL---GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT  950
               F+V+PK+E +    G++F  A +GLNLGGRTYFSSAEDDFVNRLYRRSR ++AG+ N+
Sbjct  91    TSFLVMPKTEEVCGPRGIDFP-ARIGLNLGGRTYFSSAEDDFVNRLYRRSRPIEAGASNS  149

Query  949   PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
             PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TV+A GLTQRFCQQCSRFH+LSEFD GK
Sbjct  150   PRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVLAAGLTQRFCQQCSRFHLLSEFDQGK  209

Query  769   RSC  761
             RSC
Sbjct  210   RSC  212



>gb|AFC17960.1| squamosa promoter binding protein-like 8 [Betula platyphylla]
Length=309

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 201/321 (63%), Gaps = 41/321 (13%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDE-TAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHF  1295
             MLDY WGN   T+M SG+E TA      RQ FDPY                     ++ F
Sbjct  1     MLDYGWGN-PGTMMLSGEEETAPDPDQTRQIFDPYTQPFNI---------------NSSF  44

Query  1294  AGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHG----SHQVPLLSQ  1127
                     F H +P +Q    +S    S +DPRAY   +A++   +      H V   + 
Sbjct  45    NPQPATTAFSHFNPPQQT---HSQLHHSFFDPRAYPQPSASSYRPNQLLSLDHPVNGAAG  101

Query  1126  EAAGFVVVPKSEPL--GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN  953
                G+++VPKSE      V+F  + LGLNLGGRTYFSSAED+FVNRLYRRSR  + GS N
Sbjct  102   SGGGYLLVPKSEEAVSRSVDFV-SRLGLNLGGRTYFSSAEDEFVNRLYRRSRPTEPGSAN  160

Query  952   TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
             +PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSEFDNG
Sbjct  161   SPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNG  220

Query  772   KRSCrrrladhnrrrrknpqqpnRETAFNNTHHL---LDNAQNSSSDTLARspsdsgans  602
             KRSC        R+R  +  +  R+T   N   L    DNA+N SS+   RSP DSGA+S
Sbjct  221   KRSC--------RKRLADHNRRRRKTHQPNPEQLKSQPDNARNPSSE---RSPPDSGAHS  269

Query  601   spsvtvavspPRMSIDCFGQR  539
             + SVTVAVSPPRMS+DCF QR
Sbjct  270   TSSVTVAVSPPRMSLDCFRQR  290



>emb|CAB56568.1| squamosa promoter binding protein-homologue 3 [Antirrhinum majus]
Length=305

 Score =   228 bits (581),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 194/316 (61%), Gaps = 38/316 (12%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQ-FFDPYggqqtggfddaaaagGSLVGPSAHF  1295
             ML+Y+WGN S +++ SG+E     +  RQ  FDPY                 +  P  HF
Sbjct  1     MLEYDWGNPS-SIILSGEEIPPDPEQTRQDNFDPYSANTNFSQTPHF-----INNPQTHF  54

Query  1294  AGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAG  1115
                +     +  HP             + YDP           +  GS  + L   +  G
Sbjct  55    TAPNTHHQQYPFHP-------------NFYDP-----------YNPGS-TLGLEPADPTG  89

Query  1114  FVVVPKSEPL--GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRC  941
             F+ +PK+EP   GG EF+ + +GLNLGGRTYF+S+EDDFVNRLYRRSR ++ GS N PRC
Sbjct  90    FMTIPKTEPAVGGGFEFN-SRIGLNLGGRTYFASSEDDFVNRLYRRSRLLEPGSINAPRC  148

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             QAEGCNADL+H KHYHRRHKVCEFH+KAA V+A GLTQRFCQQCSRFHVLSEFDNGKRSC
Sbjct  149   QAEGCNADLSHCKHYHRRHKVCEFHSKAANVVAAGLTQRFCQQCSRFHVLSEFDNGKRSC  208

Query  760   rrrladhnrrrrknpqqpnRETAFNNTHHLLDN--AQNSSSDTLARspsdsgansspsvt  587
             RRRLADHNRRRRK+ QQ N +     +    +N  A NSSS+ L R         S SVT
Sbjct  209   RRRLADHNRRRRKSSQQANSQENSGKSQLQGNNAAAPNSSSENLPR-SPPDSGAHSSSVT  267

Query  586   vavspPRMSIDCFGQR  539
               VSPPR+S+DCFG R
Sbjct  268   AGVSPPRISLDCFGHR  283



>ref|XP_006375255.1| hypothetical protein POPTR_0014s05680g [Populus trichocarpa]
 gb|ERP53052.1| hypothetical protein POPTR_0014s05680g [Populus trichocarpa]
Length=328

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 208/332 (63%), Gaps = 45/332 (14%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNH------RQ--FFDPYggqqtggfddaaaagGSL  1316
             ML+YEWGN S T+M SG +   A  NH      RQ   FD Y  Q     +         
Sbjct  1     MLEYEWGNPS-TIMLSGGDDQQAGSNHEVQDQNRQASIFDHYTTQSFNDNNLIPQHTSPT  59

Query  1315  VGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL  1136
             +             +F +H     A   N   + S +DPRAY GA A++     +H   L
Sbjct  60    L-------------MFQNHPTTTNATHHN---INSFFDPRAYAGAGASSF--PTTHHPSL  101

Query  1135  LSQE----------AAGFVVVPKSE--PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRL  992
             LS +          A  + ++PKSE  P    +   + +GLNLGGRTYFSSAEDDFVNRL
Sbjct  102   LSLDPIPTVTSVATATSYFLIPKSEEIPRSNSDLITSRIGLNLGGRTYFSSAEDDFVNRL  161

Query  991   YRRSRAVDAGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
             YRRSR +D GS  N PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQ
Sbjct  162   YRRSRPLDPGSSSNAPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQ  221

Query  814   QCSRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTL  635
             QCSRFH+LSEFDNGKRSCR+RLADHNRRRRK+ Q         N    L+NA  SSS+ L
Sbjct  222   QCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSHQINQ-----ENQKSHLENATISSSEIL  276

Query  634   ARspsdsgansspsvtvavspPRMSIDCFGQR  539
              RSP DSGA+ + SVTVA+SPPRMS+DCF QR
Sbjct  277   TRSPPDSGAHPTSSVTVAMSPPRMSLDCFKQR  308



>ref|XP_007218335.1| hypothetical protein PRUPE_ppa008560mg [Prunus persica]
 gb|EMJ19534.1| hypothetical protein PRUPE_ppa008560mg [Prunus persica]
Length=327

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 207/324 (64%), Gaps = 31/324 (10%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA-----QNHRQFFDPYggqqtggfddaaaagGSLVGP  1307
             MLDYEWGN S TVM S D    +       N    FD Y  Q +           +LV P
Sbjct  1     MLDYEWGNPS-TVMLSPDNDPGSDPTRQHHNTTTIFDHYASQASQASAFN-----NLVPP  54

Query  1306  SAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQ  1127
                     H   F HH    QA Q     L S+YD  AY  A+A A   H     PLLS 
Sbjct  55    PPPPQQQSHHAAFAHHFNSAQAQQ-----LHSIYDAHAYANASAYAPPNHH----PLLSL  105

Query  1126  E------AAGFVVVPKSEPL-GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSR-AV  971
             +      A G ++VPKSE L   V+F  + +GLNLGGRTYFSS EDDF+NRLYRR+R A 
Sbjct  106   DPIQGGAAHGLILVPKSEDLCRPVDF-ASRIGLNLGGRTYFSS-EDDFMNRLYRRTRPAT  163

Query  970   DAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVL  791
             + GS + PRCQAEGC ADL+HAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+L
Sbjct  164   ETGSNHAPRCQAEGCTADLSHAKHYHRRHKVCEFHSKASTVIANGLTQRFCQQCSRFHLL  223

Query  790   SEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsg  611
              EFDNGKRSC RR    + RRR+  QQ N+E   +    L++NA+NSSSD +ARSP +S 
Sbjct  224   PEFDNGKRSC-RRRLADHNRRRRKTQQTNQENHNSQVQQLVENARNSSSDNVARSPPESA  282

Query  610   ansspsvtvavspPRMSIDCFGQR  539
             A+S+ SVTVA+SPPRM++DCF QR
Sbjct  283   AHSASSVTVALSPPRMTLDCFRQR  306



>ref|XP_010264333.1| PREDICTED: squamosa promoter-binding-like protein 8 [Nelumbo 
nucifera]
Length=330

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 206/314 (66%), Gaps = 32/314 (10%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             ML+YEWGN SA ++ SG+E    +   RQ FD Y     G          + + P+A + 
Sbjct  1     MLEYEWGNPSA-MLLSGEEPGQDSDQTRQIFDQYNQTLAG----------NFLSPAASYP  49

Query  1291  GADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAGF  1112
                  Q         Q   +N  HL SLYD R+Y  +     + H  H  P        F
Sbjct  50    THHPFQ---------QQQHQNQTHLQSLYDARSYSLS-----YPH-QHPAPEPVAGPTSF  94

Query  1111  VVVPKSEPL---GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRC  941
             +++PKSE +   GG++F  A +GLNLGGRTYFSSAEDDFVNRLYRRSR ++AG  N+PRC
Sbjct  95    MILPKSEEVCGPGGMDFP-ARIGLNLGGRTYFSSAEDDFVNRLYRRSRPIEAGVSNSPRC  153

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             QAEGCNADLTHAKHYHRRHKVCEFH+KA+TV+AGGLTQRFCQQCSRFH+LSEFD GKRSC
Sbjct  154   QAEGCNADLTHAKHYHRRHKVCEFHSKASTVLAGGLTQRFCQQCSRFHLLSEFDQGKRSC  213

Query  760   rrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgansspsvtva  581
             R+RLADHNRRRRK+  Q   +         L+NA  S S+  ARS  +SGA+SS SVTVA
Sbjct  214   RKRLADHNRRRRKSQPQQQTQQQ--QQQVQLENALGSPSENPARSSPESGAHSSSSVTVA  271

Query  580   vspPRMSIDCFGQR  539
             VSPPRMS+ CF  R
Sbjct  272   VSPPRMSLGCFQPR  285



>ref|XP_011033165.1| PREDICTED: squamosa promoter-binding-like protein 8 [Populus 
euphratica]
Length=328

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 207/332 (62%), Gaps = 45/332 (14%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNH------RQ--FFDPYggqqtggfddaaaagGSL  1316
             ML+YEWGN S T+M SG +   A  NH      RQ   FD Y  Q     +         
Sbjct  1     MLEYEWGNPS-TIMLSGGDDQQAGSNHDVQDQNRQASIFDHYTTQSFNDNNLIPQHTSPA  59

Query  1315  VGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL  1136
             +             +F +H     A   N   + S +DPRAY GA A+      +H   L
Sbjct  60    L-------------MFQNHPTTTNATHHN---INSFFDPRAYAGAGASTF--PTTHHPSL  101

Query  1135  LSQE----------AAGFVVVPKSE--PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRL  992
             LS +          A  + ++PKSE  P    +   + +GLNLGGRTYFSSAEDDFVNRL
Sbjct  102   LSLDPIPTVTSVATATSYFLIPKSEEIPRSNSDLITSRIGLNLGGRTYFSSAEDDFVNRL  161

Query  991   YRRSRAVDAGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
             YRRSR +D GS  N PRCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQ
Sbjct  162   YRRSRPLDPGSSSNAPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQ  221

Query  814   QCSRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTL  635
             QCSRFH+LSEFDNGKRSCR+RLADHNRRRRK+ Q         N    L+NA  SSS+ L
Sbjct  222   QCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSHQINQ-----ENQKSHLENATISSSEIL  276

Query  634   ARspsdsgansspsvtvavspPRMSIDCFGQR  539
              RSP DSGA+ + SVTVA+SPPR+S+DCF QR
Sbjct  277   TRSPPDSGAHPASSVTVAMSPPRISLDCFKQR  308



>ref|XP_002301256.2| hypothetical protein POPTR_0002s14320g [Populus trichocarpa]
 gb|EEE80529.2| hypothetical protein POPTR_0002s14320g [Populus trichocarpa]
Length=325

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 195/329 (59%), Gaps = 42/329 (13%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQN----HRQ--FFDPYggqqtggfddaaaagGSLVG  1310
             ML+YEWGN S  ++  GDE AA  Q     +RQ   FD Y                +L  
Sbjct  1     MLEYEWGNPSTMMLSGGDEQAATNQEVQHLNRQANIFDHYTHSFNDNHLIPQQTSSTL--  58

Query  1309  PSAHFAGADHLQLFHHHHPGEQAGQENSAH--LCSLYDPRayggaaaaaAFQHGSH----  1148
                         +F +H         NSAH    SL+DPRAY G+ A++   + +     
Sbjct  59    ------------MFQNH-----PTATNSAHHSFNSLFDPRAYTGSGASSYSANDTSLLSL  101

Query  1147  -QVPLLSQEAAG--FVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRS  980
               +P ++  A    + ++PK E +    +   + +GLNLGGRTYFSSAEDDFV RLYRRS
Sbjct  102   DSIPTITSVATATPYFLIPKGEEISRPSDLITSRIGLNLGGRTYFSSAEDDFVKRLYRRS  161

Query  979   RAVDAGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSR  803
             R +D GS  N  RCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSR
Sbjct  162   RPLDPGSSSNALRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSR  221

Query  802   FHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARsp  623
             FH+LSEFDNGKRSC               ++ + +    N    L+NA N SSD L RSP
Sbjct  222   FHILSEFDNGKRSC-----RKRLADHNRRRRKSHQVNQENQRSQLENAANPSSDILTRSP  276

Query  622   sdsga-nsspsvtvavspPRMSIDCFGQR  539
              DSGA ++S + TVA+SPPRMS+DCF QR
Sbjct  277   LDSGAHSTSSATTVAISPPRMSLDCFKQR  305



>ref|XP_011017436.1| PREDICTED: squamosa promoter-binding-like protein 8 [Populus 
euphratica]
Length=326

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 197/330 (60%), Gaps = 43/330 (13%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQ-------FFDPYggqqtggfddaaaagGSLV  1313
             ML+YEWGN SA +M SGD+  AA+    Q        FD Y        +       S  
Sbjct  1     MLEYEWGNPSA-IMLSGDDEQAASNQEVQHLNRQANIFDHYTTHSFNDNNLIPQQTSS--  57

Query  1312  GPSAHFAGADHLQLFHHHHPGEQAGQENSAH--LCSLYDPRaygga-aaaaAFQHGS---  1151
                          L   +HP       NSAH    SL+DPRAY G+ A + +  H S   
Sbjct  58    ------------NLMFQNHPTA----TNSAHHSFNSLFDPRAYTGSGAPSYSANHPSLLS  101

Query  1150  -HQVPLLSQ--EAAGFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRR  983
                +P ++    A+ + ++PK+E +    +   + +GLNLGGRTYFSSAEDDFV RLYRR
Sbjct  102   LDSIPTITSVTTASPYFLIPKNEEISRPSDLITSRIGLNLGGRTYFSSAEDDFVKRLYRR  161

Query  982   SRAVDAGSF-NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
             SR +D GS  N  RCQAEGCNADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCS
Sbjct  162   SRPLDPGSSSNAVRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCS  221

Query  805   RFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARs  626
             RFH LSEFDNGKRSC               ++ + +    N    L+NA N+SS+ L RS
Sbjct  222   RFHNLSEFDNGKRSC-----RKRLADHNRRRRKSHQVNQENQRSQLENAANTSSEILTRS  276

Query  625   psdsga-nsspsvtvavspPRMSIDCFGQR  539
             P DSGA ++S + TVA+SPPRMS+DCF QR
Sbjct  277   PPDSGAHSTSSATTVAISPPRMSLDCFKQR  306



>ref|XP_004510110.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X2 [Cicer arietinum]
Length=281

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 164/257 (64%), Gaps = 32/257 (12%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQN----HRQFFDPYggqqtggfddaaaagGSLVGPS  1304
             MLDYEWGN S  +M +G+E A+AA      HRQ FD Y  Q     +          GP+
Sbjct  1     MLDYEWGNPS-NIMLTGNEDASAAAASDQAHRQLFDHYTSQTMLSDNYLHHPS----GPN  55

Query  1303  AHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQV--PLLS  1130
              +    D    F HHH   Q  Q++  H    +DPRAY  A++  ++          +LS
Sbjct  56    ININTTD----FTHHHFNPQ--QQHHMHH-PFFDPRAYQAASSTNSYPPPQPPPPPSMLS  108

Query  1129  QE----------AAGFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRR  983
              +          A G ++VPKSE +G  ++F G+ +GLNLGGRTYFSS+EDDFV RLYRR
Sbjct  109   LDPLPHVNTHNCAPGLLLVPKSEDVGRPMDFVGSRIGLNLGGRTYFSSSEDDFVTRLYRR  168

Query  982   SRAVDAGSF---NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQ  812
             SR  + GS    N+PRCQAEGCNADL+ AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQ
Sbjct  169   SRPPEPGSSASSNSPRCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQ  228

Query  811   CSRFHVLSEFDNGKRSC  761
             CSRFH+LSEFDNGKRSC
Sbjct  229   CSRFHLLSEFDNGKRSC  245



>ref|XP_004510109.1| PREDICTED: squamosa promoter-binding-like protein 8-like isoform 
X1 [Cicer arietinum]
Length=324

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 164/257 (64%), Gaps = 32/257 (12%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQN----HRQFFDPYggqqtggfddaaaagGSLVGPS  1304
             MLDYEWGN S  +M +G+E A+AA      HRQ FD Y  Q     +          GP+
Sbjct  1     MLDYEWGNPS-NIMLTGNEDASAAAASDQAHRQLFDHYTSQTMLSDNYLHHPS----GPN  55

Query  1303  AHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQV--PLLS  1130
              +    D    F HHH   Q  Q++  H    +DPRAY  A++  ++          +LS
Sbjct  56    ININTTD----FTHHHFNPQ--QQHHMHH-PFFDPRAYQAASSTNSYPPPQPPPPPSMLS  108

Query  1129  QE----------AAGFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRR  983
              +          A G ++VPKSE +G  ++F G+ +GLNLGGRTYFSS+EDDFV RLYRR
Sbjct  109   LDPLPHVNTHNCAPGLLLVPKSEDVGRPMDFVGSRIGLNLGGRTYFSSSEDDFVTRLYRR  168

Query  982   SRAVDAGSF---NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQ  812
             SR  + GS    N+PRCQAEGCNADL+ AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQ
Sbjct  169   SRPPEPGSSASSNSPRCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQ  228

Query  811   CSRFHVLSEFDNGKRSC  761
             CSRFH+LSEFDNGKRSC
Sbjct  229   CSRFHLLSEFDNGKRSC  245



>ref|XP_003626693.1| Squamosa promoter binding protein [Medicago truncatula]
 gb|AET01169.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=327

 Score =   215 bits (548),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 159/255 (62%), Gaps = 26/255 (10%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDE----TAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPS  1304
             MLDYEWGN S  +M +G+E     AA  Q HRQ FD Y  Q     +     GG   GP+
Sbjct  1     MLDYEWGNPS-NIMLTGNEDNSGAAATDQAHRQIFDHYASQAMLSDNYLNGPGG---GPT  56

Query  1303  AHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRa---yggaaaaaAFQHGSHQVPLL  1133
                   D     HHH+      Q++     S +DPRA       A++           +L
Sbjct  57    IDINSGD---FTHHHNQFSPHNQQHHNIHQSFFDPRAFHGGSSTASSYPPPQPQPPPSML  113

Query  1132  SQE-------AAGFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSR  977
             S +       + GF++VPKSE +   ++F G+ LGLNLGGRTYFSS EDDFV RLYRRSR
Sbjct  114   SLDPLPGHGHSPGFLLVPKSEDVNRPIDFVGSRLGLNLGGRTYFSS-EDDFVTRLYRRSR  172

Query  976   AVDAGSF---NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
               + GS    N+PRCQAEGCNADL+ AKHYHRRHKVCEFH+KAATV+A GLTQRFCQQCS
Sbjct  173   PPEPGSTGSSNSPRCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVVAAGLTQRFCQQCS  232

Query  805   RFHVLSEFDNGKRSC  761
             RFH+LSEFDNGKRSC
Sbjct  233   RFHLLSEFDNGKRSC  247



>ref|XP_006445349.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|ESR58589.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|KDO85637.1| hypothetical protein CISIN_1g020302mg [Citrus sinensis]
Length=282

 Score =   214 bits (544),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 155/248 (63%), Gaps = 17/248 (7%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaa--------agGSL  1316
             M+DYEWGN S T++ +GDE        RQ FD Y  Q+                    +L
Sbjct  1     MVDYEWGNPS-TILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTL  59

Query  1315  VGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL  1136
                              HHH        NS +  SL+DPRAY  A++ A   H      +
Sbjct  60    YHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHS-----M  114

Query  1135  LSQEAA--GFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDA  965
             LS +AA  G+ ++PK+E +   V+   + +GLNLGGRTYFSSA+DDFV+RLYRR R  +A
Sbjct  115   LSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEA  174

Query  964   GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSE  785
             GS N PRCQAEGC+ADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSE
Sbjct  175   GSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSE  234

Query  784   FDNGKRSC  761
             FDNGKRSC
Sbjct  235   FDNGKRSC  242



>ref|XP_006445348.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 ref|XP_006464477.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Citrus 
sinensis]
 gb|ESR58588.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|KDO85636.1| hypothetical protein CISIN_1g020302mg [Citrus sinensis]
Length=328

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 209/323 (65%), Gaps = 25/323 (8%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaa--------agGSL  1316
             M+DYEWGN S T++ +GDE        RQ FD Y  Q+                    +L
Sbjct  1     MVDYEWGNPS-TILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTL  59

Query  1315  VGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL  1136
                              HHH        NS +  SL+DPRAY  A++ A   H      +
Sbjct  60    YHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHS-----M  114

Query  1135  LSQEAA--GFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDA  965
             LS +AA  G+ ++PK+E +   V+   + +GLNLGGRTYFSSA+DDFV+RLYRR R  +A
Sbjct  115   LSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEA  174

Query  964   GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSE  785
             GS N PRCQAEGC+ADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSE
Sbjct  175   GSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSE  234

Query  784   FDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNS-SSDTLARspsdsga  608
             FDNGKRSCR+RLADHNRRRRK+ QQP        T  L DN ++    + LA+SP DSGA
Sbjct  235   FDNGKRSCRKRLADHNRRRRKSQQQP-------TTTPLQDNQKSQLEPEILAKSPPDSGA  287

Query  607   nsspsvtvavspPRMSIDCFGQR  539
             +SS SVTVAVSPPRMS+DCF Q+
Sbjct  288   HSSSSVTVAVSPPRMSLDCFRQK  310



>ref|XP_009782499.1| PREDICTED: squamosa promoter-binding-like protein 8 isoform X2 
[Nicotiana sylvestris]
Length=307

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 153/248 (62%), Gaps = 43/248 (17%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDYEW          G+ET      + QFFDP+                  V P AHF+
Sbjct  1     MLDYEWET-------GGEETTQETDQNDQFFDPF------------------VNPLAHFS  35

Query  1291  GA-DHLQLFHHHH------PGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLL  1133
                +HL             P  Q    N+ H  SLY+P  Y    +     H +  + L 
Sbjct  36    PIRNHLDQQQQQQIQNHQFPQFQTTPNNN-HFSSLYNPHTYDVPYSQT---HHTSMLSLQ  91

Query  1132  SQEAAGF-VVVPKSEP--LGGVEFSGAS-LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDA  965
                + GF  V+PKSE   +GG++F+  S +GLNLGGRTYF+S+EDDFVNRL+RR+RAV+A
Sbjct  92    PTGSTGFNTVLPKSELQFMGGIDFTNTSRIGLNLGGRTYFASSEDDFVNRLFRRTRAVEA  151

Query  964   GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSE  785
             GS   P+CQA+GCNADLTHAKHYHRRHKVCEFH+KAATVIA G+TQRFCQQCSRFH LS+
Sbjct  152   GS---PKCQADGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGVTQRFCQQCSRFHDLSK  208

Query  784   FDNGKRSC  761
             FDNGKRSC
Sbjct  209   FDNGKRSC  216



>ref|XP_009782498.1| PREDICTED: squamosa promoter-binding-like protein 8 isoform X1 
[Nicotiana sylvestris]
Length=310

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 153/248 (62%), Gaps = 43/248 (17%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAHFA  1292
             MLDYEW          G+ET      + QFFDP+                  V P AHF+
Sbjct  1     MLDYEWET-------GGEETTQETDQNDQFFDPF------------------VNPLAHFS  35

Query  1291  GA-DHLQLFHHHH------PGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLL  1133
                +HL             P  Q    N+ H  SLY+P  Y    +     H +  + L 
Sbjct  36    PIRNHLDQQQQQQIQNHQFPQFQTTPNNN-HFSSLYNPHTYDVPYSQT---HHTSMLSLQ  91

Query  1132  SQEAAGF-VVVPKSEP--LGGVEFSGAS-LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDA  965
                + GF  V+PKSE   +GG++F+  S +GLNLGGRTYF+S+EDDFVNRL+RR+RAV+A
Sbjct  92    PTGSTGFNTVLPKSELQFMGGIDFTNTSRIGLNLGGRTYFASSEDDFVNRLFRRTRAVEA  151

Query  964   GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSE  785
             GS   P+CQA+GCNADLTHAKHYHRRHKVCEFH+KAATVIA G+TQRFCQQCSRFH LS+
Sbjct  152   GS---PKCQADGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGVTQRFCQQCSRFHDLSK  208

Query  784   FDNGKRSC  761
             FDNGKRSC
Sbjct  209   FDNGKRSC  216



>ref|XP_003521087.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Glycine 
max]
Length=336

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 167/268 (62%), Gaps = 42/268 (16%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA---QNHRQFFDPYggqqtggfddaaaagGSLVGPSA  1301
             MLDYEWGN S T+M SG+E ++AA   Q HRQ FD Y            A   S    +A
Sbjct  1     MLDYEWGNPS-TIMLSGNEDSSAAGSDQTHRQIFDHYASHTLIPDHFLHAPTHS----TA  55

Query  1300  HFAGADHLQLFHHHHPGEQAGQENSAHLC-----SLYDPRayggaaaaaAFQHGSHQVP-  1139
               A A  +   HHHH   Q    N  H+      + +DPRA+ GA+        S+  P 
Sbjct  56    TTAAAATVDFTHHHHFTPQPHHHNQNHMNHHHHHAFFDPRAFHGASNT------SYPPPH  109

Query  1138  -LLSQEAAGFV-----------------VVPKSEPLG-GVEFSGASLGLNLGGRTYFSSA  1016
              +LS +    V                 +VPKSE +G  ++F G+ +GLNLGGRTYFSS+
Sbjct  110   SMLSLDPLPHVNAVGPGHGPGSGPGGLLLVPKSEDVGRPMDFVGSRIGLNLGGRTYFSSS  169

Query  1015  EDDFVNRLYRRSRAVDAGSF---NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVI  845
             EDDFV+RLYRRSR V+ GS    N+PRCQAEGCNADL+ AKHYHRRHKVCEFH+KAATVI
Sbjct  170   EDDFVSRLYRRSRPVEPGSTASSNSPRCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVI  229

Query  844   AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             A GLTQRFCQQCSRFH+LSEFDNGKRSC
Sbjct  230   AAGLTQRFCQQCSRFHLLSEFDNGKRSC  257



>ref|XP_006445347.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
 gb|ESR58587.1| hypothetical protein CICLE_v10021106mg [Citrus clementina]
Length=324

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 155/248 (63%), Gaps = 17/248 (7%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaa--------agGSL  1316
             M+DYEWGN S T++ +GDE        RQ FD Y  Q+                    +L
Sbjct  1     MVDYEWGNPS-TILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTL  59

Query  1315  VGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL  1136
                              HHH        NS +  SL+DPRAY  A++ A   H      +
Sbjct  60    YHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHS-----M  114

Query  1135  LSQEAA--GFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDA  965
             LS +AA  G+ ++PK+E +   V+   + +GLNLGGRTYFSSA+DDFV+RLYRR R  +A
Sbjct  115   LSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEA  174

Query  964   GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSE  785
             GS N PRCQAEGC+ADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSE
Sbjct  175   GSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSE  234

Query  784   FDNGKRSC  761
             FDNGKRSC
Sbjct  235   FDNGKRSC  242



>ref|XP_007134545.1| hypothetical protein PHAVU_010G056000g [Phaseolus vulgaris]
 gb|ESW06539.1| hypothetical protein PHAVU_010G056000g [Phaseolus vulgaris]
Length=330

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 162/256 (63%), Gaps = 22/256 (9%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA--QNHRQFFDPYggqqtggfddaaaagGSLVGPSAH  1298
             MLDYEWGN S+ ++   +ETAA A  Q HRQ FD Y            A   S    +A 
Sbjct  1     MLDYEWGNPSSIMLTGNEETAAGASDQTHRQIFDHYASHSLIPDHFLHAPTHSNAT-TAA  59

Query  1297  FAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQV--PLLSQE  1124
              A  D+    HH +P +      + H    +DPRA+ GA++ +     S     PL    
Sbjct  60    AATVDYTNHHHHFNP-QPHHHHLNHHHHPFFDPRAFHGASSTSYPPTPSMLSLDPLPHVN  118

Query  1123  AAG-----------FVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRS  980
             AA             ++VPKSE +G  ++F G+ +GLNLGGRTYFSS EDDFV+RLYRRS
Sbjct  119   AANCGPGPGPGPGGLLLVPKSEDVGRPMDFVGSRIGLNLGGRTYFSS-EDDFVSRLYRRS  177

Query  979   RAVDAGSF---NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
             R  ++GS    N+PRCQAEGCNADL+ AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQC
Sbjct  178   RPAESGSAASSNSPRCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQC  237

Query  808   SRFHVLSEFDNGKRSC  761
             SRFH+LSEFDNGKRSC
Sbjct  238   SRFHLLSEFDNGKRSC  253



>ref|XP_002892031.1| hypothetical protein ARALYDRAFT_470069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68290.1| hypothetical protein ARALYDRAFT_470069 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 153/263 (58%), Gaps = 48/263 (18%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDE----TAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPS  1304
             MLDYEW N S+ V+ SGDE    +    ++   FFDP                  L+   
Sbjct  1     MLDYEWDNPSSLVL-SGDERNPDSDPTTRSSLSFFDPI--SHYNNDHRHITISPPLLSSF  57

Query  1303  AHFAGADHLQL-----------FHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQH  1157
             ++     HL L           FHHHH               LYDPR      A+    H
Sbjct  58    SNNQQQHHLTLYGQSSSNNNLMFHHHH---------------LYDPRTTTPYGASDPMYH  102

Query  1156  GSHQVP--LLSQE------AAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFV  1001
                  P  L S +      ++   ++PK+E    V+F+   +GLNLGGRTYFS+A+DDFV
Sbjct  103   PHSSAPASLFSYDQTSGSGSSYNFLIPKTE----VDFTSNRIGLNLGGRTYFSAADDDFV  158

Query  1000  NRLYRRSRAVDAG---SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLT  830
             +RLYRRSR  ++G   S +TPRCQAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+
Sbjct  159   SRLYRRSRPGESGMGNSLSTPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLS  218

Query  829   QRFCQQCSRFHVLSEFDNGKRSC  761
             QRFCQQCSRFH+LSEFDNGKRSC
Sbjct  219   QRFCQQCSRFHLLSEFDNGKRSC  241



>ref|XP_004308485.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 197/321 (61%), Gaps = 31/321 (10%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQN-----HRQFFDPYggqqtggfddaaaagGSLVGP  1307
             MLDYEW N S+ ++   +    +  N     H    D Y   Q    +            
Sbjct  1     MLDYEWANPSSVILDGSESVNGSDPNRHLHHHNGILDHYATTQVAFNNLLPPQPQQ----  56

Query  1306  SAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQ  1127
               H A A H         G+   Q +  H  SL+DP      A+A+++   +H   +LS 
Sbjct  57    QQHSAFAQHF--------GQSQTQAHQVH--SLFDP---SVFASASSYAPTTHHHSMLSL  103

Query  1126  EAA-----GFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAG  962
             + +     G +++PKSE +         +GLNLGGRTYFSS EDDF+NRLYRRSR  D G
Sbjct  104   DPSIPGHHGLMLIPKSEDMCPPTDFATRIGLNLGGRTYFSS-EDDFMNRLYRRSRPADHG  162

Query  961   SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
               N+PRCQAEGC+ADL+ AKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+L+EF
Sbjct  163   PLNSPRCQAEGCHADLSQAKHYHRRHKVCEFHSKASTVIANGLTQRFCQQCSRFHLLAEF  222

Query  781   DNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgans  602
             DNGKRSCR+RLADHNRRRRK+ Q      +   +  L + A+NSSSD + +SP +S  +S
Sbjct  223   DNGKRSCRKRLADHNRRRRKSQQPSQENRS---SQPLSETARNSSSDNVTKSPGESAGHS  279

Query  601   spsvtvavspPRMSIDCFGQR  539
             S +VTVA+SPPR+ +DCF  R
Sbjct  280   SSAVTVALSPPRIGLDCFRPR  300



>ref|XP_010089258.1| Squamosa promoter-binding-like protein 8 [Morus notabilis]
 gb|EXB37583.1| Squamosa promoter-binding-like protein 8 [Morus notabilis]
Length=364

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 161/196 (82%), Gaps = 8/196 (4%)
 Frame = -2

Query  1114  FVVVPKSEP--LGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF--NTP  947
             F++VPKSE      V+FS + +GLNLGGRTYFSS EDDF++RLYRR RA++AGS   N+P
Sbjct  153   FMLVPKSEDHQRAAVDFS-SRIGLNLGGRTYFSS-EDDFMSRLYRRPRALEAGSTSANSP  210

Query  946   RCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKR  767
             RCQAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GLTQRFCQQCSRFH+LSEFDNGKR
Sbjct  211   RCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLTQRFCQQCSRFHLLSEFDNGKR  270

Query  766   SCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgansspsvt  587
             SCR+RLADHNRRRRK  Q   +     +     +NAQN SSD +ARSP DSGA SS SVT
Sbjct  271   SCRKRLADHNRRRRKTQQPNQQVQNPKSLQ--PENAQNPSSDNVARSPPDSGAQSSSSVT  328

Query  586   vavspPRMSIDCFGQR  539
             VAVSPPRMS+DCF QR
Sbjct  329   VAVSPPRMSLDCFRQR  344



>ref|XP_009373190.1| PREDICTED: squamosa promoter-binding-like protein 8 [Pyrus x 
bretschneideri]
 ref|XP_009373191.1| PREDICTED: squamosa promoter-binding-like protein 8 [Pyrus x 
bretschneideri]
Length=346

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 174/338 (51%), Positives = 211/338 (62%), Gaps = 42/338 (12%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAA------AQNHRQ------FFDPYggqqtggfddaaaa  1328
             MLDYEWGN +  VM S D  + +       ++H Q      F D Y   Q   F++   A
Sbjct  1     MLDYEWGNPNNVVMLSPDTDSGSIHGSDPTRHHHQHNHASTFLDHYASSQASAFNNLVPA  60

Query  1327  gGSLVGPSAHFAG--ADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHG  1154
                      H     ADH    HH     QA Q     L S+YDP AY  A+  A   H 
Sbjct  61    PPPPPPQPHHQTSTFADHFNPTHH-----QAQQ-----LHSIYDPHAYASASTYAPPHHH  110

Query  1153  SHQV-------PLLSQEAAGFVVVPKSEPL-GGVEFSGASLGLNLGGRTYFSSAEDDFVN  998
              H         P+    A G +++PK+E +   V+F+ + +GLNLGGRTYF+S EDDF+N
Sbjct  111   HHHHHSMLGLDPVHGGTANGLMLIPKTEDMCPPVDFA-SRIGLNLGGRTYFAS-EDDFMN  168

Query  997   RLYRRSRA-VDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRF  821
             RLYRRSR   +  S ++PRCQAEGC ADL+H+KHYHRRHKVCEFH+KA+TVIA GLTQRF
Sbjct  169   RLYRRSRPGSEITSTHSPRCQAEGCAADLSHSKHYHRRHKVCEFHSKASTVIANGLTQRF  228

Query  820   CQQCSRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHH----LLDNAQN  653
             CQQCSRFH+LSEFDNGKRSCR+RLADHNRRRRK  Q      A +N+ H     L+ AQN
Sbjct  229   CQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKTQQTIQ---AHHNSQHQQQPPLEKAQN  285

Query  652   SSSDTLARspsdsgansspsvtvavspPRMSIDCFGQR  539
             SSSD +A SP +S A S  SVTVAVSPPRM++DCF QR
Sbjct  286   SSSDNVASSPPESAALSVSSVTVAVSPPRMTLDCFRQR  323



>ref|XP_003530168.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Glycine 
max]
Length=338

 Score =   200 bits (508),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 4/122 (3%)
 Frame = -2

Query  1114  FVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF---NTP  947
              ++VPKSE +G  ++F G+ +GLNLGGRTYFSS+EDDFV+RLYRRSR V+ GS    N+P
Sbjct  138   LLLVPKSEEVGRPMDFVGSRIGLNLGGRTYFSSSEDDFVSRLYRRSRPVEPGSTISSNSP  197

Query  946   RCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKR  767
             RCQAEGCNADL+ AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSEFDNGKR
Sbjct  198   RCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKR  257

Query  766   SC  761
             SC
Sbjct  258   SC  259



>ref|XP_008375792.1| PREDICTED: squamosa promoter-binding-like protein 8 [Malus domestica]
 ref|XP_008375793.1| PREDICTED: squamosa promoter-binding-like protein 8 [Malus domestica]
Length=347

 Score =   197 bits (502),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 205/337 (61%), Gaps = 41/337 (12%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNH------------RQFFDPYggqqtggfddaaaa  1328
             MLDYEWGN +  VM S D  + +                  F D Y   Q   F++   A
Sbjct  1     MLDYEWGNPNNVVMLSPDTDSDSIHGSDPTRHHHHHNHASTFLDHYASSQASAFNNLVPA  60

Query  1327  gGSLVGPSAHFAG--ADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHG  1154
                      H     A+H    HH     QA Q     L S+YDP AY  A+  A   H 
Sbjct  61    PPPPPPQPHHQTSTFANHFNPTHH-----QAQQ-----LHSIYDPHAYASASTYAPPHHX  110

Query  1153  SHQVPLLSQE------AAGFVVVPKSEPL-GGVEFSGASLGLNLGGRTYFSSAEDDFVNR  995
                  +L  +      A G +++PKSE +   V+F  + +GLNLGGRTYF+S EDDF+NR
Sbjct  111   HQHHSMLGLDPVHGGAANGLMLIPKSEDMCPPVDF-ASRIGLNLGGRTYFAS-EDDFMNR  168

Query  994   LYRRSRA-VDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFC  818
             LYRRSR   +  S ++PRCQAEGC ADL+H+KHYHRRHKVCEFH+KA+TVIA GLTQRFC
Sbjct  169   LYRRSRPGSEITSTHSPRCQAEGCAADLSHSKHYHRRHKVCEFHSKASTVIANGLTQRFC  228

Query  817   QQCSRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHH----LLDNAQNS  650
             QQCSRFH+LSEFDNGKRSCR+RLADHNRRRRK  Q        +N+ H     L+ A+NS
Sbjct  229   QQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKTQQTIQEH---HNSQHQQQPPLEKARNS  285

Query  649   SSDTLARspsdsgansspsvtvavspPRMSIDCFGQR  539
             SSD +A SP +S A S  SVTVAVSPPRM++DCF QR
Sbjct  286   SSDNVASSPPESAALSVSSVTVAVSPPRMTLDCFRQR  322



>dbj|BAC42797.1| putative squamosa promoter binding protein 8 SPL8 [Arabidopsis 
thaliana]
Length=333

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 149/256 (58%), Gaps = 27/256 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHR---QFFDPYggqqtggfddaaaagGSLVGPSA  1301
             MLDYEW N S+ V+ SGDE    +   R    FFDP                  L+   +
Sbjct  1     MLDYEWDNPSSIVL-SGDERNPDSDPTRSSFSFFDPI--SHYNNDHRHITISPPLLSSFS  57

Query  1300  HFAGADHLQLFHHHHPGEQ-----------AGQENSAHLCSLYDP--RayggaaaaaAFQ  1160
             +     HL L+   +   Q            G   +       DP    +  A  A+ F 
Sbjct  58    NQQQQQHLTLYGQTNSNNQFLHHHHHHHSLYGSTTTTTPYGASDPIYHPHSSAPPASLFS  117

Query  1159  HGSHQVPLLSQEAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRS  980
             +        S  +  F+ +PK+E    V+F+   +GLNLGGRTYFS+A+DDFV+RLYRRS
Sbjct  118   YDQTGPGSGSGSSYNFL-IPKTE----VDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRS  172

Query  979   RAVDAG---SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
             R  ++G   S +TPRCQAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQQC
Sbjct  173   RPGESGMANSLSTPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQC  232

Query  808   SRFHVLSEFDNGKRSC  761
             SRFH+LSEFDNGKRSC
Sbjct  233   SRFHLLSEFDNGKRSC  248



>gb|AGP03031.1| SQUAMOSA promoter binding protein-like protein 8 [Arabis alpina]
 gb|KFK42576.1| squamosa promoter-binding-like protein 8 [Arabis alpina]
Length=336

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 152/266 (57%), Gaps = 45/266 (17%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGS----LVGPS  1304
             MLDYEW N S+ +M SGDE     +NH    DP                 +    L+ P 
Sbjct  1     MLDYEWDNPSS-IMLSGDE-----RNHHDS-DPTRALSIFDTTPHHHQPYNDHRHLISPP  53

Query  1303  --AHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLS  1130
               + ++   HL ++ H        Q +     S YDPR      A + +   S   PL S
Sbjct  54    LLSSYSNQQHLTVYGHQTTHITTNQFHH----SYYDPRNTTSPYADSLYH--SSASPLFS  107

Query  1129  QEAAGF---------------VVVPKSE-----PLGGVEFSGASLGLNLGGRTYFSSAED  1010
              +  G                 ++PK+E     PL   +++   +GLNLGGRTYFS+A+D
Sbjct  108   FDQPGTGSGGPASSYSGSSYNFLIPKTEVDVSRPL---DYTPNRIGLNLGGRTYFSAADD  164

Query  1009  DFVNRLYRRSRAVDAG---SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAG  839
             DFV+RLYRRSR  + G   S + PRCQAEGCN+DL+HAKHYHRRHKVCEFH+KA+TV+A 
Sbjct  165   DFVSRLYRRSRPGEPGMGNSLSAPRCQAEGCNSDLSHAKHYHRRHKVCEFHSKASTVVAA  224

Query  838   GLTQRFCQQCSRFHVLSEFDNGKRSC  761
             GL+QRFCQQCSRFH+LSEFDNGKRSC
Sbjct  225   GLSQRFCQQCSRFHLLSEFDNGKRSC  250



>ref|XP_006305139.1| hypothetical protein CARUB_v10009506mg [Capsella rubella]
 gb|EOA38037.1| hypothetical protein CARUB_v10009506mg [Capsella rubella]
Length=367

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/280 (44%), Positives = 153/280 (55%), Gaps = 36/280 (13%)
 Frame = -2

Query  1525  FPFSFLLDSGVRMSERDA-------MLDYEWGNQSATVMFSGDETAAAAQNHR--QFFDP  1373
             FP +       R   RD        MLDYEW N S+ V+   D    +    R   FFDP
Sbjct  10    FPPAVSAKENKRKERRDLPRDCKANMLDYEWENPSSLVLSGDDRNPGSVDPTRPLSFFDP  69

Query  1372  YggqqtggfddaaaagGS---------LVGPSAHFAGADHLQLFHHH---HPGEQAGQEN  1229
                        +     S         L  P  H +   H   FHH     P   +   +
Sbjct  70    SHFNNDRHITLSPPLFSSNHHHHHHHHLTPP--HTSVYAHTNHFHHQAFYDPRSPSPSPS  127

Query  1228  SAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAGFVVVPKSEPLGGVEFSGASLGL  1049
                   +Y P     +A A  F +  H  P  S  +  F++ PK+E    V+F+   +GL
Sbjct  128   PYPSDPIYHP---HSSAPAPLFSYDLH-APAASSSSYNFLI-PKTE----VDFTSNRIGL  178

Query  1048  NLGGRTYFSSAEDDFVNRLYRRSRAVDAG----SFNTPRCQAEGCNADLTHAKHYHRRHK  881
             NLGGRTYFS+A+DDFV+RLYRRSR  + G      +TPRCQAEGC+ADL+HAKHYHRRHK
Sbjct  179   NLGGRTYFSAADDDFVSRLYRRSRPGEPGMGNSPLSTPRCQAEGCSADLSHAKHYHRRHK  238

Query  880   VCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             VCEFH+KA+TV+A GL+QRFCQQCSRFH+LSEFDNGKRSC
Sbjct  239   VCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSC  278



>ref|XP_009119750.1| PREDICTED: squamosa promoter-binding-like protein 8 [Brassica 
rapa]
Length=328

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 153/261 (59%), Gaps = 40/261 (15%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSL------VG  1310
             MLDYEW N S  ++ SG++    + +H+Q  DP              +  S       + 
Sbjct  1     MLDYEWDNPSV-IILSGED---RSHHHQQEPDPTRVLSIFDPTQTHHSQSSYSNTCPPLF  56

Query  1309  PSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayg---gaaaaaAFQHGSH---  1148
             PS   +   HL ++ H          N  H   +YDPR        ++ + + H  H   
Sbjct  57    PS--LSNQQHLTVYGHQ-------TSNQFHPSFVYDPRITNHPYSPSSDSIYGHPHHSAL  107

Query  1147  ----QVPLLSQEAAGFVVVPKSE-----PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNR  995
                 Q       ++   ++PK+E     PL   +F+   +GLNLGGRTYFS+A+DDFV+R
Sbjct  108   FSFDQTGSGGSGSSYNFLIPKTEVDVSRPL---DFTSNRIGLNLGGRTYFSAADDDFVSR  164

Query  994   LYRRSRAVDAG---SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQR  824
             LYRRSR  + G   + +TPRCQAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QR
Sbjct  165   LYRRSRPGELGVGNTLSTPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQR  224

Query  823   FCQQCSRFHVLSEFDNGKRSC  761
             FCQQCSRFH+LSEFDNGKRSC
Sbjct  225   FCQQCSRFHLLSEFDNGKRSC  245



>ref|XP_010480322.1| PREDICTED: squamosa promoter-binding-like protein 8, partial 
[Camelina sativa]
Length=209

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 8/120 (7%)
 Frame = -2

Query  1108  VVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN----TPRC  941
             ++PK+E    V+F+   +GLNLGGRTYFS+A+DDFV+RLYRRSR  ++G  N    TPRC
Sbjct  10    LIPKTE----VDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMGNSPLSTPRC  65

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             QAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQQCSRFH+LSEFDNGKRSC
Sbjct  66    QAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSC  125



>gb|KDO85638.1| hypothetical protein CISIN_1g020302mg [Citrus sinensis]
Length=231

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 141/234 (60%), Gaps = 17/234 (7%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaa--------agGSL  1316
             M+DYEWGN S T++ +GDE        RQ FD Y  Q+                    +L
Sbjct  1     MVDYEWGNPS-TILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTL  59

Query  1315  VGPSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPL  1136
                              HHH        NS +  SL+DPRAY  A++ A   H      +
Sbjct  60    YHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHS-----M  114

Query  1135  LSQEAA--GFVVVPKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDA  965
             LS +AA  G+ ++PK+E +   V+   + +GLNLGGRTYFSSA+DDFV+RLYRR R  +A
Sbjct  115   LSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEA  174

Query  964   GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSR  803
             GS N PRCQAEGC+ADLTHAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSR
Sbjct  175   GSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSR  228



>ref|XP_010496481.1| PREDICTED: squamosa promoter-binding-like protein 8 [Camelina 
sativa]
Length=202

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 98/110 (89%), Gaps = 4/110 (4%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN----TPRCQAEGCNADLT  911
             V+F+   +GLNLGGRTYFS+A+DDFV+RLYRRSR  ++G  N    TPRCQAEGCNADL+
Sbjct  9     VDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMGNSLLSTPRCQAEGCNADLS  68

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQQCSRFH+LSEFDNGKRSC
Sbjct  69    HAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSC  118



>emb|CDY38043.1| BnaCnng09040D [Brassica napus]
Length=335

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 150/257 (58%), Gaps = 27/257 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAH-F  1295
             MLDYEW N SA +M SG+E     ++H Q  D                       S   F
Sbjct  1     MLDYEWDNTSA-IMGSGEE-----RHHHQDLDTTRALSIFDPTQTNHHQSPYNNFSPPLF  54

Query  1294  AGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAG  1115
             +   HL + + HH        N  H  S YDP  Y  +++ + +   S    L S + +G
Sbjct  55    SSQQHLTVVYGHHQTAHNIPTNQFHH-SFYDPNPYSSSSSDSIYHAHSSASALFSFDQSG  113

Query  1114  FV--------VVPKSEP--LGGVEFSGAS-LGLNLGGRTYFSSAEDDFVNRLYRRSRAVD  968
                       +VPK+E      ++FS ++ +GLNLGGRTYFS+ +DDFV+RLYRRSR  +
Sbjct  114   PAGSGSSYNFLVPKTEVDVSRSLDFSTSNRIGLNLGGRTYFSAGDDDFVSRLYRRSRPGE  173

Query  967   --------AGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQ  812
                     + +  TPRCQAE CNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQQ
Sbjct  174   LLGMGNSLSTTTTTPRCQAERCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQ  233

Query  811   CSRFHVLSEFDNGKRSC  761
             CSRFH+LSEFDNGKRSC
Sbjct  234   CSRFHLLSEFDNGKRSC  250



>ref|XP_008458127.1| PREDICTED: squamosa promoter-binding-like protein 8 [Cucumis 
melo]
 ref|XP_008458128.1| PREDICTED: squamosa promoter-binding-like protein 8 [Cucumis 
melo]
Length=297

 Score =   182 bits (461),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 152/201 (76%), Gaps = 12/201 (6%)
 Frame = -2

Query  1114  FVVVPKSEPLGG-----VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVD--AGSF  956
             F++VPKSE + G     VEF+ A +GLNLGGRTYFSS E++FVNRLYR++R+     GS 
Sbjct  98    FMLVPKSEDVCGSMAAPVEFA-ARIGLNLGGRTYFSSEEEEFVNRLYRKTRSGSEMGGSG  156

Query  955   N-TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
             N   RCQAEGCNADL+ AKHYHRRHKVCEFH+KA+TVI  GLTQRFCQQCSRFHV+ EFD
Sbjct  157   NWAVRCQAEGCNADLSQAKHYHRRHKVCEFHSKASTVITAGLTQRFCQQCSRFHVVGEFD  216

Query  778   NGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLA-Rspsdsgans  602
             NGKRSCR+RLADHNRRRRK  Q  ++ T   N+  LL    +SS+ + A RS  +S   S
Sbjct  217   NGKRSCRKRLADHNRRRRKTQQSHHQGTP--NSSQLLQTTPSSSTHSAATRSTMESTGQS  274

Query  601   spsvtvavspPRMSIDCFGQR  539
             + SVTVAVSP RMS+DC  QR
Sbjct  275   AWSVTVAVSPTRMSLDCLNQR  295



>ref|XP_009118853.1| PREDICTED: squamosa promoter-binding-like protein 8 [Brassica 
rapa]
Length=334

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 147/257 (57%), Gaps = 28/257 (11%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGPSAH-F  1295
             MLDYEW N SA +M SG+E     ++H Q  D                       S   F
Sbjct  1     MLDYEWDNTSA-IMGSGEE-----RHHHQDLDTTRALSIFDPTQTNHHQSPYNNFSPPLF  54

Query  1294  AGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQEAAG  1115
             +   HL + + H            H  S YDP  Y  +++ + +   S    L S + +G
Sbjct  55    SNQQHLTVVYGHQTAHNIPTNQFHH--SFYDPNPYASSSSDSIYHAHSSASALFSFDQSG  112

Query  1114  FV--------VVPKSEP---LGGVEFSGAS-LGLNLGGRTYFSSAEDDFVNRLYRRSRAV  971
                       +VPK+E       ++FS ++ +GLNLGGRTYFS+ +DDFV+RLYRRSR  
Sbjct  113   PAGSGSSYNFLVPKTEVDVVSRSLDFSTSNRIGLNLGGRTYFSAGDDDFVSRLYRRSRPG  172

Query  970   DA-------GSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQ  812
             +         +  TPRCQAE CNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQQ
Sbjct  173   ELLGMGNSLSTTLTPRCQAERCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQ  232

Query  811   CSRFHVLSEFDNGKRSC  761
             CSRFH+LSEFDNGKRSC
Sbjct  233   CSRFHLLSEFDNGKRSC  249



>ref|XP_010056422.1| PREDICTED: squamosa promoter-binding-like protein 8 [Eucalyptus 
grandis]
 gb|KCW73146.1| hypothetical protein EUGRSUZ_E01600 [Eucalyptus grandis]
Length=367

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 155/209 (74%), Gaps = 21/209 (10%)
 Frame = -2

Query  1114  FVVVPKSE------PLGGVEFSGASLGLNLGGRTYFSS---AEDDFVNRLYRRS------  980
             F++VPKSE      P    E + A +GLNLGGRTYF+S   AEDDFV+RLYRR       
Sbjct  135   FLMVPKSEDATGARPSPAAELAAARIGLNLGGRTYFASSVAAEDDFVSRLYRRPSAGRAG  194

Query  979   ---RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
                  V + + N PRCQAEGCNADLTHAKHYHRRHKVCEFH+KAA VIAGGLTQRFCQQC
Sbjct  195   GEGGGVGSAAANAPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAAAVIAGGLTQRFCQQC  254

Query  808   SRFHVLSEFDNGKRSCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLAR  629
             SRFH+L+EFDNGKRSCR+RLADHNRRRRK+ QQP R+   N      +  +NSS D  +R
Sbjct  255   SRFHLLAEFDNGKRSCRKRLADHNRRRRKSHQQPGRD---NLAKTQQEGCRNSSGDNPSR  311

Query  628   spsdsgansspsvtvavspPRMSIDCFGQ  542
             SP DSG  S+ SVTVA+SPPRMS+DCF Q
Sbjct  312   SPPDSGTQSASSVTVALSPPRMSLDCFRQ  340



>ref|XP_010692128.1| PREDICTED: squamosa promoter-binding-like protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=286

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 5/115 (4%)
 Frame = -2

Query  1105  VPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGC  926
             +PK+EP     F+   +GLNLG RTYFS A+DD V+RLYRRSRAV+  + ++P+CQAEGC
Sbjct  101   IPKTEPDI---FTNRPIGLNLGRRTYFS-ADDDLVSRLYRRSRAVEPAA-HSPKCQAEGC  155

Query  925   NADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             NADL HAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+LSEFDNGKRSC
Sbjct  156   NADLNHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSC  210



>gb|KCW73147.1| hypothetical protein EUGRSUZ_E01600 [Eucalyptus grandis]
Length=321

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 103/136 (76%), Gaps = 18/136 (13%)
 Frame = -2

Query  1114  FVVVPKSE------PLGGVEFSGASLGLNLGGRTYFSS---AEDDFVNRLYRRS------  980
             F++VPKSE      P    E + A +GLNLGGRTYF+S   AEDDFV+RLYRR       
Sbjct  135   FLMVPKSEDATGARPSPAAELAAARIGLNLGGRTYFASSVAAEDDFVSRLYRRPSAGRAG  194

Query  979   ---RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
                  V + + N PRCQAEGCNADLTHAKHYHRRHKVCEFH+KAA VIAGGLTQRFCQQC
Sbjct  195   GEGGGVGSAAANAPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAAAVIAGGLTQRFCQQC  254

Query  808   SRFHVLSEFDNGKRSC  761
             SRFH+L+EFDNGKRSC
Sbjct  255   SRFHLLAEFDNGKRSC  270



>ref|XP_010540239.1| PREDICTED: squamosa promoter-binding-like protein 8 [Tarenaya 
hassleriana]
Length=286

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 131/243 (54%), Gaps = 45/243 (19%)
 Frame = -2

Query  1471  MLDYEWGNQSATVM-----FSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSLVGP  1307
             ML+Y+WGN SA V         D     +      FDP                   + P
Sbjct  2     MLEYDWGNPSAMVFSAPDDDDDDAHHPDSTRPIPMFDPTHHSMLSPPPPPLINNQQFLYP  61

Query  1306  SAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQ  1127
             +A+         FHH                ++YDP A  G      +Q   H       
Sbjct  62    AAN--------QFHH----------------AMYDPPASYGQPGTGLYQVADHD------  91

Query  1126  EAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRS-RAVDAGSFNT  950
                G  +V         + + + +GLNLGGRTYFS+A+DDFV+RLYRRS R  ++   NT
Sbjct  92    RGTGPYMV---------DMTTSRIGLNLGGRTYFSAADDDFVSRLYRRSSRPGESCLSNT  142

Query  949   PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
             PRCQAEGCNADL+ AKHYHRRHKVC+FH+KA+TV+  GLTQRFCQQCSRFH+LSEFDNGK
Sbjct  143   PRCQAEGCNADLSQAKHYHRRHKVCDFHSKASTVLTAGLTQRFCQQCSRFHLLSEFDNGK  202

Query  769   RSC  761
             RSC
Sbjct  203   RSC  205



>emb|CDX90071.1| BnaA10g00110D [Brassica napus]
Length=312

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/258 (43%), Positives = 144/258 (56%), Gaps = 50/258 (19%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQFFDPYggqqtggfddaaaagGSL------VG  1310
             MLDYEW N S  ++ SG++    + +H+Q  DP              +  S       + 
Sbjct  1     MLDYEWDNPSV-IILSGED---RSHHHQQEPDPTRVLSIFDPTQTHHSQSSYSNTCPPLF  56

Query  1309  PSAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayg---gaaaaaAFQHGSH---  1148
             PS   +   HL ++ H          N  H   +YDPR        ++ + + H  H   
Sbjct  57    PS--LSNQQHLTVYGHQ-------TSNQFHPSFVYDPRITNHPYSPSSDSIYGHPHHSAL  107

Query  1147  ----QVPLLSQEAAGFVVVPKSE-----PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNR  995
                 Q       ++   ++PK+E     PL   +F+   +GLNLGGRTYFS+A+DDFV+R
Sbjct  108   FSFDQTGSGGSGSSYNFLIPKTEVDVSRPL---DFTSNRIGLNLGGRTYFSAADDDFVSR  164

Query  994   LYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
             L             TPRCQAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQ
Sbjct  165   L-------------TPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQ  211

Query  814   QCSRFHVLSEFDNGKRSC  761
             QCSRFH+LSEFDNGKRSC
Sbjct  212   QCSRFHLLSEFDNGKRSC  229



>ref|XP_004140489.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Cucumis 
sativus]
 gb|KGN46565.1| hypothetical protein Csa_6G109120 [Cucumis sativus]
Length=297

 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 98/127 (77%), Gaps = 9/127 (7%)
 Frame = -2

Query  1114  FVVVPKSEPLGG------VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVD--AGS  959
             F++VPKSE + G           A +GLNLGGRTYFSS E++FVNRLYRR+R      GS
Sbjct  95    FMLVPKSENVCGSIGAAAPAEFAARIGLNLGGRTYFSSEEEEFVNRLYRRTRTGSEMGGS  154

Query  958   FN-TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
              N   RCQAEGCNADL+ AKHYHRRHKVCEFH+KA+TVI  GLTQRFCQQCSRFHV+ EF
Sbjct  155   GNWAVRCQAEGCNADLSQAKHYHRRHKVCEFHSKASTVITAGLTQRFCQQCSRFHVVGEF  214

Query  781   DNGKRSC  761
             DNGKRSC
Sbjct  215   DNGKRSC  221



>ref|XP_010479450.1| PREDICTED: squamosa promoter-binding-like protein 8 [Camelina 
sativa]
Length=334

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 8/120 (7%)
 Frame = -2

Query  1108  VVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN----TPRC  941
             ++PK+E    V+F+   +GLNLGGRTYFS+A+DDFV+RLYRRSR  ++G  N    TPRC
Sbjct  135   LIPKTE----VDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMGNSLLSTPRC  190

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             QAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL+QR      RFH+LSEFDNGKRSC
Sbjct  191   QAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRXXXXXXRFHLLSEFDNGKRSC  250



>ref|XP_004163755.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Cucumis 
sativus]
Length=297

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 97/127 (76%), Gaps = 9/127 (7%)
 Frame = -2

Query  1114  FVVVPKSEPLGG------VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVD--AGS  959
             F++VPKSE + G           A +GLNLGGRTYFSS E++FVNRLYRR+R      GS
Sbjct  95    FMLVPKSENVCGSIGAAAPAEFAARIGLNLGGRTYFSSEEEEFVNRLYRRTRTGSEMGGS  154

Query  958   FN-TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
              N   RCQAEGCNADL+ AKHYHRRHKVCEFH+ A+TVI  GLTQRFCQQCSRFHV+ EF
Sbjct  155   GNWAVRCQAEGCNADLSQAKHYHRRHKVCEFHSTASTVITAGLTQRFCQQCSRFHVVGEF  214

Query  781   DNGKRSC  761
             DNGKRSC
Sbjct  215   DNGKRSC  221



>ref|XP_007140981.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
 ref|XP_007140982.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
 gb|ESW12975.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
 gb|ESW12976.1| hypothetical protein PHAVU_008G157200g [Phaseolus vulgaris]
Length=325

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 143/260 (55%), Gaps = 42/260 (16%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA--QNHRQFFDPYggqqtggfddaaaagGSLVGPSAH  1298
             MLDYEW   ++ ++ +G+E A     Q  RQ FD                   L  P  H
Sbjct  1     MLDYEWN--TSMILLAGNEAAGGEPDQTRRQIFD--------------HNFAMLTDPILH  44

Query  1297  FAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGS----HQVPLLS  1130
              +       F HHHP     Q +     + +DPRA+  A+  +     S    + +P L+
Sbjct  45    GSTPTATTAFSHHHPFNPQQQHHQQ---AFFDPRAFQSASTTSFSPPPSLLSLNPIPPLA  101

Query  1129  QE--------AAGFVVVPKSE----PLG---GVEFSGASLGLNLGGRTYFSSAEDDFVNR  995
                         GF+++ KSE    P+         G  LGLNLGGRTYF+++ +D ++R
Sbjct  102   PSHCGLGPGSGLGFLLMSKSEDVTSPMNFDVSGHGLGPGLGLNLGGRTYFAASNEDTLDR  161

Query  994   LYRRS--RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRF  821
              YR     +V   S N PRCQAEGCN DL+ AKHYHRRHKVCEFH+KAATVIA GLTQRF
Sbjct  162   FYRSKTVESVSTVSSNLPRCQAEGCNTDLSEAKHYHRRHKVCEFHSKAATVIAAGLTQRF  221

Query  820   CQQCSRFHVLSEFDNGKRSC  761
             CQQCSRFH+LSEFDNGKRSC
Sbjct  222   CQQCSRFHLLSEFDNGKRSC  241



>ref|XP_008232622.1| PREDICTED: squamosa promoter-binding-like protein 8 [Prunus mume]
Length=282

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 174/316 (55%), Gaps = 60/316 (19%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAA-----QNHRQFFDPYggqqtggfddaaaagGSLVGP  1307
             MLDYEWGN S TVM S D    +       N    FD Y  Q +           +LV P
Sbjct  1     MLDYEWGNPS-TVMLSPDNDPGSDPTRHHHNTTTIFDHYASQASQASAFN-----NLVPP  54

Query  1306  SAHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayggaaaaaAFQHGSHQVPLLSQ  1127
                     H   F HH    QA Q     L S+YD  AY  A+A A   H     PLLS 
Sbjct  55    PPPPQQQSHHAAFAHHFNSAQAQQ-----LHSIYDAHAYASASAYAPPNHH----PLLSL  105

Query  1126  EAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTP  947
             +           P+ G    GA+ G                         A D GS + P
Sbjct  106   D-----------PIHG----GAAHGP------------------------APDPGSPHAP  126

Query  946   RCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKR  767
             RCQAEGC ADL+HAKHYHRRHKVCEFH+KA+TVIA GLTQRFCQQCSRFH+L EFDNGKR
Sbjct  127   RCQAEGCTADLSHAKHYHRRHKVCEFHSKASTVIANGLTQRFCQQCSRFHLLPEFDNGKR  186

Query  766   SCrrrladhnrrrrknpqqpnRETAFNNTHHLLDNAQNSSSDTLARspsdsgansspsvt  587
             SC RR    + RRR+  QQ N+E   +    L++NA+NSSSD +ARSP +S A+S+ SVT
Sbjct  187   SC-RRRLADHNRRRRKTQQTNQENHNSQVQQLVENARNSSSDNVARSPPESAAHSASSVT  245

Query  586   vavspPRMSIDCFGQR  539
             VA+SPPRM++DCF QR
Sbjct  246   VALSPPRMTLDCFRQR  261



>ref|XP_010497828.1| PREDICTED: squamosa promoter-binding-like protein 8, partial 
[Camelina sativa]
Length=96

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 83/95 (87%), Gaps = 4/95 (4%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN----TPRCQAEGCNADLT  911
             V+F+   +GLNLGGRTYFS+A+DDFV+RLYRRSR  ++G  N    TPRCQAEGCNADL+
Sbjct  2     VDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMGNSPLSTPRCQAEGCNADLS  61

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
             HAKHYHRRHKVCEFH+KA+TV+A GL+QRFCQQCS
Sbjct  62    HAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCS  96



>gb|KHN18030.1| Squamosa promoter-binding-like protein 8 [Glycine soja]
Length=91

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 3/91 (3%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF---NTPRCQAEGCNADLTH  908
             ++F G+ +GLN+GGRTYFSS+EDDFV+RLYRRSR V+ GS    N+PRCQAEGCNADL+ 
Sbjct  1     MDFVGSRIGLNMGGRTYFSSSEDDFVSRLYRRSRPVEPGSTILSNSPRCQAEGCNADLSQ  60

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
             AKHYH RHKVCEFH+KAAT+IA GLTQR CQ
Sbjct  61    AKHYHHRHKVCEFHSKAATIIAAGLTQRLCQ  91



>gb|KCW73148.1| hypothetical protein EUGRSUZ_E01600 [Eucalyptus grandis]
Length=257

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 89/122 (73%), Gaps = 18/122 (15%)
 Frame = -2

Query  1114  FVVVPKSE------PLGGVEFSGASLGLNLGGRTYFSS---AEDDFVNRLYRRS------  980
             F++VPKSE      P    E + A +GLNLGGRTYF+S   AEDDFV+RLYRR       
Sbjct  135   FLMVPKSEDATGARPSPAAELAAARIGLNLGGRTYFASSVAAEDDFVSRLYRRPSAGRAG  194

Query  979   ---RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
                  V + + N PRCQAEGCNADLTHAKHYHRRHKVCEFH+KAA VIAGGLTQRFCQQC
Sbjct  195   GEGGGVGSAAANAPRCQAEGCNADLTHAKHYHRRHKVCEFHSKAAAVIAGGLTQRFCQQC  254

Query  808   SR  803
             SR
Sbjct  255   SR  256



>ref|XP_010913684.1| PREDICTED: squamosa promoter-binding-like protein 10 isoform 
X2 [Elaeis guineensis]
Length=318

 Score =   149 bits (377),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             +GLNLG RTYFSS +   ++RL+ RSR + + +   PRCQAEGC ADL+ AKHYHRRHKV
Sbjct  117   IGLNLGHRTYFSSGDALAIDRLFARSRGMYSLNHQPPRCQAEGCKADLSGAKHYHRRHKV  176

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CEFH+KA  VIAGGL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  177   CEFHSKATVVIAGGLQQRFCQQCSRFHVLTEFDEAKRSC  215



>ref|XP_010913682.1| PREDICTED: squamosa promoter-binding-like protein 10 isoform 
X1 [Elaeis guineensis]
 ref|XP_010913683.1| PREDICTED: squamosa promoter-binding-like protein 10 isoform 
X1 [Elaeis guineensis]
Length=396

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             +GLNLG RTYFSS +   ++RL+ RSR + + +   PRCQAEGC ADL+ AKHYHRRHKV
Sbjct  117   IGLNLGHRTYFSSGDALAIDRLFARSRGMYSLNHQPPRCQAEGCKADLSGAKHYHRRHKV  176

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CEFH+KA  VIAGGL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  177   CEFHSKATVVIAGGLQQRFCQQCSRFHVLTEFDEAKRSC  215



>ref|XP_008781929.1| PREDICTED: squamosa promoter-binding-like protein 10 [Phoenix 
dactylifera]
Length=404

 Score =   151 bits (381),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  1060  SLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHK  881
             ++GLNLG RTYFSS +   ++RL+ RSR + + +   PRCQAEGC ADL+ AKHYHRRHK
Sbjct  118   TIGLNLGHRTYFSSGDALAIDRLFARSRGMYSLNHQPPRCQAEGCKADLSGAKHYHRRHK  177

Query  880   VCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             VCEFH+KA  VIAGGL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  178   VCEFHSKATVVIAGGLQQRFCQQCSRFHVLTEFDEAKRSC  217



>ref|XP_008775519.1| PREDICTED: squamosa promoter-binding-like protein 10 [Phoenix 
dactylifera]
Length=401

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             +GLNLG RTYFSS +   ++RL+ RSR V + S   PRCQAEGC ADL+ AKHYHRRHKV
Sbjct  122   IGLNLGHRTYFSSGDALAIDRLFARSREVYSLSHQPPRCQAEGCKADLSGAKHYHRRHKV  181

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CEFH+KA  VI GGL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  182   CEFHSKATVVITGGLQQRFCQQCSRFHVLAEFDAAKRSC  220



>ref|XP_010928678.1| PREDICTED: squamosa promoter-binding-like protein 10 [Elaeis 
guineensis]
Length=403

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             +GLNLG RTYFSS +   ++RL+ RSR + + S   PRCQAEGC ADL+ AKHYHRRHKV
Sbjct  121   IGLNLGHRTYFSSGDALAIDRLFARSRGLYSLSHQPPRCQAEGCKADLSGAKHYHRRHKV  180

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CEFHAKAA VI GGL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  181   CEFHAKAAVVITGGLHQRFCQQCSRFHVLAEFDATKRSC  219



>emb|CDY15132.1| BnaC05g00110D [Brassica napus]
Length=233

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 131/251 (52%), Gaps = 62/251 (25%)
 Frame = -2

Query  1471  MLDYEWGNQSATVMFSGDETAAAAQNHRQ----------FFDPYggqqtggfddaaaagG  1322
             MLDYEW N S  +M SG++ +    +HRQ           FDP            + +  
Sbjct  1     MLDYEWDNPSV-IMLSGEDRS----HHRQQEPDPTRVLSIFDP-------TQTHHSQSSY  48

Query  1321  SLVGPS--AHFAGADHLQLFHHHHPGEQAGQENSAHLCSLYDPRayg---gaaaaaAFQH  1157
             S   P   + F+   HL ++ H          N  H   +YD R        ++ + + H
Sbjct  49    SNTCPPLFSSFSNQQHLTVYGHQ-------TSNQFHPSFVYDSRTTNHLYAPSSDSIYGH  101

Query  1156  GSHQVPL-LSQEAAG------FVVVPKSE-----PLGGVEFSGASLGLNLGGRTYFSSAE  1013
               H       Q  +G        ++PK+E     PL   +F+   +GLNLGGRTYFS+A+
Sbjct  102   PHHSALFSFDQTWSGGSGSSYNFLIPKAEVDVSRPL---DFTSNRIGLNLGGRTYFSAAD  158

Query  1012  DDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGL  833
              DFV+RL             TPRCQAEGCNADL+HAKHYHRRHKVCEFH+KA+TV+A GL
Sbjct  159   GDFVSRL-------------TPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGL  205

Query  832   TQRFCQQCSRF  800
             +QRFCQQCSRF
Sbjct  206   SQRFCQQCSRF  216



>ref|XP_009408821.1| PREDICTED: squamosa promoter-binding-like protein 8 [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   147 bits (372),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -2

Query  1069  SGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHR  890
             SG  +GLNLG RTYFSS +   ++ L+ RSR V + S   PRCQAEGC ADL+ AKHYHR
Sbjct  102   SGGRIGLNLGQRTYFSSGDGLEMDHLFARSRGVYSLSHQPPRCQAEGCKADLSGAKHYHR  161

Query  889   RHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RHKVCEFH+KA  VIA GL QRFCQQCSRFH L+EFD  KRSC
Sbjct  162   RHKVCEFHSKATVVIAHGLQQRFCQQCSRFHALAEFDEAKRSC  204



>ref|XP_009408055.1| PREDICTED: squamosa promoter-binding-like protein 10 [Musa acuminata 
subsp. malaccensis]
Length=343

 Score =   145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 90/133 (68%), Gaps = 6/133 (5%)
 Frame = -2

Query  1141  PLLSQEAAGFVVVPKSE-PLGGVEFS-GAS----LGLNLGGRTYFSSAEDDFVNRLYRRS  980
             PL+   +  F   P  E P+G V+   G S    +GLNLG RTYFSS +   ++RL  RS
Sbjct  57    PLVPTNSFHFFSPPPPEYPIGLVKMDDGGSGCGRIGLNLGHRTYFSSGDALAMDRLLARS  116

Query  979   RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRF  800
               + + S + PRCQAEGC  DL+ AKHYHRRHKVCE H+KA  V+ GGL QRFCQQCSRF
Sbjct  117   SGMHSLSSHQPRCQAEGCKTDLSGAKHYHRRHKVCELHSKATVVVVGGLQQRFCQQCSRF  176

Query  799   HVLSEFDNGKRSC  761
             HVL+EFD  KRSC
Sbjct  177   HVLAEFDKAKRSC  189



>gb|AGI62063.1| SQUAMOSA promoter-binding-like 15 [Erycina pusilla]
Length=339

 Score =   142 bits (358),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 87/131 (66%), Gaps = 10/131 (8%)
 Frame = -2

Query  1144  VPLLSQEAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSS---AEDDFVNRLYRRSRA  974
             V L S  A+G +  P    +     +   +GLNLG RTYFSS   AE+    R+ RR   
Sbjct  43    VDLFSPTASGGMFSPAGLGMPTAVAAPTRIGLNLGVRTYFSSGSHAEEAGAGRVCRRR--  100

Query  973   VDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHV  794
                      RCQAEGC ADL+HAKHYHRRHKVCEFH+KA+ VIA GL+QRFCQQCSRFHV
Sbjct  101   -----VRIARCQAEGCGADLSHAKHYHRRHKVCEFHSKASIVIAAGLSQRFCQQCSRFHV  155

Query  793   LSEFDNGKRSC  761
             LSEFD GKRSC
Sbjct  156   LSEFDQGKRSC  166



>ref|XP_006845685.1| hypothetical protein AMTR_s00019p00235390 [Amborella trichopoda]
 gb|ERN07360.1| hypothetical protein AMTR_s00019p00235390 [Amborella trichopoda]
Length=248

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             LGLNLG RTYFSS++   + R  R SR +  G    PRCQAEGC  DLT+AKHYHRRHKV
Sbjct  6     LGLNLGQRTYFSSSDGGVIVR--RNSRGLFGGPV-VPRCQAEGCGNDLTNAKHYHRRHKV  62

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CEFH+KA  VIA GL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  63    CEFHSKATRVIANGLEQRFCQQCSRFHVLAEFDEVKRSC  101



>gb|EMT31506.1| Squamosa promoter-binding-like protein 5 [Aegilops tauschii]
Length=379

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 88/135 (65%), Gaps = 15/135 (11%)
 Frame = -2

Query  1123  AAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF----  956
             +AGF+   +  P   V   G  +GLNLG RTYFS A+   V+RL  RSR   AG+     
Sbjct  120   SAGFLKREEGGPFSDVG-GGGRIGLNLGRRTYFSPADVLAVDRLLMRSRFGGAGAMGMLG  178

Query  955   ----------NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
                        TPRCQAEGC ADL+ AKHYHRRHKVCE+HAKAATV A G  QRFCQQCS
Sbjct  179   LGLGAAAHQHQTPRCQAEGCKADLSAAKHYHRRHKVCEYHAKAATVAASGKQQRFCQQCS  238

Query  805   RFHVLSEFDNGKRSC  761
             RFHVL+EFD  KRSC
Sbjct  239   RFHVLAEFDEAKRSC  253



>gb|AHW57567.1| squamosa promoter-binding-like protein 21 [Triticum aestivum]
Length=452

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 88/135 (65%), Gaps = 15/135 (11%)
 Frame = -2

Query  1123  AAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF----  956
             +AGF+   +  P   V   G  +GLNLG RTYFS A+   V+RL  RSR   AG+     
Sbjct  130   SAGFLKREEGGPFSDVG-GGGRIGLNLGRRTYFSPADVLAVDRLLMRSRFGGAGAMGMLG  188

Query  955   ----------NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
                        TPRCQAEGC ADL+ AKHYHRRHKVCE+HAKAATV A G  QRFCQQCS
Sbjct  189   LGLGAAAHQHQTPRCQAEGCKADLSAAKHYHRRHKVCEYHAKAATVAASGKQQRFCQQCS  248

Query  805   RFHVLSEFDNGKRSC  761
             RFHVL+EFD  KRSC
Sbjct  249   RFHVLAEFDEAKRSC  263



>ref|XP_006418484.1| hypothetical protein EUTSA_v10008083mg, partial [Eutrema salsugineum]
 gb|ESQ36837.1| hypothetical protein EUTSA_v10008083mg, partial [Eutrema salsugineum]
Length=173

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -2

Query  997  RLYRRSRAVDAG-SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRF  821
            RLYRRSR  + G S +TPRCQAEGCNADL+HAKHY RRHKV EFH+KA+TV+A GL+QRF
Sbjct  1    RLYRRSRPGELGNSLSTPRCQAEGCNADLSHAKHYPRRHKVWEFHSKASTVVAAGLSQRF  60

Query  820  CQQCSRFHVLSEFDNGKRSC  761
             QQCSRFH+LSEFDNGKRSC
Sbjct  61   SQQCSRFHLLSEFDNGKRSC  80



>gb|ABM67301.1| SBP-domain protein 7 [Physcomitrella patens]
Length=575

 Score =   142 bits (358),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ ED   NRL +R RA   G  + P CQAEGC +DL+ AK YHRRH
Sbjct  105   ARIGLNLGVRTYFST-EDTTTNRLVKRHRAGSPGP-HIPLCQAEGCKSDLSTAKQYHRRH  162

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE H+KA  V+AGG TQRFCQQCSRFH L EFD+GKRSC
Sbjct  163   KVCELHSKAPNVVAGGQTQRFCQQCSRFHSLGEFDDGKRSC  203



>emb|CAI91303.1| squamosa promoter binding protein 1 [Physcomitrella patens]
Length=619

 Score =   142 bits (358),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ ED  V RL +R RA   G F  P CQAEGC  DL++AKHYHRRH
Sbjct  180   ARIGLNLGVRTYFST-EDTAVGRLGKRHRAGSPG-FQVPVCQAEGCKDDLSNAKHYHRRH  237

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE H+KA TV  GG TQRFCQQCSRFH L EFD GKRSC
Sbjct  238   KVCELHSKAPTVTVGGHTQRFCQQCSRFHHLGEFDEGKRSC  278



>ref|XP_004965676.1| PREDICTED: squamosa promoter-binding-like protein 10-like [Setaria 
italica]
Length=410

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 81/119 (68%), Gaps = 11/119 (9%)
 Frame = -2

Query  1084  GGVEFSGAS----LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQ  938
             GGV   GA+    +GLNLG RTYFS  +   V+RL  RSR      F         PRCQ
Sbjct  122   GGVGADGATAAGRIGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGFGFGGAHHQPPRCQ  181

Query  937   AEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AEGC ADL+ AKHYHRRHKVCE+HAKA+ V AGG  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  182   AEGCKADLSGAKHYHRRHKVCEYHAKASVVAAGGKQQRFCQQCSRFHVLTEFDEAKRSC  240



>gb|KHN34486.1| Squamosa promoter-binding-like protein 8 [Glycine soja]
Length=214

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -2

Query  955  NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDN  776
            N+PRCQAEGCNADL+ AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSEFDN
Sbjct  71   NSPRCQAEGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDN  130

Query  775  GKRSC  761
            GKRSC
Sbjct  131  GKRSC  135



>ref|XP_001769751.1| predicted protein [Physcomitrella patens]
 gb|EDQ65313.1| predicted protein [Physcomitrella patens]
Length=840

 Score =   142 bits (358),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ ED  V RL +R RA   G F  P CQAEGC  DL++AKHYHRRH
Sbjct  334   ARIGLNLGVRTYFST-EDTAVGRLGKRHRAGSPG-FQVPVCQAEGCKDDLSNAKHYHRRH  391

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE H+KA TV  GG TQRFCQQCSRFH L EFD GKRSC
Sbjct  392   KVCELHSKAPTVTVGGHTQRFCQQCSRFHHLGEFDEGKRSC  432



>ref|XP_001779155.1| predicted protein [Physcomitrella patens]
 gb|EDQ56001.1| predicted protein [Physcomitrella patens]
Length=892

 Score =   142 bits (357),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ ED   NRL +R RA   G  + P CQAEGC +DL+ AK YHRRH
Sbjct  395   ARIGLNLGVRTYFST-EDTTTNRLVKRHRAGSPGP-HIPLCQAEGCKSDLSTAKQYHRRH  452

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE H+KA  V+AGG TQRFCQQCSRFH L EFD+GKRSC
Sbjct  453   KVCELHSKAPNVVAGGQTQRFCQQCSRFHSLGEFDDGKRSC  493



>ref|XP_006656320.1| PREDICTED: squamosa promoter-binding-like protein 10-like [Oryza 
brachyantha]
Length=425

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 74/106 (70%), Gaps = 7/106 (7%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+RL  RSR                PRCQAEGC ADL+ AKH
Sbjct  123   IGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKH  182

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKA+ V AGG  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  183   YHRRHKVCEYHAKASVVAAGGKQQRFCQQCSRFHVLTEFDEAKRSC  228



>ref|XP_001775629.1| predicted protein [Physcomitrella patens]
 gb|EDQ59576.1| predicted protein [Physcomitrella patens]
Length=726

 Score =   140 bits (353),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ E+   NRL +R RA   GS   P CQAEGC  DL+ AK YHRRH
Sbjct  201   ARIGLNLGVRTYFST-EETATNRLGKRHRAGSPGSI-APMCQAEGCKFDLSLAKPYHRRH  258

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE H+KA  VIAGG TQRFCQQCSRFH L EFD+GKRSC
Sbjct  259   KVCELHSKAPNVIAGGQTQRFCQQCSRFHSLGEFDDGKRSC  299



>ref|XP_002437398.1| hypothetical protein SORBIDRAFT_10g026200 [Sorghum bicolor]
 gb|EER88765.1| hypothetical protein SORBIDRAFT_10g026200 [Sorghum bicolor]
Length=444

 Score =   137 bits (345),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 74/106 (70%), Gaps = 7/106 (7%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+RL  RSR                PRCQAEGC ADL+ AKH
Sbjct  150   IGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKH  209

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKA+ V AGG  QRFCQQCSRFHVLSEFD  KRSC
Sbjct  210   YHRRHKVCEYHAKASVVAAGGKQQRFCQQCSRFHVLSEFDEVKRSC  255



>ref|XP_009398934.1| PREDICTED: squamosa promoter-binding-like protein 8 [Musa acuminata 
subsp. malaccensis]
Length=328

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 79/114 (69%), Gaps = 14/114 (12%)
 Frame = -2

Query  1081  GVEFSG--ASLGLNLGGRTYFSSAEDD-----FVNRLYRRSRAVDAGSFNTPRCQAEGCN  923
             G+EF    A +GLNLG RTYFSSA           R+ RR   +        RCQAEGC+
Sbjct  81    GMEFPPLPARIGLNLGVRTYFSSASPADGGGVVTGRVCRRRTRIA-------RCQAEGCS  133

Query  922   ADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              +LTHAKHYHRRHKVCEFH+KA+ V   GL+QRFCQQCSRFHVL+EFD GKRSC
Sbjct  134   MELTHAKHYHRRHKVCEFHSKASVVNVAGLSQRFCQQCSRFHVLTEFDQGKRSC  187



>ref|XP_009398983.1| PREDICTED: squamosa promoter-binding-like protein 10 [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = -2

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
             V++ + +  GG       +GLNLG RTYFSS +   ++    RS   +    + PRCQAE
Sbjct  90    VLIKREDGTGGC----GRIGLNLGHRTYFSSGDALAIDWQLSRSTLNN----HQPRCQAE  141

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             GC ADL+ AKHYHRRH+VCEFH+KA  VI GGL QRFCQQCSRFHVL+EFD  KRSC
Sbjct  142   GCKADLSGAKHYHRRHRVCEFHSKATVVIVGGLQQRFCQQCSRFHVLAEFDEAKRSC  198



>ref|XP_003560391.1| PREDICTED: squamosa promoter-binding-like protein 10 [Brachypodium 
distachyon]
Length=416

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 76/114 (67%), Gaps = 12/114 (11%)
 Frame = -2

Query  1066  GASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF------------NTPRCQAEGCN  923
             G ++GLNLG RTYFS  +   V+RL  RSR                     PRCQAEGC 
Sbjct  117   GRNIGLNLGRRTYFSPGDMMAVDRLLMRSRLGGVFGLGFGGPGGHGHHHQPPRCQAEGCK  176

Query  922   ADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             ADL+ AKHYHRRHKVCE+HAKA+ V AGG  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  177   ADLSGAKHYHRRHKVCEYHAKASLVSAGGKHQRFCQQCSRFHVLTEFDEAKRSC  230



>ref|NP_001058261.1| Os06g0659100 [Oryza sativa Japonica Group]
 sp|Q0DAE8.1|SPL10_ORYSJ RecName: Full=Squamosa promoter-binding-like protein 10 [Oryza 
sativa Japonica Group]
 sp|A2YFT9.1|SPL10_ORYSI RecName: Full=Squamosa promoter-binding-like protein 10 [Oryza 
sativa Indica Group]
 dbj|BAF20175.1| Os06g0659100 [Oryza sativa Japonica Group]
 gb|EAZ01950.1| hypothetical protein OsI_23977 [Oryza sativa Indica Group]
Length=426

 Score =   134 bits (338),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+RL  RSR                PRCQAEGC ADL+ AKH
Sbjct  136   IGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKH  195

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  196   YHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSC  241



>gb|AHW57571.1| squamosa promoter-binding-like protein 22 [Triticum aestivum]
Length=416

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+RL  RSR                PRCQAEGC ADL+ AKH
Sbjct  132   IGLNLGRRTYFSPGDMMAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKH  191

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  192   YHRRHKVCEYHAKASLVAAAGKQQRFCQQCSRFHVLTEFDEAKRSC  237



>gb|EEE66160.1| hypothetical protein OsJ_22229 [Oryza sativa Japonica Group]
Length=453

 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+RL  RSR                PRCQAEGC ADL+ AKH
Sbjct  136   IGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKH  195

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  196   YHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSC  241



>ref|XP_009389111.1| PREDICTED: squamosa promoter-binding-like protein 8 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 71/101 (70%), Gaps = 5/101 (5%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS AE+  V       R          RCQAEGC  DLTHAKHYHRRH
Sbjct  87    ARIGLNLGVRTYFSPAEEASVVVGRVCRRRTRIA-----RCQAEGCGIDLTHAKHYHRRH  141

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCEFH+KA+  I  GL+QRFCQQCSRFH L+EFD GKRSC
Sbjct  142   KVCEFHSKASIAIVAGLSQRFCQQCSRFHALTEFDQGKRSC  182



>ref|XP_009391170.1| PREDICTED: squamosa promoter-binding-like protein 10 [Musa acuminata 
subsp. malaccensis]
Length=323

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 71/102 (70%), Gaps = 7/102 (7%)
 Frame = -2

Query  1066  GASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRR  887
             G  +GLNLG RTYFSS E          +R V + S   PRCQAEGC  DL+ AKHYHRR
Sbjct  102   GGRIGLNLGRRTYFSSGES-------LTTRGVYSLSHQPPRCQAEGCRTDLSGAKHYHRR  154

Query  886   HKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             H+VCEFH+KA  V+ GG  QRFCQQCSRFH L+EFD  KRSC
Sbjct  155   HRVCEFHSKATVVVVGGSQQRFCQQCSRFHGLAEFDEAKRSC  196



>ref|XP_002451645.1| hypothetical protein SORBIDRAFT_04g005180 [Sorghum bicolor]
 gb|EES04621.1| hypothetical protein SORBIDRAFT_04g005180 [Sorghum bicolor]
Length=445

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 78/132 (59%), Gaps = 22/132 (17%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF---------------  956
             PL     SG  +GLNLG RTYFS A+   V+RL  RSR                      
Sbjct  134   PLVDAGGSGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLGGGVGVGMGMGLGMGVLGLGL  193

Query  955   -------NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFH  797
                      P+CQAEGC ADL+ AKHYHRRHKVCE+HAKA +V A G  QRFCQQCSRFH
Sbjct  194   GAAHHHHQPPKCQAEGCKADLSAAKHYHRRHKVCEYHAKAGSVAAAGKQQRFCQQCSRFH  253

Query  796   VLSEFDNGKRSC  761
             VL+EFD  KRSC
Sbjct  254   VLAEFDEAKRSC  265



>gb|ACF78942.1| unknown [Zea mays]
 gb|ACF79303.1| unknown [Zea mays]
 gb|ACN31588.1| unknown [Zea mays]
Length=424

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVD--------AGSFNTPRCQAEGCNADLTHAKHY  896
             LNLG RTYFS  +   V+RL  RSR           A     PRCQAEGC ADL+ AKHY
Sbjct  135   LNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHQHQVPRCQAEGCKADLSGAKHY  194

Query  895   HRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             HRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVLSEFD  KRSC
Sbjct  195   HRRHKVCEYHAKASVVAANGKQQRFCQQCSRFHVLSEFDEVKRSC  239



>ref|NP_001105656.1| SBP-domain protein4 [Zea mays]
 emb|CAB56630.1| SBP-domain protein 4 [Zea mays]
Length=424

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 72/105 (69%), Gaps = 8/105 (8%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVD--------AGSFNTPRCQAEGCNADLTHAKHY  896
             LNLG RTYFS  +   V+RL  RSR           A     PRCQAEGC ADL+ AKHY
Sbjct  135   LNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHQHQVPRCQAEGCKADLSGAKHY  194

Query  895   HRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             HRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVLSEFD  KRSC
Sbjct  195   HRRHKVCEYHAKASVVAANGKQQRFCQQCSRFHVLSEFDEVKRSC  239



>gb|AFW76141.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
Length=434

 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 79/129 (61%), Gaps = 20/129 (16%)
 Frame = -2

Query  1087  LGGVEFSGAS----LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT----------  950
             LG V+  G      +GLNLG RTYFS  +   V+RL  RSR    G              
Sbjct  125   LGMVKREGGGADGRIGLNLGRRTYFSPGDMMAVDRLLMRSRLGGGGGAFGLGFGFGFGGA  184

Query  949   ------PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLS  788
                   PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V  GG  QRFCQQCSRFHVLS
Sbjct  185   HHLQAPPRCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVATGGKQQRFCQQCSRFHVLS  244

Query  787   EFDNGKRSC  761
             EFD  KRSC
Sbjct  245   EFDEVKRSC  253



>gb|EMS47142.1| Squamosa promoter-binding-like protein 10 [Triticum urartu]
Length=406

 Score =   131 bits (329),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = -2

Query  1084  GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGC  926
             GG       +GLNLG RTYFS  +   V+R+  RSR                PRCQ E C
Sbjct  117   GGGAGDAGRIGLNLGRRTYFSPGDMMAVDRMLMRSRLGGVFGLGFGRAHHQAPRCQVEDC  176

Query  925   NADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  177   KADLSGAKHYHRRHKVCEYHAKASLVAAAGKQQRFCQQCSRFHVLTEFDEAKRSC  231



>emb|CAI91302.1| squamosa promoter binding protein 4 [Physcomitrella patens]
Length=507

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ E+   + L +R R    GS   P CQAEGC  DL+ +K YHRRH
Sbjct  15    ARIGLNLGVRTYFST-EETAASGLGKRHRTGSPGS-QVPTCQAEGCKTDLSTSKQYHRRH  72

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE H+KA  V  GG TQRFCQQCSRFH L EFDNGKRSC
Sbjct  73    KVCELHSKAPNVQVGGQTQRFCQQCSRFHSLEEFDNGKRSC  113



>gb|AHW57563.1| squamosa promoter-binding-like protein 20 [Triticum aestivum]
Length=388

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 9/118 (8%)
 Frame = -2

Query  1087  LGGVEFSG--ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQA  935
             +G V+  G    +GLNLG RTYFS  +   V+R+  RSR                PRCQ 
Sbjct  110   MGMVKREGDAGRIGLNLGRRTYFSPGDMMAVDRVLMRSRLGGVFGLGFGRGHHQAPRCQV  169

Query  934   EGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             E C ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  170   EDCRADLSGAKHYHRRHKVCEYHAKASLVSAAGKQQRFCQQCSRFHVLTEFDEAKRSC  227



>ref|XP_001761751.1| predicted protein [Physcomitrella patens]
 gb|EDQ73507.1| predicted protein [Physcomitrella patens]
Length=730

 Score =   132 bits (333),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             +GLNLG RTYFS+ E   V  L +R  A   GS   P CQAEGC ADL+ AK YHRRHKV
Sbjct  250   IGLNLGVRTYFSTKET--VANLGKRPTAGSPGS-QVPMCQAEGCKADLSQAKQYHRRHKV  306

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CE H+KA  V+A G TQRFCQQCSRFH+L EFD+GKRSC
Sbjct  307   CEHHSKALNVVANGQTQRFCQQCSRFHLLGEFDDGKRSC  345



>ref|XP_010934135.1| PREDICTED: squamosa promoter-binding-like protein 5 [Elaeis guineensis]
Length=364

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 74/103 (72%), Gaps = 8/103 (8%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSA--EDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHR  890
             A +GLNLG RTYFSS   ED  V     R R   A        QAEGC ADLTHAKHYHR
Sbjct  88    ARIGLNLGVRTYFSSTSPEDQMVVGRVCRRRTRTARC------QAEGCGADLTHAKHYHR  141

Query  889   RHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RHKVCEFH+KA+ VI  GL+QRFCQQCSRFHVL+EFD GKRSC
Sbjct  142   RHKVCEFHSKASIVITAGLSQRFCQQCSRFHVLAEFDQGKRSC  184



>dbj|BAK07638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+R+  RSR                PRCQ E C ADL+ AKH
Sbjct  130   IGLNLGRRTYFSPGDMMAVDRVLMRSRLGGVFGLGFGRAHQQAPRCQVEDCKADLSGAKH  189

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKAA V   G  QRFCQQCSRFHVL EFD  KRSC
Sbjct  190   YHRRHKVCEYHAKAALVSTAGKQQRFCQQCSRFHVLMEFDEAKRSC  235



>ref|XP_010919591.1| PREDICTED: squamosa promoter-binding-like protein 8 [Elaeis guineensis]
Length=367

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFSSA  +    + R  R     +      QAEGC ADLTHAKHYHRRH
Sbjct  83    ARIGLNLGVRTYFSSASPEEEMAVGRVCRRRTRTARC----QAEGCGADLTHAKHYHRRH  138

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCEFH+KA+ VI  GL+QRFCQQCSRFHVL+EFD GKRSC
Sbjct  139   KVCEFHSKASIVITAGLSQRFCQQCSRFHVLAEFDQGKRSC  179



>ref|XP_008802805.1| PREDICTED: squamosa promoter-binding-like protein 8 [Phoenix 
dactylifera]
Length=364

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 74/101 (73%), Gaps = 4/101 (4%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFSSA  +    + R  R     +      QAEGC ADLTHAKHYHRRH
Sbjct  83    ARIGLNLGVRTYFSSASPEEEMAVGRVCRRRTRTARC----QAEGCAADLTHAKHYHRRH  138

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCEFH+KA+ VI  GL+QRFCQQCSRFHVL+EFD GKRSC
Sbjct  139   KVCEFHSKASIVITAGLSQRFCQQCSRFHVLAEFDQGKRSC  179



>ref|NP_001105116.1| SBP-domain protein3 [Zea mays]
 emb|CAB56629.1| SBP-domain protein 3 [Zea mays]
Length=435

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 78/129 (60%), Gaps = 20/129 (16%)
 Frame = -2

Query  1087  LGGVEFSGAS----LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT----------  950
             LG V+  G      +GLNLG RTYFS  +   V+RL  RSR    G              
Sbjct  127   LGMVKREGGGADGRIGLNLGRRTYFSPGDMMAVDRLLMRSRLGGGGGAFGLGFGFGFGGA  186

Query  949   ------PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLS  788
                    RCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V  GG  QRFCQQCSRFHVLS
Sbjct  187   HHQAPPARCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVATGGKQQRFCQQCSRFHVLS  246

Query  787   EFDNGKRSC  761
             EFD  KRSC
Sbjct  247   EFDEVKRSC  255



>ref|XP_006838199.1| hypothetical protein AMTR_s00106p00144050 [Amborella trichopoda]
 gb|ERN00768.1| hypothetical protein AMTR_s00106p00144050 [Amborella trichopoda]
Length=278

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 75/104 (72%), Gaps = 8/104 (8%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+    GLNLGGR YF   E    N  ++RS  V  G+    RCQ +GC  DL+ AK+YH
Sbjct  112   FTRDRFGLNLGGRIYFPEIE----NEEFQRSYQVSCGA----RCQIDGCGVDLSTAKNYH  163

Query  892   RRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCEFH+KA++V+AGG  +RFCQQCSRFH LSEFD+GKRSC
Sbjct  164   RRHKVCEFHSKASSVVAGGHKKRFCQQCSRFHELSEFDHGKRSC  207



>ref|XP_008796149.1| PREDICTED: squamosa promoter-binding-like protein 10 [Phoenix 
dactylifera]
Length=366

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 75/103 (73%), Gaps = 8/103 (8%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSA--EDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHR  890
             A +GLNLG RTYFSSA  E+D V     R R   A        QAEGC ADLTHAKHYHR
Sbjct  87    ARIGLNLGVRTYFSSASPEEDMVVGRVCRRRTRTARC------QAEGCGADLTHAKHYHR  140

Query  889   RHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RHKVCEFH+KA+ VI  G +QRFCQQCSRFHVL+EFD GKRSC
Sbjct  141   RHKVCEFHSKASVVIIAGHSQRFCQQCSRFHVLAEFDQGKRSC  183



>ref|XP_001782674.1| predicted protein [Physcomitrella patens]
 gb|EDQ52505.1| predicted protein [Physcomitrella patens]
Length=682

 Score =   129 bits (325),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = -2

Query  1075  EFSGASL----------GLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGC  926
             EFS AS+           LNLG RTYFS+ +D  V RL +R R    GS   P CQAEGC
Sbjct  101   EFSAASMHDHHIKREKIVLNLGVRTYFSN-QDAAVGRLSKRHRVGSPGS-QLPTCQAEGC  158

Query  925   NADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              ADL   K+Y+RRHKVCEFH+K   VI GG TQRFCQQCSRFH L EFD+GKRSC
Sbjct  159   KADLNVTKNYYRRHKVCEFHSKTPIVIVGGHTQRFCQQCSRFHRLGEFDDGKRSC  213



>gb|ABM67304.1| SBP-domain protein 12 [Physcomitrella patens]
Length=420

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             +GLNLG RTYFS+ E   V  L +R  A   GS   P CQA+GC ADL+ AK YHRRHKV
Sbjct  186   IGLNLGVRTYFSTKE--TVANLGKRPTAGSPGS-QVPMCQAKGCKADLSLAKQYHRRHKV  242

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CE H+KA  V+A G TQRFC QCSRFH+L EFD+GKR+C
Sbjct  243   CEHHSKALNVVANGQTQRFCLQCSRFHLLGEFDDGKRTC  281



>dbj|BAD38344.1| putative SBP-domain protein [Oryza sativa Japonica Group]
Length=439

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 73/119 (61%), Gaps = 20/119 (17%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKH  899
             +GLNLG RTYFS  +   V+RL  RSR                PRCQAEGC ADL+ AKH
Sbjct  136   IGLNLGRRTYFSPGDMLAVDRLLMRSRLGGVFGLGFGGAHHQPPRCQAEGCKADLSGAKH  195

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCS-------------RFHVLSEFDNGKRSC  761
             YHRRHKVCE+HAKA+ V A G  QRFCQQCS             RFHVL+EFD  KRSC
Sbjct  196   YHRRHKVCEYHAKASVVAASGKQQRFCQQCSRIVTLWVYVHVLDRFHVLTEFDEAKRSC  254



>ref|XP_009397654.1| PREDICTED: squamosa promoter-binding-like protein 10 [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS AE+  +       R     +       AEGC  DL HAKHYHRRH
Sbjct  89    ARIGLNLGVRTYFSPAEEAGIVVGRVCRRRRAHAARCQ----AEGCGIDLAHAKHYHRRH  144

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCEFH+KA+ VI  GL+QRFCQQCSRFHVL EFD GKRSC
Sbjct  145   KVCEFHSKASIVIVAGLSQRFCQQCSRFHVLMEFDQGKRSC  185



>ref|NP_001106077.1| SBP-domain protein1 [Zea mays]
 emb|CAB56627.1| SBP-domain protein 1 [Zea mays]
Length=440

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 78/131 (60%), Gaps = 21/131 (16%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN--------------  953
             PL      G  +GLNLG RTYFS A+   V+RL  RSR    G                 
Sbjct  141   PLVDAAGGGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLAGGGVGVGLGMGLGMGVLGLG  200

Query  952   -------TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHV  794
                     PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHV
Sbjct  201   AAHHQQPPPRCQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSRFHV  260

Query  793   LSEFDNGKRSC  761
             L+EFD  KRSC
Sbjct  261   LAEFDEAKRSC  271



>gb|AFW70372.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
Length=440

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 78/131 (60%), Gaps = 21/131 (16%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN--------------  953
             PL      G  +GLNLG RTYFS A+   V+RL  RSR    G                 
Sbjct  141   PLVDAAGGGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLAGGGVGVGLGMGLGMGVLGLG  200

Query  952   -------TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHV  794
                     PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHV
Sbjct  201   AAHHQQPPPRCQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSRFHV  260

Query  793   LSEFDNGKRSC  761
             L+EFD  KRSC
Sbjct  261   LAEFDEAKRSC  271



>gb|ACG39009.1| SBP-domain protein 1 [Zea mays]
 gb|AFW70371.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
 gb|AIB05500.1| SBP transcription factor, partial [Zea mays]
Length=441

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 78/131 (60%), Gaps = 21/131 (16%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN--------------  953
             PL      G  +GLNLG RTYFS A+   V+RL  RSR    G                 
Sbjct  141   PLVDAAGGGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLAGGGVGVGLGMGLGMGVLGLG  200

Query  952   -------TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHV  794
                     PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHV
Sbjct  201   AAHHQQPPPRCQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSRFHV  260

Query  793   LSEFDNGKRSC  761
             L+EFD  KRSC
Sbjct  261   LAEFDEAKRSC  271



>gb|KHN01962.1| Squamosa promoter-binding-like protein 8 [Glycine soja]
Length=238

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -2

Query  934  EGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
            EGCNADL+ AKHYHRRHKVCEFH+KAATVIA GLTQRFCQQCSRFH+LSEFDNGKRSC
Sbjct  64   EGCNADLSQAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRSC  121



>ref|XP_008680933.1| PREDICTED: SBP-domain protein1 isoform X2 [Zea mays]
Length=505

 Score =   123 bits (309),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 78/131 (60%), Gaps = 21/131 (16%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN--------------  953
             PL      G  +GLNLG RTYFS A+   V+RL  RSR    G                 
Sbjct  205   PLVDAAGGGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLAGGGVGVGLGMGLGMGVLGLG  264

Query  952   -------TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHV  794
                     PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQCSRFHV
Sbjct  265   AAHHQQPPPRCQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSRFHV  324

Query  793   LSEFDNGKRSC  761
             L+EFD  KRSC
Sbjct  325   LAEFDEAKRSC  335



>ref|XP_003571005.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brachypodium 
distachyon]
Length=384

 Score =   121 bits (304),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 75/113 (66%), Gaps = 14/113 (12%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF--------------NTPRCQAEGCNA  920
             +GLNLG RTYFS A+   V+RL  R+R    G                  PRCQAEGC A
Sbjct  69    IGLNLGRRTYFSPADVLAVDRLLMRTRGGLGGGGMGVLGLGLGGGIMQQPPRCQAEGCKA  128

Query  919   DLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             DL+ AKHYHRRHKVCE+HAKAA V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  129   DLSAAKHYHRRHKVCEYHAKAAAVAANGKQQRFCQQCSRFHVLAEFDEAKRSC  181



>ref|XP_004951719.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X1 [Setaria italica]
Length=429

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 77/122 (63%), Gaps = 22/122 (18%)
 Frame = -2

Query  1060  SLGLNLGGRTYFSSAEDDFVNRLYRRS-RAVDAGSF---------------------NTP  947
             ++GLNLG RTYFS A+   V+RL  RS R VD                           P
Sbjct  141   TIGLNLGRRTYFSPADVLAVDRLLTRSARLVDGVGMGMGLGMGVLGLGLGAAHHHQQQPP  200

Query  946   RCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKR  767
             RCQAEGC ADL+ AKHYHRRHKVCEFHAKAA V A G  QRFCQQCSRFHVL+EFD  KR
Sbjct  201   RCQAEGCKADLSAAKHYHRRHKVCEFHAKAAAVAAAGKQQRFCQQCSRFHVLAEFDEAKR  260

Query  766   SC  761
             SC
Sbjct  261   SC  262



>ref|XP_004951720.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X2 [Setaria italica]
Length=430

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 77/122 (63%), Gaps = 22/122 (18%)
 Frame = -2

Query  1060  SLGLNLGGRTYFSSAEDDFVNRLYRRS-RAVDAGSF---------------------NTP  947
             ++GLNLG RTYFS A+   V+RL  RS R VD                           P
Sbjct  141   TIGLNLGRRTYFSPADVLAVDRLLTRSARLVDGVGMGMGLGMGVLGLGLGAAHHHQQQPP  200

Query  946   RCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKR  767
             RCQAEGC ADL+ AKHYHRRHKVCEFHAKAA V A G  QRFCQQCSRFHVL+EFD  KR
Sbjct  201   RCQAEGCKADLSAAKHYHRRHKVCEFHAKAAAVAAAGKQQRFCQQCSRFHVLAEFDEAKR  260

Query  766   SC  761
             SC
Sbjct  261   SC  262



>ref|XP_002991886.1| hypothetical protein SELMODRAFT_7674, partial [Selaginella moellendorffii]
 gb|EFJ06997.1| hypothetical protein SELMODRAFT_7674, partial [Selaginella moellendorffii]
Length=87

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -2

Query  985  RSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
            R RA   G+   P CQAEGC ADL+ AKHYHRRHKVCE H+KAATV A G TQRFCQQCS
Sbjct  1    RPRANSPGA-QVPLCQAEGCKADLSGAKHYHRRHKVCELHSKAATVTANGQTQRFCQQCS  59

Query  805  RFHVLSEFDNGKRSC  761
            RFH LSEFD GKRSC
Sbjct  60   RFHPLSEFDEGKRSC  74



>ref|XP_002980130.1| hypothetical protein SELMODRAFT_17777, partial [Selaginella moellendorffii]
 gb|EFJ19000.1| hypothetical protein SELMODRAFT_17777, partial [Selaginella moellendorffii]
Length=96

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  955  NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDN  776
              P CQAEGC ADL+ AKHYHRRHKVCE H+KAATV A G TQRFCQQCSRFH LSEFD 
Sbjct  3    QVPLCQAEGCKADLSGAKHYHRRHKVCELHSKAATVTANGQTQRFCQQCSRFHPLSEFDE  62

Query  775  GKRSC  761
            GKRSC
Sbjct  63   GKRSC  67



>gb|AFW66312.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
Length=404

 Score =   120 bits (300),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 66/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF------------NTPRCQAEGCNADLTH  908
             LNLG RTYF+ A  D +         +                   PRCQAEGC ADL+ 
Sbjct  155   LNLGRRTYFTPAAVDRLLGGGLGGVGLGMSVLGLGVGAAHHHQQQPPRCQAEGCKADLSA  214

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AKHYHRRHKVCEFH KA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  215   AKHYHRRHKVCEFHTKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKRSC  263



>gb|AFW66313.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
Length=405

 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 66/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF------------NTPRCQAEGCNADLTH  908
             LNLG RTYF+ A  D +         +                   PRCQAEGC ADL+ 
Sbjct  155   LNLGRRTYFTPAAVDRLLGGGLGGVGLGMSVLGLGVGAAHHHQQQPPRCQAEGCKADLSA  214

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AKHYHRRHKVCEFH KA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  215   AKHYHRRHKVCEFHTKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKRSC  263



>ref|NP_001132280.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
 gb|ACF81063.1| unknown [Zea mays]
 gb|AFW66314.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
Length=406

 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 66/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF------------NTPRCQAEGCNADLTH  908
             LNLG RTYF+ A  D +         +                   PRCQAEGC ADL+ 
Sbjct  155   LNLGRRTYFTPAAVDRLLGGGLGGVGLGMSVLGLGVGAAHHHQQQPPRCQAEGCKADLSA  214

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AKHYHRRHKVCEFH KA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  215   AKHYHRRHKVCEFHTKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKRSC  263



>gb|ACG32386.1| hypothetical protein [Zea mays]
Length=404

 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 66/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSF------------NTPRCQAEGCNADLTH  908
             LNLG RTYF+ A  D +         +                   PRCQAEGC ADL+ 
Sbjct  153   LNLGRRTYFTPAAVDRLLGGGLGGVGLGMSVLGLGVGAAHHHQQQPPRCQAEGCKADLSA  212

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AKHYHRRHKVCEFH KA+ V A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  213   AKHYHRRHKVCEFHTKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKRSC  261



>ref|XP_010256977.1| PREDICTED: squamosa promoter-binding-like protein 14 [Nelumbo 
nucifera]
Length=1085

 Score =   122 bits (306),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = -2

Query  1129  QEAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT  950
             +E    +VV K    G V+  G  L L LGG  Y   + D+   R  +R R+   GS N 
Sbjct  101   EETLKNLVVKK----GSVDEDGEKLTLKLGGGLY---SVDESAARPNKRVRSGSPGSGNY  153

Query  949   PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
             P CQ + C  DL++AK YHRRHKVCEFH+K    + GG  QRFCQQCSRFH LSEFD GK
Sbjct  154   PMCQVDDCKGDLSNAKDYHRRHKVCEFHSKTTKALVGGQMQRFCQQCSRFHPLSEFDEGK  213

Query  769   RSC  761
             RSC
Sbjct  214   RSC  216



>ref|XP_004960135.1| PREDICTED: protein LIGULELESS 1-like [Setaria italica]
Length=385

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  133   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  179

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  180   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  224



>gb|EAY95872.1| hypothetical protein OsI_17738 [Oryza sativa Indica Group]
Length=338

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  155   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  201

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  202   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  246



>ref|NP_001105543.1| protein LIGULELESS 1 [Zea mays]
 sp|O04003.1|LG1_MAIZE RecName: Full=Protein LIGULELESS 1 [Zea mays]
 gb|AAL49746.1|AF451895_1 LIGULELESS1 [Zea mays]
 gb|AAB51071.1| liguleless1 protein [Zea mays]
Length=399

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  155   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  201

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  202   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  246



>tpg|DAA35605.1| TPA: liguleless1 [Zea mays]
 gb|AIB04931.1| SBP transcription factor, partial [Zea mays]
Length=399

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  154   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  200

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  201   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  245



>ref|XP_010549292.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
 ref|XP_010549293.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
 ref|XP_010549294.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
Length=434

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = -2

Query  1057  LGLNLGGRTYFSS--AEDDFVNRL------YRRSRAVDAGSFNTPRCQAEGCNADLTHAK  902
             LGL LG RTYF    AE+D    +       +RS+++ + S   P CQ EGCN DL+ AK
Sbjct  120   LGLKLGKRTYFEDVCAENDGKGLVSPSESPVKRSKSI-SQSLQAPHCQVEGCNLDLSSAK  178

Query  901   HYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             +YHR+HKVCE H+K   VI GGL +RFCQQCSRFH LSEFD  KRSC
Sbjct  179   NYHRKHKVCESHSKCPLVIVGGLERRFCQQCSRFHGLSEFDEKKRSC  225



>gb|EMS48286.1| Squamosa promoter-binding-like protein 8 [Triticum urartu]
Length=267

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  4     FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSGAKRYH  50

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  51    RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  95



>ref|XP_010240547.1| PREDICTED: squamosa promoter-binding-like protein 8 [Brachypodium 
distachyon]
Length=420

 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 69/107 (64%), Gaps = 12/107 (11%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKH  899
               F+   LGLNLG RTYF             R     A   + PRCQAEGC ADL+ AK 
Sbjct  152   ASFAATQLGLNLGYRTYFPP-----------RGHGGYAYGHHPPRCQAEGCKADLSGAKR  200

Query  898   YHRRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  201   YHRRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  247



>emb|CAJ41454.1| liguleless-like protein [Hordeum vulgare]
Length=285

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  20    FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSGAKRYH  66

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  67    RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  111



>ref|XP_001756639.1| predicted protein [Physcomitrella patens]
 gb|EDQ78593.1| predicted protein [Physcomitrella patens]
Length=1000

 Score =   121 bits (303),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 72/114 (63%), Gaps = 15/114 (13%)
 Frame = -2

Query  1063  ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             A +GLNLG RTYFS+ E+   + L +R R    GS   P CQAEGC  DL+ +K YHRRH
Sbjct  495   ARIGLNLGVRTYFST-EETAASGLGKRHRTGSPGS-QVPTCQAEGCKTDLSTSKQYHRRH  552

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCS-------------RFHVLSEFDNGKRSC  761
             KVCE H+KA  V  GG TQRFCQQCS             RFH L EFDNGKRSC
Sbjct  553   KVCELHSKAPNVQVGGQTQRFCQQCSSTDVDLVMTSSMPRFHSLEEFDNGKRSC  606



>gb|EAZ32258.1| hypothetical protein OsJ_16462 [Oryza sativa Japonica Group]
Length=338

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  155   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  201

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  202   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  246



>sp|Q01KM7.1|SPL8_ORYSI RecName: Full=Squamosa promoter-binding-like protein 8; AltName: 
Full=OsLG1; AltName: Full=Protein LIGULELESS 1 [Oryza sativa 
Indica Group]
 emb|CAH66694.1| OSIGBa0158D24.2 [Oryza sativa Indica Group]
 dbj|BAM78641.1| squamosa promoter-binding-like protein 8 [Oryza sativa Japonica 
Group]
 gb|AGN31547.1| PAC1 [Oryza sativa Indica Group]
 gb|AGN31548.1| PAC1 [Oryza rufipogon]
Length=416

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 68/107 (64%), Gaps = 14/107 (13%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKH  899
               F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK 
Sbjct  153   ASFAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKR  199

Query  898   YHRRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  200   YHRRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  246



>ref|XP_008680934.1| PREDICTED: SBP-domain protein1 isoform X3 [Zea mays]
Length=505

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 78/132 (59%), Gaps = 22/132 (17%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN--------------  953
             PL      G  +GLNLG RTYFS A+   V+RL  RSR    G                 
Sbjct  205   PLVDAAGGGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLAGGGVGVGLGMGLGMGVLGLG  264

Query  952   -------TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC-SRFH  797
                     PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQC SRFH
Sbjct  265   AAHHQQPPPRCQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSSRFH  324

Query  796   VLSEFDNGKRSC  761
             VL+EFD  KRSC
Sbjct  325   VLAEFDEAKRSC  336



>ref|XP_008680932.1| PREDICTED: SBP-domain protein1 isoform X1 [Zea mays]
Length=506

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 78/132 (59%), Gaps = 22/132 (17%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN--------------  953
             PL      G  +GLNLG RTYFS A+   V+RL  RSR    G                 
Sbjct  205   PLVDAAGGGGRIGLNLGRRTYFSPADVLAVDRLLTRSRLAGGGVGVGLGMGLGMGVLGLG  264

Query  952   -------TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC-SRFH  797
                     PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  QRFCQQC SRFH
Sbjct  265   AAHHQQPPPRCQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSSRFH  324

Query  796   VLSEFDNGKRSC  761
             VL+EFD  KRSC
Sbjct  325   VLAEFDEAKRSC  336



>ref|XP_006652941.1| PREDICTED: squamosa promoter-binding-like protein 8-like [Oryza 
brachyantha]
Length=421

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  155   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  201

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  202   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  246



>ref|XP_010252163.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Nelumbo nucifera]
 ref|XP_010252164.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Nelumbo nucifera]
Length=484

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 79/133 (59%), Gaps = 20/133 (15%)
 Frame = -2

Query  1102  PKSEPLGGVEFSGAS-------LGLNLGGRTYF------SSAEDDFV------NRLYRRS  980
             P+ E  G     GAS       +GL LG RTYF      S+ ++ F       +   +RS
Sbjct  122   PRLEDTGTSPTLGASVGSSEPVIGLKLGKRTYFEDICAGSTIKNSFSVIPTSSSTTAKRS  181

Query  979   RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRF  800
             RA    S  TP+CQ EGCN DLT AK YHRRH+VCE H+K+  VI  GL +RFCQQCSRF
Sbjct  182   RA-SYQSTQTPQCQVEGCNLDLTSAKDYHRRHRVCESHSKSPKVIVAGLERRFCQQCSRF  240

Query  799   HVLSEFDNGKRSC  761
             H LSEFD  KRSC
Sbjct  241   HDLSEFDEKKRSC  253



>dbj|BAM78642.1| squamosa promoter-binding-like protein 8 [Oryza rufipogon]
Length=415

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  154   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  200

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  201   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  245



>ref|NP_001054119.1| Os04g0656500 [Oryza sativa Japonica Group]
 sp|Q7XPY1.1|SPL8_ORYSJ RecName: Full=Squamosa promoter-binding-like protein 8; AltName: 
Full=OsLG1; AltName: Full=Protein LIGULELESS 1 [Oryza sativa 
Japonica Group]
 emb|CAE03411.3| OSJNBa0071I13.12 [Oryza sativa Japonica Group]
 dbj|BAF16033.1| Os04g0656500 [Oryza sativa Japonica Group]
Length=416

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 68/107 (64%), Gaps = 14/107 (13%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKH  899
               F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK 
Sbjct  153   ASFAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKR  199

Query  898   YHRRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHRRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  200   YHRRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  246



>ref|XP_009402494.1| PREDICTED: squamosa promoter-binding-like protein 6 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402495.1| PREDICTED: squamosa promoter-binding-like protein 6 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   120 bits (300),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 75/126 (60%), Gaps = 7/126 (6%)
 Frame = -2

Query  1132  SQEAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYR--RSRAVDAGS  959
             S++    VVV + E  GG      SL L LGG  Y    E DF N   +  +      GS
Sbjct  91    SEKKRRIVVVEEDESCGG----AGSLSLRLGGHAY-PVVESDFANWEVKNEKKNKSQGGS  145

Query  958   FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
              + P CQ EGC+ADL  ++ YHRRHKVCE HAKA++ I     QRFCQQCSRFH+L EFD
Sbjct  146   SSNPTCQVEGCDADLCDSRDYHRRHKVCEMHAKASSAIVRNAIQRFCQQCSRFHLLEEFD  205

Query  778   NGKRSC  761
              GKRSC
Sbjct  206   EGKRSC  211



>gb|AHW57568.1| squamosa promoter-binding-like protein 8 [Triticum aestivum]
Length=407

 Score =   117 bits (292),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  148   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSGAKRYH  194

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  195   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  239



>ref|XP_004981153.1| PREDICTED: squamosa promoter-binding-like protein 6-like [Setaria 
italica]
Length=968

 Score =   119 bits (299),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 68/105 (65%), Gaps = 3/105 (3%)
 Frame = -2

Query  1066  GASLGLNLGGRTYFSSA-EDDFVNRLYRRSRA--VDAGSFNTPRCQAEGCNADLTHAKHY  896
             G SL L +GG    + A E   VN   R  +   V  GS + P CQ EGC ADLT AK Y
Sbjct  107   GGSLSLRIGGNAVGAGAMEGGDVNEDERNGKKIRVQGGSSSGPSCQVEGCGADLTAAKDY  166

Query  895   HRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             HRRHKVCE HAKA+T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  167   HRRHKVCEMHAKASTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSC  211



>ref|XP_004134953.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
 ref|XP_004155646.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
 gb|KGN49239.1| hypothetical protein Csa_6G517960 [Cucumis sativus]
Length=141

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  952  TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
              RCQA+GCNADLT AK YHRRHKVCEFH++AA VI  GL QRFCQQCSRFH LSEFD+ 
Sbjct  53   VARCQADGCNADLTGAKPYHRRHKVCEFHSRAAVVILAGLEQRFCQQCSRFHALSEFDDT  112

Query  772  KRSC  761
            KRSC
Sbjct  113  KRSC  116



>ref|XP_008439842.1| PREDICTED: squamosa promoter-binding protein 1 [Cucumis melo]
Length=142

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  952  TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
              RCQA+GCNADLT A+ YHRRHKVCEFHAKAA VI  GL QRFCQQCSRFH +SEFD+ 
Sbjct  54   VARCQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLEQRFCQQCSRFHAVSEFDDT  113

Query  772  KRSC  761
            KRSC
Sbjct  114  KRSC  117



>ref|XP_007018638.1| Squamosa promoter binding protein-like 14 [Theobroma cacao]
 gb|EOY15863.1| Squamosa promoter binding protein-like 14 [Theobroma cacao]
Length=1079

 Score =   119 bits (297),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = -2

Query  1060  SLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHK  881
             SL LNLGGR   +S E+  V+R  ++ R+   GS N P CQ + C  DL++AK YHRRHK
Sbjct  115   SLQLNLGGR--LNSVEEP-VSRPNKKVRSGSPGSTNYPMCQVDNCKEDLSNAKDYHRRHK  171

Query  880   VCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             VCE H+KA   + G   QRFCQQCSRFH+LSEFD GKRSC
Sbjct  172   VCEVHSKATKALVGKHMQRFCQQCSRFHLLSEFDEGKRSC  211



>ref|XP_003551421.1| PREDICTED: squamosa promoter-binding-like protein 9-like [Glycine 
max]
Length=373

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 65/111 (59%), Gaps = 13/111 (12%)
 Frame = -2

Query  1054  GLNLGGRTYF---SSAEDDFVNRLYRRSRAVDA----------GSFNTPRCQAEGCNADL  914
             GL  G + YF   S A        Y+ SR V +          GS   PRCQ EGC  DL
Sbjct  27    GLKFGQKIYFEDVSVAATTTTQGAYKTSRVVSSPSSASKKGRGGSLQPPRCQVEGCKVDL  86

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AK Y+ RHKVC  H+K  TVI  GL QRFCQQCSRFH+LSEFD GKRSC
Sbjct  87    SGAKAYYSRHKVCTMHSKFPTVIVAGLEQRFCQQCSRFHLLSEFDEGKRSC  137



>ref|XP_010941481.1| PREDICTED: squamosa promoter-binding-like protein 6 [Elaeis guineensis]
Length=997

 Score =   118 bits (296),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 76/121 (63%), Gaps = 9/121 (7%)
 Frame = -2

Query  1114  FVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVN---RLYRRSRAVDAGSFNTPR  944
              VVV +  P  G      SL L LGG  Y    E D VN   +  ++S+ +  G+ N P 
Sbjct  94    IVVVEEDGPYDG----SGSLALKLGGHAY-PITEPDRVNCEGKNGKKSK-LQGGNSNHPT  147

Query  943   CQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRS  764
             CQ EGC ADL+++K YHRRHKVCE HAKA T + G   QRFCQQCSRFH+L EFD GKRS
Sbjct  148   CQVEGCGADLSNSKDYHRRHKVCEMHAKAGTAMVGNAIQRFCQQCSRFHLLQEFDEGKRS  207

Query  763   C  761
             C
Sbjct  208   C  208



>dbj|BAK01070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =   118 bits (295),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 71/114 (62%), Gaps = 7/114 (6%)
 Frame = -2

Query  1090  PLGGVEFSGASLGLNLGGRTYFS--SAEDDFVNRLYRRSRA--VDAGSFNTPRCQAEGCN  923
             P+G    S   L L LGG    +  +AED  VN   R  +   V  GS N P CQ EGC 
Sbjct  107   PVGN---SSNVLSLRLGGGNSVAGGAAEDGGVNEEDRNGKRIRVQGGSSNGPACQVEGCC  163

Query  922   ADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             ADL+ AK YHRRHKVCE HAKA T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  164   ADLSAAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSC  217



>gb|KHN31114.1| Squamosa promoter-binding-like protein 9 [Glycine soja]
Length=373

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 65/111 (59%), Gaps = 13/111 (12%)
 Frame = -2

Query  1054  GLNLGGRTYF---SSAEDDFVNRLYRRSRAVDA----------GSFNTPRCQAEGCNADL  914
             GL  G + YF   S A        Y+ SR V +          GS   PRCQ EGC  DL
Sbjct  27    GLKFGQKIYFEDVSVAATTTTQGAYKTSRVVSSPSSASKKGRGGSLQAPRCQVEGCKVDL  86

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AK Y+ RHKVC  H+K  TVI  GL QRFCQQCSRFH+LSEFD GKRSC
Sbjct  87    SGAKAYYSRHKVCTMHSKFPTVIVAGLEQRFCQQCSRFHLLSEFDEGKRSC  137



>ref|XP_008663682.1| PREDICTED: protein LIGULELESS 1-like [Zea mays]
 gb|AFW59713.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein [Zea mays]
 gb|AIB05578.1| SBP transcription factor, partial [Zea mays]
Length=396

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 68/105 (65%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNLG RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  147   FAATQLGLNLGYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSGAKRYH  193

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVC+ H+KA  V+ AGG+ QRFCQQCSRFH+L EFD+ K+SC
Sbjct  194   RRHKVCDHHSKAPVVVTAGGMHQRFCQQCSRFHLLDEFDDAKKSC  238



>ref|XP_002466159.1| hypothetical protein SORBIDRAFT_01g002530 [Sorghum bicolor]
 gb|EER93157.1| hypothetical protein SORBIDRAFT_01g002530 [Sorghum bicolor]
Length=969

 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 67/105 (64%), Gaps = 3/105 (3%)
 Frame = -2

Query  1066  GASLGLNLGGRTY-FSSAEDDFVNRLYRRSRA--VDAGSFNTPRCQAEGCNADLTHAKHY  896
             G SL L +GG      + E+  VN   R  +   V  G  + P CQ EGC ADLT AK Y
Sbjct  108   GGSLSLRIGGTAVGVEAMENSDVNEDERNGKKIRVQGGGSSGPACQVEGCGADLTAAKDY  167

Query  895   HRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             HRRHKVCE HAKA+T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  168   HRRHKVCEMHAKASTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSC  212



>ref|XP_009401512.1| PREDICTED: squamosa promoter-binding-like protein 15 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401513.1| PREDICTED: squamosa promoter-binding-like protein 15 [Musa acuminata 
subsp. malaccensis]
Length=1091

 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 72/116 (62%), Gaps = 5/116 (4%)
 Frame = -2

Query  1102  PKSEPLG-GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGS-FNTPRCQAEG  929
             PK   LG  +E    +L L LGGR Y   + D+   R  +R R+   GS  N P CQ + 
Sbjct  114   PKDSVLGRNLEEDDQNLALKLGGRAY---SADEPTTRPSKRVRSGSPGSGCNYPMCQVDD  170

Query  928   CNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             C ADL+ AK YHRRHKVCE H+K A  + G   QRFCQQCSRFH LSEFD GKRSC
Sbjct  171   CRADLSSAKDYHRRHKVCEMHSKTAKALVGKQMQRFCQQCSRFHPLSEFDEGKRSC  226



>ref|XP_002447251.1| hypothetical protein SORBIDRAFT_06g031290 [Sorghum bicolor]
 gb|EES11579.1| hypothetical protein SORBIDRAFT_06g031290 [Sorghum bicolor]
Length=400

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 67/105 (64%), Gaps = 14/105 (13%)
 Frame = -2

Query  1072  FSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYH  893
             F+   LGLNL  RTYF               R       + PRCQAEGC ADL+ AK YH
Sbjct  148   FAATQLGLNLNYRTYFPP-------------RGGYTYGHHPPRCQAEGCKADLSSAKRYH  194

Query  892   RRHKVCEFHAKAATVI-AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             RRHKVCE H+KA  V+ AGGL QRFCQQCSRFH+L EFD+ K+SC
Sbjct  195   RRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKKSC  239



>gb|AFW76142.1| squamosa promoter-binding protein-like (SBP domain) transcription 
factor family protein, partial [Zea mays]
Length=400

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  949  PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
            PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V  GG  QRFCQQCSRFHVLSEFD  K
Sbjct  157  PRCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVATGGKQQRFCQQCSRFHVLSEFDEVK  216

Query  769  RSC  761
            RSC
Sbjct  217  RSC  219



>gb|ABO80946.1| SBP [Medicago truncatula]
Length=253

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -2

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
             V+V + E   G+   G +L LNLGG        +       ++SR    GS +   CQ E
Sbjct  95    VIVVEDELGLGLNKEGGNLSLNLGGGVATWEGNNG------KKSRVAGGGSSSRAFCQVE  148

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              C ADL +AK YHRRHKVCE H+KA+  + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  149   DCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRFHLLQEFDEGKRSC  205



>ref|XP_010278483.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Nelumbo nucifera]
Length=494

 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 73/127 (57%), Gaps = 15/127 (12%)
 Frame = -2

Query  1099  KSEPLGGVEFSGASL-GLNLGGRTYFS-------------SAEDDFVNRLYRRSRAVDAG  962
             ++ P  GV  S   L GL LG RTYF              S      +   +RSRA    
Sbjct  119   ETSPTLGVSGSTEPLIGLKLGKRTYFEDICAGSTIKHSSFSVIPTSSSTTAKRSRA-SYQ  177

Query  961   SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
             S  TPRCQ EGCN DL+ AK YHRRH+VCE H+K   VI  GL +RFCQQCSRFH LSEF
Sbjct  178   STQTPRCQVEGCNLDLSSAKDYHRRHRVCESHSKCPKVIVAGLERRFCQQCSRFHDLSEF  237

Query  781   DNGKRSC  761
             D  KRSC
Sbjct  238   DEKKRSC  244



>ref|XP_009420463.1| PREDICTED: squamosa promoter-binding-like protein 10, partial 
[Musa acuminata subsp. malaccensis]
Length=179

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -2

Query  1141  PLLSQEAAGFVVVPKSEPLGGVE-FSGASLGLNLGG-RTYFSSAEDDFVNRLYR-RSRAV  971
             PLL      F   P + P   VE   G  +GLNL G RTY   ++      L+  RS   
Sbjct  64    PLLPMNNLPFCWPPPTVPKNAVEPVPGGQIGLNLWGHRTYVPPSDGLETAHLFALRSVGA  123

Query  970   DAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSR  803
              + S   PRCQA+GC+ADL+ AK+YHRRHKVCEFH KAA V+A GL QRFCQQCSR
Sbjct  124   HSPSHTPPRCQADGCSADLSGAKYYHRRHKVCEFHFKAAVVVAHGLPQRFCQQCSR  179



>gb|EMT28202.1| Squamosa promoter-binding-like protein 6 [Aegilops tauschii]
 gb|AHW57565.1| squamosa promoter-binding-like protein 6 [Triticum aestivum]
Length=961

 Score =   117 bits (293),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 71/114 (62%), Gaps = 6/114 (5%)
 Frame = -2

Query  1093  EPLGGVEFSGASLGLNLGGRTYFSS-AEDDFVNRLYRRSRA--VDAGSFNTPRCQAEGCN  923
             +P+G    S   L L +GG T     AED  VN   R  +   V  GS + P CQ EGC 
Sbjct  104   DPVGN---SNNVLSLRIGGNTVAGGVAEDGGVNEEDRNGKKIRVQGGSSSGPACQVEGCC  160

Query  922   ADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             ADL+ AK YHRRHKVCE HAKA T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  161   ADLSAAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSC  214



>gb|ABM67302.1| SBP-domain protein 9 [Physcomitrella patens]
Length=681

 Score =   116 bits (291),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = -2

Query  1075  EFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHY  896
             EFS AS+  +     +    +D  V RL +R R    GS   P CQAEGC ADL   K+Y
Sbjct  176   EFSAASMHDH-----HIKREKDAAVGRLSKRHRVGSPGS-QLPTCQAEGCKADLNVTKNY  229

Query  895   HRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             +RRHKVCEFH+K   VI GG TQRFCQQCSRFH L EFD+GKRSC
Sbjct  230   YRRHKVCEFHSKTPIVIVGGHTQRFCQQCSRFHRLGEFDDGKRSC  274



>ref|XP_010252166.1| PREDICTED: squamosa promoter-binding-like protein 12 isoform 
X2 [Nelumbo nucifera]
Length=455

 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 71/114 (62%), Gaps = 11/114 (10%)
 Frame = -2

Query  1102  PKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCN  923
             P+ E  G     GAS+G          S+E     +L +RSRA    S  TP+CQ EGCN
Sbjct  122   PRLEDTGTSPTLGASVG----------SSEPVIGLKLAKRSRA-SYQSTQTPQCQVEGCN  170

Query  922   ADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              DLT AK YHRRH+VCE H+K+  VI  GL +RFCQQCSRFH LSEFD  KRSC
Sbjct  171   LDLTSAKDYHRRHRVCESHSKSPKVIVAGLERRFCQQCSRFHDLSEFDEKKRSC  224



>ref|XP_003541730.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Glycine max]
 gb|KHN08505.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=138

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  1018  AEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAG  839
              +D    R+    R   AG    P CQ +GCNADL+ AK YHRRHKVCE+HAKA  V+ G
Sbjct  32    GDDGKKKRVVSNKRGSKAGGSVPPSCQVDGCNADLSEAKPYHRRHKVCEYHAKAPAVVIG  91

Query  838   GLTQRFCQQCSRFHVLSEFDNGKRSC  761
                QRFCQQCSRFH LSEFD+ KRSC
Sbjct  92    DQHQRFCQQCSRFHELSEFDDSKRSC  117



>gb|EMS54388.1| Squamosa promoter-binding-like protein 6 [Triticum urartu]
Length=982

 Score =   116 bits (291),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = -2

Query  1084  GGVEFSGASLGLNLGGRTYFSSA-EDDFVNRLYRRSRA--VDAGSFNTPRCQAEGCNADL  914
             G V  S   L L +GG +    A ED  VN   R  +   V  GS + P CQ EGC ADL
Sbjct  105   GPVGSSNNVLSLRIGGNSVAGGAVEDGGVNEEDRNGKKIRVQGGSSSGPACQVEGCCADL  164

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AK YHRRHKVCE HAKA T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  165   SAAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSC  215



>ref|XP_006390174.1| hypothetical protein EUTSA_v10018054mg [Eutrema salsugineum]
 gb|ESQ27460.1| hypothetical protein EUTSA_v10018054mg [Eutrema salsugineum]
Length=1048

 Score =   116 bits (290),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (65%), Gaps = 3/111 (3%)
 Frame = -2

Query  1084  GGVEFSGASLGLNLGGRTYFSSAEDD-FVNRLYRRSRAVDAGSF--NTPRCQAEGCNADL  914
             GG+ + G   GL+L   T F++ ED   V R  ++ R+   GS   N P+CQ + C  DL
Sbjct  92    GGLSYEGEERGLDLNLSTGFNAVEDTPVVTRPNKKVRSGSPGSGGGNYPKCQVDNCKEDL  151

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AK YHRRHKVCE H+KA   + G   QRFCQQCSRFH+LSEFD GKRSC
Sbjct  152   SLAKDYHRRHKVCELHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSC  202



>ref|XP_008463797.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
melo]
Length=176

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  979  RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRF  800
            R    GS ++P CQA  C ADL+ AK YHRRHKVCEFH+KAA V+  G+ QRFCQQCSRF
Sbjct  39   RGKSGGSVSSPSCQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRFCQQCSRF  98

Query  799  HVLSEFDNGKRSC  761
            H L+EFD  KRSC
Sbjct  99   HELTEFDEAKRSC  111



>ref|XP_010539753.1| PREDICTED: squamosa promoter-binding-like protein 14 [Tarenaya 
hassleriana]
 ref|XP_010539755.1| PREDICTED: squamosa promoter-binding-like protein 14 [Tarenaya 
hassleriana]
Length=1040

 Score =   116 bits (290),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = -2

Query  1084  GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHA  905
             GG E +  +L LNLG     +  E+   +R  +R R+   G  N P CQ + C  DL+ A
Sbjct  98    GGSEGAERNLDLNLGN--GLNDMEETQASRQSKRVRSSSPGGANYPMCQVDCCKEDLSSA  155

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YHRRHKVCE H+KA+ V+ G   QRFCQQCSRFH+LSEFD GKRSC
Sbjct  156   KDYHRRHKVCELHSKASKVLVGKQMQRFCQQCSRFHLLSEFDEGKRSC  203



>ref|XP_002972440.1| hypothetical protein SELMODRAFT_59543, partial [Selaginella moellendorffii]
 ref|XP_002984272.1| hypothetical protein SELMODRAFT_49502, partial [Selaginella moellendorffii]
 gb|EFJ14782.1| hypothetical protein SELMODRAFT_49502, partial [Selaginella moellendorffii]
 gb|EFJ26526.1| hypothetical protein SELMODRAFT_59543, partial [Selaginella moellendorffii]
Length=74

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  943  CQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRS  764
            CQAEGC ADL+ AKHYHRRHKVCE H+KA  VIA   TQRFCQQCSRFH+L+EFD+ KRS
Sbjct  1    CQAEGCTADLSKAKHYHRRHKVCELHSKAPNVIANNQTQRFCQQCSRFHLLTEFDDSKRS  60

Query  763  C  761
            C
Sbjct  61   C  61



>gb|ABM67300.1| SBP-domain protein 6 [Physcomitrella patens]
Length=695

 Score =   115 bits (289),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 68/110 (62%), Gaps = 14/110 (13%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYR-----------RSRAVDAGSFNTPRCQAEGCNADLT  911
             +GL LG RTYF   ED F     +           + + V A +    RCQ EGC ADL+
Sbjct  222   IGLKLGRRTYF---EDSFGGGQAKGSSSPAPSPPGKKQRVVAPNVQIARCQVEGCKADLS  278

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
               K YH+RHKVCE H+KA   IA G+ QRFCQQCSRFHVL+EFD GKRSC
Sbjct  279   GCKDYHKRHKVCEMHSKAPKCIAAGIEQRFCQQCSRFHVLTEFDEGKRSC  328



>ref|XP_001761750.1| predicted protein [Physcomitrella patens]
 gb|EDQ73506.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   115 bits (289),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 68/110 (62%), Gaps = 14/110 (13%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYR-----------RSRAVDAGSFNTPRCQAEGCNADLT  911
             +GL LG RTYF   ED F     +           + + V A +    RCQ EGC ADL+
Sbjct  222   IGLKLGRRTYF---EDSFGGGQAKGSSSPAPSPPGKKQRVVAPNVQIARCQVEGCKADLS  278

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
               K YH+RHKVCE H+KA   IA G+ QRFCQQCSRFHVL+EFD GKRSC
Sbjct  279   GCKDYHKRHKVCEMHSKAPKCIAAGIEQRFCQQCSRFHVLTEFDEGKRSC  328



>ref|XP_003563064.1| PREDICTED: squamosa promoter-binding-like protein 6 [Brachypodium 
distachyon]
Length=962

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFS--SAEDDFVNRLYRRSRA--VDAGSFNTPRCQAEGCNADLT  911
             V+ +G  L L +GG T  +  + E   VN   R  +   V  GS + P CQ EGC ADL+
Sbjct  107   VDNNGRVLSLRIGGDTTVAGGAVEGGAVNEEDRNGKKIRVQGGSSSGPACQVEGCCADLS  166

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              AK YHRRHKVCE HAKA T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  167   AAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSC  216



>ref|XP_004293885.1| PREDICTED: squamosa promoter-binding protein 1-like [Fragaria 
vesca subsp. vesca]
Length=157

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = -2

Query  964  GSFNT-PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLS  788
            GS  T P CQA+ CNADL+ AK Y+RRHKVC+FH+KA  V+ GGL QRFCQQCSRFH LS
Sbjct  69   GSMTTRPSCQAQSCNADLSDAKQYYRRHKVCDFHSKAPVVVIGGLRQRFCQQCSRFHDLS  128

Query  787  EFDNGKRSC  761
            EFD  KRSC
Sbjct  129  EFDENKRSC  137



>ref|XP_010537252.1| PREDICTED: squamosa promoter-binding-like protein 14 [Tarenaya 
hassleriana]
Length=1058

 Score =   115 bits (289),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = -2

Query  1084  GGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHA  905
             GG E    +L LNLG  +  +  E+   NR  +R R+   G  N P CQ + C  DL++A
Sbjct  102   GGSEVDERNLDLNLG--SGLTGMEETQANRQNKRVRSGSPGGGNYPMCQVDFCKEDLSNA  159

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YHRRHKVC+ H+KA+  + G   QRFCQQCSRFH+LSEFD GKRSC
Sbjct  160   KDYHRRHKVCKLHSKASKALVGKQMQRFCQQCSRFHLLSEFDEGKRSC  207



>gb|EPS60112.1| hypothetical protein M569_14693, partial [Genlisea aurea]
Length=137

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 64/108 (59%), Gaps = 9/108 (8%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRS---------RAVDAGSFNTPRCQAEGCNADLTHA  905
             +GL LG RTYF +      +               R   A     PRC  EGC+ DLT A
Sbjct  6     IGLKLGKRTYFENTGGGGSSSSAAAKPGGPSSSSHRPSKATCRLVPRCVVEGCSLDLTTA  65

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YHR+HKVCE H+K + VI GGL +RFCQQCSRFH LSEFD+ KRSC
Sbjct  66    KEYHRKHKVCEAHSKCSKVILGGLERRFCQQCSRFHSLSEFDDMKRSC  113



>gb|ACF87887.1| unknown [Zea mays]
Length=297

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -2

Query  952  TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
             PRCQAEGC ADL+ AKHYHRRHKVCE+HAKA+ V A G  Q FCQQCSRFHVLSEFD  
Sbjct  49   VPRCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAANGKQQHFCQQCSRFHVLSEFDEV  108

Query  772  KRSC  761
            KRSC
Sbjct  109  KRSC  112



>ref|NP_001105115.1| SBP-domain protein2 [Zea mays]
 emb|CAB56628.1| SBP-domain protein 2 [Zea mays]
Length=445

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  946  RCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKR  767
            RCQAEGC ADL+ AKHYHRRHKVCEFH KA+ V A G  QRFCQQCSRFHVL+EFD  KR
Sbjct  214  RCQAEGCKADLSAAKHYHRRHKVCEFHTKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKR  273

Query  766  SC  761
            SC
Sbjct  274  SC  275



>gb|AFK42236.1| unknown [Medicago truncatula]
 gb|KEH31025.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=144

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -2

Query  1006  FVNRLYRRSRAVDAGSFNTPRC-QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLT  830
              V  LY +  +  AGS N P C Q E C+ADL+ AK YHRRHKVCE+HAKA  V   GL 
Sbjct  41    VVTDLYSKRSSKKAGSSNIPPCCQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHIAGLQ  100

Query  829   QRFCQQCSRFHVLSEFDNGKRSC  761
             QRFCQQCSRFH LSEFD+ KRSC
Sbjct  101   QRFCQQCSRFHGLSEFDDAKRSC  123



>ref|XP_010270607.1| PREDICTED: squamosa promoter-binding-like protein 14 [Nelumbo 
nucifera]
Length=1083

 Score =   115 bits (289),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = -2

Query  1129  QEAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT  950
             +E    +VV K    G V+  G +L L LGG  Y   + D+   R  +R R+   G+ + 
Sbjct  103   EETLKSLVVNK----GSVDEDGENLTLKLGGSLY---SVDESAARPNKRVRSGSPGTGSY  155

Query  949   PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
             P CQ + C  DL++AK YHRRHKVCE H+K    + G   QRFCQQCSRFH LSEFD GK
Sbjct  156   PMCQVDDCKGDLSNAKDYHRRHKVCELHSKTTKALVGKQMQRFCQQCSRFHPLSEFDEGK  215

Query  769   RSC  761
             RSC
Sbjct  216   RSC  218



>ref|XP_001775628.1| predicted protein [Physcomitrella patens]
 gb|EDQ59575.1| predicted protein [Physcomitrella patens]
Length=699

 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSA---------EDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHA  905
             +GL LG RTYF  +              +   ++ R V A S    RCQ EGC ADL+  
Sbjct  226   IGLKLGRRTYFEDSTGVGHAKGLSSPAPSPPGKKQRVV-APSMQIARCQVEGCKADLSGC  284

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YH+RHKVCE H+KA   IA G+ QRFCQQCSRFHVL+EFD GKRSC
Sbjct  285   KDYHKRHKVCEMHSKAPKCIAAGIEQRFCQQCSRFHVLTEFDEGKRSC  332



>gb|ABM67305.1| SBP-domain protein 13 [Physcomitrella patens]
Length=694

 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSA---------EDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHA  905
             +GL LG RTYF  +              +   ++ R V A S    RCQ EGC ADL+  
Sbjct  221   IGLKLGRRTYFEDSTGVGHAKGLSSPAPSPPGKKQRVV-APSMQIARCQVEGCKADLSGC  279

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YH+RHKVCE H+KA   IA G+ QRFCQQCSRFHVL+EFD GKRSC
Sbjct  280   KDYHKRHKVCEMHSKAPKCIAAGIEQRFCQQCSRFHVLTEFDEGKRSC  327



>ref|NP_001236309.1| uncharacterized protein LOC100527199 [Glycine max]
 gb|ACU16251.1| unknown [Glycine max]
Length=142

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -2

Query  952  TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
            TP CQ + C+ADL+ AK YHRRHKVCE+HAKA +V   GL QRFCQQCSRFHVLSEFD+ 
Sbjct  62   TPSCQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHVLSEFDDS  121

Query  772  KRSC  761
            KRSC
Sbjct  122  KRSC  125



>ref|XP_006648367.1| PREDICTED: squamosa promoter-binding-like protein 5-like [Oryza 
brachyantha]
Length=421

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 82/126 (65%), Gaps = 18/126 (14%)
 Frame = -2

Query  1084  GGVEFSGASLGLN-----LGGRTYFSSAEDDFVNRLYRRSRAVDAGSF------------  956
             GG++FS A+   +     LG RTYFS A+   V+RL  RSR    G              
Sbjct  50    GGLDFSAAAFPSSFQEAALGLRTYFSPADVLAVDRLLLRSRLGGMGMGVLGLGLAAAHHH  109

Query  955   -NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
                PRCQAEGC ADL+ AKHYHRRHKVC++HAKAA V+AGG  QRFCQQCSRFHVL+EFD
Sbjct  110   HQPPRCQAEGCKADLSAAKHYHRRHKVCDYHAKAAAVVAGGKQQRFCQQCSRFHVLAEFD  169

Query  778   NGKRSC  761
               KRSC
Sbjct  170   EAKRSC  175



>ref|XP_008437792.1| PREDICTED: squamosa promoter-binding-like protein 7 isoform X2 
[Cucumis melo]
Length=338

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-PRCQAEGCNADLTHAKHYHRRHK  881
             + LNLG R YF   ED     L    RA       T PRCQ EGC+  L +AK YHRRH+
Sbjct  68    MCLNLGKRHYF---EDSNAPSLILGKRAKSPFYATTVPRCQVEGCHVALVNAKDYHRRHR  124

Query  880   VCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             VCE H+KA  V+  GL QRFCQQCSRFHV+SEFD+ KRSC
Sbjct  125   VCEMHSKAPKVVVLGLDQRFCQQCSRFHVISEFDDSKRSC  164



>gb|KHN09987.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=141

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -2

Query  952  TPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNG  773
            TP CQ + C+ADL+ AK YHRRHKVCE+HAKA +V   GL QRFCQQCSRFHVLSEFD+ 
Sbjct  61   TPSCQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHVLSEFDDS  120

Query  772  KRSC  761
            KRSC
Sbjct  121  KRSC  124



>ref|XP_008437791.1| PREDICTED: squamosa promoter-binding-like protein 7 isoform X1 
[Cucumis melo]
Length=339

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-PRCQAEGCNADLTHAKHYHRRHK  881
             + LNLG R YF   ED     L    RA       T PRCQ EGC+  L +AK YHRRH+
Sbjct  68    MCLNLGKRHYF---EDSNAPSLILGKRAKSPFYATTVPRCQVEGCHVALVNAKDYHRRHR  124

Query  880   VCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             VCE H+KA  V+  GL QRFCQQCSRFHV+SEFD+ KRSC
Sbjct  125   VCEMHSKAPKVVVLGLDQRFCQQCSRFHVISEFDDSKRSC  164



>emb|CDP20025.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = -2

Query  1054  GLNLGGRTYFSSAEDDFVNRLYRRSRA-VDAGSFNTPRCQAEGCNADLTHAKHYHRRHKV  878
             GL  G + YF +A         ++ R+ V  G    PRCQ EGC  DL+ AK Y+ RHKV
Sbjct  20    GLKFGKKIYFEAASGRPPPAPAKKGRSGVAPGGGQPPRCQVEGCKLDLSDAKPYYSRHKV  79

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             C  H+K+ TVI  GL QRFCQQCSRFH L EFD GKRSC
Sbjct  80    CGAHSKSPTVIVAGLQQRFCQQCSRFHQLPEFDQGKRSC  118



>gb|AGI62049.1| SQUAMOSA promoter-binding-like 1 [Erycina pusilla]
Length=169

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  949  PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
            P CQAE C ADLT AK YHRRHKVCE HAKAATVI  GL QRFCQQCSRFH L EFD  K
Sbjct  56   PICQAEKCTADLTEAKRYHRRHKVCEAHAKAATVIVAGLRQRFCQQCSRFHELPEFDEVK  115

Query  769  RSC  761
            RSC
Sbjct  116  RSC  118



>ref|XP_004133774.1| PREDICTED: squamosa promoter-binding-like protein 7-like [Cucumis 
sativus]
 gb|KGN56361.1| hypothetical protein Csa_3G117960 [Cucumis sativus]
Length=340

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-PRCQAEGCNADLTHAKHYHRRHK  881
             + LNLG R YF   ED     L    RA       T PRCQ EGC+  L +AK YHRRH+
Sbjct  68    MCLNLGKRHYF---EDSNAPSLILGKRAKPPFYATTVPRCQVEGCHVALVNAKDYHRRHR  124

Query  880   VCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             VCE H+KA  V+  GL QRFCQQCSRFHV+SEFD+ KRSC
Sbjct  125   VCEMHSKAPKVVVLGLDQRFCQQCSRFHVISEFDDSKRSC  164



>ref|XP_008810376.1| PREDICTED: squamosa promoter-binding protein 1-like [Phoenix 
dactylifera]
Length=172

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  967  AGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLS  788
            AG  + P CQAE C ADLT AK YHRRHKVCE H+KA  VI  GL QRFCQQCSRFH LS
Sbjct  53   AGGASQPCCQAEKCTADLTEAKRYHRRHKVCEAHSKAPVVIVAGLRQRFCQQCSRFHELS  112

Query  787  EFDNGKRSC  761
            EFD+ KRSC
Sbjct  113  EFDDSKRSC  121



>ref|XP_008799143.1| PREDICTED: squamosa promoter-binding-like protein 15 [Phoenix 
dactylifera]
Length=1093

 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = -2

Query  1081  GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-PRCQAEGCNADLTHA  905
             G+E  G +L L LGG   F++AE+  V R  +R R+   GS  + P CQ + C ADL++A
Sbjct  127   GLEEDGENLTLKLGG-VNFTAAEEP-VARPNKRIRSRSPGSGGSYPMCQVDDCRADLSNA  184

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YHRRHKVCE H+K    + G   QRFCQQCSRFH LSEFD GKRSC
Sbjct  185   KDYHRRHKVCEVHSKTTRALVGKQMQRFCQQCSRFHPLSEFDEGKRSC  232



>ref|XP_008796104.1| PREDICTED: squamosa promoter-binding-like protein 7 [Phoenix 
dactylifera]
Length=358

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCE  872
             L LG R Y+   E+       +R R     +   PRCQ EGCN  L  AK YH+RHKVCE
Sbjct  90    LKLGKRQYY--GEEGVAGGGIKRERLSSNPAAGVPRCQVEGCNKALGDAKDYHKRHKVCE  147

Query  871   FHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              H+KA  V+  G  QRFCQQCSRFHV+SEFD+ KRSC
Sbjct  148   MHSKAPKVVVLGAEQRFCQQCSRFHVISEFDDAKRSC  184



>dbj|BAM15480.1| SBP-box protein [Torenia fournieri]
Length=419

 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 72/120 (60%), Gaps = 14/120 (12%)
 Frame = -2

Query  1105  VPKSEPLGGVEFSGASLGLNLGGRTYF-----SSAEDDFVNRLYRRSRAVDAGSFNTPRC  941
             V  +EPL         + L LG RT+F     S++     N+  ++       +  TPRC
Sbjct  101   VGSAEPL---------IALELGKRTFFENNVSSASFSGVSNQSSQKKLKSATQNVATPRC  151

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
               EGCNADL+ AK YHR+HKVC+ H+K   VI GGL +RFCQQCSRFH LSEFD  KRSC
Sbjct  152   LVEGCNADLSKAKEYHRKHKVCDSHSKCPKVIIGGLQRRFCQQCSRFHNLSEFDEKKRSC  211



>gb|AIE89804.1| SQUAMOSA promoter binding protein-like 15, partial [Salvia miltiorrhiza]
Length=133

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -2

Query  985  RSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
            + R   AG      CQAE C AD+  AK YHRRHKVCEFHAKAA V+  GL QRFCQQCS
Sbjct  41   KRRVSGAGGSTQRSCQAEDCTADMADAKPYHRRHKVCEFHAKAAVVLLSGLRQRFCQQCS  100

Query  805  RFHVLSEFDNGKRSC  761
            RFH LSEFD  KRSC
Sbjct  101  RFHELSEFDEAKRSC  115



>ref|XP_009593604.1| PREDICTED: squamosa promoter-binding-like protein 6 [Nicotiana 
tomentosiformis]
Length=147

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -2

Query  958  FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
            + TP CQ +GC  DL+ +K YH+RHKVCE H+K A VI  G  QRFCQQCSRFH+LSEFD
Sbjct  20   YQTPYCQVQGCRKDLSSSKDYHKRHKVCEVHSKTAKVIVNGTEQRFCQQCSRFHLLSEFD  79

Query  778  NGKRSC  761
            NGKRSC
Sbjct  80   NGKRSC  85



>ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis 
sativus]
 ref|XP_004165557.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis 
sativus]
 gb|KGN55117.1| Squamosa promoter-binding protein [Cucumis sativus]
Length=202

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  979  RAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRF  800
            R    GS + P CQA  C ADL+ AK YHRRHKVCEFH+KAA V+  G+ QRFCQQCSRF
Sbjct  64   RGKSGGSVSLPSCQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRFCQQCSRF  123

Query  799  HVLSEFDNGKRSC  761
            H L+EFD  KRSC
Sbjct  124  HELTEFDEAKRSC  136



>ref|XP_008810336.1| PREDICTED: squamosa promoter-binding-like protein 6 [Phoenix 
dactylifera]
Length=1001

 Score =   114 bits (284),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = -2

Query  1099  KSEPLGGVEFSG-----ASLGLNLGGRTYFSSAED--DFVNRLYRRSRAVDAGSFNTPRC  941
             K   +  VE  G      SL L LGG  Y     D  ++  +  ++S+ +  G+ + P C
Sbjct  93    KRRKIAAVEEDGLYDGSGSLALKLGGHAYPIMEADHANWEGKNGKKSK-LQGGNSSRPTC  151

Query  940   QAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             Q EGC ADL+++K YHRRHKVCE HAKA+T + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  152   QVEGCGADLSNSKDYHRRHKVCEVHAKASTAVVGNAIQRFCQQCSRFHLLQEFDEGKRSC  211



>ref|XP_009393147.1| PREDICTED: squamosa promoter-binding-like protein 6 [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   114 bits (284),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 71/118 (60%), Gaps = 8/118 (7%)
 Frame = -2

Query  1114  FVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQA  935
              +VV + E  GG      SL L LGG   F   E D  N    + +    GS + P CQ 
Sbjct  97    IIVVEEDESYGG----SGSLSLKLGGHA-FPVMEADLANGNKSKPQG---GSSSHPTCQV  148

Query  934   EGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             EGC ADL+ +K YHRRHKVCE HAKA++ +     QRFCQQCSRFH+L EFD GKRSC
Sbjct  149   EGCGADLSDSKDYHRRHKVCEMHAKASSAVVRNAIQRFCQQCSRFHLLEEFDEGKRSC  206



>ref|XP_002961226.1| hypothetical protein SELMODRAFT_28630, partial [Selaginella moellendorffii]
 ref|XP_002969457.1| hypothetical protein SELMODRAFT_17706, partial [Selaginella moellendorffii]
 gb|EFJ29545.1| hypothetical protein SELMODRAFT_17706, partial [Selaginella moellendorffii]
 gb|EFJ38765.1| hypothetical protein SELMODRAFT_28630, partial [Selaginella moellendorffii]
Length=80

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  949  PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
            P CQ +GC ADL+ AKHYHRRHKVCE H+KA  VIA   TQRFCQQCSRFH LSEFD+ K
Sbjct  5    PMCQVQGCAADLSKAKHYHRRHKVCEIHSKAPNVIANAQTQRFCQQCSRFHPLSEFDDTK  64

Query  769  RSC  761
            RSC
Sbjct  65   RSC  67



>emb|CAI91301.1| squamosa promoter binding protein 3 [Physcomitrella patens]
Length=660

 Score =   113 bits (282),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  988  RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
            ++ RA+   S   PRCQ +GC+ADL+  K YH+RHKVCE H+KAAT IA G+ QRFCQQC
Sbjct  225  KKQRALSP-STQIPRCQVQGCDADLSCCKDYHKRHKVCEMHSKAATAIAAGIEQRFCQQC  283

Query  808  SRFHVLSEFDNGKRSC  761
            SRFHVL EFD GKRSC
Sbjct  284  SRFHVLKEFDEGKRSC  299



>ref|XP_002282598.1| PREDICTED: squamosa promoter-binding-like protein 3 [Vitis vinifera]
 emb|CBI20271.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = -2

Query  1042  GGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-----PRCQAEGCNADLTHAKHYHRRHKV  878
             GGR  F   +DD +N+  +   AV            P CQAE C ADLT AK YHRRHKV
Sbjct  48    GGRALFK--DDDGINKKKKTVAAVSGSRSGGGGVGSPCCQAEKCGADLTDAKRYHRRHKV  105

Query  877   CEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             CE HAKAA V   GL QRFCQQCSRFH LSEFD  KRSC
Sbjct  106   CEVHAKAAMVEVAGLRQRFCQQCSRFHELSEFDEAKRSC  144



>ref|XP_010278485.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X2 
[Nelumbo nucifera]
Length=464

 Score =   111 bits (278),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  997  RLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFC  818
            +L +RSRA    S  TPRCQ EGCN DL+ AK YHRRH+VCE H+K   VI  GL +RFC
Sbjct  137  KLAKRSRA-SYQSTQTPRCQVEGCNLDLSSAKDYHRRHRVCESHSKCPKVIVAGLERRFC  195

Query  817  QQCSRFHVLSEFDNGKRSC  761
            QQCSRFH LSEFD  KRSC
Sbjct  196  QQCSRFHDLSEFDEKKRSC  214



>emb|CAB56569.1| squamosa promoter binding protein-homologue 4 [Antirrhinum majus]
Length=257

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = -2

Query  1072  FSGASL-GLNLGGRTYF----SSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTH  908
             FS +SL GLN G + YF    SS      ++  R    V  G    PRCQ EGC  DL+ 
Sbjct  3     FSSSSLNGLNFGKKIYFENVGSSGLQSSPSKKGRSGGVVQGG--QPPRCQVEGCKIDLSD  60

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AK Y+ RHKVC  H+K+  VI  G+ QRFCQQCSRFH L EFD GKRSC
Sbjct  61    AKAYYSRHKVCGMHSKSPKVIVAGIEQRFCQQCSRFHQLPEFDQGKRSC  109



>ref|XP_004488737.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X2 [Cicer arietinum]
Length=171

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  985  RSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
            + R   +G F+ P CQAE C+AD T +K YHRRHKVCE H+KA +V+  GL QRFCQQCS
Sbjct  41   KKRPSKSGRFSPPFCQAESCDADFTLSKRYHRRHKVCEVHSKAPSVVVAGLRQRFCQQCS  100

Query  805  RFHVLSEFDNGKRSC  761
            RFH L EFD  KRSC
Sbjct  101  RFHELMEFDEAKRSC  115



>ref|XP_009760116.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana sylvestris]
Length=136

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -2

Query  994  LYRRSRAVDAGSFNT-PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFC  818
            L R  R V  G  +  P CQ E C AD+ +AK YHRRHKVCEFHAKA  V+ GGL QRFC
Sbjct  34   LTRSGRKVPGGEGSKLPSCQIEDCTADMANAKTYHRRHKVCEFHAKAPAVLIGGLRQRFC  93

Query  817  QQCSRFHVLSEFDNGKRSC  761
            QQCSRFH L EFD  KRSC
Sbjct  94   QQCSRFHQLGEFDEAKRSC  112



>ref|XP_001775627.1| predicted protein [Physcomitrella patens]
 gb|EDQ59574.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   113 bits (282),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -2

Query  988  RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
            ++ RA+   S   PRCQ +GC+ADL+  K YH+RHKVCE H+KAAT IA G+ QRFCQQC
Sbjct  225  KKQRALSP-STQIPRCQVQGCDADLSCCKDYHKRHKVCEMHSKAATAIAAGIEQRFCQQC  283

Query  808  SRFHVLSEFDNGKRSC  761
            SRFHVL EFD GKRSC
Sbjct  284  SRFHVLKEFDEGKRSC  299



>ref|XP_010538149.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
 ref|XP_010538150.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
 ref|XP_010538151.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
 ref|XP_010538152.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
 ref|XP_010538153.1| PREDICTED: squamosa promoter-binding-like protein 2 [Tarenaya 
hassleriana]
Length=443

 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLY------RRSRAVDAGSFNTPRCQAEGCNADLTHAKHY  896
             LGL LG RTYF        N +       +R++++       PRCQ EGCN DL+ AK Y
Sbjct  124   LGLKLGKRTYFEDVCAGGNNVVKGQLLPEKRAKSIPQSLQQAPRCQVEGCNLDLSSAKDY  183

Query  895   HRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             HR+H+VC  H+K   V+ GGL +RFCQQCSRFH LSEFD  KRSC
Sbjct  184   HRKHRVCGSHSKCPIVLVGGLERRFCQQCSRFHGLSEFDGKKRSC  228



>emb|CBI24049.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = -2

Query  1057  LGLNLGGRTYF----SSAEDDFVNRLYRRSRAVDAG--------SFNTPRCQAEGCNADL  914
             +GL LG RTYF    +++           + +V A         S  TPRCQ EGCN DL
Sbjct  2     IGLKLGKRTYFEDVCAASTAKTTTSSVNPASSVSATKRFRTSYQSSQTPRCQVEGCNLDL  61

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
               AK YHRRH++CE H+K+  VI  GL +RFCQQCSRFH L+EFD+ KRSC
Sbjct  62    KSAKDYHRRHRICENHSKSPKVIVAGLERRFCQQCSRFHELTEFDDKKRSC  112



>ref|XP_010534410.1| PREDICTED: squamosa promoter-binding-like protein 14 isoform 
X2 [Tarenaya hassleriana]
Length=1044

 Score =   113 bits (283),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -2

Query  1084  GGVEFSG--ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLT  911
             GG E  G   SL LNLG  +  +  E+   NR  ++ R    G  N P+CQ + C  DL+
Sbjct  96    GGGESEGDERSLDLNLG--SCPNPVEETQPNRPNKKVRPGSPGGSNYPKCQVDCCTEDLS  153

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              AK YHRRHKVCE H+KA+  + G   QRFCQQCSRFH+LSEFD GKRSC
Sbjct  154   TAKDYHRRHKVCEVHSKASKALVGNQMQRFCQQCSRFHLLSEFDEGKRSC  203



>ref|XP_010534402.1| PREDICTED: squamosa promoter-binding-like protein 14 isoform 
X1 [Tarenaya hassleriana]
Length=1046

 Score =   113 bits (282),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -2

Query  1084  GGVEFSG--ASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLT  911
             GG E  G   SL LNLG  +  +  E+   NR  ++ R    G  N P+CQ + C  DL+
Sbjct  96    GGGESEGDERSLDLNLG--SCPNPVEETQPNRPNKKVRPGSPGGSNYPKCQVDCCTEDLS  153

Query  910   HAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              AK YHRRHKVCE H+KA+  + G   QRFCQQCSRFH+LSEFD GKRSC
Sbjct  154   TAKDYHRRHKVCEVHSKASKALVGNQMQRFCQQCSRFHLLSEFDEGKRSC  203



>ref|XP_011042488.1| PREDICTED: squamosa promoter-binding-like protein 7 [Populus 
euphratica]
Length=409

 Score =   110 bits (275),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  961  SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
            S N PRCQ EGC+  L +AK YHRRHKVCE H+KA  VI  GL QRFCQQCSRFHV+SEF
Sbjct  170  SVNVPRCQVEGCHVALLNAKDYHRRHKVCEMHSKAPKVIVLGLEQRFCQQCSRFHVVSEF  229

Query  781  DNGKRSC  761
            D+ KRSC
Sbjct  230  DDAKRSC  236



>emb|CDP07242.1| unnamed protein product [Coffea canephora]
Length=1065

 Score =   113 bits (282),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 67/109 (61%), Gaps = 1/109 (1%)
 Frame = -2

Query  1087  LGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTH  908
             LG    SG   G   G  T F+S  D+ V+R  +R R+   GS   P CQ + C  DL+H
Sbjct  86    LGSDSGSGGKAGDAAGTSTSFNST-DEPVSRPNKRVRSGSPGSATYPMCQVDHCEEDLSH  144

Query  907   AKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             AK YHRRHKVCEFH+KA   +     QRFCQQCSRFH L EFD GKRSC
Sbjct  145   AKDYHRRHKVCEFHSKATKALVSKQMQRFCQQCSRFHPLPEFDEGKRSC  193



>gb|KEH24442.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=860

 Score =   113 bits (282),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -2

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
             V+V + E   G+   G +L LNLGG        +       ++SR    GS +   CQ E
Sbjct  95    VIVVEDELGLGLNKEGGNLSLNLGGGVATWEGNNG------KKSRVAGGGSSSRAFCQVE  148

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              C ADL +AK YHRRHKVCE H+KA+  + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  149   DCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRFHLLQEFDEGKRSC  205



>ref|XP_007043985.1| Squamosa promoter binding protein-like 2, putative isoform 1 
[Theobroma cacao]
 ref|XP_007043986.1| Squamosa promoter binding protein-like 2, putative isoform 2, 
partial [Theobroma cacao]
 ref|XP_007043987.1| Squamosa promoter binding protein-like 2, putative isoform 1 
[Theobroma cacao]
 ref|XP_007043988.1| Squamosa promoter binding protein-like 2, putative isoform 2, 
partial [Theobroma cacao]
 ref|XP_007043989.1| Squamosa promoter binding protein-like 2, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOX99816.1| Squamosa promoter binding protein-like 2, putative isoform 1 
[Theobroma cacao]
 gb|EOX99817.1| Squamosa promoter binding protein-like 2, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOX99818.1| Squamosa promoter binding protein-like 2, putative isoform 1 
[Theobroma cacao]
 gb|EOX99819.1| Squamosa promoter binding protein-like 2, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOX99820.1| Squamosa promoter binding protein-like 2, putative isoform 2, 
partial [Theobroma cacao]
Length=480

 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 75/135 (56%), Gaps = 21/135 (16%)
 Frame = -2

Query  1105  VPKSEPLGGVEFSGASLG-------LNLGGRTYFS-------------SAEDDFVNRLYR  986
             V K EP G      AS+G       L LG RTYF              SA         +
Sbjct  115   VSKVEPTGTSPTLEASVGSGEPLLSLKLGKRTYFEDVCAGSNAKISSCSATPAPSPTTAK  174

Query  985   RSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
             RS+  +  S + P CQ EGCN DL+ AK YHR+H+VCE H+K+  VI GGL +RFCQQCS
Sbjct  175   RSKP-NCQSTHVPHCQVEGCNLDLSSAKDYHRKHRVCESHSKSPKVIVGGLERRFCQQCS  233

Query  805   RFHVLSEFDNGKRSC  761
             RFH LSEFD  KRSC
Sbjct  234   RFHGLSEFDEKKRSC  248



>ref|XP_004488736.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X1 [Cicer arietinum]
Length=181

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  985  RSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCS  806
            + R   +G F+ P CQAE C+AD T +K YHRRHKVCE H+KA +V+  GL QRFCQQCS
Sbjct  51   KKRPSKSGRFSPPFCQAESCDADFTLSKRYHRRHKVCEVHSKAPSVVVAGLRQRFCQQCS  110

Query  805  RFHVLSEFDNGKRSC  761
            RFH L EFD  KRSC
Sbjct  111  RFHELMEFDEAKRSC  125



>gb|KDP20990.1| hypothetical protein JCGZ_21461 [Jatropha curcas]
Length=142

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = -2

Query  976  AVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFH  797
            ++ +GS     CQA+ C AD+T AK YHRRHKVCEFHAKA  V+  G+ QRFCQQCSRFH
Sbjct  46   SIGSGSMPPVSCQADNCTADMTDAKRYHRRHKVCEFHAKAPLVVVAGIQQRFCQQCSRFH  105

Query  796  VLSEFDNGKRSC  761
             LSEFD+ KRSC
Sbjct  106  GLSEFDDNKRSC  117



>ref|XP_002280160.1| PREDICTED: squamosa promoter-binding-like protein 13A [Vitis 
vinifera]
 ref|XP_010663753.1| PREDICTED: squamosa promoter-binding-like protein 13A [Vitis 
vinifera]
 emb|CAN77059.1| hypothetical protein VITISV_022138 [Vitis vinifera]
 emb|CBI15679.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   110 bits (274),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 77/138 (56%), Gaps = 27/138 (20%)
 Frame = -2

Query  1105  VPKSEPLGGVEFSGA-------SLGLNLGGRTYFSSAEDDFVNRLY--------------  989
             +P  + +GG   SG        S+ L LG     S+   DF ++L               
Sbjct  20    IPNIDVVGGTSSSGVHKTGGDFSIDLKLG---QVSNPSSDFADKLKEQKFSSIAAPLPSG  76

Query  988   --RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQ  815
               +R+RA + GS  T  C  +GCN+DL++ + YHRRHKVCE H+K A V  GG TQRFCQ
Sbjct  77    SSKRARATNNGS-QTVSCLVDGCNSDLSNCREYHRRHKVCELHSKTAQVTIGGHTQRFCQ  135

Query  814   QCSRFHVLSEFDNGKRSC  761
             QCSRFH L EFD GKRSC
Sbjct  136   QCSRFHSLEEFDEGKRSC  153



>ref|XP_002514905.1| LIGULELESS1 protein, putative [Ricinus communis]
 gb|EEF47459.1| LIGULELESS1 protein, putative [Ricinus communis]
Length=483

 Score =   111 bits (277),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 65/112 (58%), Gaps = 13/112 (12%)
 Frame = -2

Query  1057  LGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFN-------------TPRCQAEGCNAD  917
             LGL LG RTYF         +    S A+   S +             TPRCQ EGCN D
Sbjct  137   LGLKLGKRTYFEDVCAGSNIKSSSFSSAIPGSSISPPKRSKSSSQASSTPRCQVEGCNLD  196

Query  916   LTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             L+ AK YHR+H+VCE H+K   VI  GL +RFCQQCSRFH LSEFD  KRSC
Sbjct  197   LSSAKDYHRKHRVCENHSKCPKVIVAGLERRFCQQCSRFHGLSEFDEKKRSC  248



>ref|XP_004155257.1| PREDICTED: protein AATF-like [Cucumis sativus]
Length=833

 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = -2

Query  1051  LNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-PRCQAEGCNADLTHAKHYHRRHKVC  875
             LNLG R YF   ED     L    RA       T PRCQ EGC+  L +AK YHRRH+VC
Sbjct  247   LNLGKRHYF---EDSNAPSLILGKRAKPPFYATTVPRCQVEGCHVALVNAKDYHRRHRVC  303

Query  874   EFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             E H+KA  V+  GL QRFCQQCSRFHV+SEFD+ KRSC
Sbjct  304   EMHSKAPKVVVLGLDQRFCQQCSRFHVISEFDDSKRSC  341



>gb|EEC72603.1| hypothetical protein OsI_06074 [Oryza sativa Indica Group]
Length=359

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 71/111 (64%), Gaps = 19/111 (17%)
 Frame = -2

Query  1036  RTYFSSAEDDFVNRLYRRSR-------------------AVDAGSFNTPRCQAEGCNADL  914
             RTYFS A+   V+RL  RSR                   A  A     PRCQAEGC ADL
Sbjct  48    RTYFSPADVLAVDRLLLRSRLGGMGMEMGMGMGVLGLGLAAAAHHHQPPRCQAEGCKADL  107

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AKHYHRRHKVC+FHAKAA V+A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  108   SAAKHYHRRHKVCDFHAKAAAVLAAGKQQRFCQQCSRFHVLAEFDEAKRSC  158



>ref|XP_004297083.1| PREDICTED: squamosa promoter-binding-like protein 1-like [Fragaria 
vesca subsp. vesca]
Length=1033

 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -2

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
             V+V   E    V+    SL L LGG+ Y    E+D       +++ V   S N   CQ E
Sbjct  100   VIVENEE----VDDEAGSLNLKLGGQVY-PILEEDVKTGKKMKTKIVGTTS-NRAVCQVE  153

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              C ADL+HAK YHRRHKVC  HA+A   + G + QRFCQQCSRFHVL EFD GKRSC
Sbjct  154   DCKADLSHAKDYHRRHKVCHMHARATRAMVGNILQRFCQQCSRFHVLQEFDEGKRSC  210



>ref|XP_002302512.1| hypothetical protein POPTR_0002s14330g [Populus trichocarpa]
 gb|EEE81785.1| hypothetical protein POPTR_0002s14330g [Populus trichocarpa]
Length=398

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  958  FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
             N PRCQ EGC+  L +AK YHRRHKVCE H+KAA VI  GL QRFCQQCSRFHV+SEFD
Sbjct  163  VNVPRCQVEGCHVALVNAKGYHRRHKVCEMHSKAAKVIVLGLEQRFCQQCSRFHVVSEFD  222

Query  778  NGKRSC  761
            + KRSC
Sbjct  223  DAKRSC  228



>gb|EMT11741.1| Squamosa promoter-binding-like protein 10 [Aegilops tauschii]
Length=259

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 58/88 (66%), Gaps = 7/88 (8%)
 Frame = -2

Query  1003  VNRLYRRSRAVDAGSF-------NTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVI  845
             V+R+  RSR                PRCQ E C ADL+ AKHYHR HKVCE+HAKAA V 
Sbjct  4     VDRMLMRSRLGGVFGLGFGRAHHQAPRCQVEDCKADLSGAKHYHRCHKVCEYHAKAALVS  63

Query  844   AGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             A G  QRFCQQCSRFH+L+EFD  KRSC
Sbjct  64    AAGKQQRFCQQCSRFHLLTEFDEAKRSC  91



>gb|EEE56429.1| hypothetical protein OsJ_05597 [Oryza sativa Japonica Group]
Length=359

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 71/111 (64%), Gaps = 19/111 (17%)
 Frame = -2

Query  1036  RTYFSSAEDDFVNRLYRRSR-------------------AVDAGSFNTPRCQAEGCNADL  914
             RTYFS A+   V+RL  RSR                   A  A     PRCQAEGC ADL
Sbjct  48    RTYFSPADVLAVDRLLLRSRLGGMGMEMGMGMGVLGLGLAAAAHHHQPPRCQAEGCKADL  107

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AKHYHRRHKVC+FHAKAA V+A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  108   SAAKHYHRRHKVCDFHAKAAAVLAAGKQQRFCQQCSRFHVLAEFDEAKRSC  158



>ref|XP_010943949.1| PREDICTED: squamosa promoter-binding protein 1-like [Elaeis guineensis]
Length=178

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  949  PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
            P CQAE C ADLT AK YHRRHKVCE H+KA+ VI  GL QRFCQQCSRFH LSEFD+ K
Sbjct  66   PCCQAEKCTADLTEAKRYHRRHKVCEAHSKASIVIVAGLRQRFCQQCSRFHELSEFDDSK  125

Query  769  RSC  761
            RSC
Sbjct  126  RSC  128



>ref|XP_010943552.1| PREDICTED: squamosa promoter-binding-like protein 14 isoform 
X4 [Elaeis guineensis]
Length=438

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  988  RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
            RR + V  G    PRCQ EGC  DLT AK Y+ RHKVC  H+KA  VI GGL QRFCQQC
Sbjct  141  RRGKGVVHGGQGPPRCQVEGCKLDLTGAKAYYCRHKVCGMHSKAPKVIVGGLEQRFCQQC  200

Query  808  SRFHVLSEFDNGKRSC  761
            SRFH LSEFD GKRSC
Sbjct  201  SRFHQLSEFDQGKRSC  216



>gb|ADY75712.1| SPL3-like protein [Eucalyptus globulus]
Length=147

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  949  PRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGK  770
            P CQAE C+ D+T AK YHRRHKVCEFHAKA+  +  GL QRFCQQCSRFH LSEFD  K
Sbjct  61   PMCQAENCSIDMTDAKRYHRRHKVCEFHAKASVAMVAGLRQRFCQQCSRFHELSEFDEAK  120

Query  769  RSC  761
            RSC
Sbjct  121  RSC  123



>ref|XP_010943550.1| PREDICTED: squamosa promoter-binding-like protein 17 isoform 
X2 [Elaeis guineensis]
Length=446

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  988  RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
            RR + V  G    PRCQ EGC  DLT AK Y+ RHKVC  H+KA  VI GGL QRFCQQC
Sbjct  141  RRGKGVVHGGQGPPRCQVEGCKLDLTGAKAYYCRHKVCGMHSKAPKVIVGGLEQRFCQQC  200

Query  808  SRFHVLSEFDNGKRSC  761
            SRFH LSEFD GKRSC
Sbjct  201  SRFHQLSEFDQGKRSC  216



>gb|AES82254.2| squamosa promoter-binding-like protein [Medicago truncatula]
Length=1001

 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -2

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
             V+V + E   G+   G +L LNLGG        +       ++SR    GS +   CQ E
Sbjct  95    VIVVEDELGLGLNKEGGNLSLNLGGGVATWEGNNG------KKSRVAGGGSSSRAFCQVE  148

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              C ADL +AK YHRRHKVCE H+KA+  + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  149   DCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRFHLLQEFDEGKRSC  205



>ref|XP_010943549.1| PREDICTED: squamosa promoter-binding-like protein 14 isoform 
X1 [Elaeis guineensis]
Length=449

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  988  RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
            RR + V  G    PRCQ EGC  DLT AK Y+ RHKVC  H+KA  VI GGL QRFCQQC
Sbjct  141  RRGKGVVHGGQGPPRCQVEGCKLDLTGAKAYYCRHKVCGMHSKAPKVIVGGLEQRFCQQC  200

Query  808  SRFHVLSEFDNGKRSC  761
            SRFH LSEFD GKRSC
Sbjct  201  SRFHQLSEFDQGKRSC  216



>ref|XP_010943551.1| PREDICTED: squamosa promoter-binding-like protein 14 isoform 
X3 [Elaeis guineensis]
Length=445

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  988  RRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQC  809
            RR + V  G    PRCQ EGC  DLT AK Y+ RHKVC  H+KA  VI GGL QRFCQQC
Sbjct  141  RRGKGVVHGGQGPPRCQVEGCKLDLTGAKAYYCRHKVCGMHSKAPKVIVGGLEQRFCQQC  200

Query  808  SRFHVLSEFDNGKRSC  761
            SRFH LSEFD GKRSC
Sbjct  201  SRFHQLSEFDQGKRSC  216



>gb|KEH38697.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=171

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  967  AGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLS  788
             G F++P CQ E C ADLT +K YHRRHKVCE H+KA+ V+  G+ QRFCQQCSRFH L+
Sbjct  50   GGRFSSPICQVESCGADLTFSKRYHRRHKVCEVHSKASVVVVAGMRQRFCQQCSRFHELA  109

Query  787  EFDNGKRSC  761
            EFD  KRSC
Sbjct  110  EFDESKRSC  118



>gb|AGI62059.1| SQUAMOSA promoter-binding-like 11 [Erycina pusilla]
Length=1011

 Score =   112 bits (280),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = -2

Query  1060  SLGLNLGGRTYFSSAED-DFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRH  884
             SL L LG   Y    ED + V     +   V   + N P+CQ + C ADL+ +K YHRRH
Sbjct  107   SLTLKLGAHAYPVMEEDLNLVGMKNGKRVMVQVNNPNHPKCQVQNCCADLSQSKDYHRRH  166

Query  883   KVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             KVCE HAKA++ + G + QRFCQQCSRFH+L EFD GKRSC
Sbjct  167   KVCEMHAKASSAVVGNVIQRFCQQCSRFHLLQEFDEGKRSC  207



>ref|XP_002510746.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF52933.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=1073

 Score =   112 bits (280),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = -2

Query  1099  KSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNA  920
             K+ P  G E  G  L LNL G   F++ E+  V+R  +R R+   G+   P CQ + C  
Sbjct  102   KNAPPAGDEDDG--LRLNLAG--VFNAVEEP-VSRPNKRVRSGSPGTATYPMCQVDNCKE  156

Query  919   DLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             DL++AK YHRRHKVCE H+K+   + G   QRFCQQCSRFH LSEFD GKRSC
Sbjct  157   DLSNAKDYHRRHKVCELHSKSTQALVGKQMQRFCQQCSRFHPLSEFDEGKRSC  209



>ref|XP_003626036.1| SQUAMOSA promoter binding protein [Medicago truncatula]
Length=994

 Score =   112 bits (280),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -2

Query  1111  VVVPKSEPLGGVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAE  932
             V+V + E   G+   G +L LNLGG        +       ++SR    GS +   CQ E
Sbjct  95    VIVVEDELGLGLNKEGGNLSLNLGGGVATWEGNNG------KKSRVAGGGSSSRAFCQVE  148

Query  931   GCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
              C ADL +AK YHRRHKVCE H+KA+  + G   QRFCQQCSRFH+L EFD GKRSC
Sbjct  149   DCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRFHLLQEFDEGKRSC  205



>gb|AGI62051.1| SQUAMOSA promoter-binding-like 3 [Erycina pusilla]
Length=456

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -2

Query  1078  VEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKH  899
             VE     +GL LG RTYF +          +RSRA    + +T  CQ EGCN DLT AK 
Sbjct  112   VESGEPPIGLKLGKRTYFENLVSSNAKISMKRSRASHQANQHT-YCQVEGCNFDLTAAKD  170

Query  898   YHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             YHR+H+VCE H+K+  V+  G  +RFCQQCSRFH LSEFD  KRSC
Sbjct  171   YHRKHRVCERHSKSPRVVVSGHERRFCQQCSRFHDLSEFDQKKRSC  216



>ref|XP_003547153.1| PREDICTED: squamosa promoter-binding protein 1-like [Glycine 
max]
 gb|KHN24765.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=138

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -2

Query  1015  EDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGG  836
             +D    ++    R   AG    P CQ +GC+ADL+ AK YHRRHKVCE+HAKA  V+ G 
Sbjct  33    DDGRKKKVVSSKRGSKAGGSVPPSCQVDGCSADLSEAKPYHRRHKVCEYHAKAPAVLIGD  92

Query  835   LTQRFCQQCSRFHVLSEFDNGKRSC  761
               QRFCQQCSRFH LSEFD+ KRSC
Sbjct  93    QHQRFCQQCSRFHELSEFDDSKRSC  117



>ref|NP_001046066.2| Os02g0177300 [Oryza sativa Japonica Group]
 dbj|BAD27984.1| putative SBP-domain protein [Oryza sativa Japonica Group]
 dbj|BAF07980.2| Os02g0177300 [Oryza sativa Japonica Group]
Length=458

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 71/111 (64%), Gaps = 19/111 (17%)
 Frame = -2

Query  1036  RTYFSSAEDDFVNRLYRRSR-------------------AVDAGSFNTPRCQAEGCNADL  914
             RTYFS A+   V+RL  RSR                   A  A     PRCQAEGC ADL
Sbjct  147   RTYFSPADVLAVDRLLLRSRLGGMGMEMGMGMGVLGLGLAAAAHHHQPPRCQAEGCKADL  206

Query  913   THAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             + AKHYHRRHKVC+FHAKAA V+A G  QRFCQQCSRFHVL+EFD  KRSC
Sbjct  207   SAAKHYHRRHKVCDFHAKAAAVLAAGKQQRFCQQCSRFHVLAEFDEAKRSC  257



>ref|XP_002275728.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Vitis 
vinifera]
 emb|CBI21879.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  943  CQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRS  764
            CQAE C ADLT AK YHRRHKVCE HAKA  V+ GG+ QRFCQQCSRFH LSEFD  KRS
Sbjct  50   CQAERCTADLTDAKQYHRRHKVCEHHAKAQVVVVGGIRQRFCQQCSRFHELSEFDEAKRS  109

Query  763  C  761
            C
Sbjct  110  C  110



>gb|EYU33445.1| hypothetical protein MIMGU_mgv1a005903mg [Erythranthe guttata]
Length=465

 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 20/146 (14%)
 Frame = -2

Query  1153  SHQVPLLSQEAAGFVVVPKSEPLGGVEFSGASLGLNLGGRTYFSSA--------------  1016
             S+++ +   E +G   V ++  +G VE     +GL LG RTYF ++              
Sbjct  104   SNKIEMKETEVSGTYPVLEAS-VGSVE---PLIGLKLGKRTYFENSGAGGNVKSVSSSSS  159

Query  1015  -EDDFVNRLYRRSRAVDAGSFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAG  839
                +    L +++++    +   PRC  +GCNADL+ AK YHR+H+VC+ H+K A VI G
Sbjct  160   VVPNTSTSLLKKTKS-PGQNLPAPRCAVDGCNADLSTAKDYHRKHRVCDGHSKCAKVIVG  218

Query  838   GLTQRFCQQCSRFHVLSEFDNGKRSC  761
             GL +RFCQQCSRFH LSEFD  KRSC
Sbjct  219   GLERRFCQQCSRFHNLSEFDERKRSC  244



>ref|XP_011017438.1| PREDICTED: squamosa promoter-binding-like protein 7 [Populus 
euphratica]
Length=401

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  958  FNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFD  779
             N PRCQ EGC+  L +AK YHRRHKVCE H+KAA VI  GL QRFCQQCSRFHV+SEFD
Sbjct  163  VNVPRCQVEGCHVALVNAKGYHRRHKVCEMHSKAAKVIVLGLEQRFCQQCSRFHVVSEFD  222

Query  778  NGKRSC  761
            + KRSC
Sbjct  223  DAKRSC  228



>ref|XP_010932155.1| PREDICTED: squamosa promoter-binding-like protein 15 [Elaeis 
guineensis]
 ref|XP_010932156.1| PREDICTED: squamosa promoter-binding-like protein 15 [Elaeis 
guineensis]
Length=1093

 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = -2

Query  1081  GVEFSGASLGLNLGGRTYFSSAEDDFVNRLYRRSRAVDAGSFNT-PRCQAEGCNADLTHA  905
             G+E  G +L L LGG  Y +S E   V R  +R R+   GS  + P CQ + C ADL++A
Sbjct  122   GLEEDGENLTLKLGGANYTASEEP--VARPNKRVRSGSPGSGGSYPMCQVDDCRADLSNA  179

Query  904   KHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEFDNGKRSC  761
             K YHRRHKVCE H+K    + G   QRFCQQCSRFH LSEFD GKRSC
Sbjct  180   KDYHRRHKVCEVHSKTTKALVGKQMQRFCQQCSRFHPLSEFDEGKRSC  227



>ref|XP_006375256.1| hypothetical protein POPTR_0014s05690g [Populus trichocarpa]
 gb|ERP53053.1| hypothetical protein POPTR_0014s05690g [Populus trichocarpa]
Length=408

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  961  SFNTPRCQAEGCNADLTHAKHYHRRHKVCEFHAKAATVIAGGLTQRFCQQCSRFHVLSEF  782
            S N PRCQ EGC+  L +AK YHRRHKVCE H+KA  VI  GL QRFCQQCSRFHV+SEF
Sbjct  169  SVNVPRCQVEGCHVALLNAKDYHRRHKVCEMHSKAPKVIVLGLEQRFCQQCSRFHVVSEF  228

Query  781  DNGKRSC  761
            D+ KRSC
Sbjct  229  DDAKRSC  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791533042520