BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20828_g1_i3 len=2014 path=[2384:0-713 3098:714-722 3107:723-818
@4900@!:819-1903 4284:1904-2013]

Length=2014
                                                                      Score     E

ref|XP_007019285.1|  ACT domain repeat 3 isoform 1                      722   0.0      
ref|XP_002268570.1|  PREDICTED: uncharacterized protein LOC100250...    720   0.0      Vitis vinifera
ref|XP_003634395.1|  PREDICTED: uncharacterized protein LOC100250...    720   0.0      
ref|XP_010664860.1|  PREDICTED: uncharacterized protein LOC100250...    720   0.0      
ref|XP_004242056.1|  PREDICTED: uncharacterized protein LOC101244...    717   0.0      
ref|XP_002520259.1|  amino acid binding protein, putative               714   0.0      Ricinus communis
ref|XP_008237781.1|  PREDICTED: uncharacterized protein LOC103336...    714   0.0      
ref|XP_007201032.1|  hypothetical protein PRUPE_ppa005671mg             713   0.0      
ref|XP_009368404.1|  PREDICTED: uncharacterized protein LOC103957905    712   0.0      
ref|XP_009790961.1|  PREDICTED: uncharacterized protein LOC104238336    711   0.0      
ref|XP_006356716.1|  PREDICTED: uncharacterized protein LOC102587087    711   0.0      
gb|KDP43084.1|  hypothetical protein JCGZ_25270                         710   0.0      
emb|CDP11981.1|  unnamed protein product                                709   0.0      
ref|XP_010062190.1|  PREDICTED: uncharacterized protein LOC104449657    708   0.0      
ref|XP_008237779.1|  PREDICTED: uncharacterized protein LOC103336...    707   0.0      
ref|XP_008381705.1|  PREDICTED: uncharacterized protein LOC103444...    703   0.0      
ref|XP_011101934.1|  PREDICTED: uncharacterized protein LOC105179968    700   0.0      
ref|XP_009360670.1|  PREDICTED: uncharacterized protein LOC103951...    697   0.0      
ref|XP_006434331.1|  hypothetical protein CICLE_v10001100mg             695   0.0      
ref|XP_002306671.1|  ACT domain-containing family protein               694   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006472891.1|  PREDICTED: uncharacterized protein LOC102609...    694   0.0      
ref|XP_010999853.1|  PREDICTED: uncharacterized protein LOC105107576    691   0.0      
ref|XP_010679322.1|  PREDICTED: uncharacterized protein LOC104894719    691   0.0      
gb|KHG13930.1|  [Protein-PII] uridylyltransferase                       689   0.0      
ref|XP_011027407.1|  PREDICTED: uncharacterized protein LOC105127...    687   0.0      
ref|XP_004290721.1|  PREDICTED: uncharacterized protein LOC101309692    686   0.0      
ref|XP_010270359.1|  PREDICTED: uncharacterized protein LOC104606716    685   0.0      
ref|XP_002302203.1|  hypothetical protein POPTR_0002s07550g             684   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003523410.1|  PREDICTED: uncharacterized protein LOC100789...    675   0.0      
ref|XP_003541896.1|  PREDICTED: uncharacterized protein LOC100797...    674   0.0      
ref|XP_006596251.1|  PREDICTED: uncharacterized protein LOC100789...    673   0.0      
ref|XP_003526664.1|  PREDICTED: uncharacterized protein LOC100797...    671   0.0      
ref|XP_006581605.1|  PREDICTED: uncharacterized protein LOC100797...    670   0.0      
ref|XP_010537315.1|  PREDICTED: uncharacterized protein LOC104812060    669   0.0      
gb|EYU32470.1|  hypothetical protein MIMGU_mgv1a006244mg                666   0.0      
ref|XP_006390132.1|  hypothetical protein EUTSA_v10018530mg             664   0.0      
gb|KHN23444.1|  [Protein-PII] uridylyltransferase                       666   0.0      
ref|XP_007137510.1|  hypothetical protein PHAVU_009G133100g             663   0.0      
ref|XP_010260456.1|  PREDICTED: uncharacterized protein LOC104599...    660   0.0      
ref|XP_004498366.1|  PREDICTED: uncharacterized protein LOC101494...    660   0.0      
ref|NP_565146.1|  ACT domain-containing protein 3                       660   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104635.1|  PREDICTED: uncharacterized protein LOC103830578    660   0.0      
emb|CDX79183.1|  BnaC06g21200D                                          659   0.0      
ref|XP_010428767.1|  PREDICTED: uncharacterized protein LOC104713366    659   0.0      
ref|XP_010416625.1|  PREDICTED: uncharacterized protein LOC104702470    657   0.0      
gb|AAM65519.1|  unknown                                                 657   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX87550.1|  BnaA07g33230D                                          656   0.0      
ref|XP_009106363.1|  PREDICTED: uncharacterized protein LOC103832156    653   0.0      
emb|CDX88335.1|  BnaC06g37790D                                          652   0.0      
ref|XP_004502566.1|  PREDICTED: uncharacterized protein LOC101511775    652   0.0      
ref|XP_010260453.1|  PREDICTED: uncharacterized protein LOC104599...    652   0.0      
emb|CDX68068.1|  BnaA07g21080D                                          652   0.0      
ref|XP_002887664.1|  hypothetical protein ARALYDRAFT_476859             650   0.0      
gb|KEH35390.1|  four ACT domain ACT domain protein which protein        650   0.0      
ref|XP_010089340.1|  [Protein-PII] uridylyltransferase                  647   0.0      
gb|EPS66237.1|  hypothetical protein M569_08538                         623   0.0      
ref|XP_011027413.1|  PREDICTED: uncharacterized protein LOC105127...    614   0.0      
ref|XP_008808483.1|  PREDICTED: uncharacterized protein LOC103720...    613   0.0      
gb|KEH40482.1|  four ACT domain ACT domain protein which protein        605   0.0      
ref|XP_010930652.1|  PREDICTED: uncharacterized protein LOC105051758    594   0.0      
ref|XP_009416935.1|  PREDICTED: uncharacterized protein LOC103997445    590   0.0      
ref|XP_006302326.1|  hypothetical protein CARUB_v10020382mg             588   0.0      
ref|XP_007019287.1|  ACT domain repeat 3 isoform 3                      580   0.0      
ref|XP_010322947.1|  PREDICTED: uncharacterized protein LOC101244...    578   0.0      
ref|XP_007201031.1|  hypothetical protein PRUPE_ppa005671mg             573   0.0      
ref|XP_006847223.1|  hypothetical protein AMTR_s00017p00256400          572   0.0      
ref|XP_008381706.1|  PREDICTED: uncharacterized protein LOC103444...    566   0.0      
ref|XP_008237783.1|  PREDICTED: uncharacterized protein LOC103336...    566   0.0      
ref|XP_009360674.1|  PREDICTED: uncharacterized protein LOC103951...    560   0.0      
gb|ADE76039.1|  unknown                                                 563   0.0      
ref|XP_006472895.1|  PREDICTED: uncharacterized protein LOC102609...    556   0.0      
ref|XP_006578947.1|  PREDICTED: uncharacterized protein LOC100789...    538   0.0      
gb|ABK22147.1|  unknown                                                 536   0.0      Picea sitchensis
ref|XP_009106365.1|  PREDICTED: uncharacterized protein LOC103832...    530   0.0      
ref|XP_004498367.1|  PREDICTED: uncharacterized protein LOC101494...    527   2e-179   
ref|XP_004498368.1|  PREDICTED: uncharacterized protein LOC101494...    523   7e-178   
ref|XP_002990728.1|  hypothetical protein SELMODRAFT_132226             519   8e-175   
ref|XP_009609311.1|  PREDICTED: uncharacterized protein LOC104103130    513   1e-174   
ref|XP_002986703.1|  hypothetical protein SELMODRAFT_124581             517   5e-174   
ref|XP_003575136.1|  PREDICTED: uncharacterized protein LOC100839017    503   5e-169   
ref|XP_007019286.1|  ACT domain repeat 3 isoform 2                      498   9e-169   
ref|XP_008347951.1|  PREDICTED: uncharacterized protein LOC103411072    496   7e-168   
ref|XP_004952805.1|  PREDICTED: uncharacterized protein LOC101775...    498   1e-166   
ref|XP_008808484.1|  PREDICTED: uncharacterized protein LOC103720...    489   1e-164   
gb|KDO83532.1|  hypothetical protein CISIN_1g0127933mg                  484   2e-163   
gb|KDO83531.1|  hypothetical protein CISIN_1g0127933mg                  484   2e-163   
ref|XP_002978936.1|  hypothetical protein SELMODRAFT_109915             488   5e-163   
gb|KHG17797.1|  [Protein-PII] uridylyltransferase                       488   5e-163   
ref|NP_001047123.1|  Os02g0555600                                       489   7e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002986453.1|  hypothetical protein SELMODRAFT_124305             486   2e-162   
ref|XP_011086839.1|  PREDICTED: uncharacterized protein LOC105168...    486   3e-162   
ref|XP_007043904.1|  ACT domain repeat 4 isoform 2                      486   5e-162   
ref|XP_007222134.1|  hypothetical protein PRUPE_ppa005716mg             484   2e-161   
ref|XP_008645795.1|  PREDICTED: uncharacterized protein LOC103627...    484   2e-161   
gb|EYU42079.1|  hypothetical protein MIMGU_mgv1a006197mg                483   4e-161   
ref|XP_009599622.1|  PREDICTED: uncharacterized protein LOC104095244    482   1e-160   
ref|XP_008243801.1|  PREDICTED: uncharacterized protein LOC103342019    482   1e-160   
ref|XP_002266641.1|  PREDICTED: uncharacterized protein LOC100250497    481   3e-160   Vitis vinifera
ref|XP_010249096.1|  PREDICTED: uncharacterized protein LOC104591777    480   6e-160   
ref|XP_008645794.1|  PREDICTED: uncharacterized protein LOC103627...    484   9e-160   
emb|CAN83845.1|  hypothetical protein VITISV_001862                     480   1e-159   Vitis vinifera
ref|XP_002974009.1|  hypothetical protein SELMODRAFT_100599             480   2e-159   
ref|XP_004310107.1|  PREDICTED: uncharacterized protein LOC101292961    478   3e-159   
ref|XP_007222095.1|  hypothetical protein PRUPE_ppa005632mg             478   4e-159   
ref|XP_008222209.1|  PREDICTED: uncharacterized protein LOC103322107    481   4e-159   
ref|XP_008389912.1|  PREDICTED: uncharacterized protein LOC103452175    478   5e-159   
ref|XP_003516462.1|  PREDICTED: uncharacterized protein LOC100787...    478   5e-159   
ref|XP_006367494.1|  PREDICTED: uncharacterized protein LOC102581...    478   5e-159   
ref|XP_006367493.1|  PREDICTED: uncharacterized protein LOC102581...    478   5e-159   
ref|XP_006573170.1|  PREDICTED: uncharacterized protein LOC100787...    478   8e-159   
ref|XP_006856315.1|  hypothetical protein AMTR_s00047p00143120          477   1e-158   
ref|XP_011086838.1|  PREDICTED: uncharacterized protein LOC105168...    477   1e-158   
ref|XP_009343127.1|  PREDICTED: uncharacterized protein LOC103935102    476   2e-158   
ref|XP_002514875.1|  amino acid binding protein, putative               476   2e-158   Ricinus communis
gb|KCW61913.1|  hypothetical protein EUGRSUZ_H04608                     476   2e-158   
gb|KHN29949.1|  [Protein-PII] uridylyltransferase                       476   3e-158   
ref|XP_010025287.1|  PREDICTED: uncharacterized protein LOC104415658    476   3e-158   
ref|XP_003518790.2|  PREDICTED: uncharacterized protein LOC100813...    476   5e-158   
gb|KHN02615.1|  [Protein-PII] uridylyltransferase                       474   7e-158   
ref|XP_004490253.1|  PREDICTED: uncharacterized protein LOC101508...    474   1e-157   
ref|XP_004490255.1|  PREDICTED: uncharacterized protein LOC101508...    474   1e-157   
ref|XP_004490254.1|  PREDICTED: uncharacterized protein LOC101508...    474   1e-157   
ref|XP_008389382.1|  PREDICTED: uncharacterized protein LOC103451737    474   2e-157   
gb|KDP26845.1|  hypothetical protein JCGZ_18003                         474   2e-157   
ref|XP_006844620.1|  hypothetical protein AMTR_s00016p00225040          474   2e-157   
ref|XP_002314917.2|  hypothetical protein POPTR_0010s14840g             473   5e-157   Populus trichocarpa [western balsam poplar]
emb|CDP13377.1|  unnamed protein product                                473   7e-157   
ref|XP_007043903.1|  ACT domain repeat 4 isoform 1                      473   7e-157   
ref|XP_008459880.1|  PREDICTED: uncharacterized protein LOC103498...    472   1e-156   
ref|XP_011102236.1|  PREDICTED: uncharacterized protein LOC105180...    471   2e-156   
ref|XP_010250636.1|  PREDICTED: uncharacterized protein LOC104592829    471   2e-156   
ref|XP_010260920.1|  PREDICTED: uncharacterized protein LOC104599871    471   2e-156   
ref|XP_010091626.1|  [Protein-PII] uridylyltransferase                  471   2e-156   
ref|XP_011102239.1|  PREDICTED: uncharacterized protein LOC105180...    471   2e-156   
ref|XP_010929567.1|  PREDICTED: uncharacterized protein LOC105051...    471   3e-156   
ref|XP_010066810.1|  PREDICTED: uncharacterized protein LOC104453...    471   3e-156   
ref|XP_007161398.1|  hypothetical protein PHAVU_001G065500g             465   3e-156   
ref|XP_010066809.1|  PREDICTED: uncharacterized protein LOC104453...    471   3e-156   
ref|XP_010090668.1|  [Protein-PII] uridylyltransferase                  471   4e-156   
ref|XP_004140541.1|  PREDICTED: uncharacterized protein LOC101218687    469   1e-155   
ref|XP_009792706.1|  PREDICTED: uncharacterized protein LOC104239695    469   1e-155   
ref|XP_008339767.1|  PREDICTED: uncharacterized protein LOC103402787    469   1e-155   
ref|XP_010682711.1|  PREDICTED: uncharacterized protein LOC104897524    469   2e-155   
gb|ADE77534.1|  unknown                                                 468   2e-155   
ref|XP_009627377.1|  PREDICTED: uncharacterized protein LOC104117...    469   2e-155   
ref|XP_009627378.1|  PREDICTED: uncharacterized protein LOC104117...    468   3e-155   
ref|XP_009793984.1|  PREDICTED: uncharacterized protein LOC104240...    468   4e-155   
ref|XP_009793985.1|  PREDICTED: uncharacterized protein LOC104240...    468   5e-155   
gb|KDO70279.1|  hypothetical protein CISIN_1g013090mg                   468   5e-155   
ref|XP_002512031.1|  amino acid binding protein, putative               467   5e-155   Ricinus communis
ref|XP_009793986.1|  PREDICTED: uncharacterized protein LOC104240...    467   6e-155   
ref|XP_006450386.1|  hypothetical protein CICLE_v10010775mg             469   6e-155   
ref|XP_010324768.1|  PREDICTED: uncharacterized protein LOC101260...    467   7e-155   
ref|XP_009784019.1|  PREDICTED: uncharacterized protein LOC104232494    467   7e-155   
ref|XP_004228421.1|  PREDICTED: uncharacterized protein LOC101260...    467   7e-155   
ref|XP_011020651.1|  PREDICTED: uncharacterized protein LOC105122...    467   8e-155   
ref|XP_010324799.1|  PREDICTED: uncharacterized protein LOC101260...    466   9e-155   
ref|XP_011020660.1|  PREDICTED: uncharacterized protein LOC105122...    466   1e-154   
ref|XP_008459879.1|  PREDICTED: uncharacterized protein LOC103498...    467   1e-154   
ref|XP_009356452.1|  PREDICTED: uncharacterized protein LOC103947287    466   1e-154   
ref|XP_007153472.1|  hypothetical protein PHAVU_003G038400g             466   2e-154   
ref|XP_002312346.1|  hypothetical protein POPTR_0008s10860g             465   3e-154   Populus trichocarpa [western balsam poplar]
ref|XP_009105455.1|  PREDICTED: uncharacterized protein LOC103831...    466   3e-154   
ref|XP_010257938.1|  PREDICTED: uncharacterized protein LOC104597...    465   4e-154   
ref|XP_004239021.1|  PREDICTED: uncharacterized protein LOC101259744    465   6e-154   
ref|XP_009105454.1|  PREDICTED: uncharacterized protein LOC103831...    465   6e-154   
ref|XP_010257936.1|  PREDICTED: uncharacterized protein LOC104597...    465   6e-154   
ref|XP_010556116.1|  PREDICTED: uncharacterized protein LOC104825486    465   6e-154   
emb|CDY33557.1|  BnaC06g29950D                                          464   8e-154   
ref|XP_006348650.1|  PREDICTED: uncharacterized protein LOC102583967    464   8e-154   
ref|XP_010936426.1|  PREDICTED: uncharacterized protein LOC105056...    464   9e-154   
ref|XP_010936425.1|  PREDICTED: uncharacterized protein LOC105056...    464   9e-154   
ref|XP_011009617.1|  PREDICTED: uncharacterized protein LOC105114...    464   1e-153   
emb|CDP00474.1|  unnamed protein product                                465   1e-153   
ref|XP_006484247.1|  PREDICTED: uncharacterized protein LOC102622082    464   2e-153   
ref|XP_010543092.1|  PREDICTED: uncharacterized protein LOC104816118    463   2e-153   
ref|XP_006437860.1|  hypothetical protein CICLE_v10031536mg             463   3e-153   
ref|XP_008340245.1|  PREDICTED: uncharacterized protein LOC103403190    463   3e-153   
ref|XP_010681133.1|  PREDICTED: uncharacterized protein LOC104896128    462   5e-153   
gb|KDP41357.1|  hypothetical protein JCGZ_15764                         462   6e-153   
ref|XP_009372243.1|  PREDICTED: uncharacterized protein LOC103961427    462   7e-153   
ref|XP_009611121.1|  PREDICTED: uncharacterized protein LOC104104...    462   7e-153   
ref|XP_002297856.1|  hypothetical protein POPTR_0001s13490g             462   8e-153   Populus trichocarpa [western balsam poplar]
emb|CDX95965.1|  BnaA07g27660D                                          462   8e-153   
ref|XP_010929566.1|  PREDICTED: uncharacterized protein LOC105051...    462   1e-152   
ref|XP_008776535.1|  PREDICTED: uncharacterized protein LOC103696629    462   1e-152   
ref|XP_006437973.1|  hypothetical protein CICLE_v10031521mg             461   1e-152   
ref|XP_003614264.1|  ACR4                                               461   2e-152   
dbj|BAJ33767.1|  unnamed protein product                                461   2e-152   
ref|XP_007045767.1|  ACT domain repeat 4                                462   3e-152   
ref|XP_006391062.1|  hypothetical protein EUTSA_v10018526mg             461   4e-152   
ref|XP_004297204.1|  PREDICTED: uncharacterized protein LOC101300715    460   4e-152   
ref|XP_010241627.1|  PREDICTED: uncharacterized protein LOC104586168    462   5e-152   
ref|XP_009127699.1|  PREDICTED: uncharacterized protein LOC103852547    460   8e-152   
ref|XP_011036119.1|  PREDICTED: uncharacterized protein LOC105133725    459   9e-152   
gb|KDO81815.1|  hypothetical protein CISIN_1g044728mg                   459   9e-152   
emb|CDY65806.1|  BnaA02g35780D                                          459   9e-152   
ref|XP_008445429.1|  PREDICTED: uncharacterized protein LOC103488452    459   1e-151   
ref|XP_010928327.1|  PREDICTED: uncharacterized protein LOC105050...    459   1e-151   
ref|XP_009613079.1|  PREDICTED: uncharacterized protein LOC104106280    459   2e-151   
gb|EPS70014.1|  hypothetical protein M569_04746                         458   3e-151   
ref|XP_010650073.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    457   4e-151   
gb|ACG60681.1|  unknown protein                                         457   5e-151   Brassica oleracea var. alboglabra
ref|XP_004152119.1|  PREDICTED: uncharacterized protein LOC101215960    457   6e-151   
ref|XP_004490252.1|  PREDICTED: uncharacterized protein LOC101508...    458   6e-151   
ref|XP_004490250.1|  PREDICTED: uncharacterized protein LOC101508...    458   6e-151   
ref|XP_002304667.1|  hypothetical protein POPTR_0003s16620g             457   6e-151   Populus trichocarpa [western balsam poplar]
ref|XP_004490251.1|  PREDICTED: uncharacterized protein LOC101508...    458   7e-151   
ref|XP_010928326.1|  PREDICTED: uncharacterized protein LOC105050...    459   8e-151   
ref|XP_008454022.1|  PREDICTED: uncharacterized protein LOC103494569    457   9e-151   
ref|XP_006302244.1|  hypothetical protein CARUB_v10020277mg             457   1e-150   
ref|XP_010470880.1|  PREDICTED: uncharacterized protein LOC104750738    457   1e-150   
ref|XP_010511930.1|  PREDICTED: uncharacterized protein LOC104787960    456   2e-150   
gb|AAF27052.1|AC008262_1  F4N2.2                                        455   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177067.1|  ACT domain-containing protein                         455   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974107.1|  ACT domain-containing protein                         456   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887219.1|  hypothetical protein ARALYDRAFT_476032             455   5e-150   
gb|KGN47669.1|  hypothetical protein Csa_6G367150                       455   5e-150   
ref|XP_004144160.1|  PREDICTED: uncharacterized protein LOC101218703    454   6e-150   
ref|XP_004156949.1|  PREDICTED: uncharacterized LOC101215960            454   6e-150   
ref|XP_010250220.1|  PREDICTED: uncharacterized protein LOC104592...    456   7e-150   
ref|XP_009413600.1|  PREDICTED: uncharacterized protein LOC103994872    454   7e-150   
gb|KHG02132.1|  [Protein-PII] uridylyltransferase                       454   8e-150   
ref|XP_010415531.1|  PREDICTED: uncharacterized protein LOC104701533    454   1e-149   
emb|CDX81587.1|  BnaC02g18910D                                          454   2e-149   
ref|XP_003621757.1|  hypothetical protein MTR_7g022470                  453   2e-149   
ref|XP_010250221.1|  PREDICTED: uncharacterized protein LOC104592...    454   5e-149   
ref|XP_004984033.1|  PREDICTED: uncharacterized protein LOC101763...    452   5e-149   
ref|XP_004984034.1|  PREDICTED: uncharacterized protein LOC101763...    452   6e-149   
gb|KHG00039.1|  [Protein-PII] uridylyltransferase                       451   8e-149   
ref|XP_011020811.1|  PREDICTED: uncharacterized protein LOC105123048    452   8e-149   
ref|XP_007139290.1|  hypothetical protein PHAVU_008G016800g             451   1e-148   
ref|XP_008788826.1|  PREDICTED: uncharacterized protein LOC103706...    452   2e-148   
gb|EAZ23437.1|  hypothetical protein OsJ_07127                          456   3e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004136481.1|  PREDICTED: uncharacterized protein LOC101219701    451   3e-148   
ref|XP_003552661.1|  PREDICTED: uncharacterized protein LOC100816426    450   4e-148   
gb|KHN13850.1|  [Protein-PII] uridylyltransferase                       450   5e-148   
ref|XP_004492064.1|  PREDICTED: uncharacterized protein LOC101498352    449   6e-148   
gb|EAZ27314.1|  hypothetical protein OsJ_11253                          449   6e-148   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90442.1|  hypothetical protein OsI_12028                          449   7e-148   Oryza sativa Indica Group [Indian rice]
ref|XP_008466435.1|  PREDICTED: uncharacterized protein LOC103503843    450   8e-148   
ref|XP_008668558.1|  PREDICTED: ACR4 isoform X1                         449   1e-147   
ref|NP_197914.1|  ACT domain-containing protein                         451   1e-147   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001050359.1|  Os03g0413100                                       449   1e-147   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32101.1|  hypothetical protein JCGZ_12562                         449   1e-147   
ref|NP_001142223.1|  ACR4                                               449   1e-147   Zea mays [maize]
ref|XP_009394314.1|  PREDICTED: uncharacterized protein LOC103979823    448   2e-147   
gb|ACG25547.1|  ACR4                                                    448   3e-147   Zea mays [maize]
gb|EAY86274.1|  hypothetical protein OsI_07644                          453   4e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_009799495.1|  PREDICTED: uncharacterized protein LOC104245...    447   6e-147   
ref|XP_002265013.2|  PREDICTED: uncharacterized protein LOC100264...    447   9e-147   Vitis vinifera
tpg|DAA45793.1|  TPA: hypothetical protein ZEAMMB73_762765              445   2e-146   
ref|XP_010277393.1|  PREDICTED: uncharacterized protein LOC104611...    446   2e-146   
ref|XP_010273298.1|  PREDICTED: uncharacterized protein LOC104608...    447   3e-146   
ref|XP_006367527.1|  PREDICTED: uncharacterized protein LOC102594553    444   5e-146   
emb|CAN83103.1|  hypothetical protein VITISV_015490                     443   6e-146   Vitis vinifera
ref|XP_010541607.1|  PREDICTED: uncharacterized protein LOC104815...    446   6e-146   
ref|XP_010927752.1|  PREDICTED: uncharacterized protein LOC105049714    444   9e-146   
ref|XP_010421384.1|  PREDICTED: uncharacterized protein LOC104706856    445   2e-145   
gb|KCW80355.1|  hypothetical protein EUGRSUZ_C01720                     444   2e-145   
ref|XP_010048170.1|  PREDICTED: uncharacterized protein LOC104437016    444   2e-145   
ref|XP_002515490.1|  amino acid binding protein, putative               444   2e-145   Ricinus communis
ref|XP_008790740.1|  PREDICTED: uncharacterized protein LOC103707843    442   3e-145   
ref|XP_010527984.1|  PREDICTED: uncharacterized protein LOC104805208    442   4e-145   
ref|XP_002874251.1|  ACT domain-containing protein                      444   4e-145   
ref|XP_004228427.1|  PREDICTED: uncharacterized protein LOC101262744    442   6e-145   
ref|XP_002281251.1|  PREDICTED: uncharacterized protein LOC100242743    441   8e-145   Vitis vinifera
ref|XP_009151052.1|  PREDICTED: uncharacterized protein LOC103874392    443   9e-145   
ref|XP_002525301.1|  amino acid binding protein, putative               442   1e-144   Ricinus communis
emb|CBI34815.3|  unnamed protein product                                441   1e-144   
ref|XP_002467694.1|  hypothetical protein SORBIDRAFT_01g032575          440   2e-144   Sorghum bicolor [broomcorn]
ref|XP_009411127.1|  PREDICTED: uncharacterized protein LOC103992926    441   2e-144   
gb|KHN26914.1|  [Protein-PII] uridylyltransferase                       441   2e-144   
ref|XP_010493784.1|  PREDICTED: uncharacterized protein LOC104771009    442   2e-144   
ref|XP_003545456.1|  PREDICTED: uncharacterized protein LOC100820595    441   3e-144   
ref|XP_010454854.1|  PREDICTED: uncharacterized protein LOC104736552    442   3e-144   
ref|XP_006394780.1|  hypothetical protein EUTSA_v10004050mg             442   3e-144   
gb|AAM93430.1|  ACR5                                                    439   4e-144   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565304.1|  ACT domain-containing protein 5                       439   5e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395679.1|  hypothetical protein EUTSA_v10004191mg             439   5e-144   
emb|CDX80500.1|  BnaC07g29440D                                          441   6e-144   
gb|KHN27192.1|  [Protein-PII] uridylyltransferase                       438   6e-144   
ref|XP_001769906.1|  predicted protein                                  439   6e-144   
gb|KDP33571.1|  hypothetical protein JCGZ_07142                         440   7e-144   
ref|XP_010273258.1|  PREDICTED: uncharacterized protein LOC104608...    441   7e-144   
ref|XP_010276411.1|  PREDICTED: uncharacterized protein LOC104611164    439   7e-144   
ref|XP_007011818.1|  ACT-like superfamily protein                       440   1e-143   
ref|XP_006650194.1|  PREDICTED: uncharacterized protein LOC102721346    439   1e-143   
ref|XP_006394781.1|  hypothetical protein EUTSA_v10004050mg             440   2e-143   
emb|CDX88170.1|  BnaA06g27610D                                          439   2e-143   
ref|XP_008804075.1|  PREDICTED: uncharacterized protein LOC103717456    437   2e-143   
ref|XP_006289879.1|  hypothetical protein CARUB_v10003494mg             439   4e-143   
ref|XP_002876893.1|  hypothetical protein ARALYDRAFT_904656             437   4e-143   
ref|XP_010926807.1|  PREDICTED: uncharacterized protein LOC105048981    437   4e-143   
ref|XP_003631797.2|  PREDICTED: uncharacterized protein LOC100852...    438   5e-143   
ref|XP_010554272.1|  PREDICTED: uncharacterized protein LOC104824...    437   6e-143   
gb|ACL53099.1|  unknown                                                 436   7e-143   
ref|XP_011081540.1|  PREDICTED: uncharacterized protein LOC105164564    437   7e-143   
emb|CBI21063.3|  unnamed protein product                                438   7e-143   
emb|CDY49687.1|  BnaA02g27260D                                          436   8e-143   
ref|XP_008219523.1|  PREDICTED: uncharacterized protein LOC103319...    438   8e-143   
gb|EYU37402.1|  hypothetical protein MIMGU_mgv1a005812mg                437   8e-143   
ref|XP_010648677.1|  PREDICTED: uncharacterized protein LOC100852...    437   8e-143   
ref|XP_007156374.1|  hypothetical protein PHAVU_003G280900g             436   1e-142   
ref|XP_009129076.1|  PREDICTED: uncharacterized protein LOC103853936    436   1e-142   
ref|XP_004288269.1|  PREDICTED: uncharacterized protein LOC101292932    436   2e-142   
ref|XP_011039651.1|  PREDICTED: uncharacterized protein LOC105136133    436   2e-142   
ref|XP_010927766.1|  PREDICTED: uncharacterized protein LOC105049725    432   2e-141   
ref|XP_006291103.1|  hypothetical protein CARUB_v10017215mg             433   2e-141   
emb|CDP09866.1|  unnamed protein product                                432   2e-141   
ref|XP_008796580.1|  PREDICTED: uncharacterized protein LOC103711996    432   3e-141   
ref|XP_011036590.1|  PREDICTED: uncharacterized protein LOC105134046    434   3e-141   
ref|XP_006358366.1|  PREDICTED: uncharacterized protein LOC102578578    432   4e-141   
ref|XP_010554273.1|  PREDICTED: uncharacterized protein LOC104824...    431   4e-141   
ref|XP_006574875.1|  PREDICTED: uncharacterized protein LOC100798999    431   5e-141   
ref|XP_010929569.1|  PREDICTED: uncharacterized protein LOC105051...    431   6e-141   
ref|XP_004514319.1|  PREDICTED: uncharacterized protein LOC101500937    431   7e-141   
ref|XP_010502395.1|  PREDICTED: uncharacterized protein LOC104779692    431   8e-141   
ref|XP_004244583.1|  PREDICTED: uncharacterized protein LOC101243731    431   9e-141   
dbj|BAC43240.1|  unknown protein                                        430   9e-141   
ref|XP_010929570.1|  PREDICTED: uncharacterized protein LOC105051...    431   1e-140   
gb|ACJ84936.1|  unknown                                                 428   2e-140   
ref|XP_009421053.1|  PREDICTED: uncharacterized protein LOC104000676    430   3e-140   
ref|XP_010514143.1|  PREDICTED: uncharacterized protein LOC104790131    430   3e-140   
ref|XP_002509632.1|  amino acid binding protein, putative               429   4e-140   
ref|XP_010321943.1|  PREDICTED: uncharacterized protein LOC101249271    431   4e-140   
emb|CDY45710.1|  BnaC02g35120D                                          429   5e-140   
ref|XP_009629350.1|  PREDICTED: uncharacterized protein LOC104119532    431   5e-140   
ref|XP_010250632.1|  PREDICTED: uncharacterized protein LOC104592825    428   8e-140   
ref|XP_009383404.1|  PREDICTED: uncharacterized protein LOC103971170    428   1e-139   
ref|XP_008378393.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    430   1e-139   
ref|XP_010099846.1|  [Protein-PII] uridylyltransferase                  430   1e-139   
ref|XP_006363718.1|  PREDICTED: uncharacterized protein LOC102603691    428   1e-139   
ref|XP_008219522.1|  PREDICTED: uncharacterized protein LOC103319...    429   2e-139   
ref|XP_002884250.1|  hypothetical protein ARALYDRAFT_477311             427   2e-139   
ref|XP_003549097.1|  PREDICTED: uncharacterized protein LOC100818...    427   2e-139   
ref|XP_004292978.1|  PREDICTED: uncharacterized protein LOC101293754    429   2e-139   
ref|XP_009770494.1|  PREDICTED: uncharacterized protein LOC104221191    429   2e-139   
ref|XP_008790256.1|  PREDICTED: uncharacterized protein LOC103707...    429   3e-139   
ref|XP_010679666.1|  PREDICTED: uncharacterized protein LOC104894974    427   5e-139   
ref|XP_004245697.1|  PREDICTED: uncharacterized protein LOC101260460    426   6e-139   
ref|XP_010679989.1|  PREDICTED: uncharacterized protein LOC104895235    426   8e-139   
ref|XP_009762180.1|  PREDICTED: uncharacterized protein LOC104214...    427   8e-139   
ref|XP_009373348.1|  PREDICTED: uncharacterized protein LOC103962372    426   1e-138   
ref|NP_186848.1|  ACT domain-containing protein 6                       425   1e-138   
ref|XP_003622131.1|  Amino acid binding protein, putative               425   1e-138   
ref|XP_007161677.1|  hypothetical protein PHAVU_001G089200g             426   1e-138   
ref|XP_006368726.1|  ACT domain-containing family protein               425   1e-138   
ref|XP_009346780.1|  PREDICTED: uncharacterized protein LOC103938500    425   2e-138   
ref|XP_008231090.1|  PREDICTED: uncharacterized protein LOC103330...    424   2e-138   
ref|XP_007047587.1|  ACT domain repeat 1, putative isoform 1            426   2e-138   
ref|XP_004304532.1|  PREDICTED: uncharacterized protein LOC101293911    424   3e-138   
ref|XP_011081096.1|  PREDICTED: uncharacterized protein LOC105164190    424   3e-138   
ref|XP_008373875.1|  PREDICTED: uncharacterized protein LOC103437194    424   3e-138   
ref|XP_008448923.1|  PREDICTED: uncharacterized protein LOC103490944    424   4e-138   
ref|XP_011007844.1|  PREDICTED: uncharacterized protein LOC105113386    425   4e-138   
gb|KDO83538.1|  hypothetical protein CISIN_1g0127933mg                  417   5e-138   
ref|XP_008441313.1|  PREDICTED: uncharacterized protein LOC103485467    424   6e-138   
ref|XP_003553951.1|  PREDICTED: uncharacterized protein LOC100801859    424   6e-138   
ref|XP_010936170.1|  PREDICTED: uncharacterized protein LOC105055...    426   6e-138   
ref|XP_011029105.1|  PREDICTED: uncharacterized protein LOC105128946    424   6e-138   
gb|KHN02059.1|  [Protein-PII] uridylyltransferase                       423   7e-138   
ref|XP_011098918.1|  PREDICTED: uncharacterized protein LOC105177449    423   8e-138   
ref|XP_010108109.1|  [Protein-PII] uridylyltransferase                  423   9e-138   
ref|XP_006857102.1|  hypothetical protein AMTR_s00065p00123930          428   9e-138   
gb|EYU31837.1|  hypothetical protein MIMGU_mgv1a007510mg                421   1e-137   
ref|XP_009588356.1|  PREDICTED: uncharacterized protein LOC104085940    422   1e-137   
ref|XP_010053392.1|  PREDICTED: uncharacterized protein LOC104441845    422   1e-137   
ref|XP_002272024.1|  PREDICTED: uncharacterized protein LOC100248040    422   2e-137   
emb|CDP13538.1|  unnamed protein product                                424   2e-137   
ref|XP_009767148.1|  PREDICTED: uncharacterized protein LOC104218369    422   2e-137   
ref|XP_010936169.1|  PREDICTED: uncharacterized protein LOC105055...    427   2e-137   
ref|XP_006362626.1|  PREDICTED: uncharacterized protein LOC102588535    432   2e-137   
ref|XP_011031317.1|  PREDICTED: uncharacterized protein LOC105130...    424   2e-137   
ref|XP_010023323.1|  PREDICTED: uncharacterized protein LOC104414031    424   2e-137   
ref|XP_008379088.1|  PREDICTED: uncharacterized protein LOC103442112    422   3e-137   
ref|XP_010028975.1|  PREDICTED: uncharacterized protein LOC104419...    421   4e-137   
ref|XP_007215389.1|  hypothetical protein PRUPE_ppa005796mg             421   4e-137   
ref|XP_010934544.1|  PREDICTED: uncharacterized protein LOC105054670    422   5e-137   
gb|EYU28889.1|  hypothetical protein MIMGU_mgv1a006953mg                420   5e-137   
ref|XP_007038043.1|  ACT domain repeat 6 isoform 1                      424   6e-137   
ref|XP_007031924.1|  ACT domain repeat 6                                421   7e-137   
ref|XP_009152150.1|  PREDICTED: uncharacterized protein LOC103875388    421   7e-137   
emb|CDY02975.1|  BnaC07g22520D                                          421   7e-137   
ref|XP_006440437.1|  hypothetical protein CICLE_v10020159mg             421   8e-137   
ref|XP_010912996.1|  PREDICTED: uncharacterized protein LOC105038791    421   8e-137   
gb|KDO63881.1|  hypothetical protein CISIN_1g013535mg                   420   9e-137   
ref|XP_006477308.1|  PREDICTED: uncharacterized protein LOC102613...    420   1e-136   
emb|CDY51199.1|  BnaA06g39780D                                          420   1e-136   
ref|XP_002320665.2|  hypothetical protein POPTR_0014s00840g             421   2e-136   
ref|XP_010024175.1|  PREDICTED: uncharacterized protein LOC104414711    420   2e-136   
ref|XP_006426129.1|  hypothetical protein CICLE_v10025521mg             421   2e-136   
ref|XP_009362597.1|  PREDICTED: uncharacterized protein LOC103952667    421   2e-136   
ref|XP_001775245.1|  predicted protein                                  420   2e-136   
ref|XP_011033868.1|  PREDICTED: uncharacterized protein LOC105132218    419   2e-136   
ref|XP_009393011.1|  PREDICTED: uncharacterized protein LOC103978802    420   3e-136   
ref|XP_002304443.1|  ACT domain-containing family protein               419   3e-136   
ref|XP_001764811.1|  predicted protein                                  419   3e-136   
ref|XP_006447023.1|  hypothetical protein CICLE_v10015110mg             419   3e-136   
ref|XP_007038044.1|  ACT domain repeat 6 isoform 2                      418   3e-136   
ref|XP_009613791.1|  PREDICTED: uncharacterized protein LOC104106...    420   4e-136   
ref|XP_006369838.1|  hypothetical protein POPTR_0001s33460g             419   4e-136   
ref|XP_009404247.1|  PREDICTED: uncharacterized protein LOC103987...    419   5e-136   
emb|CDP02625.1|  unnamed protein product                                420   5e-136   
ref|XP_011031316.1|  PREDICTED: uncharacterized protein LOC105130...    420   7e-136   
ref|XP_008351934.1|  PREDICTED: uncharacterized protein LOC103415377    419   1e-135   
gb|AGT16037.1|  hypothetical protein SHCRBa_044_D02_F_100               418   2e-135   
ref|XP_007040015.1|  ACT domain repeat 8                                417   2e-135   
ref|XP_006851819.1|  hypothetical protein AMTR_s00041p00050300          417   2e-135   
ref|XP_009785185.1|  PREDICTED: uncharacterized protein LOC104233484    417   2e-135   
ref|XP_004158495.1|  PREDICTED: uncharacterized protein LOC101225681    417   2e-135   
ref|XP_006408561.1|  hypothetical protein EUTSA_v10020734mg             417   2e-135   
ref|XP_009393003.1|  PREDICTED: uncharacterized protein LOC103978796    419   2e-135   
ref|XP_008804003.1|  PREDICTED: uncharacterized protein LOC103717...    417   4e-135   
ref|XP_002445807.1|  hypothetical protein SORBIDRAFT_07g026100          417   4e-135   
ref|XP_009396538.1|  PREDICTED: uncharacterized protein LOC103981...    417   5e-135   
ref|XP_003517440.1|  PREDICTED: uncharacterized protein LOC100780903    416   5e-135   
ref|XP_009396545.1|  PREDICTED: uncharacterized protein LOC103981...    417   6e-135   
ref|XP_002452266.1|  hypothetical protein SORBIDRAFT_04g022677          415   6e-135   
ref|XP_007205133.1|  hypothetical protein PRUPE_ppa005094mg             417   7e-135   
ref|XP_009405884.1|  PREDICTED: uncharacterized protein LOC103988920    416   8e-135   
ref|XP_009613029.1|  PREDICTED: uncharacterized protein LOC104106236    416   8e-135   
ref|XP_002310330.2|  hypothetical protein POPTR_0007s14780g             417   9e-135   
ref|XP_009385445.1|  PREDICTED: uncharacterized protein LOC103972808    416   9e-135   
gb|KGN55928.1|  hypothetical protein Csa_3G036540                       416   1e-134   
ref|XP_006338713.1|  PREDICTED: uncharacterized protein LOC102582...    415   1e-134   
ref|XP_004171478.1|  PREDICTED: uncharacterized LOC101205369            415   1e-134   
ref|XP_002298641.1|  hypothetical protein POPTR_0001s33460g             414   2e-134   
ref|XP_011000958.1|  PREDICTED: uncharacterized protein LOC105108...    414   2e-134   
ref|XP_003538563.1|  PREDICTED: uncharacterized protein LOC100806283    414   2e-134   
ref|XP_006363807.1|  PREDICTED: uncharacterized protein LOC102587133    416   3e-134   
ref|XP_004147955.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    414   3e-134   
gb|EYU40556.1|  hypothetical protein MIMGU_mgv1a006507mg                414   3e-134   
gb|KHG23892.1|  [Protein-PII] uridylyltransferase                       414   3e-134   
ref|XP_007158417.1|  hypothetical protein PHAVU_002G151300g             414   4e-134   
ref|XP_006338714.1|  PREDICTED: uncharacterized protein LOC102582...    414   4e-134   
ref|XP_004138626.1|  PREDICTED: uncharacterized protein LOC101213097    414   5e-134   
ref|XP_004231764.1|  PREDICTED: uncharacterized protein LOC101263860    413   5e-134   
ref|XP_007208916.1|  hypothetical protein PRUPE_ppa1027134mg            413   7e-134   
gb|AAF03449.1|AC010797_25  unknown protein                              414   9e-134   
ref|XP_004982474.1|  PREDICTED: uncharacterized protein LOC101774...    413   9e-134   
ref|XP_010940980.1|  PREDICTED: uncharacterized protein LOC105059401    413   1e-133   
ref|XP_003622132.1|  Amino acid binding protein, putative               414   1e-133   
ref|XP_011099408.1|  PREDICTED: uncharacterized protein LOC105177...    414   2e-133   
ref|XP_004231941.1|  PREDICTED: uncharacterized protein LOC101266...    414   2e-133   
ref|XP_008238666.1|  PREDICTED: uncharacterized protein LOC103337282    412   2e-133   
gb|KDP25581.1|  hypothetical protein JCGZ_20737                         412   2e-133   
ref|XP_008231089.1|  PREDICTED: uncharacterized protein LOC103330...    412   2e-133   
ref|XP_006650292.1|  PREDICTED: uncharacterized protein LOC102702453    412   2e-133   
ref|XP_008804002.1|  PREDICTED: uncharacterized protein LOC103717...    412   2e-133   
ref|XP_008237545.1|  PREDICTED: uncharacterized protein LOC103336...    413   2e-133   
ref|XP_002512902.1|  amino acid binding protein, putative               411   3e-133   
ref|XP_008790789.1|  PREDICTED: uncharacterized protein LOC103707875    411   3e-133   
emb|CDP20649.1|  unnamed protein product                                411   4e-133   
ref|XP_009134574.1|  PREDICTED: uncharacterized protein LOC103858...    410   4e-133   
ref|XP_009344226.1|  PREDICTED: uncharacterized protein LOC103936115    410   6e-133   
ref|XP_009780757.1|  PREDICTED: uncharacterized protein LOC104229755    411   6e-133   
ref|XP_004298708.1|  PREDICTED: uncharacterized protein LOC101304477    410   8e-133   
ref|XP_008341281.1|  PREDICTED: uncharacterized protein LOC103404170    410   2e-132   
gb|KDP41794.1|  hypothetical protein JCGZ_26812                         409   2e-132   
gb|EEC75693.1|  hypothetical protein OsI_12504                          409   3e-132   
ref|NP_001050608.1|  Os03g0598100                                       409   3e-132   
ref|XP_002466847.1|  hypothetical protein SORBIDRAFT_01g015160          409   3e-132   
ref|XP_009377996.1|  PREDICTED: uncharacterized protein LOC103966550    408   7e-132   
ref|XP_010316031.1|  PREDICTED: uncharacterized protein LOC101266...    409   1e-131   
ref|XP_008237541.1|  PREDICTED: uncharacterized protein LOC103336...    409   1e-131   
ref|XP_008811478.1|  PREDICTED: uncharacterized protein LOC103722634    407   1e-131   
emb|CDX74326.1|  BnaA03g27210D                                          407   1e-131   
ref|XP_009623593.1|  PREDICTED: uncharacterized protein LOC104114...    407   1e-131   
ref|XP_010055557.1|  PREDICTED: uncharacterized protein LOC104443739    407   1e-131   
ref|XP_011099405.1|  PREDICTED: uncharacterized protein LOC105177...    409   2e-131   
ref|XP_009339717.1|  PREDICTED: uncharacterized protein LOC103931913    407   2e-131   
ref|NP_001130980.1|  uncharacterized protein LOC100192085               407   2e-131   
ref|XP_003562315.1|  PREDICTED: uncharacterized protein LOC100840593    407   2e-131   
gb|EYU29019.1|  hypothetical protein MIMGU_mgv1a006539mg                406   2e-131   
ref|XP_010028976.1|  PREDICTED: uncharacterized protein LOC104419...    405   4e-131   
ref|XP_008791268.1|  PREDICTED: uncharacterized protein LOC103708225    406   6e-131   
ref|XP_003525780.1|  PREDICTED: uncharacterized protein LOC100802262    405   9e-131   
ref|XP_009391844.1|  PREDICTED: uncharacterized protein LOC103977913    405   1e-130   
ref|XP_010496419.1|  PREDICTED: uncharacterized protein LOC104773493    404   1e-130   
gb|KHN09770.1|  [Protein-PII] uridylyltransferase                       404   2e-130   
ref|XP_001769236.1|  predicted protein                                  404   3e-130   
ref|XP_003549893.2|  PREDICTED: uncharacterized protein LOC100794729    404   3e-130   
emb|CDX91919.1|  BnaC03g32210D                                          403   5e-130   
ref|XP_006382080.1|  hypothetical protein POPTR_0006s27260g             403   8e-130   
gb|ACG60673.1|  hypothetical protein BoB028L01.070                      401   2e-129   
gb|KHN42726.1|  [Protein-PII] uridylyltransferase                       401   2e-129   
ref|XP_010249097.1|  PREDICTED: uncharacterized protein LOC104591778    401   2e-129   
ref|XP_009134572.1|  PREDICTED: uncharacterized protein LOC103858...    401   3e-129   
ref|XP_003611547.1|  ACT domain-containing protein                      403   3e-129   
ref|XP_009416235.1|  PREDICTED: uncharacterized protein LOC103996875    401   3e-129   
ref|XP_008440421.1|  PREDICTED: uncharacterized protein LOC103484871    402   3e-129   
ref|XP_009412293.1|  PREDICTED: uncharacterized protein LOC103993822    404   3e-129   
emb|CAN80840.1|  hypothetical protein VITISV_043834                     401   3e-129   
dbj|BAJ95140.1|  predicted protein                                      401   3e-129   
ref|XP_004974011.1|  PREDICTED: uncharacterized protein LOC101766285    402   4e-129   
ref|XP_006447024.1|  hypothetical protein CICLE_v10015110mg             402   4e-129   
ref|XP_009382898.1|  PREDICTED: uncharacterized protein LOC103970718    400   5e-129   
gb|KHG16540.1|  [Protein-PII] uridylyltransferase                       400   8e-129   
dbj|BAJ99866.1|  predicted protein                                      400   8e-129   



>ref|XP_007019285.1| ACT domain repeat 3 isoform 1 [Theobroma cacao]
 gb|EOY16510.1| ACT domain repeat 3 isoform 1 [Theobroma cacao]
Length=449

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/452 (78%), Positives = 392/452 (87%), Gaps = 4/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS+RINPPRVSVDN SC+DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENLSVRINPPRVSVDNTSCRDCTVVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAYVSSDGGWFMDVFHVTDQ G ++TDG TI YIE+ALGPKG+T+D +K CPGK V
Sbjct  61    FIITKAYVSSDGGWFMDVFHVTDQQGKQITDGKTIDYIERALGPKGHTTDGMKNCPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+G++TAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSVGNHTAIELIGRDRPGLLSEISAVLANLHFNVAAAEVWTHNRRIACVLYVNDDPTS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL ++EEQLK+ILR C+DD+ +A TS SMG THIDRRLHQM FADRDYEGG +
Sbjct  181   RAVDDPNRLSIMEEQLKHILRGCEDDDKVARTSFSMGFTHIDRRLHQMLFADRDYEGGGV  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PS KP ++++ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS+
Sbjct  241   TTEVDYPPSFKPKITVERCEEKGYSVVSVQCKDRAKLMFDIVCTLTDMQYVVFHANISSN  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDGCTLDTEGEK+RV+KCLEAAI RRVSEGL LELCAKDRVGLLS+VT
Sbjct  301   GPYALQEYFIRHMDGCTLDTEGEKERVIKCLEAAIHRRVSEGLSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVSTVGEQ VNVFYVRD+ GNPVDTK IE LRKEIG  MMLNVKK  
Sbjct  361   RILRENGLSVRRAGVSTVGEQAVNVFYVRDAYGNPVDTKTIEALRKEIGHTMMLNVKKDP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             A A A      ET+ W+KTSFFFG+LL KF A
Sbjct  421   ASAKAHEA---ETSGWAKTSFFFGNLLEKFLA  449



>ref|XP_002268570.1| PREDICTED: uncharacterized protein LOC100250578 isoform X3 [Vitis 
vinifera]
 emb|CAN73861.1| hypothetical protein VITISV_007291 [Vitis vinifera]
Length=447

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/450 (77%), Positives = 391/450 (87%), Gaps = 6/450 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS+RINPPRVSVDN+SC DCT++KVDS+NKPGILLEVVQ+L+D+D
Sbjct  1     MAKVCWPYFDPEYENLSMRINPPRVSVDNLSCSDCTLIKVDSMNKPGILLEVVQILTDID  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQ GNK+TDG  I YIEKALGPKG T D +KT PGK V
Sbjct  61    LLITKAYISSDGGWFMDVFHVTDQQGNKITDGKIIDYIEKALGPKGDTIDGVKTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIG+DRPGLLSEISAVLA+LHFNVV AEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIELIGKDRPGLLSEISAVLADLHFNVVGAEVWTHNRRIACVVYVNDDATC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL V+EEQLKN+LR C+DD+ +A TS SMG TH+DRRLHQM FADRDYEGG  
Sbjct  181   RAVDDPTRLSVMEEQLKNVLRGCEDDDKVARTSFSMGFTHVDRRLHQMLFADRDYEGGGT  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
              +EAD  PS KP ++ID C +KGYS VSV CKDRPKLMFDIVCTLTDMQYVVFHA+ISSD
Sbjct  241   TIEADYPPSFKPKITIDRCEDKGYSAVSVMCKDRPKLMFDIVCTLTDMQYVVFHASISSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRHMDGCTLD EGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VT
Sbjct  301   GPYASQEYFIRHMDGCTLDNEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRE+GL VTRAGVSTVGEQ +NVFYVRD+SG PVD K IE LRKEIG  MMLNVKK  
Sbjct  361   RVLREHGLSVTRAGVSTVGEQAMNVFYVRDASGKPVDMKTIEALRKEIGHTMMLNVKKEP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             + A       PE + W+KTSFFFGSL  +F
Sbjct  421   SSAKT-----PEASGWAKTSFFFGSLFERF  445



>ref|XP_003634395.1| PREDICTED: uncharacterized protein LOC100250578 isoform X2 [Vitis 
vinifera]
Length=465

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/450 (77%), Positives = 391/450 (87%), Gaps = 6/450 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS+RINPPRVSVDN+SC DCT++KVDS+NKPGILLEVVQ+L+D+D
Sbjct  19    MAKVCWPYFDPEYENLSMRINPPRVSVDNLSCSDCTLIKVDSMNKPGILLEVVQILTDID  78

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQ GNK+TDG  I YIEKALGPKG T D +KT PGK V
Sbjct  79    LLITKAYISSDGGWFMDVFHVTDQQGNKITDGKIIDYIEKALGPKGDTIDGVKTWPGKRV  138

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIG+DRPGLLSEISAVLA+LHFNVV AEVWTHN+RIACV+YVND  +C
Sbjct  139   GVHSVGDHTAIELIGKDRPGLLSEISAVLADLHFNVVGAEVWTHNRRIACVVYVNDDATC  198

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL V+EEQLKN+LR C+DD+ +A TS SMG TH+DRRLHQM FADRDYEGG  
Sbjct  199   RAVDDPTRLSVMEEQLKNVLRGCEDDDKVARTSFSMGFTHVDRRLHQMLFADRDYEGGGT  258

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
              +EAD  PS KP ++ID C +KGYS VSV CKDRPKLMFDIVCTLTDMQYVVFHA+ISSD
Sbjct  259   TIEADYPPSFKPKITIDRCEDKGYSAVSVMCKDRPKLMFDIVCTLTDMQYVVFHASISSD  318

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRHMDGCTLD EGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VT
Sbjct  319   GPYASQEYFIRHMDGCTLDNEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVT  378

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRE+GL VTRAGVSTVGEQ +NVFYVRD+SG PVD K IE LRKEIG  MMLNVKK  
Sbjct  379   RVLREHGLSVTRAGVSTVGEQAMNVFYVRDASGKPVDMKTIEALRKEIGHTMMLNVKKEP  438

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             + A       PE + W+KTSFFFGSL  +F
Sbjct  439   SSAKT-----PEASGWAKTSFFFGSLFERF  463



>ref|XP_010664860.1| PREDICTED: uncharacterized protein LOC100250578 isoform X1 [Vitis 
vinifera]
 emb|CBI19929.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/450 (77%), Positives = 391/450 (87%), Gaps = 6/450 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS+RINPPRVSVDN+SC DCT++KVDS+NKPGILLEVVQ+L+D+D
Sbjct  20    MAKVCWPYFDPEYENLSMRINPPRVSVDNLSCSDCTLIKVDSMNKPGILLEVVQILTDID  79

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQ GNK+TDG  I YIEKALGPKG T D +KT PGK V
Sbjct  80    LLITKAYISSDGGWFMDVFHVTDQQGNKITDGKIIDYIEKALGPKGDTIDGVKTWPGKRV  139

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIG+DRPGLLSEISAVLA+LHFNVV AEVWTHN+RIACV+YVND  +C
Sbjct  140   GVHSVGDHTAIELIGKDRPGLLSEISAVLADLHFNVVGAEVWTHNRRIACVVYVNDDATC  199

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL V+EEQLKN+LR C+DD+ +A TS SMG TH+DRRLHQM FADRDYEGG  
Sbjct  200   RAVDDPTRLSVMEEQLKNVLRGCEDDDKVARTSFSMGFTHVDRRLHQMLFADRDYEGGGT  259

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
              +EAD  PS KP ++ID C +KGYS VSV CKDRPKLMFDIVCTLTDMQYVVFHA+ISSD
Sbjct  260   TIEADYPPSFKPKITIDRCEDKGYSAVSVMCKDRPKLMFDIVCTLTDMQYVVFHASISSD  319

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRHMDGCTLD EGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VT
Sbjct  320   GPYASQEYFIRHMDGCTLDNEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVT  379

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRE+GL VTRAGVSTVGEQ +NVFYVRD+SG PVD K IE LRKEIG  MMLNVKK  
Sbjct  380   RVLREHGLSVTRAGVSTVGEQAMNVFYVRDASGKPVDMKTIEALRKEIGHTMMLNVKKEP  439

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             + A       PE + W+KTSFFFGSL  +F
Sbjct  440   SSAKT-----PEASGWAKTSFFFGSLFERF  464



>ref|XP_004242056.1| PREDICTED: uncharacterized protein LOC101244297 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322946.1| PREDICTED: uncharacterized protein LOC101244297 isoform X1 [Solanum 
lycopersicum]
Length=447

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/451 (77%), Positives = 390/451 (86%), Gaps = 6/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR+  PYFDPEYETLSIRINPPRVSVDN +C+DCT+VKVDS+NKPGILLEVVQ+LSDLD
Sbjct  1     MARSYGPYFDPEYETLSIRINPPRVSVDNATCRDCTLVKVDSINKPGILLEVVQILSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQHGNKVTD NTIG+IEKALGP+GYTS +LKTCPG+ V
Sbjct  61    LVITKAYISSDGGWFMDVFHVTDQHGNKVTDNNTIGHIEKALGPEGYTSGILKTCPGRKV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             G NS+GDYT IELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN RIACVLY+ND  S 
Sbjct  121   GENSMGDYTTIELIGRDRPGLLSEISAVLANLHFNVAAAEVWTHNGRIACVLYINDNCSS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
                D+ SRLCV+EEQL NILR  +DD + AH + S+GSTH+DRRLHQMFFADRDYEGGCL
Sbjct  181   LDEDEESRLCVMEEQLNNILRGREDDESGAHATFSVGSTHVDRRLHQMFFADRDYEGGCL  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             +ME +  P+ KP+V I+ CVEKGYSVVSV CKDR KLMFDIVCTLTDMQY VFHA ISSD
Sbjct  241   EMEIEYPPNSKPDVRIESCVEKGYSVVSVSCKDRAKLMFDIVCTLTDMQYAVFHATISSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GPSASQEY+IRHMDGCTL++E EK++VVKC+EAAI+RR+SEG   ELCAKDRVGLLS+VT
Sbjct  301   GPSASQEYFIRHMDGCTLESEAEKEKVVKCIEAAIRRRISEGFSFELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRENGL VTRAGV+T+GE+  N FYVRD+SGNPV+ K IE LR+EIGQ MMLNVKK  
Sbjct  361   RVLRENGLSVTRAGVTTIGEKAKNFFYVRDASGNPVEMKTIERLREEIGQTMMLNVKKDP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFR  386
               A A     PET   +KTSFFFG LL KFR
Sbjct  421   TSAKA-----PETGGLAKTSFFFGGLLEKFR  446



>ref|XP_002520259.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF42045.1| amino acid binding protein, putative [Ricinus communis]
Length=447

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/452 (77%), Positives = 382/452 (85%), Gaps = 6/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS RINPPRVSVDN SC +CT++KVDS+NKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENLSTRINPPRVSVDNTSCNECTLIKVDSMNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMD+FHVTDQ G K+ D  TI YIEKALGPK Y  D LKT PGK V
Sbjct  61    FIITKAYISSDGGWFMDIFHVTDQQGKKIIDSKTIDYIEKALGPKEYNKDELKTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GDYTAIELIGRDRPGLLSEI+AVLANLHFNV AAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDYTAIELIGRDRPGLLSEITAVLANLHFNVAAAEVWTHNRRIACVVYVNDYTTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               VDDP+RL V+EEQLKNILR C+DD   + TS SMG THIDRRLHQMFFADRDYEGG +
Sbjct  181   RPVDDPTRLSVMEEQLKNILRGCEDDEKASRTSFSMGFTHIDRRLHQMFFADRDYEGGGV  240

Query  1015  DMEADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E + P S KP ++++ C EKGYSVVSV CKDR KL+FDIVCTLTDMQYVVFHA ISSD
Sbjct  241   TNEVEYPSSFKPKITVERCGEKGYSVVSVCCKDRAKLLFDIVCTLTDMQYVVFHATISSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEYYIRHMDGCTLDTEGEK+RV+KCLEAAI+RRV EGL LELCAKDRVGLLS+VT
Sbjct  301   GPYASQEYYIRHMDGCTLDTEGEKERVIKCLEAAIRRRVCEGLSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRENGL VTRAGV+TVGEQ +NVFYVRDSSGNPVD K IE LRKEIG  MMLNVKK  
Sbjct  361   RVLRENGLSVTRAGVTTVGEQAMNVFYVRDSSGNPVDMKTIEALRKEIGHTMMLNVKKTP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
               A       PE   W+KTSFFFG+LL +F A
Sbjct  421   VSASQ-----PEAKGWAKTSFFFGNLLERFLA  447



>ref|XP_008237781.1| PREDICTED: uncharacterized protein LOC103336512 isoform X2 [Prunus 
mume]
 ref|XP_008237782.1| PREDICTED: uncharacterized protein LOC103336512 isoform X2 [Prunus 
mume]
Length=448

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/453 (77%), Positives = 385/453 (85%), Gaps = 7/453 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR CWPYFDPEYE LS RINPPRVSVDN SC DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCWPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+ D  TI YIEKALGPKG+ +DVLK  PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKLADSKTIDYIEKALGPKGHITDVLKAWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               VDDP+RL  +EEQLKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVDDPNRLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P ++I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  241   ANEVDHYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP ASQEY+IRHMDGCTLDTEGEK+RV+KC++AAI+RRVSE LRLELCAKDRVGLLS+V
Sbjct  301   DGPYASQEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEDLRLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL VTRAGV+T+GEQ +NVFYVRDSSGNPVD K IE LRKEIG   M NVKKV
Sbjct  361   TRILRENGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKV  420

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                + A     PET  W KTSFFFG+LL +F A
Sbjct  421   PTSSKA-----PETKGWGKTSFFFGNLLERFLA  448



>ref|XP_007201032.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
 gb|EMJ02231.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
Length=448

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/453 (77%), Positives = 385/453 (85%), Gaps = 7/453 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR CWPYFDPEYE LS RINPPRVS+DN SC DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCWPYFDPEYENLSTRINPPRVSIDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+ D  TI YIEKALGPKG+ +DVLK  PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKLADSKTIDYIEKALGPKGHITDVLKAWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               VDDP+RL  +EEQLKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVDDPNRLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P ++I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  241   ANEVDDYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP ASQEY+IRHMDGCTLDTEGEK+RV+KC++AAI+RRVSE LRLELCAKDRVGLLS+V
Sbjct  301   DGPYASQEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEDLRLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL VTRAGV+T+GEQ +NVFYVRDSSGNPVD K IE LRKEIG   M NVKKV
Sbjct  361   TRILRENGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKV  420

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                + A     PET  W KTSFFFG+LL +F A
Sbjct  421   PTSSKA-----PETKGWGKTSFFFGNLLERFLA  448



>ref|XP_009368404.1| PREDICTED: uncharacterized protein LOC103957905 [Pyrus x bretschneideri]
Length=449

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/453 (76%), Positives = 386/453 (85%), Gaps = 6/453 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR C PYFDPEYE LS RINPPRVSVDN SC DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCSPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G KVTD  TI YIEKALGPKG+ +DVL   PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKVTDSKTIDYIEKALGPKGHITDVLNAWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIG+DRPGLLSEISAVLANLHFNV+AAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIELIGKDRPGLLSEISAVLANLHFNVIAAEVWTHNRRIACVVYVNDNTAC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               V+D +RL  +EEQLKNILR C+DD  + HTS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVEDKTRLSTMEEQLKNILRVCEDDEKVGHTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P ++I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  241   TNEVDHFPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP ASQEY+IRHMDGCTLDTEGEK+RV+KC++AAI+RRVSEGLRLELCAKDRVGLLS+V
Sbjct  301   DGPYASQEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEGLRLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL VTRAGV+T+GEQ +N+FYVRDSS NPVD K IE LRKEIG  MM NVKKV
Sbjct  361   TRILRENGLSVTRAGVTTIGEQAMNIFYVRDSSENPVDIKTIEALRKEIGHTMMFNVKKV  420

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                +  +    PET  W+KTSFFFG+LL +F A
Sbjct  421   PTNSAEA----PETKGWAKTSFFFGNLLERFLA  449



>ref|XP_009790961.1| PREDICTED: uncharacterized protein LOC104238336 [Nicotiana sylvestris]
 ref|XP_009790962.1| PREDICTED: uncharacterized protein LOC104238336 [Nicotiana sylvestris]
 ref|XP_009790963.1| PREDICTED: uncharacterized protein LOC104238336 [Nicotiana sylvestris]
Length=446

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/451 (78%), Positives = 387/451 (86%), Gaps = 7/451 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR   PYFDPEYETLSIRINPPRVSVDN SCKDCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARRYGPYFDPEYETLSIRINPPRVSVDNASCKDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQ GNKVTD NTIG+IEKALGP+GYTS +LK CPG+ V
Sbjct  61    LVITKAYISSDGGWFMDVFHVTDQQGNKVTDSNTIGHIEKALGPEGYTSGILKPCPGRKV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GVNS+GDYT IELIG DRPGLLSEISAVLANLHFNV AAEVWTHN+R ACVLYVND  S 
Sbjct  121   GVNSVGDYTTIELIGSDRPGLLSEISAVLANLHFNVAAAEVWTHNRRTACVLYVNDNCSS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               VD+ SRLCV+EEQL NILR  +DD + AH + ++GSTH+DRRLHQMFFADRDYEGGCL
Sbjct  181   LDVDEESRLCVMEEQLNNILRGREDDESGAHATFTVGSTHVDRRLHQMFFADRDYEGGCL  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             +ME +  PS KP V I+ CVEKGYSVVSV CKDRPKLMFDIVCTLTDMQY VFHA ISSD
Sbjct  241   EMEIEYPPSFKPEVRIESCVEKGYSVVSVSCKDRPKLMFDIVCTLTDMQYAVFHATISSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRHMDGCTL++E EK +VVKCLEAAI+RR+SEG  LELCAKDR+GLLS+VT
Sbjct  301   GPYASQEYFIRHMDGCTLESEEEK-KVVKCLEAAIRRRISEGFSLELCAKDRIGLLSEVT  359

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRENGL VTRAGV+T+GE+  NVFYVRD+SGNPV+ K IE LR+EIGQ MMLNVKK  
Sbjct  360   RVLRENGLSVTRAGVTTIGEKAKNVFYVRDASGNPVEMKTIERLREEIGQTMMLNVKKAP  419

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFR  386
             A A       PET   +KTSFFFG LL  FR
Sbjct  420   ASAKV-----PETGGLAKTSFFFGGLLEMFR  445



>ref|XP_006356716.1| PREDICTED: uncharacterized protein LOC102587087 [Solanum tuberosum]
Length=447

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/451 (77%), Positives = 387/451 (86%), Gaps = 6/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR+  PYFDPEYETLSIRINPPRVSVDN SCKDCT+VKVDS+NKPGILLEVVQ+LSDLD
Sbjct  1     MARSYGPYFDPEYETLSIRINPPRVSVDNASCKDCTLVKVDSINKPGILLEVVQILSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQHGNKVTD NTIG+IEKALGP+GYTS +LKT PG+ V
Sbjct  61    LVITKAYISSDGGWFMDVFHVTDQHGNKVTDNNTIGHIEKALGPEGYTSGILKTRPGRKV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             G NS+GDYT IELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN RIACVLY+ND  S 
Sbjct  121   GENSMGDYTTIELIGRDRPGLLSEISAVLANLHFNVAAAEVWTHNGRIACVLYINDNCSS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
                D+ SRLCV+EEQL NILR  +DD + AH + S+GS H+DRRLHQMFFADRDYEGGCL
Sbjct  181   LDEDEESRLCVMEEQLNNILRGREDDESGAHATFSVGSIHVDRRLHQMFFADRDYEGGCL  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             +ME +  P+ KP+V I+ CVEKGYSVVSV CKDR KLMFDIVCTLTDMQY VFHA ISSD
Sbjct  241   EMEIEYPPNSKPDVRIESCVEKGYSVVSVSCKDRAKLMFDIVCTLTDMQYAVFHATISSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GPSASQEY+IRHMDGCTL++E EK++VVKC+EAAI+RR+SEG   ELCAKDRVGLLS+VT
Sbjct  301   GPSASQEYFIRHMDGCTLESEAEKEKVVKCIEAAIRRRISEGFSFELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRENGL VTRAGV+T+GE+  N FYVRD+SGNPV+ K IE LR+EIGQ MMLNVKKV 
Sbjct  361   RVLRENGLSVTRAGVTTIGEKAKNFFYVRDASGNPVEMKTIERLREEIGQTMMLNVKKVP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFR  386
               A       PET   +KTSFF G LL KFR
Sbjct  421   TSAKE-----PETGGLAKTSFFLGGLLEKFR  446



>gb|KDP43084.1| hypothetical protein JCGZ_25270 [Jatropha curcas]
Length=447

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/452 (76%), Positives = 386/452 (85%), Gaps = 6/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS RINPPRVSVDN +C D T++KVDS+NKPGILLEVVQ+L+D+D
Sbjct  1     MAKVCWPYFDPEYENLSTRINPPRVSVDNTTCNDSTLIKVDSMNKPGILLEVVQILTDMD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMD+FHVTDQ G K+TD  TI YIEKALGPK Y    LKT PGK V
Sbjct  61    LIITKAYISSDGGWFMDIFHVTDQQGKKITDSKTIDYIEKALGPKEYNKTELKTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEI+AVLANLHFNV+AAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEITAVLANLHFNVIAAEVWTHNRRIACVVYVNDDTTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL V+EEQLKNILR C+DD  +A TS SMG THIDRRLHQMFFADRDYEGG +
Sbjct  181   RAVDDPTRLSVMEEQLKNILRGCEDDEKVARTSFSMGFTHIDRRLHQMFFADRDYEGGGV  240

Query  1015  DMEAD-CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  P+ +P +++D C +KGYSVVSV+CKDR KL+FDIVCTLTDMQYVVFHA+ISSD
Sbjct  241   ANEVDHPPAFQPKITVDRCGDKGYSVVSVRCKDRAKLLFDIVCTLTDMQYVVFHASISSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEYYIRHMDGC LD+EGEK+RV+KCLEAAI+RRV EGL LELCAKDRVGLLS+VT
Sbjct  301   GPYALQEYYIRHMDGCILDSEGEKERVIKCLEAAIRRRVCEGLSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRENGL VTRAGV+TVGEQ VNVFYVRDSSGNPVD K IE LRKEIGQ M+L+VKK  
Sbjct  361   RVLRENGLSVTRAGVTTVGEQAVNVFYVRDSSGNPVDMKTIEALRKEIGQTMLLDVKKTP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
               A       PE   W+KTSFFFG+LL +F A
Sbjct  421   VSARE-----PEARGWAKTSFFFGNLLERFLA  447



>emb|CDP11981.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/451 (78%), Positives = 389/451 (86%), Gaps = 6/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR  WPYFDPEYETLSIRINPP V+VDN SCKDCT+VKVDS+NKPGILLEVVQ+LSDLD
Sbjct  1     MARDGWPYFDPEYETLSIRINPPSVAVDNTSCKDCTLVKVDSLNKPGILLEVVQILSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQHGNK+T+ NTI +IEKALGPKG+T+DVLKT  GK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQHGNKITESNTIEHIEKALGPKGHTADVLKTWQGKQV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S GD+TAIEL GRDRPGLLSEI AVLANLHFNV+AAEVWTHN+RIAC+LYVND  +C
Sbjct  121   GVHSSGDHTAIELTGRDRPGLLSEIFAVLANLHFNVIAAEVWTHNRRIACLLYVNDDSTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDPSRL  +E QL NILR C+DD N+A T+ S   TH+DRRLHQM FADRDYEGGCL
Sbjct  181   RAVDDPSRLSTMEVQLNNILRGCEDDRNVARTNFSASVTHVDRRLHQMLFADRDYEGGCL  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               EA   PS  P ++ID CVEKGYSVV+V CKDR KLMFDIVCTLTDMQYVVFHA I+SD
Sbjct  241   STEAGYPPSFTPKITIDRCVEKGYSVVTVNCKDRSKLMFDIVCTLTDMQYVVFHATITSD  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEYYIRHMDGCTLDTEGEK RV+KCLEAAI+RRVSE L LELCAKDRVGLLS+VT
Sbjct  301   GPYASQEYYIRHMDGCTLDTEGEKQRVIKCLEAAIRRRVSEDLILELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             RVLRENGL VTRAGV+TVGEQG++VFYVRD+SG+PVD K IEGLRKEIGQ MMLN     
Sbjct  361   RVLRENGLSVTRAGVTTVGEQGIHVFYVRDASGDPVDMKTIEGLRKEIGQTMMLN-----  415

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFR  386
                  +    PE+++WSKTSF FGSLLGKFR
Sbjct  416   VKKVQTCVKAPESSSWSKTSFSFGSLLGKFR  446



>ref|XP_010062190.1| PREDICTED: uncharacterized protein LOC104449657 [Eucalyptus grandis]
 ref|XP_010062191.1| PREDICTED: uncharacterized protein LOC104449657 [Eucalyptus grandis]
 ref|XP_010062192.1| PREDICTED: uncharacterized protein LOC104449657 [Eucalyptus grandis]
 gb|KCW69260.1| hypothetical protein EUGRSUZ_F02763 [Eucalyptus grandis]
Length=450

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/453 (75%), Positives = 385/453 (85%), Gaps = 5/453 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS RINPPRVSVDN SC DCT+VKVDS+NKPGILLEVVQ+LSDLD
Sbjct  1     MAKVCWPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSMNKPGILLEVVQILSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTD HG K+TD  TI YIEKALGP G+ +D  KT PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDHHGKKITDSKTIDYIEKALGPNGHHTDRTKTWPGKKV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISA+LANL  NVVAAEVWTHN+RIACVLYVNDK++C
Sbjct  121   GVHSIGDHTAIELIGRDRPGLLSEISAILANLDINVVAAEVWTHNRRIACVLYVNDKINC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL ++EEQLKNI+R   DD N+  TS SMG TH+DRRLHQMFFAD+DYE   +
Sbjct  181   RAVDDPNRLSIMEEQLKNIIRGYDDDENVGRTSFSMGFTHVDRRLHQMFFADKDYENCGV  240

Query  1015  DMEADCPS--LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
                AD  S  +KP ++I+HC EKGYSVVSV+CKDR KL+FDIVCTLTDMQYVV HA ISS
Sbjct  241   TASADDYSSLMKPKITIEHCKEKGYSVVSVRCKDRAKLLFDIVCTLTDMQYVVSHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP A QEYYIRHMDGCTLD+EGEK+RV+KCLEAAIQRRVSEGL LELCAKDRVGLLS+V
Sbjct  301   DGPDALQEYYIRHMDGCTLDSEGEKERVIKCLEAAIQRRVSEGLSLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL V+RAGV+TVGEQ +NVFYVRDSSGNPVD K IE LRKEIG  MMLN   V
Sbjct  361   TRILRENGLSVSRAGVTTVGEQAMNVFYVRDSSGNPVDMKTIEALRKEIGHTMMLN---V  417

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                  + +   PE++ W+KTSFFFG+LL +F A
Sbjct  418   KKVPASGSAKAPESSNWAKTSFFFGNLLERFLA  450



>ref|XP_008237779.1| PREDICTED: uncharacterized protein LOC103336512 isoform X1 [Prunus 
mume]
 ref|XP_008237780.1| PREDICTED: uncharacterized protein LOC103336512 isoform X1 [Prunus 
mume]
Length=456

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/461 (75%), Positives = 385/461 (84%), Gaps = 15/461 (3%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR CWPYFDPEYE LS RINPPRVSVDN SC DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCWPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+ D  TI YIEKALGPKG+ +DVLK  PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKLADSKTIDYIEKALGPKGHITDVLKAWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               VDDP+RL  +EEQLKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVDDPNRLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P ++I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  241   ANEVDHYPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSE--------GLRLELCAKD  686
             DGP ASQEY+IRHMDGCTLDTEGEK+RV+KC++AAI+RRVSE         LRLELCAKD
Sbjct  301   DGPYASQEYFIRHMDGCTLDTEGEKERVIKCIDAAIRRRVSEVSNYHEIQDLRLELCAKD  360

Query  685   RVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQR  506
             RVGLLS+VTR+LRENGL VTRAGV+T+GEQ +NVFYVRDSSGNPVD K IE LRKEIG  
Sbjct  361   RVGLLSEVTRILRENGLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHT  420

Query  505   MMLNvkkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
              M NVKKV   + A     PET  W KTSFFFG+LL +F A
Sbjct  421   TMFNVKKVPTSSKA-----PETKGWGKTSFFFGNLLERFLA  456



>ref|XP_008381705.1| PREDICTED: uncharacterized protein LOC103444536 isoform X1 [Malus 
domestica]
Length=449

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/453 (75%), Positives = 382/453 (84%), Gaps = 6/453 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR C PYFDPEYE LS RINPPRVSVDN SC DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCSPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G KVTD  TI YIEKALGPKG+ +D+L   PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKVTDSKTIDYIEKALGPKGHITDLLNAWPGKGV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANLHFNV+AA+VWTHN RIACV+YVND  +C
Sbjct  121   GVHSIGDHTAIELIGRDRPGLLSEISAVLANLHFNVIAADVWTHNGRIACVVYVNDDTTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               V+D +RL  +EEQLKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVEDQARLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P + I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  241   AHEVDHFPPCFQPKIXIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP ASQEY+IRHMDGCTLDTEGEK+R +KC++AAI+RRVSEGLRLELCAKDRVGLLS+V
Sbjct  301   DGPYASQEYFIRHMDGCTLDTEGEKERAIKCIDAAIRRRVSEGLRLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL VTRAGV+T+G+QG+N+FY+RDSSGN VD K IE LRKEIG  MM NVKKV
Sbjct  361   TRILRENGLSVTRAGVTTIGDQGINIFYIRDSSGNSVDIKTIEALRKEIGHTMMFNVKKV  420

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                +       PET  W+KTSFFFG+LL +F A
Sbjct  421   PTSSAEV----PETKGWAKTSFFFGNLLERFLA  449



>ref|XP_011101934.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
 ref|XP_011101940.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
 ref|XP_011101941.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
 ref|XP_011101947.1| PREDICTED: uncharacterized protein LOC105179968 [Sesamum indicum]
Length=443

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/444 (77%), Positives = 380/444 (86%), Gaps = 6/444 (1%)
 Frame = -1

Query  1720  WPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITK  1541
             W YFDPEYETLSIRINPP+VSVDN SCK+CT+VKVDS+NKPGILLEVVQ+L+DLDLIITK
Sbjct  4     WAYFDPEYETLSIRINPPQVSVDNSSCKECTLVKVDSMNKPGILLEVVQILTDLDLIITK  63

Query  1540  AYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             AY+SSDGGWFMDVFHVTDQ G K++D  TI +IEKALGPKG+TS +LKT PGK VGVNS+
Sbjct  64    AYISSDGGWFMDVFHVTDQQGQKISDSRTIEHIEKALGPKGHTSGILKTSPGKRVGVNSM  123

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
             GDYTAIELIGRDRPGLLSEISAVLANLH NVVAAEVWTHN+RIACVLYVND  +  AVDD
Sbjct  124   GDYTAIELIGRDRPGLLSEISAVLANLHINVVAAEVWTHNRRIACVLYVNDDTTNRAVDD  183

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEAD  1001
              SRL  +EEQLKN+LR C +D+N  HTSVS+GSTH+DRRLHQ+ F+DRDYEG     E D
Sbjct  184   ESRLAAMEEQLKNLLRGCGNDDNAGHTSVSLGSTHVDRRLHQLLFSDRDYEGTFAATEPD  243

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
              P L P V+ID C EK YSVV+V+CKDRPKLMFDIVCTLTD+QYVVFHA ISSDGP ASQ
Sbjct  244   SP-LVPKVTIDRCEEKDYSVVTVRCKDRPKLMFDIVCTLTDLQYVVFHATISSDGPYASQ  302

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRHMDGCTL+TEGEK++V+KCLEAAI+RR+SEGL LELCAKDRVGLLS+VTRVLREN
Sbjct  303   EYYIRHMDGCTLETEGEKEKVIKCLEAAIRRRISEGLSLELCAKDRVGLLSEVTRVLREN  362

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
             GL VTRAGV+TVGEQ +N+FYV D+SG PVD K IE LRKEIG  M LNVKK      A 
Sbjct  363   GLSVTRAGVTTVGEQAMNIFYVSDASGKPVDGKTIEELRKEIGHTMRLNVKKAPTNTKAL  422

Query  460   akVPPETAAWSKTSFFFGSLLGKF  389
                  E + W+KTSFFFGSLL KF
Sbjct  423   -----EASGWAKTSFFFGSLLEKF  441



>ref|XP_009360670.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360671.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360672.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009360673.1| PREDICTED: uncharacterized protein LOC103951112 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342844.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342845.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342846.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342847.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342848.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342849.1| PREDICTED: uncharacterized protein LOC103934817 isoform X1 [Pyrus 
x bretschneideri]
Length=449

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/453 (75%), Positives = 381/453 (84%), Gaps = 6/453 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR C PYFDPEYE LS RINPPRVS+DN SC DCTIVKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCSPYFDPEYENLSTRINPPRVSIDNSSCSDCTIVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G KVTD  TI YIEKALGPKG+ +D+L   PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKVTDSKTIDYIEKALGPKGHITDLLNAWPGKGV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIE+IGRDRPGLLSEISAVLANLHFNV+AAEVWTHN RIACV+YVND  +C
Sbjct  121   GVHSVGDHTAIEIIGRDRPGLLSEISAVLANLHFNVIAAEVWTHNGRIACVVYVNDDTTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               V+D +RL  +EEQLKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVEDQARLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P ++I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  241   ANEVDHFPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP ASQEY+IRHMDG TLDTEGEK+R +KC++AAI+RRVSEGLRLELCAKDRVGLLS+V
Sbjct  301   DGPYASQEYFIRHMDGYTLDTEGEKERAIKCIDAAIRRRVSEGLRLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRE+GL VTRAGV+T+GEQ +N+FYVRDSSGN VD K IE LRKEIG  M+ NVKKV
Sbjct  361   TRILREHGLSVTRAGVTTIGEQAMNIFYVRDSSGNSVDIKTIEALRKEIGHTMIFNVKKV  420

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                +       PET  W+KTSFFFG+LL +F A
Sbjct  421   PTSSAEV----PETKGWAKTSFFFGNLLERFLA  449



>ref|XP_006434331.1| hypothetical protein CICLE_v10001100mg [Citrus clementina]
 ref|XP_006434332.1| hypothetical protein CICLE_v10001100mg [Citrus clementina]
 gb|ESR47571.1| hypothetical protein CICLE_v10001100mg [Citrus clementina]
 gb|ESR47572.1| hypothetical protein CICLE_v10001100mg [Citrus clementina]
Length=456

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/456 (75%), Positives = 382/456 (84%), Gaps = 5/456 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA A WPYFDPEYE+LS+RINPPR SVDN SC +CT+VKVDSVNKPGILLEVVQVLSDLD
Sbjct  1     MANAYWPYFDPEYESLSLRINPPRASVDNSSCPECTVVKVDSVNKPGILLEVVQVLSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHV DQ G K+TDG TI YIEKALGPKG+ +   KT P K V
Sbjct  61    LIITKAYISSDGGWFMDVFHVIDQQGKKITDGKTIDYIEKALGPKGHITAGAKTWPSKQV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANL FNV AAEVWTHN+RIACVLYVND  +C
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVAAAEVWTHNRRIACVLYVNDDTTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNN--IAHTSVSMGSTHIDRRLHQMFFADRDYEGG  1022
              AV D +RL ++EEQLKNILR C D+++  +A TS SMG TH+DRRLHQMFFADRDYEGG
Sbjct  181   RAVGDQTRLSLMEEQLKNILRGCDDEDSEKVARTSFSMGFTHVDRRLHQMFFADRDYEGG  240

Query  1021  CL---DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAA  851
              +   D     PS KP ++++   +KGYSVV+VKC+DR KLMFDIVCTLTDMQYVVFHAA
Sbjct  241   GVTTADQVDHTPSFKPEITVERLEDKGYSVVNVKCRDRAKLMFDIVCTLTDMQYVVFHAA  300

Query  850   ISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLL  671
             ISSDGP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLL
Sbjct  301   ISSDGPHASQEYYIRHMDGCILDTEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLL  360

Query  670   SDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNv  491
             S+VTR+LRENGL VTRAGVSTVGEQ VNVFYVRD+SGNPVD K IE LRKEIG  M+ NV
Sbjct  361   SEVTRILRENGLSVTRAGVSTVGEQAVNVFYVRDASGNPVDMKTIEALRKEIGHTMLFNV  420

Query  490   kkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             KKV A   A  +     A W KTSFFFG+L  +F A
Sbjct  421   KKVPASRSAYKEPEASIAGWPKTSFFFGNLFERFLA  456



>ref|XP_002306671.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEE93667.1| ACT domain-containing family protein [Populus trichocarpa]
Length=445

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/452 (75%), Positives = 377/452 (83%), Gaps = 8/452 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS RINPPRVSVDN SC D T++KVDS+NKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENLSTRINPPRVSVDNTSCSDSTLIKVDSMNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+ D  TI YIEKALGPKG   + + T  GK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKIADLKTIDYIEKALGPKG--QEEVTTWSGKPV  118

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIEL GRDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  + 
Sbjct  119   GVHSVGDHTAIELTGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDDTTS  178

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL  +E+QLKNILR C DD     TS SMG TH+DRRLHQM FADRDYEGG +
Sbjct  179   RAVDDPTRLSAMEDQLKNILRGCDDDEKEGRTSFSMGFTHVDRRLHQMLFADRDYEGGIV  238

Query  1015  DMEA-DCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E  D PS KP ++++HC EKGYSVV+V+CKDR KLMFDIVCTLTDMQYVVFHA ISSD
Sbjct  239   ATEIHDPPSFKPKITVEHCEEKGYSVVTVRCKDRAKLMFDIVCTLTDMQYVVFHATISSD  298

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
              P ASQEYYIRHMDGC LDTEGEKDRV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VT
Sbjct  299   APHASQEYYIRHMDGCVLDTEGEKDRVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVT  358

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V+RAGV T+GEQ +NVFYVRD+SGNPVD KIIE LR+EIG  MMLNVKK  
Sbjct  359   RILRENGLSVSRAGVMTIGEQAMNVFYVRDASGNPVDMKIIEALRREIGHTMMLNVKKPP  418

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
               +       PE   W+KTSFFFG+LL +F A
Sbjct  419   VSSRE-----PEARGWAKTSFFFGNLLERFLA  445



>ref|XP_006472891.1| PREDICTED: uncharacterized protein LOC102609378 isoform X1 [Citrus 
sinensis]
 ref|XP_006472892.1| PREDICTED: uncharacterized protein LOC102609378 isoform X2 [Citrus 
sinensis]
 ref|XP_006472893.1| PREDICTED: uncharacterized protein LOC102609378 isoform X3 [Citrus 
sinensis]
 ref|XP_006472894.1| PREDICTED: uncharacterized protein LOC102609378 isoform X4 [Citrus 
sinensis]
Length=456

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/456 (75%), Positives = 382/456 (84%), Gaps = 5/456 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA A WPYFDPEYE+LS+RINPPR SVDN SC +CT+VKVDSVNKPGILLEVVQVLSDLD
Sbjct  1     MANAYWPYFDPEYESLSLRINPPRASVDNSSCPECTVVKVDSVNKPGILLEVVQVLSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHV DQ G K+TDG TI YIEKALGPKG+ +   KT P K V
Sbjct  61    LIITKAYISSDGGWFMDVFHVIDQQGKKITDGKTIDYIEKALGPKGHITAGAKTWPSKQV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANL FNV AAEVWTHN+RIACVLYVND  +C
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVAAAEVWTHNRRIACVLYVNDDTTC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNN--IAHTSVSMGSTHIDRRLHQMFFADRDYEGG  1022
              AV D +RL ++EEQLKNILR C D+++  +A TS SMG TH+DRRLHQMFFADRDYEGG
Sbjct  181   RAVGDQTRLSLMEEQLKNILRGCDDEDSEKVARTSFSMGFTHVDRRLHQMFFADRDYEGG  240

Query  1021  CL---DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAA  851
              +   D     PS KP ++++   +KGYSVV+VKC+DR KLMFDIVCTLTDMQYVVFHAA
Sbjct  241   GVTTADQVDHTPSFKPEITVERLEDKGYSVVNVKCRDRAKLMFDIVCTLTDMQYVVFHAA  300

Query  850   ISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLL  671
             ISSDGP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLL
Sbjct  301   ISSDGPHASQEYYIRHMDGCILDTEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLL  360

Query  670   SDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNv  491
             S+VTR+LRENGL VTRAGVSTVGEQ VNVFYVRD+SGNPVD K IE LRKEIG  M+ NV
Sbjct  361   SEVTRILRENGLSVTRAGVSTVGEQAVNVFYVRDASGNPVDMKTIEALRKEIGHTMLFNV  420

Query  490   kkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             KKV A   A  +     A W KTSFFFG+L  +F A
Sbjct  421   KKVPASRNAYKEPEASIAGWPKTSFFFGNLFERFLA  456



>ref|XP_010999853.1| PREDICTED: uncharacterized protein LOC105107576 [Populus euphratica]
 ref|XP_010999854.1| PREDICTED: uncharacterized protein LOC105107576 [Populus euphratica]
 ref|XP_010999855.1| PREDICTED: uncharacterized protein LOC105107576 [Populus euphratica]
 ref|XP_010999857.1| PREDICTED: uncharacterized protein LOC105107576 [Populus euphratica]
 ref|XP_010999858.1| PREDICTED: uncharacterized protein LOC105107576 [Populus euphratica]
Length=445

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 375/452 (83%), Gaps = 8/452 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS RINPPRVSVDN SC D T++KVDS+NKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENLSTRINPPRVSVDNTSCSDSTLIKVDSMNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI YIEKALGPKG   + +    GK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKITDIKTIDYIEKALGPKG--QEEVTAWSGKPV  118

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIEL GRDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  + 
Sbjct  119   GVHSVGDHTAIELTGRDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDDTTS  178

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVDDP+RL  +E+QLKNILR C +D  +  TS SMG TH+DRRLHQM FADRDYEGG +
Sbjct  179   RAVDDPTRLSAMEDQLKNILRGCDEDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGIV  238

Query  1015  DMEA-DCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E  D PS KP + ++HC EKGYSVV+V CKDR KLMFDIVCTLTDMQYVVFHA ISSD
Sbjct  239   TTEIHDPPSFKPKIRVEHCGEKGYSVVTVTCKDRAKLMFDIVCTLTDMQYVVFHATISSD  298

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
              P ASQEYYIRHMDGC LDTEGEKDRV+KCLEAAI RRVSEGL LELCAKDRVGLLS+VT
Sbjct  299   APHASQEYYIRHMDGCVLDTEGEKDRVIKCLEAAIGRRVSEGLSLELCAKDRVGLLSEVT  358

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V+RAGV T+GEQ +NVFYVRD+SGNPVD KIIE LR+EIG  MMLNVKK  
Sbjct  359   RILRENGLSVSRAGVMTIGEQAMNVFYVRDASGNPVDMKIIEALRREIGHTMMLNVKKPP  418

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
               +       PE   W+KTSFFFG+LL +F A
Sbjct  419   VSSRE-----PEARGWAKTSFFFGNLLERFLA  445



>ref|XP_010679322.1| PREDICTED: uncharacterized protein LOC104894719 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679331.1| PREDICTED: uncharacterized protein LOC104894719 [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/444 (75%), Positives = 372/444 (84%), Gaps = 5/444 (1%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE LSIRINPPRVSVDN SC DCT+VKVDS+NKPGILLEVVQ+L+DLDLIITKA
Sbjct  4     PYFDPEYENLSIRINPPRVSVDNSSCSDCTLVKVDSMNKPGILLEVVQILTDLDLIITKA  63

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLG  1358
             Y+SSDGGWFMDVFHVTDQ+G K+TD  TI YIEKALGPKG  +D +K+ PGK+VG++S+G
Sbjct  64    YISSDGGWFMDVFHVTDQNGKKITDSRTIEYIEKALGPKGQAADWIKSWPGKSVGLHSVG  123

Query  1357  DYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDP  1178
             D+TA+ELIGRDRPGLLSEI AVLA+LHFN+ AAEVWTHN RIACVLYVND  +  AVDDP
Sbjct  124   DHTAVELIGRDRPGLLSEIFAVLADLHFNIAAAEVWTHNTRIACVLYVNDDTTYRAVDDP  183

Query  1177  SRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC  998
             SRL ++EEQ+KNIL   +DD    HTS SMG TH+DRRLHQM FADRDYEG     E + 
Sbjct  184   SRLSLMEEQIKNILGGTQDDEQATHTSFSMGFTHVDRRLHQMMFADRDYEGAVTATEVEY  243

Query  997   P-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
             P  LKP + ++HC EKGYSVV++KCKDRPKLMFDIVCTLTDMQYVVFHA ISSDGP ASQ
Sbjct  244   PLPLKPKIFVEHCKEKGYSVVTLKCKDRPKLMFDIVCTLTDMQYVVFHATISSDGPYASQ  303

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DGCT+D EGEKDRV+KCLEAAIQRR+S+GL LELCAKDRVGLLS+VTR+LRE+
Sbjct  304   EYYIRHVDGCTVDMEGEKDRVIKCLEAAIQRRISDGLSLELCAKDRVGLLSEVTRILREH  363

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
             GL V RAGVSTVGE+  NVFYVRDSSGNPVD K IE LRKEIG  MMLN          S
Sbjct  364   GLSVMRAGVSTVGEKAKNVFYVRDSSGNPVDVKTIEALRKEIGLTMMLN----VKKDPVS  419

Query  460   akVPPETAAWSKTSFFFGSLLGKF  389
                P E   W+KTSFFFGSLL KF
Sbjct  420   TTAPHEARGWAKTSFFFGSLLEKF  443



>gb|KHG13930.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=449

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 378/452 (84%), Gaps = 4/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS+RINPPR  +           KVDSVNKPGILLEVVQ+LSDLD
Sbjct  1     MAKVCWPYFDPEYENLSVRINPPRFYLFIHMPFFFFFFKVDSVNKPGILLEVVQILSDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAYVSSDGGWFMDVFHVTDQ G K+TDG TI YIE+ LGPKG+T+D +K CPGK V
Sbjct  61    FIITKAYVSSDGGWFMDVFHVTDQQGKKITDGKTIDYIERVLGPKGHTTDGMKDCPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S G++TAIELIGRDRPGLLSEISAVLANLHFNV  AEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSFGNHTAIELIGRDRPGLLSEISAVLANLHFNVTVAEVWTHNRRIACVLYVNDNTTS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              +V+DP+RL ++EEQLK+I+R C+DD+N+A TS SMG THIDRRLHQM FADRDYEGG +
Sbjct  181   GSVNDPNRLSIMEEQLKHIMRGCEDDDNVARTSFSMGFTHIDRRLHQMLFADRDYEGGGV  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PS KP ++++ C EKGYSVV+V+CKDR KLMFDIVCTLTDMQYVVFHA ISS+
Sbjct  241   TTEVDYPPSFKPKITVERCEEKGYSVVTVRCKDRAKLMFDIVCTLTDMQYVVFHANISSN  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRHMDGCTLDTEGEK+RVVKCLEAAI RRVSEGL LELCAKDRVGLLS+VT
Sbjct  301   GPYASQEYFIRHMDGCTLDTEGEKERVVKCLEAAIHRRVSEGLSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVSTVGE+ VNVFYVRD+ GNPVD K IE LRKEIGQ MMLNVKK  
Sbjct  361   RILRENGLSVRRAGVSTVGEKAVNVFYVRDAYGNPVDAKTIEALRKEIGQTMMLNVKKDP  420

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             +   A      ET+ W+KTSFFFG+LL KF A
Sbjct  421   SSMKAREA---ETSGWAKTSFFFGNLLEKFLA  449



>ref|XP_011027407.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027408.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027409.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027410.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027411.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
 ref|XP_011027412.1| PREDICTED: uncharacterized protein LOC105127720 isoform X1 [Populus 
euphratica]
Length=444

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/452 (75%), Positives = 379/452 (84%), Gaps = 9/452 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA  CWPYFDPEYE LS RINPPRVSVDN SC D T+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MANVCWPYFDPEYENLSTRINPPRVSVDNTSCNDSTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI YIEKALGPK  + + + T   K V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKITDIKTIDYIEKALGPK--SQEEVSTWADKRV  118

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+G + AIELIG+DRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  + 
Sbjct  119   GVHSVGGHIAIELIGKDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDDTTS  178

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AV DP+RL ++E+QLKNILR C++D     TS SMG TH+DRRLHQM FADRDYEGG +
Sbjct  179   RAVADPTRLSIMEDQLKNILRGCENDE-AGRTSFSMGFTHVDRRLHQMLFADRDYEGGIV  237

Query  1015  DMEADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E DCP SLKP ++++ C +KGYSVV+V+CKDR KLMFDIVCTLTDMQYVVFHA ISSD
Sbjct  238   ATEVDCPPSLKPKITVERCEDKGYSVVTVRCKDRAKLMFDIVCTLTDMQYVVFHATISSD  297

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VT
Sbjct  298   GPHASQEYYIRHMDGCVLDTEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVT  357

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V+RAGV T+GEQ  NVFYVRD+SGNPVDTKIIE LRKEIG  MMLNVKK  
Sbjct  358   RILRENGLAVSRAGVMTIGEQATNVFYVRDASGNPVDTKIIEALRKEIGHTMMLNVKKTP  417

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             A +       PE   W+KTSFFFG+LL +F A
Sbjct  418   ASSRE-----PEARGWAKTSFFFGNLLERFLA  444



>ref|XP_004290721.1| PREDICTED: uncharacterized protein LOC101309692 [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/461 (75%), Positives = 388/461 (84%), Gaps = 13/461 (3%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR C PYFDPEYE LS RINPPRV VDN SC DCT+VKVDSVNKPGILLEVVQVL+DLD
Sbjct  1     MARVCSPYFDPEYENLSTRINPPRVCVDNSSCSDCTLVKVDSVNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G ++TD  TI +IEKALGPKG T++V+KT PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKQITDRKTIDHIEKALGPKGDTTEVVKTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLA+LHFNVVAAEVWTHN+RIACVLYVND  S 
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLADLHFNVVAAEVWTHNRRIACVLYVNDTTS-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE----  1028
               VD P+RL  IEE+LKNILR C+DD+N+ HTS SMG TH+DRRLHQM FADRDYE    
Sbjct  180   QPVDHPTRLSTIEERLKNILRGCEDDDNVGHTSFSMGFTHVDRRLHQMLFADRDYEGSGG  239

Query  1027  -----GGCLDMEADCPS-LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYV  866
                  GG L  E D P+  +P ++I+   EKGYSVVSV+CKDR KLMFDIVCTLTDM+YV
Sbjct  240   HGGGGGGGLSNEVDFPACFQPKITIERWEEKGYSVVSVRCKDRAKLMFDIVCTLTDMEYV  299

Query  865   VFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKD  686
             VFHA ISSDGP ASQEYYIRHMDGCTLDTEGEK+RVVKC++AAI+RRVSEGLRLELCAKD
Sbjct  300   VFHATISSDGPYASQEYYIRHMDGCTLDTEGEKERVVKCIDAAIRRRVSEGLRLELCAKD  359

Query  685   RVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQR  506
             RVGLLS+VTR+LRENGL V RAGVST+GEQ +NVFYVRDSSGN VD + IE LRKEIG  
Sbjct  360   RVGLLSEVTRILRENGLSVIRAGVSTIGEQAMNVFYVRDSSGNSVDIQKIEALRKEIGHT  419

Query  505   MMLNvkkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             MM NVKKV   + A     P+T+ W+KTSFFFG+LL +F A
Sbjct  420   MMFNVKKVPTSSKAPET--PDTSGWAKTSFFFGNLLERFLA  458



>ref|XP_010270359.1| PREDICTED: uncharacterized protein LOC104606716 [Nelumbo nucifera]
 ref|XP_010270360.1| PREDICTED: uncharacterized protein LOC104606716 [Nelumbo nucifera]
Length=450

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/454 (73%), Positives = 376/454 (83%), Gaps = 7/454 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             M R CWPYFDPEYE LS+RINPPRVSVDN +CKD T+VKVDSVNKPGILLEVVQVL+DLD
Sbjct  1     MDRVCWPYFDPEYENLSLRINPPRVSVDNSTCKDSTLVKVDSVNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYT--SDVLKTCPGK  1382
             L+ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+T  ++ +KT PGK
Sbjct  61    LVITKAYISSDGGWFMDVFHVTDQQGNKVTDTKTIEYIEKVLGPKGHTVATNGVKTWPGK  120

Query  1381  NVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKV  1202
              VGV+S+GD+TAIELIG+DRPGLLSEISAVLANLH NVVAAE WTHN R+ACV YVND  
Sbjct  121   RVGVHSIGDHTAIELIGKDRPGLLSEISAVLANLHCNVVAAEAWTHNMRVACVFYVNDDT  180

Query  1201  SCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGG  1022
             +C AVDDP RL  +EEQLKNILR  +DD   A TS SMG TH+DRRLHQM FADRDYE G
Sbjct  181   TCQAVDDPIRLSAMEEQLKNILRGHEDDGKAAQTSFSMGLTHMDRRLHQMMFADRDYEAG  240

Query  1021  CLDMEAD-CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAIS  845
              +  + D  PS +P +++D C +KGYSVV+V+CKDR KLMFDIVCTLTDMQYVVFHAAIS
Sbjct  241   GVTGDIDYAPSFRPIITVDRCEDKGYSVVTVRCKDRSKLMFDIVCTLTDMQYVVFHAAIS  300

Query  844   SDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSD  665
             SDGPSA QEYYIRHMDGC LDTEGEK+RVVKCLEAA++RRV EGL LELCA+DRVGLLS+
Sbjct  301   SDGPSALQEYYIRHMDGCLLDTEGEKERVVKCLEAAVRRRVCEGLSLELCARDRVGLLSE  360

Query  664   VTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkk  485
             VTRVLRENGL VTRAGV+TVG Q +N+FYV+D+SGNPVD K IE LRKEIG  MM N   
Sbjct  361   VTRVLRENGLSVTRAGVTTVGGQAMNIFYVKDASGNPVDMKTIEALRKEIGHTMMFN---  417

Query  484   vaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                    ++   PE+  W+K+SFFFG L  +F A
Sbjct  418   -VKKVPDASDKEPESRGWAKSSFFFGGLFERFMA  450



>ref|XP_002302203.1| hypothetical protein POPTR_0002s07550g [Populus trichocarpa]
 ref|XP_006386335.1| ACT domain-containing family protein [Populus trichocarpa]
 gb|EEE81476.1| hypothetical protein POPTR_0002s07550g [Populus trichocarpa]
 gb|ERP64132.1| ACT domain-containing family protein [Populus trichocarpa]
Length=444

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 378/452 (84%), Gaps = 9/452 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA  CWPYFDPEYE LS RINPPRVSVDN SC D T+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MASVCWPYFDPEYENLSTRINPPRVSVDNTSCNDSTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI YIEKALGPK  + + + T   K V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKITDIKTIDYIEKALGPK--SQEEVTTWADKRV  118

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+G +TAIELIG+DRPGLLSEISAVLANLHFNVVAAEVWTHN RIACV+YVND  + 
Sbjct  119   GVHSVGGHTAIELIGKDRPGLLSEISAVLANLHFNVVAAEVWTHNSRIACVVYVNDDTTS  178

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AV DP+RL ++E+QLKNILR C++D     TS SMG TH+DRRLHQM FADRDYEGG +
Sbjct  179   RAVADPTRLSIMEDQLKNILRGCENDE-AGRTSFSMGFTHVDRRLHQMLFADRDYEGGIV  237

Query  1015  DMEADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D P S+KP ++++ C +KGYSVV+V+CKDR KLMFDIVCTLTDMQYVVFHA ISSD
Sbjct  238   ATEVDYPPSIKPKITVERCEDKGYSVVTVRCKDRAKLMFDIVCTLTDMQYVVFHATISSD  297

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VT
Sbjct  298   GPHASQEYYIRHMDGCVLDTEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVT  357

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V+RAGV T+GEQ  NVFYVRD+SGNPVDTKIIE LRKEIG  MMLNVKK  
Sbjct  358   RILRENGLAVSRAGVMTIGEQATNVFYVRDASGNPVDTKIIEALRKEIGHTMMLNVKKTP  417

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             A +       PE   W+KTSFFFG+LL +F A
Sbjct  418   ASSRE-----PEARGWAKTSFFFGNLLERFLA  444



>ref|XP_003523410.1| PREDICTED: uncharacterized protein LOC100789173 isoform X1 [Glycine 
max]
 gb|KHN44274.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=445

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/450 (73%), Positives = 380/450 (84%), Gaps = 8/450 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S R+NPPRVS+DN SC DCT++KVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRMNPPRVSMDNASCHDCTLIKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI +IEKALGPK  +++ +K  P K V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDFIEKALGPKSQSTEGVKNWPSKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLHFNVFAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVD+ +RL ++EEQL NILR C D   +A TS SMGSTH+DRRLHQM FADRDYE   +
Sbjct  180   QAVDEANRLSLMEEQLNNILRGC-DGEKVARTSFSMGSTHMDRRLHQMLFADRDYESYAV  238

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PSL+P ++I+ C EKGYSVVSVKCKDR KLMFDIVCTLTDMQYVVFHA +SSD
Sbjct  239   AREVDSPPSLRPKITIERCEEKGYSVVSVKCKDRAKLMFDIVCTLTDMQYVVFHATVSSD  298

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDGCTLDT+GEK+RV++C+EAAI+RRVSEG+ LELCAKDRVGLLS+VT
Sbjct  299   GPYALQEYFIRHMDGCTLDTQGEKERVIQCIEAAIRRRVSEGVSLELCAKDRVGLLSEVT  358

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVST GEQ +NVFYVRD+SGNPVD K +E LRKEIG+ MM++VK+V 
Sbjct  359   RILRENGLTVCRAGVSTRGEQALNVFYVRDASGNPVDMKTMEALRKEIGKTMMVDVKRVP  418

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             + A A     PET  W+KTSFFFG+LL +F
Sbjct  419   SNAKA-----PETRGWAKTSFFFGNLLERF  443



>ref|XP_003541896.1| PREDICTED: uncharacterized protein LOC100797658 isoform X1 [Glycine 
max]
 ref|XP_006593772.1| PREDICTED: uncharacterized protein LOC100797658 isoform X2 [Glycine 
max]
 ref|XP_006593773.1| PREDICTED: uncharacterized protein LOC100797658 isoform X3 [Glycine 
max]
 ref|XP_006593774.1| PREDICTED: uncharacterized protein LOC100797658 isoform X4 [Glycine 
max]
 ref|XP_006593775.1| PREDICTED: uncharacterized protein LOC100797658 isoform X5 [Glycine 
max]
 gb|KHN24360.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=449

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/451 (72%), Positives = 376/451 (83%), Gaps = 6/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             M + CWPYFDPEYE  S RINPPRVSVDN SC DCT++K DS+NKPGILLEVVQ+L+DLD
Sbjct  1     MTKVCWPYFDPEYENFSNRINPPRVSVDNDSCHDCTLIKFDSINKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI +IEK LGPKG +++ +K+  GK V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDFIEKTLGPKGQSTEGVKSWKGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+T IELIGRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSIGDHTVIELIGRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE-GGC  1019
              A+DD  RL +IEEQL +ILR C+DD  +A TS SMG TH+DRRLHQM FADRDYE  G 
Sbjct  180   QAMDDSKRLSIIEEQLNHILRGCEDDEKVARTSFSMGITHMDRRLHQMLFADRDYESAGV  239

Query  1018  LDMEADCPS-LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
                + DCP   +PN+ I+  VEKGYSVVSVKCKDR KLMFDIVCTLTDM+YVVFHA ISS
Sbjct  240   TTTDVDCPPCFRPNIRIERIVEKGYSVVSVKCKDRAKLMFDIVCTLTDMEYVVFHATISS  299

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             +G  ASQEY+IRHMDGCTLDTEGEK+R +KC+EAAIQRRVSEG+ LELCAKDRVGLLS+V
Sbjct  300   EGQYASQEYFIRHMDGCTLDTEGEKERAIKCIEAAIQRRVSEGVSLELCAKDRVGLLSEV  359

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL V+RAGVSTVGE+G+NVFYVRD+SGNPVD KIIE L KEIGQ +M+N   V
Sbjct  360   TRILRENGLTVSRAGVSTVGEKGLNVFYVRDASGNPVDMKIIEALHKEIGQTVMVN---V  416

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKF  389
                  A AK P ET  W++TSFFFG+LL +F
Sbjct  417   KRIPAAYAKAPVETRGWARTSFFFGNLLERF  447



>ref|XP_006596251.1| PREDICTED: uncharacterized protein LOC100789044 isoform X1 [Glycine 
max]
 ref|XP_006596252.1| PREDICTED: uncharacterized protein LOC100789044 isoform X2 [Glycine 
max]
 ref|XP_006596253.1| PREDICTED: uncharacterized protein LOC100789044 isoform X3 [Glycine 
max]
 ref|XP_006596254.1| PREDICTED: uncharacterized protein LOC100789044 isoform X4 [Glycine 
max]
 ref|XP_006596255.1| PREDICTED: uncharacterized protein LOC100789044 isoform X5 [Glycine 
max]
 ref|XP_006596256.1| PREDICTED: uncharacterized protein LOC100789044 isoform X6 [Glycine 
max]
Length=448

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/451 (72%), Positives = 374/451 (83%), Gaps = 7/451 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S RINPPRVSVDN SC DCT++K DS+NKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRINPPRVSVDNDSCHDCTLIKFDSINKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI +IEK LGPKG +++ +    GK V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDFIEKTLGPKGQSTEGVNCWQGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSIGDHTAIELIGRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEG-GC  1019
              A+DD  RL ++EEQL +ILR C+DD  +A TS +MG TH+DRRLHQM FADRDYE  G 
Sbjct  180   QAMDDSKRLSIMEEQLNHILRGCEDDEKVARTSFTMGFTHMDRRLHQMLFADRDYESVGL  239

Query  1018  LDMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
                + DC PS +P + I+  VEKGYSVVSV+CKDR KLMFDIVCTLTDM+YVVFHA ISS
Sbjct  240   TTTDVDCPPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLTDMEYVVFHATISS  299

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             +G  ASQEY+IRHMDGCTLDTEGEK+RV+KC+EAAIQRRVSEG+ LELCAKDRVGLLS+V
Sbjct  300   EGQYASQEYFIRHMDGCTLDTEGEKERVIKCIEAAIQRRVSEGVSLELCAKDRVGLLSEV  359

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL V+RAGVSTVGE+G+NVFYVRD+SGNPVD KIIE L KEIGQ MM+N    
Sbjct  360   TRILRENGLRVSRAGVSTVGEKGLNVFYVRDASGNPVDMKIIEALHKEIGQIMMVN----  415

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKF  389
                     K P ET  W+KTSFFFG+LL +F
Sbjct  416   VKRVPGYVKAPAETRGWAKTSFFFGNLLERF  446



>ref|XP_003526664.1| PREDICTED: uncharacterized protein LOC100797293 isoform X1 [Glycine 
max]
 ref|XP_006581606.1| PREDICTED: uncharacterized protein LOC100797293 isoform X3 [Glycine 
max]
Length=445

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/450 (72%), Positives = 376/450 (84%), Gaps = 8/450 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S R+NPPRVSVDN SC DCT++K+DSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRMNPPRVSVDNASCHDCTLIKIDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              +ITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI  IEKALGPK  +++ +K  P K+V
Sbjct  61    FVITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDLIEKALGPKSKSTEGVKNWPSKHV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GDYTAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSVGDYTAIELIGRDRPGLLSEISAVLANLHFNVFAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
                DDP RL ++EEQL NILR C D   +A TS SMGSTH+DRRLHQM FADRDYE   +
Sbjct  180   QVADDPKRLSLMEEQLNNILRGC-DGEKVARTSFSMGSTHMDRRLHQMLFADRDYESYAV  238

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PSL+P ++I+ C EKGYSVVSVKCKDR KLMFDIVCTLTDMQYVVFHA +SSD
Sbjct  239   AREVDSPPSLRPRITIERCEEKGYSVVSVKCKDRAKLMFDIVCTLTDMQYVVFHATVSSD  298

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDGCTLDT+GEK+RV++C+EAAI+RRVSEG+ LELCAKDRVGLLS+VT
Sbjct  299   GPYALQEYFIRHMDGCTLDTQGEKERVIQCIEAAIRRRVSEGVSLELCAKDRVGLLSEVT  358

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVST GEQ +NVFYVRD+SGNPVD K +E L KEIG+ MM++VK+V 
Sbjct  359   RILRENGLSVCRAGVSTRGEQALNVFYVRDASGNPVDMKTMEALCKEIGKTMMVDVKRVP  418

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             +   A     PET  W+KTSFFFG+LL +F
Sbjct  419   SNTKA-----PETRGWAKTSFFFGNLLERF  443



>ref|XP_006581605.1| PREDICTED: uncharacterized protein LOC100797293 isoform X2 [Glycine 
max]
Length=471

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/450 (72%), Positives = 376/450 (84%), Gaps = 8/450 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S R+NPPRVSVDN SC DCT++K+DSVNKPGILLEVVQ+L+DLD
Sbjct  27    MAKVCWPYFDPEYENFSNRMNPPRVSVDNASCHDCTLIKIDSVNKPGILLEVVQILTDLD  86

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              +ITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI  IEKALGPK  +++ +K  P K+V
Sbjct  87    FVITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDLIEKALGPKSKSTEGVKNWPSKHV  146

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GDYTAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  + 
Sbjct  147   GVHSVGDYTAIELIGRDRPGLLSEISAVLANLHFNVFAAEVWTHNRRIACVLYVNDATN-  205

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
                DDP RL ++EEQL NILR C D   +A TS SMGSTH+DRRLHQM FADRDYE   +
Sbjct  206   QVADDPKRLSLMEEQLNNILRGC-DGEKVARTSFSMGSTHMDRRLHQMLFADRDYESYAV  264

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PSL+P ++I+ C EKGYSVVSVKCKDR KLMFDIVCTLTDMQYVVFHA +SSD
Sbjct  265   AREVDSPPSLRPRITIERCEEKGYSVVSVKCKDRAKLMFDIVCTLTDMQYVVFHATVSSD  324

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDGCTLDT+GEK+RV++C+EAAI+RRVSEG+ LELCAKDRVGLLS+VT
Sbjct  325   GPYALQEYFIRHMDGCTLDTQGEKERVIQCIEAAIRRRVSEGVSLELCAKDRVGLLSEVT  384

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVST GEQ +NVFYVRD+SGNPVD K +E L KEIG+ MM++VK+V 
Sbjct  385   RILRENGLSVCRAGVSTRGEQALNVFYVRDASGNPVDMKTMEALCKEIGKTMMVDVKRVP  444

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             +   A     PET  W+KTSFFFG+LL +F
Sbjct  445   SNTKA-----PETRGWAKTSFFFGNLLERF  469



>ref|XP_010537315.1| PREDICTED: uncharacterized protein LOC104812060 [Tarenaya hassleriana]
 ref|XP_010537316.1| PREDICTED: uncharacterized protein LOC104812060 [Tarenaya hassleriana]
Length=452

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 369/453 (81%), Gaps = 3/453 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE LS RINPPRVSVDN SC+DCT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVCWPYFDPEYENLSSRINPPRVSVDNTSCEDCTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHV D  GNK+TD  TI YIEK LGPK   S  L T P K V
Sbjct  61    LTITKAYISSDGGWFMDVFHVLDHQGNKITDSKTIEYIEKVLGPKSQASAALNTWPSKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+TAIELIGRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTAIELIGRDRPGLLSEISAVLADLRFNVLAAEVWTHNRRIACVLYVNDDSTS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDPSRL  +EEQL N+LR C ++D  +A  S S+GSTH+DRRLHQM FAD+DYEG  
Sbjct  181   RAVDDPSRLSAMEEQLNNVLRGCEEEDEKVARASFSVGSTHVDRRLHQMLFADKDYEGNK  240

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             L +++     KP + ++ C EK YSV++V CKDR KLMFDIVCTLTDMQYVVFHA ISSD
Sbjct  241   L-VDSSSQGFKPEIKVERCEEKDYSVINVSCKDRAKLMFDIVCTLTDMQYVVFHANISSD  299

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEYYIRH DGCTL +E EK+RV+KCLEAAI RRVSEGL LELCAKDR+GLLS+VT
Sbjct  300   GPCASQEYYIRHKDGCTLHSEAEKERVIKCLEAAIHRRVSEGLSLELCAKDRMGLLSEVT  359

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL V RAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR+EIG  MM+NVK   
Sbjct  360   RILREHGLSVMRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRQEIGHTMMINVKNKV  419

Query  478   acacasakVPP-ETAAWSKTSFFFGSLLGKFRA  383
                 +    P   +A W+KTSFFFG+LL +F A
Sbjct  420   HVGKSKESGPAGGSAGWAKTSFFFGNLLERFLA  452



>gb|EYU32470.1| hypothetical protein MIMGU_mgv1a006244mg [Erythranthe guttata]
Length=451

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/451 (73%), Positives = 378/451 (84%), Gaps = 12/451 (3%)
 Frame = -1

Query  1720  WPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITK  1541
             W YFDPEYETLSIR+NPP+VSVDN SCK+CT+VKVDS+NKPGILLEVVQ+L+DLDLIITK
Sbjct  4     WAYFDPEYETLSIRMNPPQVSVDNSSCKECTLVKVDSMNKPGILLEVVQILTDLDLIITK  63

Query  1540  AYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             AY+SSDGGWFMDVFHVTDQ G K+TD  TI +IE+ALGPKG TS +LKT PGK VGVNS+
Sbjct  64    AYISSDGGWFMDVFHVTDQQGQKITDTRTIEHIERALGPKGNTSGILKTWPGKKVGVNSM  123

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
             GDYTAIELIGRDRPGLLSEISAVLANL  NVVAAEVWTHN+RIACVLYVND ++  AV+D
Sbjct  124   GDYTAIELIGRDRPGLLSEISAVLANLQINVVAAEVWTHNRRIACVLYVNDDITNRAVED  183

Query  1180  PSRLCVIEEQLKNILR----ACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL-  1016
              SRL  +++QLKNILR    +  DD+ +  TS S+GSTH+DRRLHQ+ FADRDYEG  + 
Sbjct  184   ESRLSAMQDQLKNILRIGGGSDDDDSVLGRTSFSVGSTHVDRRLHQLLFADRDYEGAYVA  243

Query  1015  --DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               D EADCP +KP V+I+ C EK Y VV+V+C+DRPKLMFDIVCTLTDMQYVVFHA++SS
Sbjct  244   GNDGEADCP-IKPKVTIERCEEKDYFVVNVRCRDRPKLMFDIVCTLTDMQYVVFHASVSS  302

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             +GP ASQEYY+RH+DG TLDTEGEK++VVKCLEAAI+RR+SEGL LELCAKDRVGLLS+V
Sbjct  303   EGPYASQEYYVRHIDGFTLDTEGEKEKVVKCLEAAIRRRISEGLSLELCAKDRVGLLSEV  362

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TRVLRENGL VTRAGV+TVGEQ +NVFYV D+SG  VD K IE LRKEIG  MMLNVKK 
Sbjct  363   TRVLRENGLSVTRAGVTTVGEQAMNVFYVSDASGKSVDAKTIEELRKEIGHTMMLNVKKA  422

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKF  389
                A  +     +   W K SFFFG LL KF
Sbjct  423   PTNAAKAL----DANGWGKNSFFFGGLLEKF  449



>ref|XP_006390132.1| hypothetical protein EUTSA_v10018530mg [Eutrema salsugineum]
 ref|XP_006390133.1| hypothetical protein EUTSA_v10018530mg [Eutrema salsugineum]
 gb|ESQ27418.1| hypothetical protein EUTSA_v10018530mg [Eutrema salsugineum]
 gb|ESQ27419.1| hypothetical protein EUTSA_v10018530mg [Eutrema salsugineum]
Length=454

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/452 (71%), Positives = 367/452 (81%), Gaps = 3/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSEISAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEISAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AV+D  RL  +EEQL  +LR C ++D  +A TS+S+GSTH+DRRLHQM FADRDYE   
Sbjct  181   RAVEDAERLSAMEEQLNLVLRGCEQEDEKVARTSLSIGSTHVDRRLHQMLFADRDYEAVT  240

Query  1018  LDMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               ++    P L P ++++HC EKGYSV+SV C+DR KLMFDIVCTLTDMQY+VFHA ISS
Sbjct  241   TKLDGSTSPGLDPKITVEHCEEKGYSVISVSCEDRAKLMFDIVCTLTDMQYIVFHATISS  300

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             +GP ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCAKDRVGLLS+V
Sbjct  301   NGPHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCAKDRVGLLSEV  360

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM+NVK  
Sbjct  361   TRILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMINVKNK  420

Query  481   aacacasakVPPET-AAWSKTSFFFGSLLGKF  389
                     +    T   W+KTSFFFG+LL K 
Sbjct  421   VPSRRGKEEGQAGTGGGWAKTSFFFGNLLEKL  452



>gb|KHN23444.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=512

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/450 (72%), Positives = 375/450 (83%), Gaps = 8/450 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  + R+NPPRVSVDN S  DCT++K+DSVNKPGILLEVVQ+L+DLD
Sbjct  68    MAKVCWPYFDPEYENFTNRMNPPRVSVDNASFHDCTLIKIDSVNKPGILLEVVQILTDLD  127

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              +ITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI  IEKALGPK  +++ +K  P K+V
Sbjct  128   FVITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDLIEKALGPKSKSTEGVKNWPSKHV  187

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GDYTAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  + 
Sbjct  188   GVHSVGDYTAIELIGRDRPGLLSEISAVLANLHFNVFAAEVWTHNRRIACVLYVNDATN-  246

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
                DDP RL ++EEQL NILR C D   +A TS SMGSTH+DRRLHQM FADRDYE   +
Sbjct  247   QVADDPKRLSLMEEQLNNILRGC-DGEKVARTSFSMGSTHMDRRLHQMLFADRDYESYAV  305

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PSL+P ++I+ C EKGYSVVSVKCKDR KLMFDIVCTLTDMQYVVFHA +SSD
Sbjct  306   AREVDSPPSLRPRITIERCEEKGYSVVSVKCKDRAKLMFDIVCTLTDMQYVVFHATVSSD  365

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDGCTLDT+GEK+RV++C+EAAI+RRVSEG+ LELCAKDRVGLLS+VT
Sbjct  366   GPYALQEYFIRHMDGCTLDTQGEKERVIQCIEAAIRRRVSEGVSLELCAKDRVGLLSEVT  425

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVST GEQ +NVFYVRD+SGNPVD K +E L KEIG+ MM++VK+V 
Sbjct  426   RILRENGLSVCRAGVSTRGEQALNVFYVRDASGNPVDMKTMEALCKEIGKTMMVDVKRVP  485

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
             +   A     PET  W+KTSFFFG+LL +F
Sbjct  486   SNTKA-----PETRGWAKTSFFFGNLLERF  510



>ref|XP_007137510.1| hypothetical protein PHAVU_009G133100g [Phaseolus vulgaris]
 gb|ESW09504.1| hypothetical protein PHAVU_009G133100g [Phaseolus vulgaris]
Length=445

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/450 (72%), Positives = 374/450 (83%), Gaps = 8/450 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S R+NPPRVSVDN SC DCT++KVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRMNPPRVSVDNASCHDCTLIKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI +IEKALGPK  + + +K  P K V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGRKITDSKTIDFIEKALGPKSQSKEGVKILPSKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANL FNV AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVFAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVD+P+RL ++EEQL NILR C D   +A T+ SMG TH+DRRLHQM FADRDYE    
Sbjct  180   RAVDEPNRLSLMEEQLNNILRGC-DGEKVARTNFSMGFTHMDRRLHQMLFADRDYESYRA  238

Query  1015  DMEADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               + +CP S +P ++I+ C EKGYSVV+VKCKDR KLMFDIVCTLTDMQYVVFHA +SSD
Sbjct  239   ARDVNCPLSFRPKITIERCEEKGYSVVTVKCKDRAKLMFDIVCTLTDMQYVVFHATVSSD  298

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRH+DGCTLDTEGEK+RV++C+EAAI+RRVSEG+ LELCAKDRVGLLS+VT
Sbjct  299   GPYASQEYFIRHVDGCTLDTEGEKERVIQCIEAAIRRRVSEGVSLELCAKDRVGLLSEVT  358

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRENGL V RAGVST GEQ +NVFYVRD+SGNPVD K +E L KEIG+ MM+ VK+V 
Sbjct  359   RILRENGLTVCRAGVSTRGEQALNVFYVRDASGNPVDMKTMEALGKEIGKTMMVYVKRVP  418

Query  478   acacasakVPPETAAWSKTSFFFGSLLGKF  389
               A       PET  W+KTSFFFG+LL +F
Sbjct  419   TNAKV-----PETRGWAKTSFFFGNLLERF  443



>ref|XP_010260456.1| PREDICTED: uncharacterized protein LOC104599557 isoform X2 [Nelumbo 
nucifera]
Length=449

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/448 (72%), Positives = 369/448 (82%), Gaps = 8/448 (2%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE LS+RINPPRV +DN +CKD T+VKVDSVNKPGILLEVVQVL+DLDLIITKA
Sbjct  7     PYFDPEYENLSLRINPPRVCIDNSTCKDSTLVKVDSVNKPGILLEVVQVLTDLDLIITKA  66

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGY--TSDVLKTCPGKNVGVNS  1364
             Y+SSDGGWFMDVFHVTDQ GNKVTD  TI +IE ALGPKG+  T+D +KT PGK VGV+S
Sbjct  67    YISSDGGWFMDVFHVTDQQGNKVTDTKTIEHIEMALGPKGHSVTTDGVKTWPGKRVGVHS  126

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVD  1184
             +GD+TAIELIGRDRPGLLSEISAVL +LH NVV+AEVWTHN R+ACVLYVND  +C AVD
Sbjct  127   IGDHTAIELIGRDRPGLLSEISAVLTDLHCNVVSAEVWTHNMRLACVLYVNDDTTCRAVD  186

Query  1183  DPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEA  1004
             DP RL  +EEQLKN+L    D    A T+ SMG TH+DRRLHQM FADRDYE   +  + 
Sbjct  187   DPIRLSAMEEQLKNLLGGRDDGGKAARTNFSMGFTHMDRRLHQMMFADRDYEIDVVTKDT  246

Query  1003  D-CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
             D  PS +P +++D C +KGYSVV+V+CKDRPKL+FDIVCTLTDMQYVVFHA+ISSDGP A
Sbjct  247   DYAPSFQPIITVDRCEDKGYSVVNVRCKDRPKLLFDIVCTLTDMQYVVFHASISSDGPYA  306

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEYYIRHMDGC LDTEGEK+RVVKCLEAA++RRV EGL LELCA+DRVGLLS+VTR+LR
Sbjct  307   LQEYYIRHMDGCILDTEGEKERVVKCLEAAVRRRVCEGLSLELCARDRVGLLSEVTRILR  366

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacac  467
             ENGL V RAGV+TVGEQ +NVFYVRD+SGN VD K IE LRKEIG  MMLN         
Sbjct  367   ENGLSVRRAGVTTVGEQAMNVFYVRDASGNAVDMKTIEALRKEIGHTMMLN-----VKKV  421

Query  466   asakVPPETAAWSKTSFFFGSLLGKFRA  383
              +    PE++ W+KTSFFFGSL  +F A
Sbjct  422   PANAKEPESSGWAKTSFFFGSLFERFLA  449



>ref|XP_004498366.1| PREDICTED: uncharacterized protein LOC101494165 isoform X1 [Cicer 
arietinum]
Length=453

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/455 (70%), Positives = 371/455 (82%), Gaps = 10/455 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S RINPPRVS+DN SC DCT++K+DSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRINPPRVSMDNDSCPDCTLIKIDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTS-DVLKTCPGKN  1379
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD   I +IEKALGPKG  S + +++  GK 
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKIIDFIEKALGPKGRQSKEGMQSWEGKR  120

Query  1378  VGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVS  1199
             VGV+S+GD+TAIELIGRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  +
Sbjct  121   VGVHSIGDHTAIELIGRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATN  180

Query  1198  CNAVDDPSRLCVIEEQLKNILRACKDDNN---IAHTSVSMGSTHIDRRLHQMFFADRDYE  1028
                 DD  RL +IEEQL +ILR C+DD        TS SMG TH+DRRLHQM FADRDYE
Sbjct  181   QAMDDDSKRLSIIEEQLNHILRGCEDDEKEKVARKTSFSMGFTHMDRRLHQMLFADRDYE  240

Query  1027  --GGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHA  854
                G      DCPS +PN+ I+   EKGYSVVSV+CKDR KLMFDIVCTLTDM+YVVFHA
Sbjct  241   SAAGVTTTNVDCPSFRPNIKIERIEEKGYSVVSVRCKDRAKLMFDIVCTLTDMEYVVFHA  300

Query  853   AISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGL  674
             +ISS+GP ASQEY+IRH+DGCTLDTEGEK+RV+KC+EAAIQRRVSEG+ LELCAKDRVGL
Sbjct  301   SISSEGPYASQEYFIRHVDGCTLDTEGEKERVIKCIEAAIQRRVSEGVSLELCAKDRVGL  360

Query  673   LSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLN  494
             LS+VTR+LRENGL V RAGVST+GE+G+NVFYVRD+ GNPVD KIIE L KEIGQ +M+N
Sbjct  361   LSEVTRILRENGLTVCRAGVSTIGEKGLNVFYVRDAYGNPVDMKIIEALNKEIGQTVMVN  420

Query  493   vkkvaacacasakVPPETAAWSKTSFFFGSLLGKF  389
                      A+ K P  +  WS+ SFFFG+LL +F
Sbjct  421   ----VKKVPANTKAPEASRGWSRISFFFGNLLERF  451



>ref|NP_565146.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_849896.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_849897.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_001031289.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 ref|NP_001117608.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 sp|O49285.1|ACR3_ARATH RecName: Full=ACT domain-containing protein ACR3; AltName: Full=Protein 
ACT DOMAIN REPEATS 3 [Arabidopsis thaliana]
 gb|AAK26032.1|AF360322_1 unknown protein [Arabidopsis thaliana]
 gb|AAC00631.1| Similar to uridylyl transferases [Arabidopsis thaliana]
 gb|AAM44939.1| unknown protein [Arabidopsis thaliana]
 gb|AAM93428.1| ACR3 [Arabidopsis thaliana]
 dbj|BAH20041.1| AT1G76990 [Arabidopsis thaliana]
 gb|AEE35917.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35918.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35919.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35920.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE35921.1| ACT domain-containing protein 3 [Arabidopsis thaliana]
Length=453

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/452 (71%), Positives = 367/452 (81%), Gaps = 4/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSSRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+L+ NVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLNINVVAAEAWTHNRRIACVLYVNDNATS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKD-DNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL N+LR C++ D   A TS+S+GSTH+DRRLHQMFFADRDYE   
Sbjct  181   RAVDDPERLSSMEEQLNNVLRGCEEQDEKFARTSLSIGSTHVDRRLHQMFFADRDYEAVT  240

Query  1018  -LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
              LD  A C   +P ++++HC EKGYSV++V C+DRPKLMFDIVCTLTDMQY+VFHA ISS
Sbjct  241   KLDDSASC-GFEPKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISS  299

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
              G  ASQEY+IRH DGCTLDTEGEK+RVVKCLEAAI RRVSEG  LELCAKDRVGLLS+V
Sbjct  300   SGSHASQEYFIRHKDGCTLDTEGEKERVVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEV  359

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRE+GL V+RAGV+TVGEQ VNVFYV+D+SGNPVD K IE LR EIG  MM++ K  
Sbjct  360   TRILREHGLSVSRAGVTTVGEQAVNVFYVKDASGNPVDVKTIEALRGEIGHSMMIDFKNK  419

Query  481   aacacasakVPPET-AAWSKTSFFFGSLLGKF  389
                     +    T   W+KTSFFFG+LL K 
Sbjct  420   VPSRKWKEEGQAGTGGGWAKTSFFFGNLLEKL  451



>ref|XP_009104635.1| PREDICTED: uncharacterized protein LOC103830578 [Brassica rapa]
 ref|XP_009104636.1| PREDICTED: uncharacterized protein LOC103830578 [Brassica rapa]
 ref|XP_009104637.1| PREDICTED: uncharacterized protein LOC103830578 [Brassica rapa]
Length=450

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/451 (71%), Positives = 367/451 (81%), Gaps = 5/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSSRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ +    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHAASSQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSEISAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEISAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL  ++R   ++D  +A TS+S+GSTH+DRRLHQM FADRDY+   
Sbjct  181   RAVDDPERLSAMEEQLNLVIRGSEEEDEKVARTSLSIGSTHVDRRLHQMLFADRDYDAVS  240

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                + D   L+P ++++HC EKGYSV+SV C+DR KLMFDIVCTLTDMQY+VFHA I+S 
Sbjct  241   ---KVDGSGLEPKITVEHCEEKGYSVISVSCEDRAKLMFDIVCTLTDMQYIVFHATITSS  297

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  298   GPHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  357

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM+NVK   
Sbjct  358   RILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMINVKNKV  417

Query  478   acacasakVPPET-AAWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL KF
Sbjct  418   PSRRWKQEGQAGTGGGWAKTSFFFGNLLEKF  448



>emb|CDX79183.1| BnaC06g21200D [Brassica napus]
Length=450

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/451 (71%), Positives = 366/451 (81%), Gaps = 5/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSSRINPPSVSIDNTSCKQCTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ +    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHAASSQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSEISAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEISAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDN-NIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL  ++R  + +N  +A TS+S+GSTH+DRRLHQM FADRDY+   
Sbjct  181   RAVDDPERLSAMEEQLNLVIRGSEQENEKVARTSLSIGSTHVDRRLHQMLFADRDYDAVS  240

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                + D   L+P ++++HC EKGYSV+SV C+DR KLMFDIVCTLTDMQY+VFHA I+S 
Sbjct  241   ---KVDGSGLEPKITVEHCEEKGYSVISVSCEDRAKLMFDIVCTLTDMQYIVFHATITSS  297

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  298   GPHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  357

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM+NVK   
Sbjct  358   RILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMINVKNKV  417

Query  478   acacasakVPPET-AAWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL KF
Sbjct  418   PSRRWKEEGQAGTGGGWAKTSFFFGNLLEKF  448



>ref|XP_010428767.1| PREDICTED: uncharacterized protein LOC104713366 [Camelina sativa]
Length=453

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/451 (70%), Positives = 368/451 (82%), Gaps = 2/451 (0%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVT+Q GNKVTD  TI YIEK LGPKG+ S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTNQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+L+FNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLNFNVVAAEAWTHNRRIACVLYVNDNATS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL N+LR C ++D   A TS+S+GSTH+DRRLHQMFFAD+DYE   
Sbjct  181   TAVDDPERLSAVEEQLNNVLRGCEQEDEKFARTSLSIGSTHVDRRLHQMFFADKDYEAVT  240

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                ++  P L+  ++++HC EKGYSV++V C+DRPKLMFDIVCTLTDMQY+VFHA ISS 
Sbjct  241   KLDDSSSPGLERKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISSR  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             G  ASQEY+IRH DGCTL++EGEK+RVVKCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  301   GSHASQEYFIRHKDGCTLESEGEKERVVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL V+RAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM++VK   
Sbjct  361   RILREHGLSVSRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMIDVKNKV  420

Query  478   acacasakVPPET-AAWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL K 
Sbjct  421   PSRKWKEEGQVGTGGGWAKTSFFFGNLLEKI  451



>ref|XP_010416625.1| PREDICTED: uncharacterized protein LOC104702470 [Camelina sativa]
 ref|XP_010471865.1| PREDICTED: uncharacterized protein LOC104751596 [Camelina sativa]
Length=453

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/451 (70%), Positives = 367/451 (81%), Gaps = 2/451 (0%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVT+Q GNKVTD  TI YIEK LGPKG+ S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTNQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+L+FNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLNFNVVAAEAWTHNRRIACVLYVNDNATS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL N+LR C ++D   A TS+S+GSTH+DRRLHQMFFAD+DYE   
Sbjct  181   TAVDDPERLSAMEEQLNNVLRGCEQEDEKFARTSLSIGSTHVDRRLHQMFFADKDYEAVT  240

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                ++  P L   ++++HC EKGYSV++V C+DRPKLMFDIVCTLTDMQY+VFHA ISS 
Sbjct  241   KLDDSASPGLDRKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISSR  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             G  ASQEY+IRH DGCTL++EGEK+RVVKCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  301   GSHASQEYFIRHKDGCTLESEGEKERVVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  360

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL V+RAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM++VK   
Sbjct  361   RILREHGLSVSRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMIDVKNKV  420

Query  478   acacasakVPPET-AAWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL K 
Sbjct  421   PSRKWKEEGQAGTGGGWAKTSFFFGNLLEKI  451



>gb|AAM65519.1| unknown [Arabidopsis thaliana]
Length=453

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/452 (71%), Positives = 366/452 (81%), Gaps = 4/452 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSSRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+L+ NVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLNINVVAAEAWTHNRRIACVLYVNDNATS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKD-DNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL N+LR C++ D   A TS+S+GSTH+DRRLHQMFFADRDYE   
Sbjct  181   RAVDDPERLSSMEEQLNNVLRGCEEQDEKFARTSLSIGSTHVDRRLHQMFFADRDYEAVT  240

Query  1018  -LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
              LD  A C   +P ++++HC EKGYSV++V C+DRPKLMFDIVCTLTDMQY+VFHA ISS
Sbjct  241   KLDDSASC-GFEPKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISS  299

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
              G  ASQEY+IRH DGCTLDTEGEK+R VKCLEAAI RRVSEG  LELCAKDRVGLLS+V
Sbjct  300   SGSHASQEYFIRHKDGCTLDTEGEKERXVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEV  359

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRE+GL V+RAGV+TVGEQ VNVFYV+D+SGNPVD K IE LR EIG  MM++ K  
Sbjct  360   TRILREHGLSVSRAGVTTVGEQAVNVFYVKDASGNPVDVKTIEALRGEIGHSMMIDFKNK  419

Query  481   aacacasakVPPET-AAWSKTSFFFGSLLGKF  389
                     +    T   W+KTSFFFG+LL K 
Sbjct  420   VPSRKWKEEGQAGTGGGWAKTSFFFGNLLEKL  451



>emb|CDX87550.1| BnaA07g33230D [Brassica napus]
Length=448

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/451 (71%), Positives = 363/451 (80%), Gaps = 7/451 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKGY S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGYASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL  +LR C ++D  +A T +S+GSTH+DRRLHQM FADRDYE   
Sbjct  181   RAVDDPERLSTMEEQLNLVLRGCEQEDEKVARTCLSIGSTHVDRRLHQMLFADRDYEA--  238

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                        P ++I++C EKGYSVV+V C+DRPKLMFDIVCTLTDMQY+VFHA I+S 
Sbjct  239   ---VTKVDGSVPKITIENCEEKGYSVVNVSCEDRPKLMFDIVCTLTDMQYIVFHATITSS  295

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  296   GPHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  355

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM+NVK   
Sbjct  356   RILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMINVKNKV  415

Query  478   acacasakVPPETA-AWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL K 
Sbjct  416   PSKRWKEEGQAGTGRGWAKTSFFFGNLLEKL  446



>ref|XP_009106363.1| PREDICTED: uncharacterized protein LOC103832156 [Brassica rapa]
 ref|XP_009106364.1| PREDICTED: uncharacterized protein LOC103832157 isoform X1 [Brassica 
rapa]
Length=448

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/451 (71%), Positives = 362/451 (80%), Gaps = 7/451 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKGY S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGYASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL  +LR C ++D  +A T +S+GSTH+DRRLHQM FADRDYE   
Sbjct  181   RAVDDPERLSTMEEQLNLVLRGCEQEDEKVARTCLSIGSTHVDRRLHQMLFADRDYEA--  238

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                        P ++I++C EKGYSVV+V C+DRPKLMFDIVCTLTDMQY+VFHA I+S 
Sbjct  239   ---VTKVDGSVPKITIENCEEKGYSVVNVSCEDRPKLMFDIVCTLTDMQYIVFHATITSS  295

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             G  ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  296   GSHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  355

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM+NVK   
Sbjct  356   RILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMINVKNKV  415

Query  478   acacasakVPPETA-AWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL K 
Sbjct  416   PSKRWKEEGQAGTGRGWAKTSFFFGNLLEKL  446



>emb|CDX88335.1| BnaC06g37790D [Brassica napus]
Length=448

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/451 (70%), Positives = 362/451 (80%), Gaps = 7/451 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKGY S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGYASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+LHFNVV AE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLHFNVVGAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL  +LR C ++D  +A T +S+GSTH+DRRLHQM FADRDYE   
Sbjct  181   RAVDDPERLSNMEEQLNLVLRGCEQEDEKVARTCLSIGSTHVDRRLHQMLFADRDYEA--  238

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                        P ++I++C EKGYSV++V C+DRPKLMFDIVCTLTDMQY+VFHA I+S 
Sbjct  239   ---VTKVDGSVPKITIENCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATITSS  295

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  296   GPHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  355

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG  MM+NVK   
Sbjct  356   RILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIGHSMMINVKNKV  415

Query  478   acacasakVPPETA-AWSKTSFFFGSLLGKF  389
                    +    T   W+KTSFFFG+LL K 
Sbjct  416   PSKSWKEEGQAGTGRGWAKTSFFFGNLLEKL  446



>ref|XP_004502566.1| PREDICTED: uncharacterized protein LOC101511775 [Cicer arietinum]
Length=447

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/453 (71%), Positives = 370/453 (82%), Gaps = 8/453 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             M   CWPYFDPEYE  S RINPPRVSVDN SC +CT++K DSVNKPGILLEVVQ+L+DLD
Sbjct  1     MGAVCWPYFDPEYENFSNRINPPRVSVDNASCHNCTLIKFDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI  IEKALGPK  +++ +K   GK V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQRGKKITDSKTIDLIEKALGPKSQSTEGVKNWSGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+ A+ELIGRDRPGLLSEISAVLANLHFNV  AE WTHN+RIAC+LYVND    
Sbjct  121   GVHSVGDHIAVELIGRDRPGLLSEISAVLANLHFNVAVAEAWTHNRRIACILYVNDGTR-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIA-HTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL V+EEQL N+LR C+D + IA  TS+SM  THIDRRLHQM FADRDYE   
Sbjct  180   QAVDDPKRLSVMEEQLNNVLRGCEDGDKIASRTSLSMSFTHIDRRLHQMLFADRDYESCG  239

Query  1018  LDMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
             +  ++ C PS +P ++I+ C EKGYSVVSV+C+DR KLMFDIVCTLTDMQYVVFHA ISS
Sbjct  240   VTTDSVCAPSFRPKIAIECCEEKGYSVVSVRCRDRAKLMFDIVCTLTDMQYVVFHATISS  299

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
             DGP ASQEY+IRHMDGCTLDTEGEK+RV+KC+EAAIQRRVSEG+ LELCAKDRVGLLS+V
Sbjct  300   DGPYASQEYFIRHMDGCTLDTEGEKERVIKCIEAAIQRRVSEGVSLELCAKDRVGLLSEV  359

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+LRENGL V RAG+ST GEQ +NVFYVRD+SGN +D K IE L KEIG+ MM++VKKV
Sbjct  360   TRILRENGLTVCRAGISTKGEQALNVFYVRDASGNTLDMKTIEALCKEIGKTMMIDVKKV  419

Query  481   aacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
              A          ET  W+KTSFFFG+LL +F A
Sbjct  420   PAYDKTH-----ETRGWAKTSFFFGNLLERFLA  447



>ref|XP_010260453.1| PREDICTED: uncharacterized protein LOC104599557 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010260454.1| PREDICTED: uncharacterized protein LOC104599557 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010260455.1| PREDICTED: uncharacterized protein LOC104599557 isoform X1 [Nelumbo 
nucifera]
Length=459

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/458 (71%), Positives = 369/458 (81%), Gaps = 18/458 (4%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE LS+RINPPRV +DN +CKD T+VKVDSVNKPGILLEVVQVL+DLDLIITKA
Sbjct  7     PYFDPEYENLSLRINPPRVCIDNSTCKDSTLVKVDSVNKPGILLEVVQVLTDLDLIITKA  66

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGY--TSDVLKTCPGKNVGVNS  1364
             Y+SSDGGWFMDVFHVTDQ GNKVTD  TI +IE ALGPKG+  T+D +KT PGK VGV+S
Sbjct  67    YISSDGGWFMDVFHVTDQQGNKVTDTKTIEHIEMALGPKGHSVTTDGVKTWPGKRVGVHS  126

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVD  1184
             +GD+TAIELIGRDRPGLLSEISAVL +LH NVV+AEVWTHN R+ACVLYVND  +C AVD
Sbjct  127   IGDHTAIELIGRDRPGLLSEISAVLTDLHCNVVSAEVWTHNMRLACVLYVNDDTTCRAVD  186

Query  1183  DPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEA  1004
             DP RL  +EEQLKN+L    D    A T+ SMG TH+DRRLHQM FADRDYE   +  + 
Sbjct  187   DPIRLSAMEEQLKNLLGGRDDGGKAARTNFSMGFTHMDRRLHQMMFADRDYEIDVVTKDT  246

Query  1003  D-CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
             D  PS +P +++D C +KGYSVV+V+CKDRPKL+FDIVCTLTDMQYVVFHA+ISSDGP A
Sbjct  247   DYAPSFQPIITVDRCEDKGYSVVNVRCKDRPKLLFDIVCTLTDMQYVVFHASISSDGPYA  306

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSE----------GLRLELCAKDRVG  677
              QEYYIRHMDGC LDTEGEK+RVVKCLEAA++RRV E          GL LELCA+DRVG
Sbjct  307   LQEYYIRHMDGCILDTEGEKERVVKCLEAAVRRRVCEKTSFWLYVMQGLSLELCARDRVG  366

Query  676   LLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMML  497
             LLS+VTR+LRENGL V RAGV+TVGEQ +NVFYVRD+SGN VD K IE LRKEIG  MML
Sbjct  367   LLSEVTRILRENGLSVRRAGVTTVGEQAMNVFYVRDASGNAVDMKTIEALRKEIGHTMML  426

Query  496   NvkkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
             N          +    PE++ W+KTSFFFGSL  +F A
Sbjct  427   N-----VKKVPANAKEPESSGWAKTSFFFGSLFERFLA  459



>emb|CDX68068.1| BnaA07g21080D [Brassica napus]
Length=464

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/462 (69%), Positives = 367/462 (79%), Gaps = 13/462 (3%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSSRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ +    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHAASSQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSEISAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEISAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDN-NIAHTSVSMGSTHIDRRLHQMFFADRDYEG-G  1022
              AVDDP RL  +EEQL  ++R  + +N  +A TS+S+GSTH+DRRLHQM FADRDY+   
Sbjct  181   RAVDDPERLSAMEEQLNLVIRGSEQENEKVARTSLSIGSTHVDRRLHQMLFADRDYDAVS  240

Query  1021  CLDMEADCPSL----------KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQ  872
              +D     P +           P ++++HC EKGYSV+SV C+DR KLMFDIVCTLTDMQ
Sbjct  241   KVDGSGLEPKITVEHCEEKGYSPKITVEHCEEKGYSVISVSCEDRAKLMFDIVCTLTDMQ  300

Query  871   YVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCA  692
             Y+VFHA I+S GP ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCA
Sbjct  301   YIVFHATITSSGPHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCA  360

Query  691   KDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             KDRVGLLS+VTR+LRE+GL VTRAGV+TVGEQ VNVFYVRD+SGNPVD K IE LR EIG
Sbjct  361   KDRVGLLSEVTRILREHGLSVTRAGVTTVGEQAVNVFYVRDASGNPVDVKTIEALRGEIG  420

Query  511   QRMMLNvkkvaacacasakVPPET-AAWSKTSFFFGSLLGKF  389
               MM+NVK          +    T   W+KTSFFFG+LL KF
Sbjct  421   HSMMINVKNKVPSRRWKQEGQAGTGGGWAKTSFFFGNLLEKF  462



>ref|XP_002887664.1| hypothetical protein ARALYDRAFT_476859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63923.1| hypothetical protein ARALYDRAFT_476859 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/451 (69%), Positives = 364/451 (81%), Gaps = 3/451 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKG+ S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGHASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SA+LA+L+ NVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAILADLNINVVAAEAWTHNRRIACVLYVNDNATS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL N+LR C ++D   A TS+S+GSTH+DRRLHQMFFAD+DYE   
Sbjct  181   RAVDDPERLSAMEEQLNNVLRGCEQEDEKFARTSLSIGSTHVDRRLHQMFFADKDYEAVT  240

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                +     L+P ++++HC EKGYSV++V C+DRPKLMFDIVCTLTDMQY+VFHA ISS 
Sbjct  241   KLDDFASRGLEPKITVEHCEEKGYSVINVSCEDRPKLMFDIVCTLTDMQYIVFHATISSS  300

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             G  ASQEY+IRH DGCTLDT GEK+RVVKCLEAAI RRVSEG  LELCAKDRVGLLS+VT
Sbjct  301   GSHASQEYFIRHKDGCTLDT-GEKERVVKCLEAAIHRRVSEGWSLELCAKDRVGLLSEVT  359

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkva  479
             R+LRE+GL V+RAGV+TVGEQ VNVFYV+D+SGNPVD K IE LR EIG  MM++ K   
Sbjct  360   RILREHGLSVSRAGVTTVGEQAVNVFYVKDASGNPVDVKTIEALRGEIGHSMMIDFKNKV  419

Query  478   acacasakVPPET-AAWSKTSFFFGSLLGKF  389
                    +    T   W+KT+FFFG+LL K 
Sbjct  420   PSRKGKEEGQAGTGGGWAKTTFFFGNLLEKL  450



>gb|KEH35390.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=448

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/454 (70%), Positives = 363/454 (80%), Gaps = 9/454 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA  CWPYFDPEYE  S RINPPRVSVDN SC++CT++K DSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAEVCWPYFDPEYENFSNRINPPRVSVDNASCRNCTLIKFDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAYVSSDGGWFMDVFHVTDQ G K+TD  TI  IEKALGPK    D LK   GK V
Sbjct  61    FIITKAYVSSDGGWFMDVFHVTDQQGKKITDSKTIDLIEKALGPKSQNKDELKNWSGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+  IELIGRDRPGLLSEISAVLA+LHFNVV AEVWTHN+R ACVLYVND    
Sbjct  121   GVHSVGDHIVIELIGRDRPGLLSEISAVLASLHFNVVVAEVWTHNRRTACVLYVNDGAR-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIA-HTSVSMGSTHIDRRLHQMFFADRDYEG-G  1022
              AVDDP R+ ++EEQL NILR  +D   +A  TS+SM  THIDRRLHQM FADRDYE  G
Sbjct  180   QAVDDPKRISLMEEQLNNILRGYEDGEKVASRTSLSMSFTHIDRRLHQMLFADRDYESYG  239

Query  1021  CLDMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAIS  845
                 + +C PS +P ++I+ C EKGYSVV+V+CKDR KLMFDIVCTLTDMQYVV HA IS
Sbjct  240   VTTTDVECPPSFRPKITIECCEEKGYSVVNVRCKDRAKLMFDIVCTLTDMQYVVSHATIS  299

Query  844   SDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSD  665
             SD P ASQEY+IRHMDGCTLDTEGEK+RV+KC+EAAIQRRVSEG+ LELCAKDRVGLLS+
Sbjct  300   SDRPYASQEYFIRHMDGCTLDTEGEKERVIKCIEAAIQRRVSEGVSLELCAKDRVGLLSE  359

Query  664   VTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkk  485
             VTR+LRENGL V RAG+ST GEQ +NVFYVRD+SGN VD K IE LRKEIG+ MM++   
Sbjct  360   VTRILRENGLTVCRAGISTRGEQALNVFYVRDASGNSVDMKTIEALRKEIGKTMMVD---  416

Query  484   vaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                    +     ET  W+KTSFFFG+LL +F A
Sbjct  417   --VKKVPTHDKEQETRGWAKTSFFFGNLLERFLA  448



>ref|XP_010089340.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB37665.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=455

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/413 (76%), Positives = 350/413 (85%), Gaps = 6/413 (1%)
 Frame = -1

Query  1618  VDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIE  1439
             +DSVNKPGILLEVVQ+LSDLDLIITKAY+SSDGG+FMDVFHVTDQ GNK+TD  TI YIE
Sbjct  48    LDSVNKPGILLEVVQILSDLDLIITKAYISSDGGFFMDVFHVTDQQGNKITDSKTIDYIE  107

Query  1438  KALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAA  1259
             KALGPKG T++ LKT  GK VGV+S+GD+T +ELIGRDRPGLLSEISAVLANL FNV  A
Sbjct  108   KALGPKGKTTEELKTWQGKQVGVHSIGDHTVVELIGRDRPGLLSEISAVLANLRFNVYVA  167

Query  1258  EVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGST  1079
             EVWTHN+RIACVLYVND V+C AV+DP+RL  +EEQLKNILR C+DD  + +TS SMG T
Sbjct  168   EVWTHNRRIACVLYVNDDVTCRAVNDPTRLSAMEEQLKNILRGCEDDEKVGYTSFSMGFT  227

Query  1078  HIDRRLHQMFFADRDYEGGCLDMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMF  902
             HIDRRLHQM FADRDYEG  L  E D  PS KP ++I+ C EKGYSVVSV+CKDR KLMF
Sbjct  228   HIDRRLHQMLFADRDYEGCGLTNEVDSPPSFKPKIAIERCEEKGYSVVSVRCKDRAKLMF  287

Query  901   DIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRV  722
             DIVCTLTDMQYVVFHA ISSD P ASQEYYIRHMDGCTLDTEGEK+RVVKC+EAAIQRRV
Sbjct  288   DIVCTLTDMQYVVFHATISSDAPYASQEYYIRHMDGCTLDTEGEKERVVKCIEAAIQRRV  347

Query  721   SEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTK  542
             SEGLRLELCAKDRVGLLS+VTR+LRENGL V+RAGVSTVGEQ VNVF+VRD+SGNPVD K
Sbjct  348   SEGLRLELCAKDRVGLLSEVTRILRENGLSVSRAGVSTVGEQAVNVFFVRDASGNPVDMK  407

Query  541   IIEGLRKEIGQRMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
              IE LRKEIG  MML+          ++   PE + W+KTSFFFG+LL KF A
Sbjct  408   TIEALRKEIGHTMMLS-----VKKVPTSSKAPEASGWAKTSFFFGNLLEKFLA  455



>gb|EPS66237.1| hypothetical protein M569_08538, partial [Genlisea aurea]
Length=449

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/448 (70%), Positives = 363/448 (81%), Gaps = 10/448 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             YFDPEYETLSIRINPP+VSVDN SCK CT+VKVDS+NKPGILLEVVQ+LSDLD +I KAY
Sbjct  6     YFDPEYETLSIRINPPQVSVDNSSCKKCTVVKVDSMNKPGILLEVVQILSDLDFLINKAY  65

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV--GVNSL  1361
             +SSDGGWFMDVFHVTDQ G K+TD NTI YIEKALGPKG+TS VLK+ P K V  G NS+
Sbjct  66    ISSDGGWFMDVFHVTDQQGQKITDPNTIDYIEKALGPKGHTSGVLKSWPEKRVALGQNSM  125

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
             GDY AIELIGRDRPGLLSEISAV+ANLH NVVAAEVWTHN+RIAC+LYVND  +  AV D
Sbjct  126   GDYNAIELIGRDRPGLLSEISAVVANLHINVVAAEVWTHNRRIACILYVNDDATSRAVVD  185

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE--GGCLDME  1007
             PSRL ++E+QL N+LR  +DD + + TS   GSTH+DRRLHQM F+DRDYE  G C D E
Sbjct  186   PSRLSLLEDQLNNLLRG-RDDAS-SRTSFGAGSTHVDRRLHQMLFSDRDYEYEGCCPDDE  243

Query  1006  ADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPS  830
             + C   ++P V+++ CVEK YSVV+V CKDRPKLMFDIVCTLTDM YVVFHA ISS GP 
Sbjct  244   SYCSMRVRPQVTVERCVEKDYSVVNVHCKDRPKLMFDIVCTLTDMDYVVFHANISSTGPD  303

Query  829   ASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVL  650
             AS EY+IRH DGCTL+T+ E+D V+KCLEAAI+RR+SEGL LELCAK+RVGLLS+VTRVL
Sbjct  304   ASHEYFIRHRDGCTLETDAEQDMVIKCLEAAIKRRISEGLSLELCAKNRVGLLSEVTRVL  363

Query  649   RENGLLVTRAGVSTVGEQGVNVFYVRDSSGNP-VDTKIIEGLRKEIGQRMMLNvkkvaac  473
             RENGL VTRAGV+T GE+  NVFYV D+SG P VD++ IE LRKEIG+ M  +V+K    
Sbjct  364   RENGLSVTRAGVTTEGEEATNVFYVSDASGKPVVDSRTIETLRKEIGETMRFSVRKTETA  423

Query  472   acasakVPPETAAWSKTSFFFGSLLGKF  389
             + A      E   W  TSFFFGSLL K 
Sbjct  424   SAARTT--EEGNGWGITSFFFGSLLEKL  449



>ref|XP_011027413.1| PREDICTED: uncharacterized protein LOC105127720 isoform X2 [Populus 
euphratica]
Length=402

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/410 (73%), Positives = 341/410 (83%), Gaps = 9/410 (2%)
 Frame = -1

Query  1609  VNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKAL  1430
             +NKPGILLEVVQVL+DLDLIITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI YIEKAL
Sbjct  1     MNKPGILLEVVQVLTDLDLIITKAYISSDGGWFMDVFHVTDQQGKKITDIKTIDYIEKAL  60

Query  1429  GPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVW  1250
             GPK  + + + T   K VGV+S+G + AIELIG+DRPGLLSEISAVLANLHFNVVAAEVW
Sbjct  61    GPK--SQEEVSTWADKRVGVHSVGGHIAIELIGKDRPGLLSEISAVLANLHFNVVAAEVW  118

Query  1249  THNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHID  1070
             THN+RIACV+YVND  +  AV DP+RL ++E+QLKNILR C++D     TS SMG TH+D
Sbjct  119   THNRRIACVVYVNDDTTSRAVADPTRLSIMEDQLKNILRGCENDEA-GRTSFSMGFTHVD  177

Query  1069  RRLHQMFFADRDYEGGCLDMEADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIV  893
             RRLHQM FADRDYEGG +  E DCP SLKP ++++ C +KGYSVV+V+CKDR KLMFDIV
Sbjct  178   RRLHQMLFADRDYEGGIVATEVDCPPSLKPKITVERCEDKGYSVVTVRCKDRAKLMFDIV  237

Query  892   CTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEG  713
             CTLTDMQYVVFHA ISSDGP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI+RRVSEG
Sbjct  238   CTLTDMQYVVFHATISSDGPHASQEYYIRHMDGCVLDTEGEKERVIKCLEAAIRRRVSEG  297

Query  712   LRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIE  533
             L LELCAKDRVGLLS+VTR+LRENGL V+RAGV T+GEQ  NVFYVRD+SGNPVDTKIIE
Sbjct  298   LSLELCAKDRVGLLSEVTRILRENGLAVSRAGVMTIGEQATNVFYVRDASGNPVDTKIIE  357

Query  532   GLRKEIGQRMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
              LRKEIG  MMLN          ++   PE   W+KTSFFFG+LL +F A
Sbjct  358   ALRKEIGHTMMLN-----VKKTPASSREPEARGWAKTSFFFGNLLERFLA  402



>ref|XP_008808483.1| PREDICTED: uncharacterized protein LOC103720522 isoform X1 [Phoenix 
dactylifera]
Length=448

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/449 (68%), Positives = 366/449 (82%), Gaps = 9/449 (2%)
 Frame = -1

Query  1720  WPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITK  1541
             WPYFDPEYE LS R+NPPRV +DN +C DCT+VKVDS+NKPGILLEVVQVLSDLDL I+K
Sbjct  2     WPYFDPEYENLSQRMNPPRVCIDNTTCSDCTLVKVDSMNKPGILLEVVQVLSDLDLFISK  61

Query  1540  AYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKT----CPGKNVG  1373
             AY++SDG WFMDVFHVTDQ GNK+TD  TI YIEKALGP+   S++L T     PGK+VG
Sbjct  62    AYITSDGRWFMDVFHVTDQQGNKITDQKTIEYIEKALGPE---SNILGTKGDSWPGKSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             ++S+GDYTAIELIG DRPGLLSEI AVLANLH NV+AAEVWTHN R+AC+L+VND+ +  
Sbjct  119   MHSIGDYTAIELIGTDRPGLLSEIFAVLANLHCNVIAAEVWTHNMRVACILFVNDEATFQ  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE-GGCL  1016
             AVDDPSRL  +EEQL+N+LR C DD   A TS S+G+TH+DRRLHQ+  AD+DYE GG +
Sbjct  179   AVDDPSRLSKMEEQLRNVLRGCGDDVRGARTSFSIGTTHVDRRLHQLMLADKDYEIGGSV  238

Query  1015  DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
                 +    +P ++IDHC EKGYSVV++KCKDRPKL+FDIVCTLTDMQ+VVFHA++SSDG
Sbjct  239   AERNEVIPFRPVITIDHCEEKGYSVVNIKCKDRPKLLFDIVCTLTDMQFVVFHASVSSDG  298

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
             P   QE YIRH DG TLD++ EK+ V+KCLEAAI RRVSEG  LELC +DRVGLLSDVTR
Sbjct  299   PYGLQELYIRHKDGFTLDSKEEKEMVIKCLEAAISRRVSEGFSLELCGRDRVGLLSDVTR  358

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaa  476
             VLRE GL VTRA V+T+GEQ +NVFYVRD+SGNPVD K IE LR+EIG  +MLNVK+V +
Sbjct  359   VLREYGLTVTRADVTTIGEQAMNVFYVRDASGNPVDMKTIEALRREIGHTVMLNVKRVPS  418

Query  475   cacasakVPPETAAWSKTSFFFGSLLGKF  389
              A ASAK  P+ +  ++  F FG LLG+F
Sbjct  419   SASASAKA-PQPSRGARKGFSFGGLLGRF  446



>gb|KEH40482.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=683

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/433 (70%), Positives = 356/433 (82%), Gaps = 13/433 (3%)
 Frame = -1

Query  1663  VSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQ  1484
             VS+DN SC DCT++K+DSVNKPGILLEVVQ+L+DLD IITKAY+SSDG WFMDVFHVTDQ
Sbjct  254   VSMDNDSCHDCTLIKIDSVNKPGILLEVVQILTDLDFIITKAYISSDGSWFMDVFHVTDQ  313

Query  1483  HGNKVTDGNTIGYIEKALGPKGYTS-DVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLS  1307
              G K+TD   I +IEKALGPKG  S + +K+  GK VG++S+GD+TAIELIGRDRPGLLS
Sbjct  314   QGKKITDNKIIDFIEKALGPKGRKSPEGVKSWEGKRVGIHSIGDHTAIELIGRDRPGLLS  373

Query  1306  EISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRAC  1127
             EISAVLA+  FNV+AAEVWTHN+RIACVLYVND  +    DD  RL +++E+L +ILR C
Sbjct  374   EISAVLASFQFNVIAAEVWTHNRRIACVLYVNDATNQAVDDDSKRLSLLDEKLNHILRGC  433

Query  1126  KDDNNIAHTSVSMGST--HIDRRLHQMFFADRDYE---GGCLDMEADCP-SLKPNVSIDH  965
             +DD+N+A TS SMG T  H+DRRLHQM FADRDYE   G       D P S +PN+ I+ 
Sbjct  434   EDDDNVARTSFSMGFTFTHMDRRLHQMLFADRDYESAGGVTTATNVDSPPSFRPNIEIER  493

Query  964   CVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTL  785
               EKGYSVVSV+CKDR KLMFDIVCTLTDM+YVVFHA+ISSDGP ASQEY+IRH+DGCTL
Sbjct  494   IEEKGYSVVSVRCKDRAKLMFDIVCTLTDMEYVVFHASISSDGPYASQEYFIRHVDGCTL  553

Query  784   DTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTV  605
             DTEGEK+RV+KC+EAAIQRRVSEG+ LELCAKDRVGLLS+VTR+LRENGL V RAGVST+
Sbjct  554   DTEGEKERVIKCIEAAIQRRVSEGVSLELCAKDRVGLLSEVTRILRENGLTVCRAGVSTI  613

Query  604   GEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPETA-AWS  428
             GE+G+NVFYVRD+ GNPVD  IIE LRKEIGQ +M+NVKKV A   A     PET+  W+
Sbjct  614   GEKGLNVFYVRDAYGNPVDMNIIEALRKEIGQTVMVNVKKVPANTKA-----PETSRGWA  668

Query  427   KTSFFFGSLLGKF  389
             + SFFFG+L  +F
Sbjct  669   RVSFFFGNLFERF  681



>ref|XP_010930652.1| PREDICTED: uncharacterized protein LOC105051758 [Elaeis guineensis]
Length=445

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/414 (70%), Positives = 342/414 (83%), Gaps = 9/414 (2%)
 Frame = -1

Query  1720  WPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITK  1541
             WPYFDPEYE LS R+NPPRV +DN +C DCT+VKVDSVNKPGILLEVVQVLSDLDL I+K
Sbjct  2     WPYFDPEYENLSQRMNPPRVCIDNTTCSDCTLVKVDSVNKPGILLEVVQVLSDLDLFISK  61

Query  1540  AYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKT----CPGKNVG  1373
             AY++SDG WFMDVFHVTDQ G K+T+  TI YIEKALGP+   S++L T     PGK+VG
Sbjct  62    AYITSDGRWFMDVFHVTDQQGKKITN-KTIEYIEKALGPE---SNILGTKGHFWPGKSVG  117

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             ++S+GD+TAIELIG DRPGLLSEI AVLANLH N++AAEVWTHN R+ACVLYVND+ +  
Sbjct  118   MHSIGDHTAIELIGTDRPGLLSEIFAVLANLHCNIIAAEVWTHNMRVACVLYVNDETTFQ  177

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE-GGCL  1016
             AVDDPSRL  +EE+L+N+LR   DD   A TS S+G+TH+DRRLHQ+  AD+DYE GG L
Sbjct  178   AVDDPSRLSKMEEKLRNVLRGRGDDVRGARTSFSIGTTHVDRRLHQLMLADKDYEIGGSL  237

Query  1015  DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
                 +  S +P ++IDHC EKGYSVV++KCKDRPKL+FDIVCTLTDMQ+VVFHA++SSDG
Sbjct  238   TEGNEVISFRPVITIDHCEEKGYSVVNIKCKDRPKLLFDIVCTLTDMQFVVFHASVSSDG  297

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
             P   QE YIRH DG TLD++ EK+ V+KCLEAAI RRVSEG  LELC +DRVGLLSDVTR
Sbjct  298   PYGVQELYIRHKDGFTLDSKEEKEMVIKCLEAAILRRVSEGFSLELCGRDRVGLLSDVTR  357

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLN  494
             VLRE GL VTRA V+T+GEQ +NVFYVRD+SGNPVD K IE LR+EIG  +MLN
Sbjct  358   VLREYGLTVTRADVTTIGEQAMNVFYVRDASGNPVDMKTIEALRREIGHTVMLN  411



>ref|XP_009416935.1| PREDICTED: uncharacterized protein LOC103997445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416936.1| PREDICTED: uncharacterized protein LOC103997445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416937.1| PREDICTED: uncharacterized protein LOC103997445 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/444 (65%), Positives = 351/444 (79%), Gaps = 9/444 (2%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDP+YE  S  INPPRV +DN++C DCT+VKVDSVNKPGILLEVVQVLSDLDL I+KA
Sbjct  3     PYFDPDYENFSQWINPPRVCIDNVTCNDCTLVKVDSVNKPGILLEVVQVLSDLDLAISKA  62

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLG  1358
             Y++SDG WFMDVFHVTDQ G K+T+  TI YIEKALGP+   +D   + PGK+VG++S G
Sbjct  63    YITSDGTWFMDVFHVTDQQGRKITEKKTIDYIEKALGPESLKAD---SWPGKSVGMHSFG  119

Query  1357  DYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDP  1178
             ++ AIELIG DRPGLLSEI AVLAN H NVVAAEVWTH  R+ACV+Y+ND+ +   + +P
Sbjct  120   NHIAIELIGTDRPGLLSEIFAVLANQHCNVVAAEVWTHKMRVACVIYINDEATSEPMKEP  179

Query  1177  SRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEG-GCLDMEAD  1001
             SR+C +EEQL+N+LR C DD   + TS S+GSTH+DRRLHQ+  AD+DYEG G    E D
Sbjct  180   SRMCTMEEQLRNVLRGCGDDVKGSCTSFSIGSTHVDRRLHQLMLADKDYEGYGGAIEEKD  239

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +P ++ID C +KGYSVV++KCKDR KL+FDIVCTLTDMQ+VV HA++SSDGP   Q
Sbjct  240   DMLFRPVITIDQCEDKGYSVVNIKCKDRSKLLFDIVCTLTDMQFVVSHASVSSDGPYGVQ  299

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             E YIRH DG  LD++ EK+RV+KCLEAAI RRVSEG  LE+CA+DRVGLLSDVTRVLRE 
Sbjct  300   ELYIRHKDGKILDSKDEKERVIKCLEAAILRRVSEGFSLEICARDRVGLLSDVTRVLREY  359

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
             GL V RA V+T+GE+ +NVFYVRD SGNPVD K IE LR+EIG  +MLNVK+V +   + 
Sbjct  360   GLSVLRADVTTIGEKAMNVFYVRDPSGNPVDMKTIEALRQEIGHTVMLNVKRVPSTTKS-  418

Query  460   akVPPETAAWSKTSFFFGSLLGKF  389
                 PE + W+KTSF FG+L GKF
Sbjct  419   ----PEASGWAKTSFSFGNLFGKF  438



>ref|XP_006302326.1| hypothetical protein CARUB_v10020382mg [Capsella rubella]
 gb|EOA35224.1| hypothetical protein CARUB_v10020382mg [Capsella rubella]
Length=411

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/409 (70%), Positives = 331/409 (81%), Gaps = 2/409 (0%)
 Frame = -1

Query  1609  VNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKAL  1430
             +NKPGILLEVVQVL+DLDL ITKAY+SSDGGWFMDVFHVT+Q GNKVTD  TI YIEK L
Sbjct  1     MNKPGILLEVVQVLTDLDLTITKAYISSDGGWFMDVFHVTNQQGNKVTDSKTIDYIEKVL  60

Query  1429  GPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVW  1250
             GPKG+ S    T PGK VGV+SLGD+T+IE+I RDRPGLLSE+SAVLA+L+FNVVAAE W
Sbjct  61    GPKGHASASQNTWPGKRVGVHSLGDHTSIEIIARDRPGLLSEVSAVLADLNFNVVAAEAW  120

Query  1249  THNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHI  1073
             THN+RIACVLYVND  +  AVDDP RL  +EEQL N+LR C ++D   A TS+S+GSTH+
Sbjct  121   THNRRIACVLYVNDNATSTAVDDPERLSTMEEQLNNVLRGCEQEDEKFARTSLSIGSTHV  180

Query  1072  DRRLHQMFFADRDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIV  893
             DRRLHQM FAD+DYE      ++  P L+  ++++HC EKGYSV++V C+DRPKLMFDIV
Sbjct  181   DRRLHQMLFADKDYEALTKLDDSVSPRLEAKITVEHCEEKGYSVINVSCEDRPKLMFDIV  240

Query  892   CTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEG  713
             CTLTDMQY+VFHA ISS G  ASQEY+IRH DGCTLDTEGEK+RVVKCLEAAI RRVSEG
Sbjct  241   CTLTDMQYIVFHATISSSGSHASQEYFIRHKDGCTLDTEGEKERVVKCLEAAIHRRVSEG  300

Query  712   LRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIE  533
               LELCAKDRVGLLS+VTR+LRE+GL V+RAGV+TVGEQ VNVFYVRD+SGNPVD K IE
Sbjct  301   WSLELCAKDRVGLLSEVTRILREHGLSVSRAGVTTVGEQAVNVFYVRDASGNPVDVKTIE  360

Query  532   GLRKEIGQRMMLNvkkvaacacasakVPPET-AAWSKTSFFFGSLLGKF  389
              LR EIG  MM++VK          +    T   W+KTSFFFG+LL K 
Sbjct  361   ALRGEIGHSMMIDVKNKVPSRKWKEEGQVGTGGGWAKTSFFFGNLLEKL  409



>ref|XP_007019287.1| ACT domain repeat 3 isoform 3 [Theobroma cacao]
 gb|EOY16512.1| ACT domain repeat 3 isoform 3 [Theobroma cacao]
Length=374

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/377 (75%), Positives = 318/377 (84%), Gaps = 4/377 (1%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIG  1331
             MDVFHVTDQ G ++TDG TI YIE+ALGPKG+T+D +K CPGK VGV+S+G++TAIELIG
Sbjct  1     MDVFHVTDQQGKQITDGKTIDYIERALGPKGHTTDGMKNCPGKRVGVHSVGNHTAIELIG  60

Query  1330  RDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQ  1151
             RDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  +  AVDDP+RL ++EEQ
Sbjct  61    RDRPGLLSEISAVLANLHFNVAAAEVWTHNRRIACVLYVNDDPTSRAVDDPNRLSIMEEQ  120

Query  1150  LKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP-SLKPNVS  974
             LK+ILR C+DD+ +A TS SMG THIDRRLHQM FADRDYEGG +  E D P S KP ++
Sbjct  121   LKHILRGCEDDDKVARTSFSMGFTHIDRRLHQMLFADRDYEGGGVTTEVDYPPSFKPKIT  180

Query  973   IDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDG  794
             ++ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS+GP A QEY+IRHMDG
Sbjct  181   VERCEEKGYSVVSVQCKDRAKLMFDIVCTLTDMQYVVFHANISSNGPYALQEYFIRHMDG  240

Query  793   CTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGV  614
             CTLDTEGEK+RV+KCLEAAI RRVSEGL LELCAKDRVGLLS+VTR+LRENGL V RAGV
Sbjct  241   CTLDTEGEKERVIKCLEAAIHRRVSEGLSLELCAKDRVGLLSEVTRILRENGLSVRRAGV  300

Query  613   STVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPETAA  434
             STVGEQ VNVFYVRD+ GNPVDTK IE LRKEIG  MMLN   V     ++     ET+ 
Sbjct  301   STVGEQAVNVFYVRDAYGNPVDTKTIEALRKEIGHTMMLN---VKKDPASAKAHEAETSG  357

Query  433   WSKTSFFFGSLLGKFRA  383
             W+KTSFFFG+LL KF A
Sbjct  358   WAKTSFFFGNLLEKFLA  374



>ref|XP_010322947.1| PREDICTED: uncharacterized protein LOC101244297 isoform X2 [Solanum 
lycopersicum]
Length=372

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/376 (74%), Positives = 315/376 (84%), Gaps = 6/376 (2%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIG  1331
             MDVFHVTDQHGNKVTD NTIG+IEKALGP+GYTS +LKTCPG+ VG NS+GDYT IELIG
Sbjct  1     MDVFHVTDQHGNKVTDNNTIGHIEKALGPEGYTSGILKTCPGRKVGENSMGDYTTIELIG  60

Query  1330  RDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQ  1151
             RDRPGLLSEISAVLANLHFNV AAEVWTHN RIACVLY+ND  S    D+ SRLCV+EEQ
Sbjct  61    RDRPGLLSEISAVLANLHFNVAAAEVWTHNGRIACVLYINDNCSSLDEDEESRLCVMEEQ  120

Query  1150  LKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC-PSLKPNVS  974
             L NILR  +DD + AH + S+GSTH+DRRLHQMFFADRDYEGGCL+ME +  P+ KP+V 
Sbjct  121   LNNILRGREDDESGAHATFSVGSTHVDRRLHQMFFADRDYEGGCLEMEIEYPPNSKPDVR  180

Query  973   IDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDG  794
             I+ CVEKGYSVVSV CKDR KLMFDIVCTLTDMQY VFHA ISSDGPSASQEY+IRHMDG
Sbjct  181   IESCVEKGYSVVSVSCKDRAKLMFDIVCTLTDMQYAVFHATISSDGPSASQEYFIRHMDG  240

Query  793   CTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGV  614
             CTL++E EK++VVKC+EAAI+RR+SEG   ELCAKDRVGLLS+VTRVLRENGL VTRAGV
Sbjct  241   CTLESEAEKEKVVKCIEAAIRRRISEGFSFELCAKDRVGLLSEVTRVLRENGLSVTRAGV  300

Query  613   STVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPETAA  434
             +T+GE+  N FYVRD+SGNPV+ K IE LR+EIGQ MMLN          ++   PET  
Sbjct  301   TTIGEKAKNFFYVRDASGNPVEMKTIERLREEIGQTMMLN-----VKKDPTSAKAPETGG  355

Query  433   WSKTSFFFGSLLGKFR  386
              +KTSFFFG LL KFR
Sbjct  356   LAKTSFFFGGLLEKFR  371



>ref|XP_007201031.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
 gb|EMJ02230.1| hypothetical protein PRUPE_ppa005671mg [Prunus persica]
Length=373

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/378 (75%), Positives = 315/378 (83%), Gaps = 7/378 (2%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIG  1331
             MDVFHVTDQ G K+ D  TI YIEKALGPKG+ +DVLK  PGK VGV+S+GD+TAIELIG
Sbjct  1     MDVFHVTDQQGKKLADSKTIDYIEKALGPKGHITDVLKAWPGKRVGVHSVGDHTAIELIG  60

Query  1330  RDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQ  1151
             RDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  +C  VDDP+RL  +EEQ
Sbjct  61    RDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTCQPVDDPNRLSTMEEQ  120

Query  1150  LKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEAD--CPSLKPNV  977
             LKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L  E D   P  +P +
Sbjct  121   LKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLANEVDDYPPCFQPKI  180

Query  976   SIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMD  797
             +I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISSDGP ASQEY+IRHMD
Sbjct  181   TIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISSDGPYASQEYFIRHMD  240

Query  796   GCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAG  617
             GCTLDTEGEK+RV+KC++AAI+RRVSE LRLELCAKDRVGLLS+VTR+LRENGL VTRAG
Sbjct  241   GCTLDTEGEKERVIKCIDAAIRRRVSEDLRLELCAKDRVGLLSEVTRILRENGLSVTRAG  300

Query  616   VSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPETA  437
             V+T+GEQ +NVFYVRDSSGNPVD K IE LRKEIG   M NVKKV   + A     PET 
Sbjct  301   VTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKVPTSSKA-----PETK  355

Query  436   AWSKTSFFFGSLLGKFRA  383
              W KTSFFFG+LL +F A
Sbjct  356   GWGKTSFFFGNLLERFLA  373



>ref|XP_006847223.1| hypothetical protein AMTR_s00017p00256400 [Amborella trichopoda]
 gb|ERN08804.1| hypothetical protein AMTR_s00017p00256400 [Amborella trichopoda]
Length=444

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/455 (64%), Positives = 341/455 (75%), Gaps = 15/455 (3%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA++ WPYFDPEYE LS RINPPRVS DN +C DCT+VKVDS NKPGILLEVVQVL+D+D
Sbjct  1     MAKSHWPYFDPEYENLSQRINPPRVSFDNTTCSDCTLVKVDSANKPGILLEVVQVLTDMD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYT-SDVLKTCPGKN  1379
             LII+KAY+SSDGGWFMDVFHVT+Q G K+TD  T+ YIEKALG +G T +  ++T PGK 
Sbjct  61    LIISKAYISSDGGWFMDVFHVTNQMGQKLTDTKTMEYIEKALGARGTTCATEVRTWPGKQ  120

Query  1378  VGVNSL--GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDK  1205
              GV     G  TAIEL+G DRPGLLSEISA+LA+L  NVVAAEVWTH  RIACV+YV D 
Sbjct  121   AGVAESIDGGPTAIELVGSDRPGLLSEISAILASLDCNVVAAEVWTHRTRIACVVYVTDS  180

Query  1204  VSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEG  1025
              +   +DDP+RL  +EEQL+N+L+    D   A T+ S+G  H DRRLHQM FADRDYE 
Sbjct  181   TTSRPLDDPARLAAVEEQLRNVLKGRDGDRRSARTNFSLGFMHTDRRLHQMMFADRDYEE  240

Query  1024  GCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAIS  845
                + EA      P VS+D C E+GYSVV+V+CKDRPKL+FD VCTLTDM YVVFHA+I 
Sbjct  241   EGEEEEA------PLVSVDTCGERGYSVVNVRCKDRPKLLFDTVCTLTDMHYVVFHASIV  294

Query  844   SDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSD  665
             S GP A QEYYIRH DGC LD + EK RV+KCLEAAIQRRVS GL LE+CA DRVGLLSD
Sbjct  295   SQGPHALQEYYIRHKDGCILDGDSEKQRVIKCLEAAIQRRVSNGLTLEMCASDRVGLLSD  354

Query  664   VTRVLRENGLLVTRAGVSTVGEQGVNVFYVR-DSSGNPVDTKIIEGLRKEIGQRMMLNvk  488
             VTRV RENGL VTRAGV+T+G + +NVFYVR  S+G PVDTK IE LR+EIG  M+LN  
Sbjct  355   VTRVFRENGLSVTRAGVTTIGGKAMNVFYVRYASTGEPVDTKTIEALRREIGNAMLLN--  412

Query  487   kvaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                     ++  P ++ A +K  F FGS   +F A
Sbjct  413   ---VKNLPASAKPSDSNADAKFRFSFGSFFERFLA  444



>ref|XP_008381706.1| PREDICTED: uncharacterized protein LOC103444536 isoform X2 [Malus 
domestica]
Length=374

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/378 (73%), Positives = 313/378 (83%), Gaps = 6/378 (2%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIG  1331
             MDVFHVTDQ G KVTD  TI YIEKALGPKG+ +D+L   PGK VGV+S+GD+TAIELIG
Sbjct  1     MDVFHVTDQQGKKVTDSKTIDYIEKALGPKGHITDLLNAWPGKGVGVHSIGDHTAIELIG  60

Query  1330  RDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQ  1151
             RDRPGLLSEISAVLANLHFNV+AA+VWTHN RIACV+YVND  +C  V+D +RL  +EEQ
Sbjct  61    RDRPGLLSEISAVLANLHFNVIAADVWTHNGRIACVVYVNDDTTCQPVEDQARLSTMEEQ  120

Query  1150  LKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC--PSLKPNV  977
             LKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L  E D   P  +P +
Sbjct  121   LKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLAHEVDHFPPCFQPKI  180

Query  976   SIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMD  797
              I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISSDGP ASQEY+IRHMD
Sbjct  181   XIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISSDGPYASQEYFIRHMD  240

Query  796   GCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAG  617
             GCTLDTEGEK+R +KC++AAI+RRVSEGLRLELCAKDRVGLLS+VTR+LRENGL VTRAG
Sbjct  241   GCTLDTEGEKERAIKCIDAAIRRRVSEGLRLELCAKDRVGLLSEVTRILRENGLSVTRAG  300

Query  616   VSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPETA  437
             V+T+G+QG+N+FY+RDSSGN VD K IE LRKEIG  MM NVKKV   +       PET 
Sbjct  301   VTTIGDQGINIFYIRDSSGNSVDIKTIEALRKEIGHTMMFNVKKVPTSSAEV----PETK  356

Query  436   AWSKTSFFFGSLLGKFRA  383
              W+KTSFFFG+LL +F A
Sbjct  357   GWAKTSFFFGNLLERFLA  374



>ref|XP_008237783.1| PREDICTED: uncharacterized protein LOC103336512 isoform X3 [Prunus 
mume]
Length=381

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 315/386 (82%), Gaps = 15/386 (4%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIG  1331
             MDVFHVTDQ G K+ D  TI YIEKALGPKG+ +DVLK  PGK VGV+S+GD+TAIELIG
Sbjct  1     MDVFHVTDQQGKKLADSKTIDYIEKALGPKGHITDVLKAWPGKRVGVHSVGDHTAIELIG  60

Query  1330  RDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQ  1151
             RDRPGLLSEISAVLANLHFNVVAAEVWTHN+RIACV+YVND  +C  VDDP+RL  +EEQ
Sbjct  61    RDRPGLLSEISAVLANLHFNVVAAEVWTHNRRIACVVYVNDNSTCQPVDDPNRLSTMEEQ  120

Query  1150  LKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEAD--CPSLKPNV  977
             LKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L  E D   P  +P +
Sbjct  121   LKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLANEVDHYPPCFQPKI  180

Query  976   SIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMD  797
             +I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISSDGP ASQEY+IRHMD
Sbjct  181   TIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISSDGPYASQEYFIRHMD  240

Query  796   GCTLDTEGEKDRVVKCLEAAIQRRVSE--------GLRLELCAKDRVGLLSDVTRVLREN  641
             GCTLDTEGEK+RV+KC++AAI+RRVSE         LRLELCAKDRVGLLS+VTR+LREN
Sbjct  241   GCTLDTEGEKERVIKCIDAAIRRRVSEVSNYHEIQDLRLELCAKDRVGLLSEVTRILREN  300

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
             GL VTRAGV+T+GEQ +NVFYVRDSSGNPVD K IE LRKEIG   M NVKKV   + A 
Sbjct  301   GLSVTRAGVTTIGEQAMNVFYVRDSSGNPVDIKTIEALRKEIGHTTMFNVKKVPTSSKA-  359

Query  460   akVPPETAAWSKTSFFFGSLLGKFRA  383
                 PET  W KTSFFFG+LL +F A
Sbjct  360   ----PETKGWGKTSFFFGNLLERFLA  381



>ref|XP_009360674.1| PREDICTED: uncharacterized protein LOC103951112 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009342850.1| PREDICTED: uncharacterized protein LOC103934817 isoform X2 [Pyrus 
x bretschneideri]
Length=374

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/378 (72%), Positives = 312/378 (83%), Gaps = 6/378 (2%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIG  1331
             MDVFHVTDQ G KVTD  TI YIEKALGPKG+ +D+L   PGK VGV+S+GD+TAIE+IG
Sbjct  1     MDVFHVTDQQGKKVTDSKTIDYIEKALGPKGHITDLLNAWPGKGVGVHSVGDHTAIEIIG  60

Query  1330  RDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQ  1151
             RDRPGLLSEISAVLANLHFNV+AAEVWTHN RIACV+YVND  +C  V+D +RL  +EEQ
Sbjct  61    RDRPGLLSEISAVLANLHFNVIAAEVWTHNGRIACVVYVNDDTTCQPVEDQARLSTMEEQ  120

Query  1150  LKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC--PSLKPNV  977
             LKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L  E D   P  +P +
Sbjct  121   LKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGLANEVDHFPPCFQPKI  180

Query  976   SIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMD  797
             +I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISSDGP ASQEY+IRHMD
Sbjct  181   TIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISSDGPYASQEYFIRHMD  240

Query  796   GCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAG  617
             G TLDTEGEK+R +KC++AAI+RRVSEGLRLELCAKDRVGLLS+VTR+LRE+GL VTRAG
Sbjct  241   GYTLDTEGEKERAIKCIDAAIRRRVSEGLRLELCAKDRVGLLSEVTRILREHGLSVTRAG  300

Query  616   VSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPETA  437
             V+T+GEQ +N+FYVRDSSGN VD K IE LRKEIG  M+ NVKKV   +       PET 
Sbjct  301   VTTIGEQAMNIFYVRDSSGNSVDIKTIEALRKEIGHTMIFNVKKVPTSSAEV----PETK  356

Query  436   AWSKTSFFFGSLLGKFRA  383
              W+KTSFFFG+LL +F A
Sbjct  357   GWAKTSFFFGNLLERFLA  374



>gb|ADE76039.1| unknown [Picea sitchensis]
Length=454

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/448 (63%), Positives = 341/448 (76%), Gaps = 12/448 (3%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             M   CWPYFDP++E+L+ RI+PP V +DN +C+DC++VKV+S N+ GILLEVVQVL+DLD
Sbjct  1     MESVCWPYFDPDFESLNQRIHPPMVCIDNDTCEDCSLVKVESANRHGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPK--GYTSDVLKTCPGK  1382
             LII+KAY+SSDG WFMDVFHVTDQ GNK+TD   I YI++ALG K  G T++V KTC G+
Sbjct  61    LIISKAYISSDGRWFMDVFHVTDQLGNKLTDQRIIDYIQQALGAKQGGSTTEV-KTCLGR  119

Query  1381  NVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKV  1202
              VGV S+G++TAIEL G DRPGLLSEISAVL NL  NVVAAEVWTHN R+ACV+YV D+ 
Sbjct  120   TVGVQSIGEHTAIELTGTDRPGLLSEISAVLTNLKCNVVAAEVWTHNMRVACVVYVTDES  179

Query  1201  SCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGG  1022
             +   +++P +L  I+EQL N+L+   DD     T  SMG TH +RRLHQM FADRDYEG 
Sbjct  180   TSRPIEEPEQLAAIKEQLSNVLKG-NDDRRGVKTDFSMGLTHTERRLHQMMFADRDYEGP  238

Query  1021  CLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               D  +   + +P + I++C EKGYSVV+V CKDRPKL+FD VCTLTDMQYVV HA I+S
Sbjct  239   --DTRSLGENGRPIIKIENCNEKGYSVVTVHCKDRPKLLFDTVCTLTDMQYVVLHATITS  296

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
              G  A QEYYIRHMDGCTLDTEGEK RV+KCLEAAI+RRVSEG+RLELC  DRVGLLSD+
Sbjct  297   SGTYALQEYYIRHMDGCTLDTEGEKQRVIKCLEAAIERRVSEGVRLELCTSDRVGLLSDI  356

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkv  482
             TR+ RENGL VTRA V+T  ++ VNVFYV D+SGNPVD KI+E +R+EIG  ++      
Sbjct  357   TRIFRENGLSVTRADVTTRADKAVNVFYVTDTSGNPVDMKIVEAMRREIGHTIL------  410

Query  481   aacacasakVPPETAAWSKTSFFFGSLL  398
                +  S+  P  T    K  F FGSLL
Sbjct  411   QVKSIPSSPRPCPTDTGDKAKFSFGSLL  438



>ref|XP_006472895.1| PREDICTED: uncharacterized protein LOC102609378 isoform X5 [Citrus 
sinensis]
Length=389

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/388 (72%), Positives = 315/388 (81%), Gaps = 6/388 (2%)
 Frame = -1

Query  1528  SDGGW-FMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             +DG W  + +FHV DQ G K+TDG TI YIEKALGPKG+ +   KT P K VGV+S+GD+
Sbjct  2     ADGSWTVIFLFHVIDQQGKKITDGKTIDYIEKALGPKGHITAGAKTWPSKQVGVHSVGDH  61

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIELIGRDRPGLLSEISAVLANL FNV AAEVWTHN+RIACVLYVND  +C AV D +R
Sbjct  62    TAIELIGRDRPGLLSEISAVLANLRFNVAAAEVWTHNRRIACVLYVNDDTTCRAVGDQTR  121

Query  1171  LCVIEEQLKNILRACKDDNN--IAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL---DME  1007
             L ++EEQLKNILR C D+++  +A TS SMG TH+DRRLHQMFFADRDYEGG +   D  
Sbjct  122   LSLMEEQLKNILRGCDDEDSEKVARTSFSMGFTHVDRRLHQMFFADRDYEGGGVTTADQV  181

Query  1006  ADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
                PS KP ++++   +KGYSVV+VKC+DR KLMFDIVCTLTDMQYVVFHAAISSDGP A
Sbjct  182   DHTPSFKPEITVERLEDKGYSVVNVKCRDRAKLMFDIVCTLTDMQYVVFHAAISSDGPHA  241

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
             SQEYYIRHMDGC LDTEGEK+RV+KCLEAAI+RRVSEGL LELCAKDRVGLLS+VTR+LR
Sbjct  242   SQEYYIRHMDGCILDTEGEKERVIKCLEAAIRRRVSEGLSLELCAKDRVGLLSEVTRILR  301

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacac  467
             ENGL VTRAGVSTVGEQ VNVFYVRD+SGNPVD K IE LRKEIG  M+ NVKKV A   
Sbjct  302   ENGLSVTRAGVSTVGEQAVNVFYVRDASGNPVDMKTIEALRKEIGHTMLFNVKKVPASRN  361

Query  466   asakVPPETAAWSKTSFFFGSLLGKFRA  383
             A  +     A W KTSFFFG+L  +F A
Sbjct  362   AYKEPEASIAGWPKTSFFFGNLFERFLA  389



>ref|XP_006578947.1| PREDICTED: uncharacterized protein LOC100789173 isoform X2 [Glycine 
max]
Length=364

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/369 (70%), Positives = 303/369 (82%), Gaps = 6/369 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S R+NPPRVS+DN SC DCT++KVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRMNPPRVSMDNASCHDCTLIKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI +IEKALGPK  +++ +K  P K V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDFIEKALGPKSQSTEGVKNWPSKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSVGDHTAIELIGRDRPGLLSEISAVLANLHFNVFAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              AVD+ +RL ++EEQL NILR C D   +A TS SMGSTH+DRRLHQM FADRDYE   +
Sbjct  180   QAVDEANRLSLMEEQLNNILRGC-DGEKVARTSFSMGSTHMDRRLHQMLFADRDYESYAV  238

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
               E D  PSL+P ++I+ C EKGYSVVSVKCKDR KLMFDIVCTLTDMQYVVFHA +SSD
Sbjct  239   AREVDSPPSLRPKITIERCEEKGYSVVSVKCKDRAKLMFDIVCTLTDMQYVVFHATVSSD  298

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDGCTLDT+GEK+RV++C+EAAI+RRVSE   L  C    V  +   T
Sbjct  299   GPYALQEYFIRHMDGCTLDTQGEKERVIQCIEAAIRRRVSE---LSTCIAAMVRQIHVAT  355

Query  658   RVLRENGLL  632
             +++ ++ +L
Sbjct  356   QIVSDHHIL  364


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 19/163 (12%)
 Frame = -1

Query  985  PNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIR  806
            P VS+D+      +++ V   ++P ++ ++V  LTD+ +++  A ISSDG      +++ 
Sbjct  23   PRVSMDNASCHDCTLIKVDSVNKPGILLEVVQILTDLDFIITKAYISSDGGWFMDVFHVT  82

Query  805  HMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLR-----------------LELCAKDRVG  677
               G  +      D + K L    Q   +EG++                 +EL  +DR G
Sbjct  83   DQQGKKITDSKTIDFIEKALGPKSQS--TEGVKNWPSKRVGVHSVGDHTAIELIGRDRPG  140

Query  676  LLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVD  548
            LLS+++ VL      V  A V T   +   V YV D++   VD
Sbjct  141  LLSEISAVLANLHFNVFAAEVWTHNRRIACVLYVNDATNQAVD  183



>gb|ABK22147.1| unknown [Picea sitchensis]
Length=466

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/424 (63%), Positives = 323/424 (76%), Gaps = 13/424 (3%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             M    WPYFDPEYE L  RINPP VS+DN +C DCT++KVDS NK GILLEVVQ+L+DLD
Sbjct  1     MESVSWPYFDPEYENLERRINPPSVSIDNDTCPDCTLIKVDSANKHGILLEVVQLLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKN  1379
             L I+KAY+SSDGGWFMDVFHVTDQ G+K+TD + I YI+++LG K   +S  +KTC G+ 
Sbjct  61    LTISKAYISSDGGWFMDVFHVTDQLGDKLTDESIIEYIQQSLGAKRVISSREVKTCLGRI  120

Query  1378  VGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVS  1199
             VGV S+G+YTAIEL G DRPGLLSEISAVL +   NVVAAE WTHN R+ACV+YV D+ S
Sbjct  121   VGVQSIGEYTAIELTGTDRPGLLSEISAVLTSFSCNVVAAESWTHNMRVACVVYVTDESS  180

Query  1198  CNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
                ++D  RL  I+ QL N+L+   D      T  SMG TH +RRLHQ+ FADRDYE   
Sbjct  181   NRPIEDEVRLSTIKGQLSNVLKGNDDSTKGVKTDFSMGLTHRERRLHQLMFADRDYECSS  240

Query  1018  LDMEADCPSL-----KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHA  854
                ++  PSL     KP +++++C EKGYSVV+++C+DRPKL+FD VCTLTDMQYVVFHA
Sbjct  241   ---DSSNPSLLDENMKPVITVENCNEKGYSVVNIQCRDRPKLLFDTVCTLTDMQYVVFHA  297

Query  853   AISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGL  674
             +I+ + P A QEYYIRHMDGCTLDTEGEK RV+KCLEAAI RR SEGL LEL A DR+GL
Sbjct  298   SITCNLPYALQEYYIRHMDGCTLDTEGEKHRVIKCLEAAIGRRASEGLSLELSASDRIGL  357

Query  673   LSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRD-SSGN---PVDTKIIEGLRKEIGQR  506
             LSDVTR+ RENGL VTRA V+T G++ +NVFYVRD SSGN    +D K++E +R+EIG  
Sbjct  358   LSDVTRMFRENGLSVTRADVTTRGDKAINVFYVRDASSGNLAINIDMKVVEAMRREIGHT  417

Query  505   MMLN  494
             M L 
Sbjct  418   MFLQ  421



>ref|XP_009106365.1| PREDICTED: uncharacterized protein LOC103832157 isoform X2 [Brassica 
rapa]
Length=344

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/349 (72%), Positives = 287/349 (82%), Gaps = 6/349 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+  WPYFDPEYE LS RINPP VS+DN SCK+CT+VKVDS+NKPGILLEVVQVL+DLD
Sbjct  1     MAKVYWPYFDPEYENLSTRINPPSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L ITKAY+SSDGGWFMDVFHVTDQ GNKVTD  TI YIEK LGPKGY S    T PGK V
Sbjct  61    LTITKAYISSDGGWFMDVFHVTDQQGNKVTDSKTIDYIEKVLGPKGYASASQNTWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+SLGD+T+IE+I RDRPGLLSE+SAVLA+LHFNVVAAE WTHN+RIACVLYVND  + 
Sbjct  121   GVHSLGDHTSIEIIARDRPGLLSEVSAVLADLHFNVVAAEAWTHNRRIACVLYVNDNETS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRAC-KDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC  1019
              AVDDP RL  +EEQL  +LR C ++D  +A T +S+GSTH+DRRLHQM FADRDYE   
Sbjct  181   RAVDDPERLSTMEEQLNLVLRGCEQEDEKVARTCLSIGSTHVDRRLHQMLFADRDYEAV-  239

Query  1018  LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
                        P ++I++C EKGYSVV+V C+DRPKLMFDIVCTLTDMQY+VFHA I+S 
Sbjct  240   ----TKVDGSVPKITIENCEEKGYSVVNVSCEDRPKLMFDIVCTLTDMQYIVFHATITSS  295

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCA  692
             G  ASQEY+IRH DGCTLD+EGEK+RV+KCLEAAI RRVSEG  LELCA
Sbjct  296   GSHASQEYFIRHKDGCTLDSEGEKERVIKCLEAAIHRRVSEGWSLELCA  344


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 71/155 (46%), Gaps = 15/155 (10%)
 Frame = -1

Query  985  PNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIR  806
            P+VSID+   K  ++V V   ++P ++ ++V  LTD+   +  A ISSDG      +++ 
Sbjct  23   PSVSIDNTSCKECTLVKVDSMNKPGILLEVVQVLTDLDLTITKAYISSDGGWFMDVFHVT  82

Query  805  HMDGCTLDTEGEKDRVVKCL----EAAIQRRVSEGLR-----------LELCAKDRVGLL  671
               G  +      D + K L     A+  +    G R           +E+ A+DR GLL
Sbjct  83   DQQGNKVTDSKTIDYIEKVLGPKGYASASQNTWPGKRVGVHSLGDHTSIEIIARDRPGLL  142

Query  670  SDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDS  566
            S+V+ VL +    V  A   T   +   V YV D+
Sbjct  143  SEVSAVLADLHFNVVAAEAWTHNRRIACVLYVNDN  177



>ref|XP_004498367.1| PREDICTED: uncharacterized protein LOC101494165 isoform X2 [Cicer 
arietinum]
Length=378

 Score =   527 bits (1358),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 303/380 (80%), Gaps = 10/380 (3%)
 Frame = -1

Query  1510  MDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTS-DVLKTCPGKNVGVNSLGDYTAIELI  1334
             MDVFHVTDQ G K+TD   I +IEKALGPKG  S + +++  GK VGV+S+GD+TAIELI
Sbjct  1     MDVFHVTDQQGKKITDSKIIDFIEKALGPKGRQSKEGMQSWEGKRVGVHSIGDHTAIELI  60

Query  1333  GRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEE  1154
             GRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  +    DD  RL +IEE
Sbjct  61    GRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATNQAMDDDSKRLSIIEE  120

Query  1153  QLKNILRACKDDNN---IAHTSVSMGSTHIDRRLHQMFFADRDYE--GGCLDMEADCPSL  989
             QL +ILR C+DD        TS SMG TH+DRRLHQM FADRDYE   G      DCPS 
Sbjct  121   QLNHILRGCEDDEKEKVARKTSFSMGFTHMDRRLHQMLFADRDYESAAGVTTTNVDCPSF  180

Query  988   KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI  809
             +PN+ I+   EKGYSVVSV+CKDR KLMFDIVCTLTDM+YVVFHA+ISS+GP ASQEY+I
Sbjct  181   RPNIKIERIEEKGYSVVSVRCKDRAKLMFDIVCTLTDMEYVVFHASISSEGPYASQEYFI  240

Query  808   RHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLV  629
             RH+DGCTLDTEGEK+RV+KC+EAAIQRRVSEG+ LELCAKDRVGLLS+VTR+LRENGL V
Sbjct  241   RHVDGCTLDTEGEKERVIKCIEAAIQRRVSEGVSLELCAKDRVGLLSEVTRILRENGLTV  300

Query  628   TRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVP  449
              RAGVST+GE+G+NVFYVRD+ GNPVD KIIE L KEIGQ +M+N         A+ K P
Sbjct  301   CRAGVSTIGEKGLNVFYVRDAYGNPVDMKIIEALNKEIGQTVMVN----VKKVPANTKAP  356

Query  448   PETAAWSKTSFFFGSLLGKF  389
               +  WS+ SFFFG+LL +F
Sbjct  357   EASRGWSRISFFFGNLLERF  376



>ref|XP_004498368.1| PREDICTED: uncharacterized protein LOC101494165 isoform X3 [Cicer 
arietinum]
Length=369

 Score =   523 bits (1347),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 250/346 (72%), Positives = 287/346 (83%), Gaps = 6/346 (2%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S RINPPRVS+DN SC DCT++K+DSVNKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRINPPRVSMDNDSCPDCTLIKIDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTS-DVLKTCPGKN  1379
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD   I +IEKALGPKG  S + +++  GK 
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKIIDFIEKALGPKGRQSKEGMQSWEGKR  120

Query  1378  VGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVS  1199
             VGV+S+GD+TAIELIGRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  +
Sbjct  121   VGVHSIGDHTAIELIGRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATN  180

Query  1198  CNAVDDPSRLCVIEEQLKNILRACKDDNN---IAHTSVSMGSTHIDRRLHQMFFADRDYE  1028
                 DD  RL +IEEQL +ILR C+DD        TS SMG TH+DRRLHQM FADRDYE
Sbjct  181   QAMDDDSKRLSIIEEQLNHILRGCEDDEKEKVARKTSFSMGFTHMDRRLHQMLFADRDYE  240

Query  1027  --GGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHA  854
                G      DCPS +PN+ I+   EKGYSVVSV+CKDR KLMFDIVCTLTDM+YVVFHA
Sbjct  241   SAAGVTTTNVDCPSFRPNIKIERIEEKGYSVVSVRCKDRAKLMFDIVCTLTDMEYVVFHA  300

Query  853   AISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSE  716
             +ISS+GP ASQEY+IRH+DGCTLDTEGEK+RV+KC+EAAIQRRVSE
Sbjct  301   SISSEGPYASQEYFIRHVDGCTLDTEGEKERVIKCIEAAIQRRVSE  346


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 80/169 (47%), Gaps = 30/169 (18%)
 Frame = -1

Query  985  PNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIR  806
            P VS+D+      +++ +   ++P ++ ++V  LTD+ +++  A ISSDG      +++ 
Sbjct  23   PRVSMDNDSCPDCTLIKIDSVNKPGILLEVVQILTDLDFIITKAYISSDGGWFMDVFHV-  81

Query  805  HMDGCTLDTEGEK---DRVVKCLEAAIQ---RRVSEGLR-----------------LELC  695
                   D +G+K    +++  +E A+    R+  EG++                 +EL 
Sbjct  82   ------TDQQGKKITDSKIIDFIEKALGPKGRQSKEGMQSWEGKRVGVHSIGDHTAIELI  135

Query  694  AKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVD  548
             +DR GLLS+++ VL      V  A V T   +   V YV D++   +D
Sbjct  136  GRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATNQAMD  184



>ref|XP_002990728.1| hypothetical protein SELMODRAFT_132226 [Selaginella moellendorffii]
 gb|EFJ08177.1| hypothetical protein SELMODRAFT_132226 [Selaginella moellendorffii]
Length=466

 Score =   519 bits (1337),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 258/419 (62%), Positives = 313/419 (75%), Gaps = 15/419 (4%)
 Frame = -1

Query  1732  ARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
              R C PYFDP+Y+TL  R+N P V +DN SC D T+VKVDS NK GILLEVVQVL+DLDL
Sbjct  3     GRGC-PYFDPDYDTLISRLNAPSVVIDNSSCDDATLVKVDSANKHGILLEVVQVLTDLDL  61

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
              I+KAY+SSDGGWFMDVFHVTD+ G+K+ D   I YI+++LG    T+  +KT     VG
Sbjct  62    TISKAYISSDGGWFMDVFHVTDKLGHKLRDQGIIDYIQQSLGDAQATTSQVKTSLAPTVG  121

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
               S G +TAIEL GRDRPGLLSEIS VL  +  NVVAAEVWTHN+R+ACV+YV D+ +  
Sbjct  122   TQSSGGHTAIELSGRDRPGLLSEISGVLTGMTCNVVAAEVWTHNKRVACVVYVTDEATGC  181

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE-----  1028
              + DP +L  ++EQL  +LR   D+N +A T  S G TH +RRLHQM  ADRDY+     
Sbjct  182   PIKDPEKLARMKEQLSQVLRG-DDENRLATTDFSSGLTHTERRLHQMMLADRDYDVPSST  240

Query  1027  ---GGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFH  857
                   LD       ++P +S+ +C+EKGYSVVSV+CKDRPKL+FD VCTLTDM+YVVFH
Sbjct  241   SSINAVLDAR-----IRPVISLRNCLEKGYSVVSVQCKDRPKLLFDTVCTLTDMEYVVFH  295

Query  856   AAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVG  677
             A+  +DGP A QEYYIRHMDGCTLD + E++RVVKCLEAAI+RRVSEGLRLELC +DRVG
Sbjct  296   ASARADGPYAYQEYYIRHMDGCTLDLDAEQERVVKCLEAAIERRVSEGLRLELCTRDRVG  355

Query  676   LLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             LLSDVTRV RE GL VTRA VST G++ VNVFYV D+SG  V  K++E LR EIGQ ++
Sbjct  356   LLSDVTRVFREKGLSVTRADVSTRGDRAVNVFYVTDTSGKAVSMKVVEALRLEIGQAIL  414



>ref|XP_009609311.1| PREDICTED: uncharacterized protein LOC104103130, partial [Nicotiana 
tomentosiformis]
Length=315

 Score =   513 bits (1320),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 271/306 (89%), Gaps = 1/306 (0%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR   PYFDPEYETLSIRINPPRVSVDN+SCK+CT+VKVDSVN+PGILLEVVQ+L+DLD
Sbjct  1     MARRYGPYFDPEYETLSIRINPPRVSVDNVSCKECTLVKVDSVNRPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L+ITKAY+SSDGGWFMDVFHVTDQHG KVTD +TIG+IEKALGP+GYTS +LKT PG+ V
Sbjct  61    LVITKAYISSDGGWFMDVFHVTDQHGKKVTDSSTIGHIEKALGPEGYTSGILKTWPGRRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GVNS+GDYT IELIG DRPGLLSEISAVLANLHFNV AAEVWTHN+R ACVLYVND  S 
Sbjct  121   GVNSVGDYTTIELIGSDRPGLLSEISAVLANLHFNVAAAEVWTHNRRTACVLYVNDNCSS  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               VD+ SRLCV+EEQL NILR C+DD + AH + ++GSTH+DRRLHQMFFADRDYEGGCL
Sbjct  181   LDVDEESRLCVMEEQLNNILRGCEDDESGAHATFTVGSTHVDRRLHQMFFADRDYEGGCL  240

Query  1015  DMEADC-PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             +ME +  P+ KP V I+ CVEKGYSVV+V CKDRPKLMFDIVCTLTDMQY VFHA ISSD
Sbjct  241   EMEIEYPPNFKPEVRIESCVEKGYSVVNVSCKDRPKLMFDIVCTLTDMQYAVFHATISSD  300

Query  838   GPSASQ  821
             GP ASQ
Sbjct  301   GPYASQ  306



>ref|XP_002986703.1| hypothetical protein SELMODRAFT_124581 [Selaginella moellendorffii]
 gb|EFJ12266.1| hypothetical protein SELMODRAFT_124581 [Selaginella moellendorffii]
Length=466

 Score =   517 bits (1331),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 313/419 (75%), Gaps = 15/419 (4%)
 Frame = -1

Query  1732  ARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
              R C PYFDP+Y+TL  R+N P V +DN SC D T+VKVDS NK GILLEVVQVL+DLDL
Sbjct  3     GRGC-PYFDPDYDTLISRLNAPSVVIDNSSCDDATLVKVDSANKHGILLEVVQVLTDLDL  61

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
              I+KAY+SSDGGWFMDVFHVTD+ G+K+ D   I YI+++LG    T+  +KT     VG
Sbjct  62    TISKAYISSDGGWFMDVFHVTDKLGHKLRDQGIIDYIQQSLGDAQATTSQVKTSLAPTVG  121

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
               S G +TAIEL GRDRPGLLSEIS VL  +  NVVAAEVWTHN+R+ACV+YV D+ +  
Sbjct  122   TQSSGGHTAIELSGRDRPGLLSEISGVLTGMTCNVVAAEVWTHNKRVACVVYVTDEATGC  181

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE-----  1028
              + DP +L  ++E+L  +LR   D+N +A T  S G TH +RRLHQM  ADRDY+     
Sbjct  182   PIKDPEKLARMKERLSQVLRG-DDENRLATTDFSSGLTHTERRLHQMMLADRDYDVPSST  240

Query  1027  ---GGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFH  857
                   LD       ++P +S+ +C+EKGYSVVSV+CKDRPKL+FD VCTLTDM+YVVFH
Sbjct  241   SSINAVLDAR-----IRPVISLRNCLEKGYSVVSVQCKDRPKLLFDTVCTLTDMEYVVFH  295

Query  856   AAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVG  677
             A+  +DGP A QEYYIRHMDGCTLD + E++RVVKCLEAAI+RRVSEGLRLELC +DRVG
Sbjct  296   ASARADGPYAYQEYYIRHMDGCTLDLDAEQERVVKCLEAAIERRVSEGLRLELCTRDRVG  355

Query  676   LLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             LLSDVTRV RE GL VTRA VST G++ VNVFYV D+SG  V  K++E LR EIGQ ++
Sbjct  356   LLSDVTRVFREKGLSVTRADVSTRGDRAVNVFYVTDTSGKAVSMKVVEALRLEIGQAIL  414



>ref|XP_003575136.1| PREDICTED: uncharacterized protein LOC100839017 [Brachypodium 
distachyon]
Length=450

 Score =   503 bits (1296),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 272/458 (59%), Positives = 330/458 (72%), Gaps = 21/458 (5%)
 Frame = -1

Query  1720  WPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITK  1541
             +PYFDPEYE  + RINPPRV +DN +  +CT+VKVDS+NK GILLEVVQVLSDLDL I K
Sbjct  2     FPYFDPEYENFNQRINPPRVCIDNDTMSECTVVKVDSMNKNGILLEVVQVLSDLDLTILK  61

Query  1540  AYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLK--TCPGKNVGVN  1367
             AY++SDGGWFMDVFHV ++ G KVTD  TI YIEKALGP        K    PG++VG++
Sbjct  62    AYITSDGGWFMDVFHVLNKQGQKVTDDKTIKYIEKALGPGSNLPSAKKGGGSPGRSVGMH  121

Query  1366  SLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAV  1187
             S+GD+TAIEL G DR GLLSEI AVLA L  NV+AAEVWTH  R+ACV+YVND  +   +
Sbjct  122   SIGDHTAIELKGPDRTGLLSEIFAVLAELQCNVLAAEVWTHRARVACVVYVNDVATGKPI  181

Query  1186  D-DPSRLCVIEEQLKNILRAC---KDDNNIAHTSVSMGSTHIDRRLHQMFFADR---DYE  1028
             D D  R+  IE +L+N+LR      +D   AHT  ++GSTH+DRRLHQ+  AD    D +
Sbjct  182   DVDTRRMTSIEHRLRNVLRGHGGDDEDGTGAHTEFAVGSTHVDRRLHQLMNADMELVDAQ  241

Query  1027  GGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAI  848
             G   ++  D  S    V++ +C EK YSVV+V+C+DR KL+FDIVCTLTDMQYVV HAA+
Sbjct  242   GEGEEVADDGMS----VTVGYCKEKDYSVVNVRCRDRSKLLFDIVCTLTDMQYVVSHAAV  297

Query  847   SSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLS  668
             SSDG    QE +IR  DG TL  + E+D+VVKCL+AAI RRVSEG  LE+C +DRVGLLS
Sbjct  298   SSDGLYGVQELFIRRKDGRTL-LKDEEDKVVKCLQAAISRRVSEGFTLEVCGRDRVGLLS  356

Query  667   DVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvk  488
             +VTRVLRE+GL VTRA V+TVGEQ +NVFYVRD+SG  VD K IEGLR +IGQ +MLN  
Sbjct  357   EVTRVLREHGLTVTRADVATVGEQAMNVFYVRDASGQTVDMKTIEGLRGQIGQTVMLN--  414

Query  487   kvaacacasakVPPETA--AWSKTSFF-FGSLLGKFRA  383
                    A A  PPE A    +KT FF FGSL  + RA
Sbjct  415   --VKKVPAPAVKPPEPARGGVAKTGFFSFGSLFARLRA  450



>ref|XP_007019286.1| ACT domain repeat 3 isoform 2, partial [Theobroma cacao]
 gb|EOY16511.1| ACT domain repeat 3 isoform 2, partial [Theobroma cacao]
Length=314

 Score =   498 bits (1281),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 239/304 (79%), Positives = 266/304 (88%), Gaps = 1/304 (0%)
 Frame = -1

Query  1402  LKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACV  1223
             +K CPGK VGV+S+G++TAIELIGRDRPGLLSEISAVLANLHFNV AAEVWTHN+RIACV
Sbjct  1     MKNCPGKRVGVHSVGNHTAIELIGRDRPGLLSEISAVLANLHFNVAAAEVWTHNRRIACV  60

Query  1222  LYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFA  1043
             LYVND  +  AVDDP+RL ++EEQLK+ILR C+DD+ +A TS SMG THIDRRLHQM FA
Sbjct  61    LYVNDDPTSRAVDDPNRLSIMEEQLKHILRGCEDDDKVARTSFSMGFTHIDRRLHQMLFA  120

Query  1042  DRDYEGGCLDMEADCP-SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYV  866
             DRDYEGG +  E D P S KP ++++ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYV
Sbjct  121   DRDYEGGGVTTEVDYPPSFKPKITVERCEEKGYSVVSVQCKDRAKLMFDIVCTLTDMQYV  180

Query  865   VFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKD  686
             VFHA ISS+GP A QEY+IRHMDGCTLDTEGEK+RV+KCLEAAI RRVSEGL LELCAKD
Sbjct  181   VFHANISSNGPYALQEYFIRHMDGCTLDTEGEKERVIKCLEAAIHRRVSEGLSLELCAKD  240

Query  685   RVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQR  506
             RVGLLS+VTR+LRENGL V RAGVSTVGEQ VNVFYVRD+ GNPVDTK IE LRKEIG  
Sbjct  241   RVGLLSEVTRILRENGLSVRRAGVSTVGEQAVNVFYVRDAYGNPVDTKTIEALRKEIGHT  300

Query  505   MMLN  494
             MMLN
Sbjct  301   MMLN  304



>ref|XP_008347951.1| PREDICTED: uncharacterized protein LOC103411072 [Malus domestica]
Length=322

 Score =   496 bits (1276),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 237/311 (76%), Positives = 263/311 (85%), Gaps = 2/311 (1%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MAR C PYFDPEYE LS RINPPRVSVDN SC DCT+VKVDSVNKPGILLEVVQ+L+DLD
Sbjct  1     MARVCSPYFDPEYENLSTRINPPRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             LIITKAY+SSDGGWFMDVFHVTDQ G KVTD  TI YIEKALGPKG+ +DVL   PGK V
Sbjct  61    LIITKAYISSDGGWFMDVFHVTDQQGKKVTDSKTIDYIEKALGPKGHITDVLNAWPGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S GD+TAIELIG+DRPGLLSEISAVLANLHFNV+AAEVWTHN+RIACV+YVND  +C
Sbjct  121   GVHSFGDHTAIELIGKDRPGLLSEISAVLANLHFNVIAAEVWTHNRRIACVVYVNDNTAC  180

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
               V+D +RL  +EEQLKNILR C+DD  +  TS SMG TH+DRRLHQM FADRDYEGG L
Sbjct  181   QPVEDKARLSTMEEQLKNILRGCEDDEKVGRTSFSMGFTHVDRRLHQMLFADRDYEGGGL  240

Query  1015  DMEAD--CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
               E D   P  +P ++I+ C EKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA+ISS
Sbjct  241   ANEVDHFPPCFQPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHASISS  300

Query  841   DGPSASQEYYI  809
             DGP ASQ + I
Sbjct  301   DGPYASQVHSI  311


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 77/164 (47%), Gaps = 16/164 (10%)
 Frame = -1

Query  985  PNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI-  809
            P VS+D+      ++V V   ++P ++ ++V  LTD+  ++  A ISSDG      +++ 
Sbjct  23   PRVSVDNSSCSDCTLVKVDSVNKPGILLEVVQILTDLDLIITKAYISSDGGWFMDVFHVT  82

Query  808  -----RHMDGCTLD----TEGEKDRVVKCLEAAIQRRV-----SEGLRLELCAKDRVGLL  671
                 +  D  T+D      G K  +   L A   +RV      +   +EL  KDR GLL
Sbjct  83   DQQGKKVTDSKTIDYIEKALGPKGHITDVLNAWPGKRVGVHSFGDHTAIELIGKDRPGLL  142

Query  670  SDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSG-NPVDTK  542
            S+++ VL      V  A V T   +   V YV D++   PV+ K
Sbjct  143  SEISAVLANLHFNVIAAEVWTHNRRIACVVYVNDNTACQPVEDK  186



>ref|XP_004952805.1| PREDICTED: uncharacterized protein LOC101775029 isoform X1 [Setaria 
italica]
 ref|XP_004952806.1| PREDICTED: uncharacterized protein LOC101775029 isoform X2 [Setaria 
italica]
 ref|XP_004952807.1| PREDICTED: uncharacterized protein LOC101775029 isoform X3 [Setaria 
italica]
 ref|XP_004952808.1| PREDICTED: uncharacterized protein LOC101775029 isoform X4 [Setaria 
italica]
 ref|XP_004952809.1| PREDICTED: uncharacterized protein LOC101775029 isoform X5 [Setaria 
italica]
Length=457

 Score =   498 bits (1282),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 267/465 (57%), Positives = 329/465 (71%), Gaps = 30/465 (6%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE  + RINPPRV +DN +C DCT+VKVDS+NK GILLEV+QVLSDLDL I KA
Sbjct  3     PYFDPEYENFNQRINPPRVCIDNTTCSDCTLVKVDSMNKNGILLEVLQVLSDLDLHIFKA  62

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVL----KTCPGKNVGV  1370
             Y++SDGGWFMDVFHV D+ G K+TD  TI YIEKALGP+   S++L       PG++VG+
Sbjct  63    YITSDGGWFMDVFHVVDKQGQKITDDKTIKYIEKALGPE---SNLLGAKGSNSPGRSVGL  119

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
             +S+GD+T IEL G DR GLLSEI AVLA+L  NV+AAEVWTH  R+ACV+YVND  +  A
Sbjct  120   HSIGDHTTIELKGPDRTGLLSEIFAVLADLQCNVLAAEVWTHRMRVACVVYVNDVATGLA  179

Query  1189  VDDPSRLCVIEEQLKNILRACKDDNN----------IAHTSVSMGSTHIDRRLHQMFFAD  1040
             +DDP R+  IE +L+++LR   D             +A+ +V     H+DRRLHQ+  AD
Sbjct  180   IDDPCRVSQIETRLRHVLRGYGDGGGGGGDDDGRGALANFAVGSAPHHVDRRLHQLMHAD  239

Query  1039  RDYEGGCLDM-----EADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDM  875
              D +G          E D    +P V+++HC EK YSVV+VKC+DR KL+FDIVCTLTDM
Sbjct  240   VDVDGDAAPAALAAGEGD----RPVVTVEHCEEKSYSVVNVKCRDRSKLLFDIVCTLTDM  295

Query  874   QYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELC  695
             QYVVFHAA+SS+     QE YIR  DG TL  + E +RV++CLEAAI RRVSEG  LELC
Sbjct  296   QYVVFHAAVSSEASYGIQELYIRRKDGKTL-LKNEAERVIRCLEAAISRRVSEGFTLELC  354

Query  694   AKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEI  515
              +DRVGLLSDVTRVLRE+GL V RA V+TVG Q  NVFYVR+ SG PVD K IEGLR  +
Sbjct  355   GRDRVGLLSDVTRVLREHGLTVARADVTTVGGQATNVFYVRNPSGQPVDMKTIEGLRGRV  414

Query  514   GQRMMLNvkkvaacacasakVPPETAAWSKTSFF-FGSLLGKFRA  383
             GQ +ML+ K V A    + +  P +   ++ SFF FG+L  K RA
Sbjct  415   GQTIMLSAKSVPANVAKAPE--PASGGLARASFFSFGNLFAKLRA  457



>ref|XP_008808484.1| PREDICTED: uncharacterized protein LOC103720522 isoform X2 [Phoenix 
dactylifera]
Length=378

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 301/377 (80%), Gaps = 9/377 (2%)
 Frame = -1

Query  1504  VFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKT----CPGKNVGVNSLGDYTAIEL  1337
             VFHVTDQ GNK+TD  TI YIEKALGP+   S++L T     PGK+VG++S+GDYTAIEL
Sbjct  4     VFHVTDQQGNKITDQKTIEYIEKALGPE---SNILGTKGDSWPGKSVGMHSIGDYTAIEL  60

Query  1336  IGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIE  1157
             IG DRPGLLSEI AVLANLH NV+AAEVWTHN R+AC+L+VND+ +  AVDDPSRL  +E
Sbjct  61    IGTDRPGLLSEIFAVLANLHCNVIAAEVWTHNMRVACILFVNDEATFQAVDDPSRLSKME  120

Query  1156  EQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE-GGCLDMEADCPSLKPN  980
             EQL+N+LR C DD   A TS S+G+TH+DRRLHQ+  AD+DYE GG +    +    +P 
Sbjct  121   EQLRNVLRGCGDDVRGARTSFSIGTTHVDRRLHQLMLADKDYEIGGSVAERNEVIPFRPV  180

Query  979   VSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHM  800
             ++IDHC EKGYSVV++KCKDRPKL+FDIVCTLTDMQ+VVFHA++SSDGP   QE YIRH 
Sbjct  181   ITIDHCEEKGYSVVNIKCKDRPKLLFDIVCTLTDMQFVVFHASVSSDGPYGLQELYIRHK  240

Query  799   DGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRA  620
             DG TLD++ EK+ V+KCLEAAI RRVSEG  LELC +DRVGLLSDVTRVLRE GL VTRA
Sbjct  241   DGFTLDSKEEKEMVIKCLEAAISRRVSEGFSLELCGRDRVGLLSDVTRVLREYGLTVTRA  300

Query  619   GVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPET  440
              V+T+GEQ +NVFYVRD+SGNPVD K IE LR+EIG  +MLNVK+V + A ASAK  P+ 
Sbjct  301   DVTTIGEQAMNVFYVRDASGNPVDMKTIEALRREIGHTVMLNVKRVPSSASASAKA-PQP  359

Query  439   AAWSKTSFFFGSLLGKF  389
             +  ++  F FG LLG+F
Sbjct  360   SRGARKGFSFGGLLGRF  376



>gb|KDO83532.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
 gb|KDO83533.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
 gb|KDO83534.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
 gb|KDO83535.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
 gb|KDO83536.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
 gb|KDO83537.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
Length=306

 Score =   484 bits (1245),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 262/306 (86%), Gaps = 5/306 (2%)
 Frame = -1

Query  1618  VDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIE  1439
             VDSVNKPGILLEVVQVLSDLDLIITKAY+SSDGGWFMDVFHV DQ G K+TDG TI YIE
Sbjct  1     VDSVNKPGILLEVVQVLSDLDLIITKAYISSDGGWFMDVFHVIDQQGKKITDGKTIDYIE  60

Query  1438  KALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAA  1259
             KALGPKG+ +   KT P K VGV+S+GD+TAIELIGRDRPGLLSEISAVLANL FNV AA
Sbjct  61    KALGPKGHITAGAKTWPSKQVGVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVAAA  120

Query  1258  EVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNN--IAHTSVSMG  1085
             EVWTHN+RIACVLYVND  +C AV D +RL ++EEQLKNILR C D+++  +A TS SMG
Sbjct  121   EVWTHNRRIACVLYVNDDTTCRAVGDQTRLSLMEEQLKNILRGCDDEDSEKVARTSFSMG  180

Query  1084  STHIDRRLHQMFFADRDYEGGCL---DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRP  914
              TH+DRRLHQMFFADRDYEGG +   D     PS KP ++++   +KGYSVV+VKC+DR 
Sbjct  181   FTHVDRRLHQMFFADRDYEGGGVTTADQVDHTPSFKPEITVERLEDKGYSVVNVKCRDRA  240

Query  913   KLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAI  734
             KLMFDIVCTLTDMQYVVFHAAISSDGP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI
Sbjct  241   KLMFDIVCTLTDMQYVVFHAAISSDGPHASQEYYIRHMDGCILDTEGEKERVIKCLEAAI  300

Query  733   QRRVSE  716
             +RRVSE
Sbjct  301   RRRVSE  306



>gb|KDO83531.1| hypothetical protein CISIN_1g0127933mg, partial [Citrus sinensis]
Length=319

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 262/306 (86%), Gaps = 5/306 (2%)
 Frame = -1

Query  1618  VDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIE  1439
             VDSVNKPGILLEVVQVLSDLDLIITKAY+SSDGGWFMDVFHV DQ G K+TDG TI YIE
Sbjct  1     VDSVNKPGILLEVVQVLSDLDLIITKAYISSDGGWFMDVFHVIDQQGKKITDGKTIDYIE  60

Query  1438  KALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAA  1259
             KALGPKG+ +   KT P K VGV+S+GD+TAIELIGRDRPGLLSEISAVLANL FNV AA
Sbjct  61    KALGPKGHITAGAKTWPSKQVGVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVAAA  120

Query  1258  EVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNN--IAHTSVSMG  1085
             EVWTHN+RIACVLYVND  +C AV D +RL ++EEQLKNILR C D+++  +A TS SMG
Sbjct  121   EVWTHNRRIACVLYVNDDTTCRAVGDQTRLSLMEEQLKNILRGCDDEDSEKVARTSFSMG  180

Query  1084  STHIDRRLHQMFFADRDYEGGCL---DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRP  914
              TH+DRRLHQMFFADRDYEGG +   D     PS KP ++++   +KGYSVV+VKC+DR 
Sbjct  181   FTHVDRRLHQMFFADRDYEGGGVTTADQVDHTPSFKPEITVERLEDKGYSVVNVKCRDRA  240

Query  913   KLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAI  734
             KLMFDIVCTLTDMQYVVFHAAISSDGP ASQEYYIRHMDGC LDTEGEK+RV+KCLEAAI
Sbjct  241   KLMFDIVCTLTDMQYVVFHAAISSDGPHASQEYYIRHMDGCILDTEGEKERVIKCLEAAI  300

Query  733   QRRVSE  716
             +RRVSE
Sbjct  301   RRRVSE  306



>ref|XP_002978936.1| hypothetical protein SELMODRAFT_109915, partial [Selaginella 
moellendorffii]
 gb|EFJ19893.1| hypothetical protein SELMODRAFT_109915, partial [Selaginella 
moellendorffii]
Length=452

 Score =   488 bits (1257),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 253/451 (56%), Positives = 318/451 (71%), Gaps = 21/451 (5%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVK-----VDSVNKPGILLEVVQVLSDLDL  1553
             PYFDPEY+TLS+R++PP V +DN SC D T++K     VDS NK GILLEVVQVL+DLDL
Sbjct  1     PYFDPEYDTLSLRLDPPSVVIDNTSCPDATLIKATPLPVDSKNKHGILLEVVQVLTDLDL  60

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPK--GYTSDVLKTCPGKN  1379
              I+KAY+SSDGGWFMDVFHVTDQ GNK+TD   I YI+++LG K    T++V +TC G+ 
Sbjct  61    AISKAYISSDGGWFMDVFHVTDQLGNKLTDEGIIDYIQQSLGAKQDSQTTEV-QTCLGRR  119

Query  1378  VGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVS  1199
             V + S  + TAIEL GRDRPGLLS+IS VL ++  NVVAAEVWTHN R+ACV+YV D+V+
Sbjct  120   VSLRSNTEQTAIELCGRDRPGLLSDISGVLKDMMCNVVAAEVWTHNLRVACVVYVTDEVT  179

Query  1198  CNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFAD----RDY  1031
                ++D  +L VI+ +L   L+   +    + T + M   H +RRLHQ+  AD    +  
Sbjct  180   GGPIEDEKKLAVIKARLSQALQG-DESGKGSKTDIPMAVLHTERRLHQIMSADFAAIQPE  238

Query  1030  EGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAA  851
                     AD    +P +S+ +C EKGYSVV+V+C DRPKL+FD VCTLTDM+YVVFHAA
Sbjct  239   STNTFVAAAD--KTRPAISVQNCAEKGYSVVNVRCNDRPKLLFDTVCTLTDMKYVVFHAA  296

Query  850   ISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLL  671
             I S+G  A QEYYIR MDGCTL +E E++ VVKCLEAAI+RR   G+RLELC KDRVGLL
Sbjct  297   IRSEGSFAYQEYYIRLMDGCTLKSEAEQEYVVKCLEAAIERRTGGGIRLELCTKDRVGLL  356

Query  670   SDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNv  491
             SDVTR+ RENGL VTRA VST G++ VNVFYV D+SGNPVD +I+E  RKEIGQ ++   
Sbjct  357   SDVTRIFRENGLSVTRADVSTQGDKAVNVFYVTDASGNPVDRRIVEATRKEIGQSIL---  413

Query  490   kkvaacacasakVPPETAAWSKTSFFFGSLL  398
                       +    +    SK+ F FG+ L
Sbjct  414   ---QVKDLTPSSPNSQHEVASKSRFSFGTFL  441



>gb|KHG17797.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=450

 Score =   488 bits (1256),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 234/407 (57%), Positives = 305/407 (75%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN + +  T++KVDS NK G LLEVVQVL+DLDL
Sbjct  3     CWSSSLMVDEEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             +I +AY+SSDG WFMDVFHVTDQHGNK+++ +    I++ LGP+ Y+   L     ++VG
Sbjct  63    LIRRAYISSDGEWFMDVFHVTDQHGNKLSEVDVAEKIQQQLGPRSYSFRSLT----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +    T IEL GRDRPGLLSEI AVL +L  NVVAAEVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAASKQTIIELTGRDRPGLLSEIFAVLTDLKCNVVAAEVWTHNSRMASVVYIADETTGL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
             ++D+P RL  I++ L  +L+  +D  N A+T+VS+GS H +RRLHQM +ADRDY+    +
Sbjct  179   SIDNPERLTKIKQLLLYVLKGDRDKMN-ANTAVSLGSMHKERRLHQMMYADRDYDMSDAN  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++C  KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++GP
Sbjct  238   SGSTSDRSKPQVTVENCEHKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRHMDGC + +E E+ RV+ CLEAAI+RR SEG+RLELC+ DRVGLLSDVTR+
Sbjct  298   EAYQEYYIRHMDGCPISSEAEQQRVIHCLEAAIKRRASEGIRLELCSDDRVGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V T G Q VN+FYV D+SG+PV ++ IE +RKEIG
Sbjct  358   FRENGLSVTRAEVKTRGSQAVNIFYVTDASGDPVKSETIEAVRKEIG  404



>ref|NP_001047123.1| Os02g0555600 [Oryza sativa Japonica Group]
 dbj|BAD15455.1| putative ACT domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD33316.1| putative ACT domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF09037.1| Os02g0555600 [Oryza sativa Japonica Group]
 dbj|BAG92889.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score =   489 bits (1259),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 327/480 (68%), Gaps = 36/480 (8%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE  S RINPPRV +DN +C DCT+VKVDS+NK GILLEVVQVLSDLDL I+KA
Sbjct  3     PYFDPEYENFSQRINPPRVCIDNSTCSDCTLVKVDSMNKNGILLEVVQVLSDLDLAISKA  62

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLK--TCPGKNVGVNS  1364
             Y++SDGGWFMDVFHV D+ G KVTD  TI +IEKALGP        K  + P ++VG++S
Sbjct  63    YITSDGGWFMDVFHVVDKQGQKVTDEKTIKHIEKALGPDSNLLGGAKGGSSPVRSVGMHS  122

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVD  1184
             +GD+TAIEL G DR GLLSE+ AVLA L  NV+AAEVWTH  R+ACV+YVND  S  AV 
Sbjct  123   IGDHTAIELKGPDRTGLLSEVFAVLAELGCNVLAAEVWTHRARVACVVYVNDVASGQAVG  182

Query  1183  DPSRLCVIEEQLKNILRA-----------CKDDNNIAHTSVSMGSTHIDRRLHQMFFADR  1037
             DP RL  IE +L+ +LR                 N   +  +  +TH+DRRLHQ+  AD 
Sbjct  183   DPCRLSRIEHRLRLVLRGHAGGDDGDGDDGPAHANFFSSGGAGSNTHVDRRLHQLMHADV  242

Query  1036  DYEGGCLDMEADCPS----------LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCT  887
             D +           S           +P V+++HC EK YSVV+VKC+DR KL+FDIVCT
Sbjct  243   DADDDDGLDSRAIVSGEAGNAAAAEERPVVTVEHCEEKDYSVVNVKCRDRSKLLFDIVCT  302

Query  886   LTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLR  707
             LTDM YVV HA++SSDG    QE YIR  DG TL  + E  RV+KCLEAAI RRVSEG  
Sbjct  303   LTDMHYVVSHASVSSDGIYGIQELYIRRKDGRTLQKD-EAGRVIKCLEAAISRRVSEGFT  361

Query  706   LELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGL  527
             LELC +DRVGLLSDVTRVLRE+GL VTRA V+TVG Q +NVFYVRD+SG PVD K IEGL
Sbjct  362   LELCGRDRVGLLSDVTRVLREHGLTVTRADVTTVGGQAINVFYVRDASGEPVDMKTIEGL  421

Query  526   RKEIGQRMMLNvkkvaacacasakV-----------PPETAAWSKTSFF-FGSLLGKFRA  383
             R ++G  +MLNVKKV +   +S+              P + A S+TSFF FG+L  K RA
Sbjct  422   RVQVGHTVMLNVKKVPSSPSSSSAAAAAAANGKSPGQPASGALSRTSFFSFGNLFAKLRA  481



>ref|XP_002986453.1| hypothetical protein SELMODRAFT_124305, partial [Selaginella 
moellendorffii]
 gb|EFJ12310.1| hypothetical protein SELMODRAFT_124305, partial [Selaginella 
moellendorffii]
Length=452

 Score =   486 bits (1252),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 252/451 (56%), Positives = 317/451 (70%), Gaps = 21/451 (5%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVK-----VDSVNKPGILLEVVQVLSDLDL  1553
             PYFDPEY+TLS+R++PP V +DN SC D T++K     VDS NK GILLEVVQVL+DLDL
Sbjct  1     PYFDPEYDTLSLRLDPPSVVIDNTSCPDATLIKATPLPVDSKNKHGILLEVVQVLTDLDL  60

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPK--GYTSDVLKTCPGKN  1379
              I+KAY+SSDGGWFMDVFHVTDQ GNK+ D   I YI+++LG K    T++V +TC G+ 
Sbjct  61    AISKAYISSDGGWFMDVFHVTDQLGNKLIDEGIIDYIQQSLGAKQDSQTTEV-QTCLGRR  119

Query  1378  VGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVS  1199
               + S  + TAIEL GRDRPGLLS+IS VL ++  NVVAAEVWTHN R+ACV+YV D+V+
Sbjct  120   FSLRSNTEQTAIELCGRDRPGLLSDISGVLKDMMCNVVAAEVWTHNLRVACVVYVTDEVT  179

Query  1198  CNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFAD----RDY  1031
                ++D  +L VI+ +L   L+   +    + T + M   H +RRLHQ+  AD    +  
Sbjct  180   GGPIEDEKKLAVIKARLSQALQG-DESGKGSKTDIPMAVLHTERRLHQIMSADFAAIQPE  238

Query  1030  EGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAA  851
                     AD    +P +S+ +C EKGYSVV+V+CKDRPKL+FD VCTLTDM+YVVFHAA
Sbjct  239   STNTFVAAAD--KTRPAISVQNCAEKGYSVVNVRCKDRPKLLFDTVCTLTDMKYVVFHAA  296

Query  850   ISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLL  671
             I S+G  A QEYYIR MDGCTL +E E++ VVKCLEAAI+RR   G+RLELC KDRVGLL
Sbjct  297   IRSEGSFAYQEYYIRLMDGCTLKSEAEQEYVVKCLEAAIERRTGGGIRLELCTKDRVGLL  356

Query  670   SDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNv  491
             SDVTR+ RENGL VTRA VST G++ VNVFYV D+SGNPVD +I+E  RKEIGQ ++   
Sbjct  357   SDVTRIFRENGLSVTRADVSTQGDKAVNVFYVTDASGNPVDRRIVEATRKEIGQSIL---  413

Query  490   kkvaacacasakVPPETAAWSKTSFFFGSLL  398
                       +    +    SK+ F FG+ L
Sbjct  414   ---QVKDLTPSSPNSQHEVASKSRFSFGTFL  441



>ref|XP_011086839.1| PREDICTED: uncharacterized protein LOC105168447 isoform X2 [Sesamum 
indicum]
Length=449

 Score =   486 bits (1251),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 245/440 (56%), Positives = 321/440 (73%), Gaps = 14/440 (3%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E++ L IR+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+DL+L
Sbjct  3     CWSSSLRVDDEFKKLVIRMNPPRVTVDNASDKKATLIKVDSANKRGSLLEVVQVLTDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVF+VTD+ GNKV + N    I+++LGP+G++  +L     ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFYVTDEFGNKVYEDNVSERIQQSLGPRGHSFRLL----ARSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V S  ++T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ + +
Sbjct  119   VQSASEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEANGS  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              ++DP RL  I++ L  +L+  ++  + A+++VS+GSTH  RRLHQM +ADRDY+   +D
Sbjct  179   PINDPERLANIKQLLLYVLKGDREWRS-ANSAVSVGSTHTQRRLHQMMYADRDYDVQNVD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               A     KP V++++CVEKGY+VV++ C DRPKL+FD VCTLTDMQYVVFH  I ++GP
Sbjct  238   -NATTERTKPLVTVENCVEKGYTVVNLSCPDRPKLLFDTVCTLTDMQYVVFHGTIIAEGP  296

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRHMDGC + +E E+ RV+ CLEAAI+RR SEG+RLELC+ DRVGLLSDVTR+
Sbjct  297   EAQQEYYIRHMDGCPISSEAERQRVIHCLEAAIKRRESEGIRLELCSDDRVGLLSDVTRI  356

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaac  473
              RENGL VTRA V+T G Q VNVFYV D+SG+PV ++ IE +RKEIG  ++         
Sbjct  357   FRENGLSVTRAEVTTRGTQAVNVFYVTDASGSPVKSETIEAVRKEIGLTIL-----RVKD  411

Query  472   acasakVPPETAAWSKTSFF  413
                S+  P ET  +S  S F
Sbjct  412   DTYSSSPPQETGRFSLGSLF  431



>ref|XP_007043904.1| ACT domain repeat 4 isoform 2 [Theobroma cacao]
 gb|EOX99735.1| ACT domain repeat 4 isoform 2 [Theobroma cacao]
Length=450

 Score =   486 bits (1250),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 233/407 (57%), Positives = 308/407 (76%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN + +  T++KVDS NK G LLEVVQVL+DLDL
Sbjct  3     CWSPSLTLDEEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ+GNK+++ +    I++ LGP+ Y+   L     ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQYGNKLSEVDVAERIQQQLGPRAYSFRSLT----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +   +T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ + +
Sbjct  119   VQAASKHTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGS  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
             ++D+P RL  I++ L  +L+  +D    A+T+VS+GSTH +RRLHQM +ADRDY+    D
Sbjct  179   SIDNPERLTKIKQLLLYVLKGDRDQMR-ANTAVSVGSTHTERRLHQMMYADRDYDMNDAD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + +DGP
Sbjct  238   SGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLFDTVCTLTDMQYVVYHATVIADGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRHMDGC + +E E+ RV+ CLEAAI+RR SEG+RLELC++DRVGLLSDVTR+
Sbjct  298   EAYQEYYIRHMDGCPVSSEPERQRVINCLEAAIKRRASEGIRLELCSEDRVGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VN F V D+SG+PV ++ IE +RKE+G
Sbjct  358   FRENGLSVTRAEVTTRGSQAVNAFCVTDASGDPVKSETIEAVRKELG  404



>ref|XP_007222134.1| hypothetical protein PRUPE_ppa005716mg [Prunus persica]
 gb|EMJ23333.1| hypothetical protein PRUPE_ppa005716mg [Prunus persica]
Length=447

 Score =   484 bits (1246),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 249/441 (56%), Positives = 313/441 (71%), Gaps = 22/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS N+ GILLEVVQVL+DL+LI+TKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNKACKNATVIRVDSANEYGILLEVVQVLTDLNLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   +  ++T     VGV    D+
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEGVLEYIQKSLGPEACFASSMRT-----VGVKQSTDH  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIEL G DRPGLLSE+SAVL NL  NVV+AEVWTHN R A V++V D+ +  AV DP R
Sbjct  126   TAIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMHVTDEETGLAVTDPQR  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L  I+E L N+L+        A T VS   TH +RRLHQM FADRDYE    G LD    
Sbjct  186   LARIKELLCNVLKGSNKTRG-ARTVVSHAVTHTERRLHQMMFADRDYERVDDGLLD----  240

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
               + +PNV++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA+I ++GP A Q
Sbjct  241   -DNQRPNVNVVNWQDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  300   EYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIFREN  359

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + VN FYVRD+SG PVD+K IE +R+ IGQ ++            S
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDTSGYPVDSKTIEAIRQVIGQTIL--------KVKGS  411

Query  460   akVPPETAAWSKTSFFFGSLL  398
              + P   +  S T F FG L 
Sbjct  412   PEDPKPGSEESPTRFLFGGLF  432



>ref|XP_008645795.1| PREDICTED: uncharacterized protein LOC103627283 isoform X2 [Zea 
mays]
 ref|XP_008645796.1| PREDICTED: uncharacterized protein LOC103627283 isoform X2 [Zea 
mays]
 ref|XP_008645797.1| PREDICTED: uncharacterized protein LOC103627283 isoform X2 [Zea 
mays]
 ref|XP_008645798.1| PREDICTED: uncharacterized protein LOC103627283 isoform X2 [Zea 
mays]
 ref|XP_008645799.1| PREDICTED: uncharacterized protein LOC103627283 isoform X2 [Zea 
mays]
 ref|XP_008645800.1| PREDICTED: uncharacterized protein LOC103627283 isoform X2 [Zea 
mays]
 gb|AFW71794.1| hypothetical protein ZEAMMB73_478784 [Zea mays]
 gb|AFW71795.1| hypothetical protein ZEAMMB73_478784 [Zea mays]
 gb|AFW71796.1| hypothetical protein ZEAMMB73_478784 [Zea mays]
Length=460

 Score =   484 bits (1247),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 311/424 (73%), Gaps = 20/424 (5%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE  + RINPPRV +DN +C DCT+VKVDS+NK GILLEV+QVLSDLDL I KA
Sbjct  3     PYFDPEYENFNQRINPPRVCIDNTTCSDCTLVKVDSMNKNGILLEVLQVLSDLDLHIFKA  62

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVL----KTCPGKNVGV  1370
             Y++SDGGWFMDVFHV D+ G K+TD  TI YIEKALGP+   S++L        G++VG+
Sbjct  63    YITSDGGWFMDVFHVVDKQGQKITDDKTIKYIEKALGPE---SNLLGAKGSNSAGRSVGL  119

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
             +S+GD+TAIEL G DR GLLSEI AVLA+L  NV+AAEVWTH  R+ACV+YVND  +  A
Sbjct  120   HSIGDHTAIELKGPDRRGLLSEIFAVLADLQCNVLAAEVWTHRMRVACVVYVNDVATGQA  179

Query  1189  VDDPSRLCVIEEQLKNILR--------ACKDDNNIAHTSVSMGST---HIDRRLHQMFFA  1043
             +DDP R+  +E++L+++LR           DD + AH + +  S+   H+DRRLHQ+  A
Sbjct  180   IDDPDRVARVEDRLRHVLRGYGGGGGAGDDDDGSGAHANFAAASSTPHHVDRRLHQLMHA  239

Query  1042  DRD-YEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYV  866
             D D   G      A     +P V+++HC EK YSVV+VKCKDR KL+FDIVCTLTDM+YV
Sbjct  240   DVDAVHGDGAHAAAGGEGDRPAVTVEHCEEKSYSVVNVKCKDRSKLLFDIVCTLTDMEYV  299

Query  865   VFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKD  686
             VFHAA+SS+     QE YIR  DG TL  + E ++V++CLEAAI RRVSEG  LE+C +D
Sbjct  300   VFHAAVSSEANYGIQELYIRRKDGKTL-LKDEAEKVIRCLEAAISRRVSEGFTLEVCGRD  358

Query  685   RVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQR  506
             RVGLLSDVTRVLRE+GL V+RA V+T G Q  NVFYVR+ SG PVD K +EGLR + GQ 
Sbjct  359   RVGLLSDVTRVLREHGLTVSRADVTTAGGQATNVFYVRNPSGQPVDMKTVEGLRGQFGQT  418

Query  505   MMLN  494
              MLN
Sbjct  419   AMLN  422



>gb|EYU42079.1| hypothetical protein MIMGU_mgv1a006197mg [Erythranthe guttata]
Length=453

 Score =   483 bits (1244),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 236/401 (59%), Positives = 307/401 (77%), Gaps = 7/401 (2%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L  R+NPPRV+VDN S    T++KVDS NK G LLEVVQVL+DL+LII +AY+S
Sbjct  11    DDEFEKLVRRVNPPRVTVDNDSDNKATLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDGGWFMDVFHVTD++GNKV +GN    I+++LG +G +   L     ++VGV S  ++T
Sbjct  71    SDGGWFMDVFHVTDKYGNKVHEGNISESIQQSLGQRGRSCRSL----ARSVGVESAAEHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ + + + DP RL
Sbjct  127   TIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDQTNSSPIQDPDRL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEG-GCLDMEADCPS  992
               I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+    L   +D   
Sbjct  187   SNIKQLLLYVLKGDRDKRS-ANTAVSVGSTHTERRLHQMMYADRDYDHLNTLVHSSDQLR  245

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              KP V++++CV+KGY+VV++ C DRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY+
Sbjct  246   TKPLVTVENCVDKGYTVVNLSCADRPKLLFDTVCTLTDMQYVVFHATIITEGPQAQQEYF  305

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRHMDGC + +E E+ RV+ CLEAAI+RR SEG+RLELC++DRVGLL+DVTR+ RENGL 
Sbjct  306   IRHMDGCPISSEAERQRVIHCLEAAIKRRTSEGIRLELCSEDRVGLLTDVTRIFRENGLS  365

Query  631   VTRAGVSTVGEQGVNVFYVRD-SSGNPVDTKIIEGLRKEIG  512
             V+RA V+T G Q VNVFYV D SS NPV ++ +E +RKEIG
Sbjct  366   VSRAEVTTRGTQAVNVFYVTDASSSNPVQSQTVEAVRKEIG  406



>ref|XP_009599622.1| PREDICTED: uncharacterized protein LOC104095244 [Nicotiana tomentosiformis]
Length=449

 Score =   482 bits (1241),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 241/443 (54%), Positives = 316/443 (71%), Gaps = 18/443 (4%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E++ L +R+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+DL+LII +AY+S
Sbjct  11    DDEFKKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTDQ+GNK+++ N    I+++LGP+G +   ++    ++VGV S  ++T
Sbjct  71    SDGEWFMDVFHVTDQYGNKLSEDNVAERIQQSLGPRGRSFRSME----RSVGVQSAAEHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSEI AVLA+   NVVAAEVWTHN R+A V+Y+ D+ S  A+ DP RL
Sbjct  127   TIELTGRDRPGLLSEIFAVLADHKNNVVAAEVWTHNSRMASVVYITDEESGLAITDPDRL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
               I + L  +L+  +D    A+T+VS+GSTH +RRLHQM +ADRDY+      +  C S+
Sbjct  187   AKIRKLLLYVLKGDRDRRG-ANTAVSVGSTHTERRLHQMMYADRDYDKD----DTSCVSV  241

Query  988   ---KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                KP V+++ C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I ++GP ASQE
Sbjct  242   DQRKPMVTVESCADKGYTVVNLRCADRPKLLFDAVCTLTDMQYVVYHATIIAEGPEASQE  301

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YYIRHMDGC + +E E+ RV+ CLEAA++RR S G+RLELC  DR+GLLSDVTR+ RENG
Sbjct  302   YYIRHMDGCPVSSEAERQRVIHCLEAAVKRRTSTGIRLELCGDDRIGLLSDVTRIFRENG  361

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L V+RA V T G Q +NVFYV D+SG+PV T+ IE +R EIG  ++             +
Sbjct  362   LSVSRAEVMTKGSQAINVFYVTDASGSPVKTETIEAVRNEIGMTIL------RVRDDLYS  415

Query  457   kVPPETAAWSKTSFFFGSLLGKF  389
               PP+  A       F S   KF
Sbjct  416   NSPPQQTARFSLGNIFRSRSEKF  438



>ref|XP_008243801.1| PREDICTED: uncharacterized protein LOC103342019 [Prunus mume]
Length=447

 Score =   482 bits (1240),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 248/441 (56%), Positives = 313/441 (71%), Gaps = 22/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS N+ GILLEVVQVL+DL+LI+TKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNKACKNATVIRVDSANEYGILLEVVQVLTDLNLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   +  +++     VGV    D+
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEGVLEYIQKSLGPEACFASSMRS-----VGVKQSMDH  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIEL G DRPGLLSE+SAVL NL  NVV+AEVWTHN R A V++V D+ +  AV DP R
Sbjct  126   TAIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMHVTDEETGLAVTDPQR  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L  I+E L N+L+        A T VS   TH +RRLHQM FADRDYE    G LD    
Sbjct  186   LARIKELLCNVLKGSNKTRG-ARTVVSHAVTHTERRLHQMMFADRDYERVDDGLLD----  240

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
               + +PNV++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA+I ++GP A Q
Sbjct  241   -DNQRPNVNVVNWQDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  300   EYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + VN FYVRD+SG PVD+K IE +R+ IGQ ++            S
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIEAIREVIGQTIL--------KVKGS  411

Query  460   akVPPETAAWSKTSFFFGSLL  398
              + P   +  S T F FG L 
Sbjct  412   PEDPKPGSEESPTRFLFGGLF  432



>ref|XP_002266641.1| PREDICTED: uncharacterized protein LOC100250497 [Vitis vinifera]
 emb|CBI38152.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   481 bits (1238),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 234/407 (57%), Positives = 308/407 (76%), Gaps = 11/407 (3%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN S +  T++KVDS N+ G LLEVVQVL+D+DL
Sbjct  3     CWSPSLTVDDEFEKLVIRMNPPRVTVDNASSRTATLIKVDSANRRGSLLEVVQVLNDMDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK+++ +    I+++LGP+  +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQKGNKLSEDDVAERIQQSLGPRARSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D  +  
Sbjct  119   VQAANEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDDETGL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP RL  I++ L  +L+  +D  + A+T+VS+GST+  RRLHQM +ADRDY+   +D
Sbjct  179   PIDDPDRLVKIKQLLLYVLKGDRDKRS-ANTAVSVGSTNTQRRLHQMMYADRDYD---MD  234

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++  +KGY+VV+++C DRPKL+FD VCTLTDMQYVVFHA + ++GP
Sbjct  235   SGSTNDRSKPLVTVENFADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVFHATVIAEGP  294

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH+DGC + +E E+ RV+ CLEAAI+RR SEG+RLELC++DRVGLLSDVTR+
Sbjct  295   EAYQEYYIRHVDGCPISSEAEQQRVILCLEAAIRRRTSEGIRLELCSEDRVGLLSDVTRI  354

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VN FYV DSSGNPV ++ IE +RKEIG
Sbjct  355   FRENGLSVTRAEVTTRGSQAVNAFYVTDSSGNPVKSETIEAVRKEIG  401



>ref|XP_010249096.1| PREDICTED: uncharacterized protein LOC104591777 [Nelumbo nucifera]
Length=453

 Score =   480 bits (1236),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 233/404 (58%), Positives = 311/404 (77%), Gaps = 5/404 (1%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L IR+NPPRV+VDNIS    T++KVDS NK G LLEVVQVL+DL+L I++AY+S
Sbjct  11    DDEFEKLVIRMNPPRVTVDNISSSKATLIKVDSANKHGSLLEVVQVLTDLNLTISRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHV DQ+GNK++D   I  I+++LGP    +  L++   ++VGV +  ++T
Sbjct  71    SDGEWFMDVFHVIDQNGNKLSDEKVIDRIQQSLGPSRVQN--LRSLR-RSVGVQAAAEHT  127

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              +EL GRDRPGLLSEI AVL +L  NVVAAE+WTHN R+A V+Y+ND+ + +++DD  RL
Sbjct  128   TVELTGRDRPGLLSEIFAVLMDLKCNVVAAEIWTHNSRMASVVYINDEATGSSIDDGDRL  187

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGC-LDMEADCPS  992
               I++ L  +L+  +D    A+T+VS+G+TH  RRLHQM +ADRDY+    +D       
Sbjct  188   ARIKQLLLYVLKGDRD-MRTANTAVSVGATHTQRRLHQMMYADRDYDKDYYVDGVPTTDR  246

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              KP V +++CV+KGY+VV+++C+DRPKL+FD VCTLTDMQYVVFHA ++++GP A QEYY
Sbjct  247   SKPCVMVENCVDKGYTVVNLRCQDRPKLLFDTVCTLTDMQYVVFHATVNTEGPEACQEYY  306

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH DGC + +E E+ R++ CL AAIQRR +EG+RLELC++DRVGLLSDVTR+ RENGL+
Sbjct  307   IRHKDGCPISSEAERQRLIHCLVAAIQRRSTEGIRLELCSEDRVGLLSDVTRIFRENGLV  366

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             VTRA V+T G Q VNVFYV DSSGNPV ++ IE +R EIGQ ++
Sbjct  367   VTRAEVTTCGSQAVNVFYVMDSSGNPVKSETIEAVRSEIGQTIL  410



>ref|XP_008645794.1| PREDICTED: uncharacterized protein LOC103627283 isoform X1 [Zea 
mays]
Length=571

 Score =   484 bits (1246),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 311/424 (73%), Gaps = 20/424 (5%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPEYE  + RINPPRV +DN +C DCT+VKVDS+NK GILLEV+QVLSDLDL I KA
Sbjct  114   PYFDPEYENFNQRINPPRVCIDNTTCSDCTLVKVDSMNKNGILLEVLQVLSDLDLHIFKA  173

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVL----KTCPGKNVGV  1370
             Y++SDGGWFMDVFHV D+ G K+TD  TI YIEKALGP+   S++L        G++VG+
Sbjct  174   YITSDGGWFMDVFHVVDKQGQKITDDKTIKYIEKALGPE---SNLLGAKGSNSAGRSVGL  230

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
             +S+GD+TAIEL G DR GLLSEI AVLA+L  NV+AAEVWTH  R+ACV+YVND  +  A
Sbjct  231   HSIGDHTAIELKGPDRRGLLSEIFAVLADLQCNVLAAEVWTHRMRVACVVYVNDVATGQA  290

Query  1189  VDDPSRLCVIEEQLKNILR--------ACKDDNNIAHTSVSMGST---HIDRRLHQMFFA  1043
             +DDP R+  +E++L+++LR           DD + AH + +  S+   H+DRRLHQ+  A
Sbjct  291   IDDPDRVARVEDRLRHVLRGYGGGGGAGDDDDGSGAHANFAAASSTPHHVDRRLHQLMHA  350

Query  1042  DRD-YEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYV  866
             D D   G      A     +P V+++HC EK YSVV+VKCKDR KL+FDIVCTLTDM+YV
Sbjct  351   DVDAVHGDGAHAAAGGEGDRPAVTVEHCEEKSYSVVNVKCKDRSKLLFDIVCTLTDMEYV  410

Query  865   VFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKD  686
             VFHAA+SS+     QE YIR  DG TL  + E ++V++CLEAAI RRVSEG  LE+C +D
Sbjct  411   VFHAAVSSEANYGIQELYIRRKDGKTL-LKDEAEKVIRCLEAAISRRVSEGFTLEVCGRD  469

Query  685   RVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQR  506
             RVGLLSDVTRVLRE+GL V+RA V+T G Q  NVFYVR+ SG PVD K +EGLR + GQ 
Sbjct  470   RVGLLSDVTRVLREHGLTVSRADVTTAGGQATNVFYVRNPSGQPVDMKTVEGLRGQFGQT  529

Query  505   MMLN  494
              MLN
Sbjct  530   AMLN  533



>emb|CAN83845.1| hypothetical protein VITISV_001862 [Vitis vinifera]
Length=465

 Score =   480 bits (1236),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 234/407 (57%), Positives = 308/407 (76%), Gaps = 11/407 (3%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN S +  T++KVDS N+ G LLEVVQVL+D+DL
Sbjct  3     CWSPSLTVDDEFEKLVIRMNPPRVTVDNASSRTATLIKVDSANRRGSLLEVVQVLNDMDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK+++ +    I+++LGP+  +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQKGNKLSEDDVAERIQQSLGPRARSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D  +  
Sbjct  119   VQAANEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDDETGL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP RL  I++ L  +L+  +D  + A+T+VS+GST+  RRLHQM +ADRDY+   +D
Sbjct  179   PIDDPDRLVKIKQLLLYVLKGDRDKRS-ANTAVSVGSTNTQRRLHQMMYADRDYD---MD  234

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++  +KGY+VV+++C DRPKL+FD VCTLTDMQYVVFHA + ++GP
Sbjct  235   SGSTNDRSKPLVTVENFADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVFHATVIAEGP  294

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH+DGC + +E E+ RV+ CLEAAI+RR SEG+RLELC++DRVGLLSDVTR+
Sbjct  295   EAYQEYYIRHVDGCPISSEAEQQRVILCLEAAIRRRTSEGIRLELCSEDRVGLLSDVTRI  354

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VN FYV DSSGNPV ++ IE +RKEIG
Sbjct  355   FRENGLSVTRAEVTTRGSQAVNAFYVTDSSGNPVKSETIEAVRKEIG  401



>ref|XP_002974009.1| hypothetical protein SELMODRAFT_100599 [Selaginella moellendorffii]
 ref|XP_002983482.1| hypothetical protein SELMODRAFT_180275 [Selaginella moellendorffii]
 gb|EFJ15383.1| hypothetical protein SELMODRAFT_180275 [Selaginella moellendorffii]
 gb|EFJ24964.1| hypothetical protein SELMODRAFT_100599 [Selaginella moellendorffii]
Length=477

 Score =   480 bits (1235),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 247/467 (53%), Positives = 314/467 (67%), Gaps = 44/467 (9%)
 Frame = -1

Query  1720  WPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITK  1541
             WPYFDPEYETL+ RINPPRV +DN   +  TI+K+DS N+ GILL+VVQVL+DLDL I K
Sbjct  11    WPYFDPEYETLAARINPPRVVIDNKVSEHATIIKLDSSNRHGILLDVVQVLTDLDLSILK  70

Query  1540  AYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPG-KNVGVNS  1364
             A++SSDGGWFMDVFHVTD+ GNK++D   I +IE     + Y     +TC G + +GV S
Sbjct  71    AFISSDGGWFMDVFHVTDRDGNKLSDEKVIAHIEHKGVCQAY-----RTCSGARTIGVQS  125

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA-V  1187
             L ++TAIEL G DRPGLLSEISAVLA+L  NVVAAEVWTHN R+AC++YV D       V
Sbjct  126   LAEHTAIELTGNDRPGLLSEISAVLASLGCNVVAAEVWTHNTRVACMVYVTDHEGHGGPV  185

Query  1186  DDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADR----------  1037
              DP++LC I++ L  +++    D   A T  +MG TH +RRLHQM  AD+          
Sbjct  186   KDPTKLCHIKQMLGQVMKGDSLDGKTARTDFAMGLTHTERRLHQMMSADKEEEMEVAEEE  245

Query  1036  --------------DYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFD  899
                           DY+G            +P V++ +CVEKGYSVV+V+C DRPKL+FD
Sbjct  246   AALSPAPTSISDSVDYKG------------RPTVTVKNCVEKGYSVVTVQCADRPKLLFD  293

Query  898   IVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVS  719
              VCTLTDM+YVVFHA I S+GP+A QEYYIRH+DG TL+TE E+ RVV+CLEAAI RR S
Sbjct  294   TVCTLTDMEYVVFHATIDSEGPNAFQEYYIRHLDGYTLNTETERQRVVRCLEAAILRRAS  353

Query  718   EGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKI  539
             +G+RLEL  +DR+GLLSDVTR+ RENGL V RA V+T  +  VNVFYV D++G  VD ++
Sbjct  354   QGVRLELSTQDRIGLLSDVTRIFRENGLSVARAEVTTRDDMAVNVFYVTDANGGSVDMRV  413

Query  538   IEGLRKEIGQRMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
             +E +R+E+G   +L V +           P E+A  S   F  GS  
Sbjct  414   VEAIREEVGL-AILKVTQERFPPKMLHSSPTESADKSAARFSLGSFF  459



>ref|XP_004310107.1| PREDICTED: uncharacterized protein LOC101292961 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   478 bits (1231),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 232/407 (57%), Positives = 302/407 (74%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E++ L++R+NPPRV+VDN + +  T++KVDS NK G LLEVVQVL+DL+L
Sbjct  3     CWSPSLAVDDEFQKLALRVNPPRVTVDNGTSRKATLIKVDSANKRGSLLEVVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             I+ +AY+SSDG WFMDVFHVTDQ GNK+ D      I+++LGP+  +   L++    +VG
Sbjct  63    IVRRAYISSDGEWFMDVFHVTDQQGNKLYDDGIAECIQQSLGPRARSFRALRS----SVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDR GLLSE+ AVLA L  NVVA EVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAASEHTTIELTGRDRAGLLSEVFAVLAELKCNVVAGEVWTHNSRMASVVYITDEETGK  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP RL  I+E L N+L+A KD    A+T+VS+GSTH +RRLHQM +ADRDY+    D
Sbjct  179   PIDDPLRLSEIKEFLLNVLKADKD-MRTANTAVSVGSTHKERRLHQMMYADRDYDLHSAD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++GP
Sbjct  238   SGSASDRTKPFVTVENCADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC  DR GLLSDVTR+
Sbjct  298   EAYQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              REN L VTRA V T G Q VNVFYV  +SGNPV ++ IE +R+EIG
Sbjct  358   FRENSLSVTRAEVMTRGSQAVNVFYVTGASGNPVTSETIEAVRQEIG  404



>ref|XP_007222095.1| hypothetical protein PRUPE_ppa005632mg [Prunus persica]
 gb|EMJ23294.1| hypothetical protein PRUPE_ppa005632mg [Prunus persica]
Length=450

 Score =   478 bits (1231),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 234/408 (57%), Positives = 311/408 (76%), Gaps = 15/408 (4%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L++RINPPRV+VDN S +  T++KVDS NK G LLE+VQVL+DL+LII +AY+S
Sbjct  11    DDEFEKLAMRINPPRVTVDNTSSRKATLIKVDSANKRGSLLELVQVLNDLNLIIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTDQ GNK++D      I+++LGP+  +   L+    ++VGV +  ++T
Sbjct  71    SDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLR----RSVGVQAAAEHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSE+ AVL++L  NVV AEVWTHN R+A V+++ D+ +   +DDP  L
Sbjct  127   TIELTGRDRPGLLSEVFAVLSDLKCNVVTAEVWTHNSRMASVVFITDEATGRPIDDPDHL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDME-ADCPS  992
               I++ L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY     DM+ ADC S
Sbjct  187   SKIKKLLLYVLKGDRDKRS-ANTAVSVDSTHKERRLHQMMYADRDY-----DMDGADCGS  240

Query  991   L----KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSAS  824
                  KP V++++CV+KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++GP A 
Sbjct  241   ASDRSKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEAY  300

Query  823   QEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRE  644
             QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC +DRVGLLSDVTR+ RE
Sbjct  301   QEYYIRHTDGCPISSEGERLRVIHCLEAAIRRRTSEGIRLELCGEDRVGLLSDVTRIFRE  360

Query  643   NGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             NGL VTRA V+T G Q VNVFYV D+SGN V ++ IE +R+EIG  ++
Sbjct  361   NGLSVTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGSTIL  408



>ref|XP_008222209.1| PREDICTED: uncharacterized protein LOC103322107 [Prunus mume]
Length=524

 Score =   481 bits (1238),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 235/408 (58%), Positives = 311/408 (76%), Gaps = 15/408 (4%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L++RINPPRV+VDN S +  T++KVDS NK G LLE+VQVL+DL+LII +AY+S
Sbjct  85    DDEFEKLAMRINPPRVTVDNTSSRKATLIKVDSANKRGSLLELVQVLNDLNLIIRRAYIS  144

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTDQ GNK++D      I+++LGP+  +   L+    ++VGV +  ++T
Sbjct  145   SDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLR----RSVGVQAAAEHT  200

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSEI AVL++L  NVV AEVWTHN R+A V+++ D+ +   +DDP  L
Sbjct  201   TIELTGRDRPGLLSEIFAVLSDLKCNVVTAEVWTHNSRMASVVFITDEATGRPIDDPDHL  260

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDME-ADCPS  992
               I++ L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY     DM+ ADC S
Sbjct  261   SKIKKLLLYVLKGDRDKRS-ANTAVSVDSTHKERRLHQMMYADRDY-----DMDGADCGS  314

Query  991   L----KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSAS  824
                  KP V++++CV+KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++GP A 
Sbjct  315   ASDRSKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEAY  374

Query  823   QEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRE  644
             QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC +DRVGLLSDVTR+ RE
Sbjct  375   QEYYIRHTDGCPISSEGERLRVIHCLEAAIRRRTSEGIRLELCGEDRVGLLSDVTRIFRE  434

Query  643   NGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             NGL VTRA V+T G Q VNVFYV D+SGN V ++ IE +R+EIG  ++
Sbjct  435   NGLSVTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGSTIL  482



>ref|XP_008389912.1| PREDICTED: uncharacterized protein LOC103452175 [Malus domestica]
Length=449

 Score =   478 bits (1230),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 234/411 (57%), Positives = 307/411 (75%), Gaps = 9/411 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L++RINPP V+VDN S +  T++KVDS NK G LLEVVQVL+DL+L
Sbjct  3     CWSPSLAVDDEFEKLAMRINPPMVTVDNASGRKATLIKVDSANKRGSLLEVVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK++D      I+++LGP+  +   L+    + VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLR----RXVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVL+NL  NVVA EVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAAAEHTTIELTGRDRPGLLSEVFAVLSNLKCNVVAGEVWTHNSRMASVVYITDEETGR  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP  L  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+    D
Sbjct  179   PIDDPEHLTKIKQLLLYVLKGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDMDNAD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               A   S KP V++++CV+KGY+VV+++C DRPKL+FD VCTLTDM+YVV+HA + ++GP
Sbjct  238   SVASDRS-KPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGP  296

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC  DR GLLSDVTR+
Sbjct  297   EAYQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRI  356

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              RENGL VTRA V+T G Q VNVFYV D+SGN V ++ IE +R+EIG  ++
Sbjct  357   FRENGLSVTRAEVTTRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLALL  407



>ref|XP_003516462.1| PREDICTED: uncharacterized protein LOC100787134 isoform X1 [Glycine 
max]
Length=449

 Score =   478 bits (1230),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 238/405 (59%), Positives = 300/405 (74%), Gaps = 7/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  11    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  70

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VT Q GNKVTD   + YI K+LGP+        T P ++VGV    D
Sbjct  71    ISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCV-----TSPMRSVGVKQTTD  125

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             + AIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++V D+ S +A+ DP 
Sbjct  126   HIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITDPQ  185

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  +TH +RRLHQM FADRDYE    D + D  
Sbjct  186   RLSIIKELLCNVLGGGNKKRG-AKTVVTDEATHTERRLHQMMFADRDYERVNDDDDFD-E  243

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  244   KQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEY  303

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CL AAIQRRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  304   YIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  363

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG PVD+K IE +R+ IG  ++
Sbjct  364   TVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTIL  408



>ref|XP_006367494.1| PREDICTED: uncharacterized protein LOC102581080 isoform X2 [Solanum 
tuberosum]
Length=438

 Score =   478 bits (1229),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 314/441 (71%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  1     MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQVLTDLNLVITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI K+LGP    +  ++    ++VGV +  DY
Sbjct  61    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSSFASSMR----RSVGVTAGMDY  116

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+ +   ++DP R
Sbjct  117   TSIELIGSDRPGLLSEMSAVLTNLKCNVVNAEVWTHNTRAAAIMQVKDEETGGTINDPER  176

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L ++++ L N+LR C +    A T VS G +H +RRLHQ+ FADRDYE   G  LD +  
Sbjct  177   LSMMKQLLCNVLR-CSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVLDEKE-  234

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +PNVS+ +  +K YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A Q
Sbjct  235   ----RPNVSVVNWHDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPVAQQ  290

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  291   EYCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  350

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + VN+FYVRDSSG PVD KIIE +R+ IGQ ++     V       
Sbjct  351   SLTVTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESIRQTIGQTIL----SVKGNIAEL  406

Query  460   akVPPETAAWSKTSFFFGSLL  398
               VP E    S T F FG L 
Sbjct  407   NPVPQE----SPTRFLFGGLF  423



>ref|XP_006367493.1| PREDICTED: uncharacterized protein LOC102581080 isoform X1 [Solanum 
tuberosum]
Length=448

 Score =   478 bits (1230),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 314/441 (71%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  11    MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQVLTDLNLVITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI K+LGP    +  ++    ++VGV +  DY
Sbjct  71    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSSFASSMR----RSVGVTAGMDY  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+ +   ++DP R
Sbjct  127   TSIELIGSDRPGLLSEMSAVLTNLKCNVVNAEVWTHNTRAAAIMQVKDEETGGTINDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L ++++ L N+LR C +    A T VS G +H +RRLHQ+ FADRDYE   G  LD +  
Sbjct  187   LSMMKQLLCNVLR-CSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVLDEKE-  244

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +PNVS+ +  +K YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A Q
Sbjct  245   ----RPNVSVVNWHDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPVAQQ  300

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  301   EYCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  360

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + VN+FYVRDSSG PVD KIIE +R+ IGQ ++     V       
Sbjct  361   SLTVTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESIRQTIGQTIL----SVKGNIAEL  416

Query  460   akVPPETAAWSKTSFFFGSLL  398
               VP E    S T F FG L 
Sbjct  417   NPVPQE----SPTRFLFGGLF  433



>ref|XP_006573170.1| PREDICTED: uncharacterized protein LOC100787134 isoform X2 [Glycine 
max]
Length=452

 Score =   478 bits (1229),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 238/405 (59%), Positives = 300/405 (74%), Gaps = 7/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  14    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  73

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VT Q GNKVTD   + YI K+LGP+        T P ++VGV    D
Sbjct  74    ISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCV-----TSPMRSVGVKQTTD  128

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             + AIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++V D+ S +A+ DP 
Sbjct  129   HIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITDPQ  188

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  +TH +RRLHQM FADRDYE    D + D  
Sbjct  189   RLSIIKELLCNVLGGGNKKRG-AKTVVTDEATHTERRLHQMMFADRDYERVNDDDDFD-E  246

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  247   KQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEY  306

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CL AAIQRRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  307   YIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  366

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG PVD+K IE +R+ IG  ++
Sbjct  367   TVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTIL  411



>ref|XP_006856315.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
 gb|ERN17782.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
Length=438

 Score =   477 bits (1227),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 304/438 (69%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SC+  T+++VDS NK GILLEVVQVL+DL+L+I KAY+
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNESCEHATVIQVDSANKHGILLEVVQVLTDLNLVIKKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTD+ G K+ D  T+ YI K+LG              ++VGV    +Y
Sbjct  61    SSDGGWFMDVFNVTDRDGKKLRDEETMDYIRKSLG----ADSSFIPSQRRSVGVEPSTNY  116

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IEL G DRPGLLSE+SAVL +L  NVV+AEVWTHN R A V++V D  +   + DP R
Sbjct  117   TSIELTGTDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDDPTSAPISDPQR  176

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+   +    A T VS+G TH +RRLHQM FADRDYE    D   +   
Sbjct  177   LAKIKELLCNVLKG-NNKTRGAKTVVSLGGTHTERRLHQMMFADRDYERDGQDSVDE--G  233

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
             L+P V++  C +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA + ++ P A QEYY
Sbjct  234   LRPQVTVIDCFQKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHATVDAERPEAYQEYY  293

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DGC +++E E+ RVV+CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  294   IRHIDGCPVNSEAERQRVVQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLS  353

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             V RA VST   + VN FYVRD++GNPVD K +E +R+EIGQ ++                
Sbjct  354   VIRAEVSTRNGKAVNTFYVRDATGNPVDPKTVESVRREIGQTVL--------QVKDDPSY  405

Query  451   PPETAAWSKTSFFFGSLL  398
             P  +   + T F FG+L 
Sbjct  406   PRSSPQEAPTRFLFGNLF  423



>ref|XP_011086838.1| PREDICTED: uncharacterized protein LOC105168447 isoform X1 [Sesamum 
indicum]
Length=462

 Score =   477 bits (1228),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 321/453 (71%), Gaps = 27/453 (6%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKV-------------DSVNKPGI  1592
             CW      D E++ L IR+NPPRV+VDN S K  T++KV             DS NK G 
Sbjct  3     CWSSSLRVDDEFKKLVIRMNPPRVTVDNASDKKATLIKVLQTFVSFPDFLQVDSANKRGS  62

Query  1591  LLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYT  1412
             LLEVVQVL+DL+LII +AY+SSDG WFMDVF+VTD+ GNKV + N    I+++LGP+G++
Sbjct  63    LLEVVQVLTDLNLIIRRAYISSDGEWFMDVFYVTDEFGNKVYEDNVSERIQQSLGPRGHS  122

Query  1411  SDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRI  1232
               +L     ++VGV S  ++T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+
Sbjct  123   FRLL----ARSVGVQSASEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRM  178

Query  1231  ACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQM  1052
             A V+Y+ D+ + + ++DP RL  I++ L  +L+  ++  + A+++VS+GSTH  RRLHQM
Sbjct  179   ASVVYITDEANGSPINDPERLANIKQLLLYVLKGDREWRS-ANSAVSVGSTHTQRRLHQM  237

Query  1051  FFADRDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQ  872
              +ADRDY+   +D  A     KP V++++CVEKGY+VV++ C DRPKL+FD VCTLTDMQ
Sbjct  238   MYADRDYDVQNVD-NATTERTKPLVTVENCVEKGYTVVNLSCPDRPKLLFDTVCTLTDMQ  296

Query  871   YVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCA  692
             YVVFH  I ++GP A QEYYIRHMDGC + +E E+ RV+ CLEAAI+RR SEG+RLELC+
Sbjct  297   YVVFHGTIIAEGPEAQQEYYIRHMDGCPISSEAERQRVIHCLEAAIKRRESEGIRLELCS  356

Query  691   KDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              DRVGLLSDVTR+ RENGL VTRA V+T G Q VNVFYV D+SG+PV ++ IE +RKEIG
Sbjct  357   DDRVGLLSDVTRIFRENGLSVTRAEVTTRGTQAVNVFYVTDASGSPVKSETIEAVRKEIG  416

Query  511   QRMMLNvkkvaacacasakVPPETAAWSKTSFF  413
               ++            S+  P ET  +S  S F
Sbjct  417   LTIL-----RVKDDTYSSSPPQETGRFSLGSLF  444



>ref|XP_009343127.1| PREDICTED: uncharacterized protein LOC103935102 [Pyrus x bretschneideri]
Length=449

 Score =   476 bits (1226),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/411 (56%), Positives = 306/411 (74%), Gaps = 9/411 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L++RINPP V+VDN S    T++KVDS NK G LLEVVQ+L+DL+L
Sbjct  3     CWSPSLAVDDEFEKLAMRINPPMVTVDNASSSKATLIKVDSANKRGSLLEVVQILNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK++D      I+++LGP+  +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVL+NL  NVV  EVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAAAEHTTIELTGRDRPGLLSEVFAVLSNLKCNVVTGEVWTHNSRMASVVYITDEETGR  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP  L  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+    D
Sbjct  179   PIDDPEHLTKIKQLLLYVLKGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDMDAAD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               A   S KP V++++CV+KGY+VV+++C DRPKL+FD VCTLTDM+YVV+HA + ++GP
Sbjct  238   CGASDRS-KPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGP  296

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC  DR GLLSDVTR+
Sbjct  297   EAYQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRI  356

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              RENGL VTRA V+T G Q VNVFYV D+SGN V ++ IE +R+EIG  ++
Sbjct  357   FRENGLSVTRAEVTTRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLALL  407



>ref|XP_002514875.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF47429.1| amino acid binding protein, putative [Ricinus communis]
Length=450

 Score =   476 bits (1226),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/412 (56%), Positives = 309/412 (75%), Gaps = 18/412 (4%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN + +  T++KVDS NK G LLEVVQVL+DLDL
Sbjct  3     CWSPSVTMDDEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             +I +AY+SSDG WFMDVFHVTDQHGNK+++ +    I+++LGP+  +   L+    ++VG
Sbjct  63    LIRRAYISSDGEWFMDVFHVTDQHGNKLSEDDVAERIQQSLGPRACSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  + T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+V+ +
Sbjct  119   VQTASENTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEVTGS  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDY-----E  1028
              +++P RL  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY     E
Sbjct  179   PINEPDRLTKIKQLLLYVLKGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDIDDGE  237

Query  1027  GGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAI  848
             GG     +     KP V++++C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I
Sbjct  238   GG-----STSERRKPLVTVENCADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATI  292

Query  847   SSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLS  668
              ++GP A QEYYIRHMDG  + +E E+ RV+ CLEAAI+RR  EG+RLELC++DR+GLLS
Sbjct  293   IAEGPEAYQEYYIRHMDGSPISSEAERQRVINCLEAAIRRRNPEGIRLELCSEDRIGLLS  352

Query  667   DVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             +VTR+ RENGL VTRA V+T   Q VN FYV D+SG PV ++ IE +RKEIG
Sbjct  353   EVTRIFRENGLSVTRAEVTTRDSQAVNAFYVTDASGYPVKSETIEAVRKEIG  404



>gb|KCW61913.1| hypothetical protein EUGRSUZ_H04608 [Eucalyptus grandis]
Length=433

 Score =   476 bits (1224),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 231/407 (57%), Positives = 306/407 (75%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L +R+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+D++L
Sbjct  3     CWTSPLALDDEFEKLVLRMNPPRVAVDNASSKKATLLKVDSANKRGSLLEVVQVLTDMNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK+ + +    I+++LGP+  +   L++    +VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQKGNKLFEDDVAERIQQSLGPRIRSFRSLRS----SVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  + T IEL GRDRPGLLSE+ AVLANL  NVVAAEVWTHN R+A V+Y+ D+ S  
Sbjct  119   VQAAAENTTIELTGRDRPGLLSEVFAVLANLKCNVVAAEVWTHNSRMASVVYITDEESSL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP RL  I++ L  +L+  +D N+ A+T+V++GSTH +RRLHQ+ +ADRDY+   +D
Sbjct  179   PIDDPDRLAKIKQLLLFVLKGDRDKNS-ANTAVTVGSTHTERRLHQLMYADRDYDMDGVD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     K +V++D+C++KGY+VV+++C+DRPKL+FD VCTLTDM YVV+H  + ++GP
Sbjct  238   GGSAGEQSKLSVTVDNCMDKGYTVVNLRCQDRPKLIFDTVCTLTDMDYVVYHGTVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRHMDG  + +E E+ RV+ CL AAI+RR SEG++LELC  DRVGLLSD TR+
Sbjct  298   EAYQEYYIRHMDGSPISSEAERQRVIHCLGAAIKRRTSEGIKLELCCPDRVGLLSDATRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VN FYV DSSGNPV ++IIE +RK+IG
Sbjct  358   FRENGLSVTRAEVTTRGSQAVNTFYVTDSSGNPVKSEIIESVRKQIG  404



>gb|KHN29949.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=452

 Score =   476 bits (1225),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 236/405 (58%), Positives = 300/405 (74%), Gaps = 7/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  14    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  73

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VT Q GNKVTD   + YI K+LGP+        T P ++VGV    D
Sbjct  74    ISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCV-----TSPMRSVGVKQTMD  128

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL+G DRPGLLSE+SAVL NL  N++ AEVWTHN R A V++V D+ S +A+ DP 
Sbjct  129   HTAIELMGTDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVMHVTDEESGSAITDPQ  188

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  +TH +RRLHQM FADRDYE    D +    
Sbjct  189   RLSIIKELLCNVLGGGNKKRG-AKTVVTDEATHTERRLHQMMFADRDYER-VNDDDDFAE  246

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  247   KQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEY  306

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CL AAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  307   YIKHIDGSPVKSDAERQRVIQCLAAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  366

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG PVD+K IE +R+ IG  ++
Sbjct  367   TVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTIL  411



>ref|XP_010025287.1| PREDICTED: uncharacterized protein LOC104415658 [Eucalyptus grandis]
 gb|KCW61914.1| hypothetical protein EUGRSUZ_H04608 [Eucalyptus grandis]
Length=454

 Score =   476 bits (1225),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 231/407 (57%), Positives = 306/407 (75%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L +R+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+D++L
Sbjct  3     CWTSPLALDDEFEKLVLRMNPPRVAVDNASSKKATLLKVDSANKRGSLLEVVQVLTDMNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK+ + +    I+++LGP+  +   L++    +VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQKGNKLFEDDVAERIQQSLGPRIRSFRSLRS----SVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  + T IEL GRDRPGLLSE+ AVLANL  NVVAAEVWTHN R+A V+Y+ D+ S  
Sbjct  119   VQAAAENTTIELTGRDRPGLLSEVFAVLANLKCNVVAAEVWTHNSRMASVVYITDEESSL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP RL  I++ L  +L+  +D N+ A+T+V++GSTH +RRLHQ+ +ADRDY+   +D
Sbjct  179   PIDDPDRLAKIKQLLLFVLKGDRDKNS-ANTAVTVGSTHTERRLHQLMYADRDYDMDGVD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     K +V++D+C++KGY+VV+++C+DRPKL+FD VCTLTDM YVV+H  + ++GP
Sbjct  238   GGSAGEQSKLSVTVDNCMDKGYTVVNLRCQDRPKLIFDTVCTLTDMDYVVYHGTVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRHMDG  + +E E+ RV+ CL AAI+RR SEG++LELC  DRVGLLSD TR+
Sbjct  298   EAYQEYYIRHMDGSPISSEAERQRVIHCLGAAIKRRTSEGIKLELCCPDRVGLLSDATRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VN FYV DSSGNPV ++IIE +RK+IG
Sbjct  358   FRENGLSVTRAEVTTRGSQAVNTFYVTDSSGNPVKSEIIESVRKQIG  404



>ref|XP_003518790.2| PREDICTED: uncharacterized protein LOC100813551 isoform 1 [Glycine 
max]
Length=452

 Score =   476 bits (1224),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 300/405 (74%), Gaps = 7/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  14    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  73

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VT Q GNKVTD   + YI K+LGP+        T P ++VGV    D
Sbjct  74    ISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCV-----TSPMRSVGVKQTMD  128

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL+G DRPGLLSE+SAVL NL  N++ AEVWTHN R A V++V D+ + +A+ DP 
Sbjct  129   HTAIELMGTDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVMHVTDEETGSAISDPQ  188

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  +TH +RRLHQM FADRDYE    D +    
Sbjct  189   RLSIIKELLCNVLGGGNKKRG-AKTVVTDEATHTERRLHQMMFADRDYER-VNDDDDFAE  246

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  247   KQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEY  306

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CL AAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  307   YIKHIDGSPVKSDAERQRVIQCLAAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  366

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG PVD+K IE +R+ IG  ++
Sbjct  367   TVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTIL  411



>gb|KHN02615.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=438

 Score =   474 bits (1221),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 237/404 (59%), Positives = 299/404 (74%), Gaps = 7/404 (2%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY+
Sbjct  1     MDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT Q GNKVTD   + YI K+LGP+        T P ++VGV    D+
Sbjct  61    SSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCV-----TSPMRSVGVKQTTDH  115

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
              AIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++V D+ S +A+ DP R
Sbjct  116   IAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITDPQR  175

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +I+E L N+L         A T V+  +TH +RRLHQM FADRDYE    D + D   
Sbjct  176   LSIIKELLCNVLGGGNKKRG-AKTVVTDEATHTERRLHQMMFADRDYERVNDDDDFD-EK  233

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEYY
Sbjct  234   QRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEYY  293

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             I+H+DG  + ++ E+ RV++CL AAIQRRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  294   IKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  353

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             VTRA V+T G + VN FYVR +SG PVD+K IE +R+ IG  ++
Sbjct  354   VTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTIL  397



>ref|XP_004490253.1| PREDICTED: uncharacterized protein LOC101508719 isoform X4 [Cicer 
arietinum]
Length=450

 Score =   474 bits (1221),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 302/405 (75%), Gaps = 8/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  15    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  74

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LGP+          PG++VGV    D
Sbjct  75    ISSDGGWFMDVFNVTDQDGNKVTDEAILDYIRKSLGPES-----CFPSPGRSVGVKQTMD  129

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++VND+ + +A+ DP 
Sbjct  130   HTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVNDEETGSAITDPQ  189

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  STH DRRLHQM FADRDYE   +D +    
Sbjct  190   RLSLIKELLCNVLGGGNRKRG-AKTVVTDDSTHTDRRLHQMMFADRDYER--VDDDDFDE  246

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  247   KQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEY  306

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LE+C  DRVGLLS+VTR+ REN L
Sbjct  307   YIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFRENSL  366

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG  VD+K IE +R+ IG  ++
Sbjct  367   TVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTIL  411



>ref|XP_004490255.1| PREDICTED: uncharacterized protein LOC101508719 isoform X6 [Cicer 
arietinum]
Length=442

 Score =   474 bits (1220),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 302/405 (75%), Gaps = 8/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  7     YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  66

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LGP+          PG++VGV    D
Sbjct  67    ISSDGGWFMDVFNVTDQDGNKVTDEAILDYIRKSLGPES-----CFPSPGRSVGVKQTMD  121

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++VND+ + +A+ DP 
Sbjct  122   HTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVNDEETGSAITDPQ  181

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  STH DRRLHQM FADRDYE   +D +    
Sbjct  182   RLSLIKELLCNVLGGGNRKRG-AKTVVTDDSTHTDRRLHQMMFADRDYER--VDDDDFDE  238

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  239   KQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEY  298

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LE+C  DRVGLLS+VTR+ REN L
Sbjct  299   YIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFRENSL  358

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG  VD+K IE +R+ IG  ++
Sbjct  359   TVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTIL  403



>ref|XP_004490254.1| PREDICTED: uncharacterized protein LOC101508719 isoform X5 [Cicer 
arietinum]
Length=450

 Score =   474 bits (1220),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 302/405 (75%), Gaps = 8/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  15    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  74

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LGP+          PG++VGV    D
Sbjct  75    ISSDGGWFMDVFNVTDQDGNKVTDEAILDYIRKSLGPES-----CFPSPGRSVGVKQTMD  129

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++VND+ + +A+ DP 
Sbjct  130   HTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVNDEETGSAITDPQ  189

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +I+E L N+L         A T V+  STH DRRLHQM FADRDYE   +D +    
Sbjct  190   RLSLIKELLCNVLGGGNRKRG-AKTVVTDDSTHTDRRLHQMMFADRDYER--VDDDDFDE  246

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY
Sbjct  247   KQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEY  306

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LE+C  DRVGLLS+VTR+ REN L
Sbjct  307   YIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFRENSL  366

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA V+T G + VN FYVR +SG  VD+K IE +R+ IG  ++
Sbjct  367   TVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTIL  411



>ref|XP_008389382.1| PREDICTED: uncharacterized protein LOC103451737 [Malus domestica]
 ref|XP_008350884.1| PREDICTED: uncharacterized protein LOC103414267 [Malus domestica]
Length=447

 Score =   474 bits (1219),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 305/438 (70%), Gaps = 16/438 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DLDLI+TKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLDLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LGP+   +  +++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEEVLEYIHKSLGPEACFASSMRS-----VGVKQSMDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL NL  NVV+AEVWTHN R A V+ V D+ +  A+ D  R
Sbjct  126   TVIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMRVTDEETGLAITDSQR  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+        A T VS   TH DRRLHQM FADRDYE    D+  D   
Sbjct  186   LARIKELLCNVLKGSNKARG-ARTVVSHAVTHTDRRLHQMMFADRDYERVDDDVLDD--K  242

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +P+VS+ + ++K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA+I ++GP A QEYY
Sbjct  243   QRPDVSVVNLLDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQEYY  302

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSE L+LELC  DRVGLLSDVTR+ REN L 
Sbjct  303   IRHVDGSPVKSDAERQRVIQCLEAAIERRVSEDLKLELCTTDRVGLLSDVTRIFRENSLT  362

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN FYVRD+SG PVD+K IE +R+ IGQ ++            S + 
Sbjct  363   VTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQAIGQTILKVKGNTEDTKPGSEES  422

Query  451   PPETAAWSKTSFFFGSLL  398
             P        T F FG L 
Sbjct  423   P--------TRFLFGGLF  432



>gb|KDP26845.1| hypothetical protein JCGZ_18003 [Jatropha curcas]
Length=449

 Score =   474 bits (1219),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/407 (57%), Positives = 304/407 (75%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN+S +  T++KVDS NK G LLEVVQVL+DLDL
Sbjct  3     CWSPSVAMDDEFEKLVIRMNPPRVTVDNVSSRKATLIKVDSANKRGSLLEVVQVLTDLDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK+++ +    I+++LGP+  +   L+    +++G
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQQGNKLSEDDVAERIQQSLGPRACSFRSLR----RSIG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  + T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAATENTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +D+P RL  I++ L  +L   +D  + A+T+VS+GSTH +RRLHQM +ADRDY+    +
Sbjct  179   PIDNPERLTKIKQLLLYVLMGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDMEDTE  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
                     KP V++++C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I ++GP
Sbjct  238   CGTSNERRKPLVTVENCTDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRHMDG  + +E E+ RV+ CLEAAI+RR  EG+RLELC++DRVGLLS+VTR+
Sbjct  298   EAYQEYYIRHMDGSPVSSEAERQRVINCLEAAIRRRTPEGIRLELCSEDRVGLLSEVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VNVFYV D+SG  V ++ IE +RKEIG
Sbjct  358   FRENGLSVTRAEVTTRGSQAVNVFYVTDASGYSVKSETIEAVRKEIG  404



>ref|XP_006844620.1| hypothetical protein AMTR_s00016p00225040 [Amborella trichopoda]
 gb|ERN06295.1| hypothetical protein AMTR_s00016p00225040 [Amborella trichopoda]
Length=452

 Score =   474 bits (1219),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 239/411 (58%), Positives = 302/411 (73%), Gaps = 12/411 (3%)
 Frame = -1

Query  1723  CWPY---FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW Y    D EYE L IR+NPPRV+VDN SC + T+VKVDS N  G+LLEVVQVL+DL++
Sbjct  3     CWLYSRNVDDEYEKLVIRMNPPRVTVDNTSCPNATLVKVDSANMHGVLLEVVQVLTDLNI  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
                +AY+SSDGGWFMDVFHVTD++GNK+ D   I  I+++LG K  TS    +   ++VG
Sbjct  63    RFNRAYISSDGGWFMDVFHVTDRYGNKLCDEEVINKIQQSLGAK--TSSF--SSQRRSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V    ++T+IEL GRDRPGLLSEI AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ S +
Sbjct  119   VQPSPEHTSIELTGRDRPGLLSEIFAVLADLKCNVVAAEVWTHNSRMASVVYITDECSGS  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEG---G  1022
              +DDP RL  I+E L NILR  +D    A T VSMG TH +RRLHQM FADRDYE     
Sbjct  179   PIDDPQRLSRIKELLSNILRGDRDKRG-AKTVVSMGLTHTERRLHQMMFADRDYERVERD  237

Query  1021  CLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISS  842
              L+ E D  SL+P+V++  C E+ YSVV+++ KDRPKL+FD VCTLTDMQYVV+H  + +
Sbjct  238   GLEREED-KSLRPDVTLLDCFERDYSVVTMRSKDRPKLLFDTVCTLTDMQYVVYHGTVQT  296

Query  841   DGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDV  662
                 A QEYYIRH+DG  + +E EK RV++CLEAAI+RR SEGL LELC +DRVGLLSDV
Sbjct  297   GRREAYQEYYIRHVDGLPVSSEAEKQRVIQCLEAAIERRASEGLELELCTEDRVGLLSDV  356

Query  661   TRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQ  509
             TR+ REN L +TRA ++T   + ++ FY+ D SGNPVD K I+ +R+EIGQ
Sbjct  357   TRIFRENSLTITRAEITTKSGKAIDTFYLTDVSGNPVDPKTIDAIRQEIGQ  407



>ref|XP_002314917.2| hypothetical protein POPTR_0010s14840g [Populus trichocarpa]
 gb|EEF01088.2| hypothetical protein POPTR_0010s14840g [Populus trichocarpa]
Length=447

 Score =   473 bits (1216),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 307/442 (69%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  11    MDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDGGWFMDVF+VTD  GNKVTD   + YI K+LGP+  +TS +      ++VGV    D
Sbjct  71    SSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFTSSM------RSVGVKQSMD  124

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ + +A+ DP 
Sbjct  125   HTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSAIIDPE  184

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             +L  I+E L N+L+        A T VS G TH +RRLHQM FADRDYE    D E D  
Sbjct  185   KLSRIKELLCNVLKGSNKSRG-AKTVVSHGVTHTERRLHQMMFADRDYERANND-ELD-E  241

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  EK YSVV++  KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  242   KQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEY  301

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + +E E+ R+++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  302   YIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  361

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T   + VN FYV D+SG PVD K I+ +R+ IGQ ++               
Sbjct  362   TVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTIL-----------KVKS  410

Query  454   VPPETAAWSK---TSFFFGSLL  398
              P E    S+   T F FG L 
Sbjct  411   SPEEQKPVSQESPTRFLFGGLF  432



>emb|CDP13377.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   473 bits (1216),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 302/399 (76%), Gaps = 5/399 (1%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L++RINPP V+VDN S K  T++KVDS N+ G LLEVVQVL+DL+LII +AY+S
Sbjct  11    DDEFEKLALRINPPMVTVDNESDKKATLIKVDSANRRGSLLEVVQVLTDLNLIIKRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTDQ GNK+++      I+++LGP+G +    +     +VGV    ++ 
Sbjct  71    SDGEWFMDVFHVTDQDGNKLSEDKVAERIQQSLGPRGRSFRSFRR----SVGVQPALEHA  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+V+  A+DDP RL
Sbjct  127   TIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEVNGVAIDDPERL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
               I++ L ++L+  KD  + A+T+VS+GSTH +RRLHQM +ADRDY+   +D        
Sbjct  187   SKIKQLLLHVLKGNKDRRS-ANTAVSVGSTHKERRLHQMMYADRDYDNDVMDCAPTSDRT  245

Query  988   KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI  809
             KP V+++ C +KGY+VV++ C DRPKL+FD VCTLTDMQYVV+H  I ++GP A QEYYI
Sbjct  246   KPLVTVEKCADKGYTVVNLSCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEGPEAHQEYYI  305

Query  808   RHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLV  629
             RH+DG  + +E E+ R++ CLEAAI+RR SEG+RLELC++DRVGLLSDVTR+ RENGL V
Sbjct  306   RHIDGWPISSEAERQRLIHCLEAAIKRRTSEGIRLELCSEDRVGLLSDVTRIFRENGLSV  365

Query  628   TRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             TRA V+T G Q VNVFYV D+SG PV  + IE +RKEIG
Sbjct  366   TRAEVTTRGSQAVNVFYVTDASGYPVKNETIEAVRKEIG  404



>ref|XP_007043903.1| ACT domain repeat 4 isoform 1 [Theobroma cacao]
 gb|EOX99734.1| ACT domain repeat 4 isoform 1 [Theobroma cacao]
Length=473

 Score =   473 bits (1218),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 233/430 (54%), Positives = 308/430 (72%), Gaps = 31/430 (7%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN + +  T++KVDS NK G LLEVVQVL+DLDL
Sbjct  3     CWSPSLTLDEEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEK---------------------  1436
             II +AY+SSDG WFMDVFHVTDQ+GNK+++ +    I++                     
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQYGNKLSEVDVAERIQQKPKSSLHQFLLEWESSVLLVA  122

Query  1435  --ALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVA  1262
                LGP+ Y+   L     ++VGV +   +T IEL GRDRPGLLSE+ AVL +L  NVVA
Sbjct  123   RAQLGPRAYSFRSLT----RSVGVQAASKHTTIELTGRDRPGLLSEVFAVLTDLKCNVVA  178

Query  1261  AEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGS  1082
             AEVWTHN R+A V+Y+ D+ + +++D+P RL  I++ L  +L+  +D    A+T+VS+GS
Sbjct  179   AEVWTHNSRMASVVYITDEATGSSIDNPERLTKIKQLLLYVLKGDRDQMR-ANTAVSVGS  237

Query  1081  THIDRRLHQMFFADRDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMF  902
             TH +RRLHQM +ADRDY+    D  +     KP V++++C +KGY+VV+++C DRPKL+F
Sbjct  238   THTERRLHQMMYADRDYDMNDADSGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLF  297

Query  901   DIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRV  722
             D VCTLTDMQYVV+HA + +DGP A QEYYIRHMDGC + +E E+ RV+ CLEAAI+RR 
Sbjct  298   DTVCTLTDMQYVVYHATVIADGPEAYQEYYIRHMDGCPVSSEPERQRVINCLEAAIKRRA  357

Query  721   SEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTK  542
             SEG+RLELC++DRVGLLSDVTR+ RENGL VTRA V+T G Q VN F V D+SG+PV ++
Sbjct  358   SEGIRLELCSEDRVGLLSDVTRIFRENGLSVTRAEVTTRGSQAVNAFCVTDASGDPVKSE  417

Query  541   IIEGLRKEIG  512
              IE +RKE+G
Sbjct  418   TIEAVRKELG  427



>ref|XP_008459880.1| PREDICTED: uncharacterized protein LOC103498865 isoform X2 [Cucumis 
melo]
Length=451

 Score =   472 bits (1214),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/407 (57%), Positives = 311/407 (76%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWPY---FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L  R+NPPRV++DN S +  T++KVDS NK G LLEVVQVL+DL+L
Sbjct  3     CWSLSLPLDDEFEKLVNRMNPPRVTIDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQHGNK+++ +    I+++LGP+  +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQHGNKLSENDVAERIQQSLGPRARSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAAEEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGF  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
             ++ DP RL  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+   LD
Sbjct  179   SISDPDRLGKIKQLLLFVLKGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDQDDLD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++C +KGY+VV+++  DRPKL+FD VCTLTDMQYVV+HA + ++GP
Sbjct  238   CGSTSERRKPLVTVENCADKGYTVVNLRSPDRPKLLFDTVCTLTDMQYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              ASQEYYIRHMDG  + +E E+ RV+ CLEAAI+RR SEG+RLELC++DR GLLSDVTR+
Sbjct  298   EASQEYYIRHMDGSPISSEAERQRVIHCLEAAIRRRTSEGIRLELCSEDRAGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VNVFYV D+SGNPV +++IE +RKEIG
Sbjct  358   FRENGLSVTRAEVTTRGTQAVNVFYVTDASGNPVKSEMIEAVRKEIG  404



>ref|XP_011102236.1| PREDICTED: uncharacterized protein LOC105180260 isoform X1 [Sesamum 
indicum]
 ref|XP_011102238.1| PREDICTED: uncharacterized protein LOC105180260 isoform X1 [Sesamum 
indicum]
Length=448

 Score =   471 bits (1213),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/438 (56%), Positives = 314/438 (72%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNESCKNATVIQVDSANKQGILLEVVQVLTDLNLMITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF+VTD  GNK+TD   + YI+K+LGP    +  ++    ++VGV S  D+
Sbjct  71    CSDGGWFMDVFNVTDHDGNKITDEGILDYIQKSLGPDSCFASSMR----RSVGVTSGMDH  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ +  A+ DP R
Sbjct  127   TSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDEENGGAITDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +++  L N+L+        A T VS+G+TH +RRLHQM F DRDYE    D  AD   
Sbjct  187   LAMVKRLLCNVLKGSNKSRE-AKTVVSVGATHTERRLHQMMFDDRDYERMGND-SAD-EK  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FDIVCTLTDMQYVVFH  + ++GP A QEY 
Sbjct  244   ERPNVNVVNWHDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVDAEGPEAYQEYC  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAIQRRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  304   IRHIDGSPVKSDAERQRVIQCLEAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFRENSLT  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN FYVRD+SG PVD KII+ +R+ IGQ ++    +V      S +V
Sbjct  364   VTRAEVATRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTIL----RVKGSPEESNQV  419

Query  451   PPETAAWSKTSFFFGSLL  398
             P E    S T F FG L 
Sbjct  420   PQE----SPTRFLFGGLF  433



>ref|XP_010250636.1| PREDICTED: uncharacterized protein LOC104592829 [Nelumbo nucifera]
Length=450

 Score =   471 bits (1213),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 301/403 (75%), Gaps = 5/403 (1%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L IR+NPPRV+VDN + +  T++KVDS NK G LLEVVQVL+D++L I +AY+S
Sbjct  11    DDEFEKLLIRMNPPRVTVDNTTSRKATLIKVDSANKHGSLLEVVQVLTDMNLTIIRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHV DQ GNK+ D   I  I+++LG +  +   L+    ++VGV +  ++T
Sbjct  71    SDGEWFMDVFHVVDQDGNKLFDEKVIDRIQQSLGSRAQSLRSLR----RSVGVQAAAEHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSEI AVL +L  NVVAAEVWTHN R+A V+Y+ D+ + + +DDP RL
Sbjct  127   TIELTGRDRPGLLSEIFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGSPIDDPDRL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
               I++ L  +L+  +D    A+T+VS+G+TH +RRLHQM +ADRDY+   +         
Sbjct  187   ARIKQLLLYVLKGDRD-MRTANTAVSVGTTHTERRLHQMMYADRDYDREDMGNSPAIDRS  245

Query  988   KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI  809
             KP V++++C +KGY+VV+++C+DRPKL+FDIVCTLTDMQYVVFH  + ++G  A QEYYI
Sbjct  246   KPCVTVENCADKGYTVVNLRCRDRPKLLFDIVCTLTDMQYVVFHGTVGTEGLEAYQEYYI  305

Query  808   RHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLV  629
             RH DG  + +E E+ R+V CLEAA+QRR +EG+RLELC +DR+GLLSDVTR+ RENGL V
Sbjct  306   RHKDGYPIRSEAERQRLVHCLEAAVQRRSTEGIRLELCIEDRIGLLSDVTRIFRENGLSV  365

Query  628   TRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             TRA V+T G Q VN FYV DSSGNPV ++ IE +R EIGQ ++
Sbjct  366   TRAEVTTRGSQAVNSFYVTDSSGNPVKSETIESVRSEIGQTVL  408



>ref|XP_010260920.1| PREDICTED: uncharacterized protein LOC104599871 [Nelumbo nucifera]
Length=448

 Score =   471 bits (1213),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 308/438 (70%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  11    MDDEYEKFVRRMNPPRVVIDNETCKNATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTD+ GNK+ D   + YI K+LG        L    G+NVGV    ++
Sbjct  71    SSDGGWFMDVFNVTDREGNKLKDEGILEYIRKSLGADSSFVPTL----GRNVGVEQSTNH  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IEL G DRPGLLSE+ AVL  L  NVV AEVWTHN R A V++V D+ + +A+ DP  
Sbjct  127   TSIELTGTDRPGLLSEVCAVLTGLKCNVVNAEVWTHNTRAAAVMHVTDEETGSAITDPES  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L N+L+   +    A T+VS+G TH +RRLHQM FADRDYE   LD  A    
Sbjct  187   LSKIKALLCNVLKG-NNKTRGAKTAVSLGVTHTERRLHQMMFADRDYER--LDDHAFDEK  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA + ++ P A QE+Y
Sbjct  244   QRPNVTVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEQPEAYQEFY  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ RENGL 
Sbjct  304   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENGLA  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + +N FYVRD++GNPVD K I+ +R+ IGQ ++             ++ 
Sbjct  364   VTRAEVTTRAGKAINTFYVRDAAGNPVDAKTIDSIRQVIGQTIL--------QVRGCSEN  415

Query  451   PPETAAWSKTSFFFGSLL  398
                ++  S T F FG L 
Sbjct  416   TKSSSQESPTRFLFGGLF  433



>ref|XP_010091626.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB44892.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=443

 Score =   471 bits (1212),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 312/442 (71%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQVL+DL+LIITKAY+
Sbjct  7     MDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEHGILLEVVQVLTDLNLIITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDG WFMDVF+VTDQ GNKVTD   + YI+K+LGP+  + S +      ++VGV    D
Sbjct  67    SSDGCWFMDVFNVTDQDGNKVTDEGVLDYIQKSLGPESCFMSSM------RSVGVTPSMD  120

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL G DRPGLLSE+ AVL +L  NVV+AEVWTHN R A +++V D+ + +A+ DP 
Sbjct  121   HTAIELTGSDRPGLLSEVCAVLTHLKCNVVSAEVWTHNTRAASIMHVTDEETGSAISDPE  180

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL  I+E L N+L+        A T VS   TH +RRLHQM FADRDYE   LD +A   
Sbjct  181   RLSRIKELLCNVLKGSNKSRG-AKTVVSHEVTHTERRLHQMMFADRDYER--LDDDALDE  237

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  +K YSVV+++ KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  238   RQRPNVSVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMKYVVFHANIDAEGPEAYQEY  297

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  + +E E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  298   YIRHVDGSPVKSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  357

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T G + +N FYV D+SG PVD+K I+ +R+ IGQ ++               
Sbjct  358   TVTRAEVTTKGGKAMNTFYVSDASGYPVDSKTIDSIRQAIGQTIL-----------KVKG  406

Query  454   VPPETAAWSK---TSFFFGSLL  398
              P E  + S+   T F FG L 
Sbjct  407   SPEELKSGSQESPTRFLFGGLF  428



>ref|XP_011102239.1| PREDICTED: uncharacterized protein LOC105180260 isoform X2 [Sesamum 
indicum]
 ref|XP_011102240.1| PREDICTED: uncharacterized protein LOC105180260 isoform X2 [Sesamum 
indicum]
Length=438

 Score =   471 bits (1211),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/438 (56%), Positives = 314/438 (72%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNESCKNATVIQVDSANKQGILLEVVQVLTDLNLMITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF+VTD  GNK+TD   + YI+K+LGP    +  ++    ++VGV S  D+
Sbjct  61    CSDGGWFMDVFNVTDHDGNKITDEGILDYIQKSLGPDSCFASSMR----RSVGVTSGMDH  116

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ +  A+ DP R
Sbjct  117   TSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDEENGGAITDPER  176

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +++  L N+L+        A T VS+G+TH +RRLHQM F DRDYE    D  AD   
Sbjct  177   LAMVKRLLCNVLKGSNKSRE-AKTVVSVGATHTERRLHQMMFDDRDYERMGND-SAD-EK  233

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FDIVCTLTDMQYVVFH  + ++GP A QEY 
Sbjct  234   ERPNVNVVNWHDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVDAEGPEAYQEYC  293

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAIQRRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  294   IRHIDGSPVKSDAERQRVIQCLEAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFRENSLT  353

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN FYVRD+SG PVD KII+ +R+ IGQ ++    +V      S +V
Sbjct  354   VTRAEVATRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTIL----RVKGSPEESNQV  409

Query  451   PPETAAWSKTSFFFGSLL  398
             P E    S T F FG L 
Sbjct  410   PQE----SPTRFLFGGLF  423



>ref|XP_010929567.1| PREDICTED: uncharacterized protein LOC105051015 isoform X2 [Elaeis 
guineensis]
Length=450

 Score =   471 bits (1212),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 234/405 (58%), Positives = 303/405 (75%), Gaps = 8/405 (2%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY  L IR+NPPRV+VDN S K  T+VKVDS N+ G LLEVVQ ++DL+L I +AYVS
Sbjct  10    DDEYGKLVIRMNPPRVTVDNTSSKKATLVKVDSSNRHGSLLEVVQAITDLNLTIRRAYVS  69

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHV DQ GNK+ D   I  I+++LG K +    L+    ++VGV + G +T
Sbjct  70    SDGEWFMDVFHVVDQDGNKLHDSEVIDRIQQSLGAKAFDLWSLR----RSVGVQASGVHT  125

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IELIGR+RPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ +   +DD  RL
Sbjct  126   TIELIGRNRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGGPIDDADRL  185

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS-  992
               I++ L+ +L+  +D  + A+T++S+G TH +RRLHQM +ADRDY+ G  D E + PS 
Sbjct  186   SKIKQLLRYVLKGNRDKRS-ANTAISLGVTHTERRLHQMMYADRDYDRGDAD-EEESPSD  243

Query  991   -LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               K  V++++C +KGYSVV+V+CKDRPKL+FD VCTLTDMQYVVFHA + ++GP A QEY
Sbjct  244   RRKLQVTVENCTDKGYSVVNVRCKDRPKLLFDTVCTLTDMQYVVFHATLIAEGPEAYQEY  303

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH DG  + +E E+ R++ CLEAAI+RR +EG+RLELC  DRVGLLSDVTR+ RENGL
Sbjct  304   YIRHSDGLPISSEAERQRLILCLEAAIKRRNTEGVRLELCCDDRVGLLSDVTRIFRENGL  363

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VT A VST G Q VNVFYV D+SGNPV ++ IE +R EIG+ ++
Sbjct  364   TVTCAEVSTRGSQAVNVFYVMDASGNPVQSRTIEAIRNEIGEAIL  408



>ref|XP_010066810.1| PREDICTED: uncharacterized protein LOC104453874 isoform X2 [Eucalyptus 
grandis]
Length=442

 Score =   471 bits (1211),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 305/440 (69%), Gaps = 17/440 (4%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             P  D EYE L  R+NPPRV +DN +CK+ T+++VDS N+PGILLEVVQVL+DL+LIITKA
Sbjct  5     PNMDDEYEKLIRRMNPPRVVIDNETCKNATVIQVDSANRPGILLEVVQVLTDLNLIITKA  64

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLG  1358
             Y+SSDGGWFMDVF+VTDQ GNK+ +   + YI+K LGP     D   T   ++VGV    
Sbjct  65    YISSDGGWFMDVFNVTDQDGNKIMNDEILDYIKKVLGP-----DSCFTSSLRSVGVKPSD  119

Query  1357  DYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDP  1178
             D+TAIEL G DRPGLLSE+SAVL +L  NVV+AEVWTHN R A V++V D+ + +AV DP
Sbjct  120   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDEETGSAVTDP  179

Query  1177  SRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC  998
              RL  I E L N+L+        A T VS G T   RRLHQM FADRDYE    DM  + 
Sbjct  180   ERLTRIRELLCNVLKGSNKSRG-AKTVVSHGVTLTTRRLHQMMFADRDYERTDDDMLDE-  237

Query  997   PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +PNV + +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QE
Sbjct  238   -KQRPNVEVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQE  296

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YYIRH DG  ++++ E++R++ CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  297   YYIRHQDGSPVNSDAERERLMHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  356

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA VST   + VN FYVRD+SG PVD K I+ +R+ IGQ ++              
Sbjct  357   LTVTRAEVSTKDGKAVNTFYVRDASGYPVDPKTIDSIRETIGQTIL---------HVKGN  407

Query  457   kVPPETAAWSKTSFFFGSLL  398
                 + A  S + F FG L 
Sbjct  408   SGESKPAQESPSRFLFGGLF  427



>ref|XP_007161398.1| hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris]
 ref|XP_007161400.1| hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris]
 gb|ESW33392.1| hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris]
 gb|ESW33394.1| hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris]
Length=310

 Score =   465 bits (1197),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 218/309 (71%), Positives = 255/309 (83%), Gaps = 1/309 (0%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             MA+ CWPYFDPEYE  S RINPPRVSVDN SC DCT++K DS+NKPGILLEVVQ+L+DLD
Sbjct  1     MAKVCWPYFDPEYENFSNRINPPRVSVDNDSCHDCTLIKFDSINKPGILLEVVQILTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
              IITKAY+SSDGGWFMDVFHVTDQ G K+TD  TI +IEKALGPKG +++ +++  GK V
Sbjct  61    FIITKAYISSDGGWFMDVFHVTDQQGKKITDSKTIDFIEKALGPKGQSTEGVRSWQGKRV  120

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV+S+GD+TAIELIGRDRPGLLSEISAVLA+L FNV+AAEVWTHN+RIACVLYVND  + 
Sbjct  121   GVHSIGDHTAIELIGRDRPGLLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATN-  179

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              A+D+  RL ++EEQL +ILR C+DD  +A TS SMG TH+DRRLHQM FADRDYE   +
Sbjct  180   EAMDESKRLSIMEEQLNHILRGCEDDEKVARTSFSMGFTHMDRRLHQMLFADRDYESAGV  239

Query  1015  DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
                   PS +P + I+  VEKGYSVVSV+CKDR KLMFDIVCTLTDMQYVVFHA ISS+G
Sbjct  240   TTTDCAPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLTDMQYVVFHATISSEG  299

Query  835   PSASQEYYI  809
               ASQ + I
Sbjct  300   QYASQVHII  308


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 19/163 (12%)
 Frame = -1

Query  985  PNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIR  806
            P VS+D+      +++     ++P ++ ++V  LTD+ +++  A ISSDG      +++ 
Sbjct  23   PRVSVDNDSCHDCTLIKFDSINKPGILLEVVQILTDLDFIITKAYISSDGGWFMDVFHVT  82

Query  805  HMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLR-----------------LELCAKDRVG  677
               G  +      D + K L    Q   +EG+R                 +EL  +DR G
Sbjct  83   DQQGKKITDSKTIDFIEKALGPKGQS--TEGVRSWQGKRVGVHSIGDHTAIELIGRDRPG  140

Query  676  LLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVD  548
            LLS+++ VL      V  A V T   +   V YV D++   +D
Sbjct  141  LLSEISAVLASLQFNVIAAEVWTHNRRIACVLYVNDATNEAMD  183



>ref|XP_010066809.1| PREDICTED: uncharacterized protein LOC104453874 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64855.1| hypothetical protein EUGRSUZ_G02423 [Eucalyptus grandis]
Length=446

 Score =   471 bits (1211),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 305/440 (69%), Gaps = 17/440 (4%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             P  D EYE L  R+NPPRV +DN +CK+ T+++VDS N+PGILLEVVQVL+DL+LIITKA
Sbjct  9     PNMDDEYEKLIRRMNPPRVVIDNETCKNATVIQVDSANRPGILLEVVQVLTDLNLIITKA  68

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLG  1358
             Y+SSDGGWFMDVF+VTDQ GNK+ +   + YI+K LGP     D   T   ++VGV    
Sbjct  69    YISSDGGWFMDVFNVTDQDGNKIMNDEILDYIKKVLGP-----DSCFTSSLRSVGVKPSD  123

Query  1357  DYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDP  1178
             D+TAIEL G DRPGLLSE+SAVL +L  NVV+AEVWTHN R A V++V D+ + +AV DP
Sbjct  124   DHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDEETGSAVTDP  183

Query  1177  SRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC  998
              RL  I E L N+L+        A T VS G T   RRLHQM FADRDYE    DM  + 
Sbjct  184   ERLTRIRELLCNVLKGSNKSRG-AKTVVSHGVTLTTRRLHQMMFADRDYERTDDDMLDE-  241

Query  997   PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +PNV + +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QE
Sbjct  242   -KQRPNVEVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQE  300

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YYIRH DG  ++++ E++R++ CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  301   YYIRHQDGSPVNSDAERERLMHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  360

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA VST   + VN FYVRD+SG PVD K I+ +R+ IGQ ++              
Sbjct  361   LTVTRAEVSTKDGKAVNTFYVRDASGYPVDPKTIDSIRETIGQTIL---------HVKGN  411

Query  457   kVPPETAAWSKTSFFFGSLL  398
                 + A  S + F FG L 
Sbjct  412   SGESKPAQESPSRFLFGGLF  431



>ref|XP_010090668.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB40332.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=451

 Score =   471 bits (1211),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 302/407 (74%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWPYFDP---EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW    P   E+E L +RINPPRV+VDN S +  T++KVDS N+ G LLEVVQVL+DL+L
Sbjct  3     CWSSSLPNGDEFEKLMMRINPPRVTVDNASSRKATLIKVDSANRRGSLLEVVQVLTDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQHG K+++ +    I+++LGP+ ++   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQHGKKLSEDDVAERIQQSLGPRAHSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  + T IEL G DRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAATENTTIELTGTDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DD   L  I++ L  +L+  +D  + A+T+VS+ STH DRRLHQM +ADRDY+    D
Sbjct  179   PIDDADHLTKIKQLLLYVLKGDRDKRS-ANTAVSVDSTHKDRRLHQMMYADRDYDVEDSD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
                     KP  ++++C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++GP
Sbjct  238   GGTTSEPRKPLATVENCADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH DGC + +E E+ RV+ CLEAAI+RR SEG+RLELC+ DRVGLLSDVTR+
Sbjct  298   EACQEYYIRHTDGCPISSEAERQRVINCLEAAIRRRNSEGIRLELCSDDRVGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL V+RA V+T G Q VNVFYV D+SGNPV ++ IE +RKEIG
Sbjct  358   FRENGLSVSRAEVTTRGSQAVNVFYVTDASGNPVRSETIEAVRKEIG  404



>ref|XP_004140541.1| PREDICTED: uncharacterized protein LOC101218687 [Cucumis sativus]
 ref|XP_004170246.1| PREDICTED: uncharacterized LOC101218687 [Cucumis sativus]
 gb|KGN46439.1| hypothetical protein Csa_6G093100 [Cucumis sativus]
Length=451

 Score =   469 bits (1208),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/407 (58%), Positives = 309/407 (76%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWPY---FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L  R+NPPRV+VDN S +  T++KVDS NK G LLEVVQVL+DL+L
Sbjct  3     CWSLSLPLDDEFEKLVNRMNPPRVTVDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK+++ +    I+++LGP+G +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQRGNKLSENDVAERIQQSLGPRGRSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAAEEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGF  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP RL  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+   LD
Sbjct  179   PIDDPDRLGKIKQLLLFVLKGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDQDDLD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V+++ C +KGY+VV+++  DRPKL+FD VCTLTDMQYVV+HA + ++GP
Sbjct  238   CGSTSERRKPLVTVESCADKGYTVVNLRSPDRPKLLFDTVCTLTDMQYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A+QEYYIRHMDG  + +E E+ RV+ CLEAAI+RR SEG+RLELC+ DR GLLSDVTR+
Sbjct  298   EATQEYYIRHMDGSPISSEAERQRVIHCLEAAIRRRTSEGIRLELCSDDRAGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VNVFYV D+SGNPV +++IE +RKEIG
Sbjct  358   FRENGLSVTRAEVTTRGTQAVNVFYVTDASGNPVKSEMIEAVRKEIG  404



>ref|XP_009792706.1| PREDICTED: uncharacterized protein LOC104239695 [Nicotiana sylvestris]
Length=449

 Score =   469 bits (1207),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 231/406 (57%), Positives = 303/406 (75%), Gaps = 12/406 (3%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E++ L +R+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+DL+LII +AY+S
Sbjct  11    DDEFKKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTDQHGNK+++ N    I+++LGP+G +   ++    ++VGV S  ++T
Sbjct  71    SDGEWFMDVFHVTDQHGNKLSEDNVAERIQQSLGPRGRSFRSME----RSVGVQSAAEHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSEI AVLA+   NVVAAEVWTHN R+A V+Y+ D+ S  A+ DP RL
Sbjct  127   TIELTGRDRPGLLSEIFAVLADHKNNVVAAEVWTHNSRMASVVYITDEESGLAITDPDRL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
               I + L  +L+  +D    A+T+VS+GSTH +RRLHQM +A    +      + DC S+
Sbjct  187   AKIRKLLLYVLKGDRDRRG-ANTAVSVGSTHTERRLHQMMYA----DRDYDKDDTDCVSV  241

Query  988   ---KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                KP V+++ C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I ++GP ASQE
Sbjct  242   DQRKPLVTVESCADKGYTVVNLRCADRPKLLFDAVCTLTDMQYVVYHATIIAEGPEASQE  301

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YYIRHMDGC + +E E+ RV+ CLEAA++RR S G+RLELC  DR+GLLSDVTR+ RENG
Sbjct  302   YYIRHMDGCPVSSEAERQRVIHCLEAAVKRRTSTGIRLELCGDDRIGLLSDVTRIFRENG  361

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             L V+RA V T G Q +NVFYV D+SG PV ++ IE +R EIG  ++
Sbjct  362   LSVSRAEVMTKGSQAINVFYVTDASGGPVKSETIEAVRNEIGMTIL  407



>ref|XP_008339767.1| PREDICTED: uncharacterized protein LOC103402787 [Malus domestica]
Length=447

 Score =   469 bits (1207),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 308/444 (69%), Gaps = 28/444 (6%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EY  L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LI+TKAY+
Sbjct  11    MDDEYGKLIRRMNPPRVVIDNEACKNATVIRVDSANKYGILLEVVQVLTDLNLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTD  GNKVTD   + YI+K+LGP+   +  +++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDHDGNKVTDEEVLDYIQKSLGPEACFASSMRS-----VGVKQSMDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL N   NVV+AEVWTHN R A V++V D+ +  A+ DP R
Sbjct  126   TVIELTGSDRPGLLSEVSAVLTNHKCNVVSAEVWTHNTRAASVMHVTDEETGLAITDPQR  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L  I+E L N+L+        A T VS   TH +RRLHQM FADRDYE    G LD +  
Sbjct  186   LAXIKELLCNVLKGSNKARG-ARTVVSHAVTHTERRLHQMMFADRDYERVHDGVLDDKQ-  243

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +P+VS+ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYV+FHA+I ++GP A Q
Sbjct  244   ----RPDVSVVNWHDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVIFHASIDAEGPEAYQ  299

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  300   EYYIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + VN FYVRD+SG PVD+K IE +R+ IGQ ++             
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQVIGQTIL-----------KV  408

Query  460   akVPPETAAWSK---TSFFFGSLL  398
                P +T   S+   T F FG L 
Sbjct  409   KGNPEDTKPGSEESPTRFLFGGLF  432



>ref|XP_010682711.1| PREDICTED: uncharacterized protein LOC104897524 [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   469 bits (1206),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 316/452 (70%), Gaps = 21/452 (5%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E++ L +R+NPPRV+VDN S ++ T++KVDS NK G LLEVVQVL+D++L
Sbjct  3     CWTPSLKVDEEFQKLVLRMNPPRVTVDNSSSRNTTLIKVDSANKRGSLLEVVQVLNDMNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQHGNK+ + +    I+++LGP+  +    ++     VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQHGNKLCEDDVAERIQQSLGPRARSFRSRRS-----VG  117

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSEI AVL +   NVVAAEVWTH+ R+A V+Y+ D+ + +
Sbjct  118   VQAAVEHTTIELTGRDRPGLLSEIFAVLTDHKCNVVAAEVWTHSSRMASVVYITDEATGS  177

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
             A+ DP RL  IE  L  +L   +D  + A+T+VS+G TH +RRLHQM +ADRDY+   ++
Sbjct  178   AIYDPDRLTRIENLLLAVLMEDRDKRS-ANTAVSVGGTHTERRLHQMMYADRDYD--MMN  234

Query  1012  MEADCPS----LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAIS  845
             M    P      KP V++D+C E+GY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + 
Sbjct  235   MNGVIPGCSQPRKPLVTVDNCSERGYTVVNLRCADRPKLLFDTVCTLTDMQYVVYHATLI  294

Query  844   SDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSD  665
             ++GP A QEYYIRH DGC + +E E+ R++ CLEAAI RR SEG+ LELC+ DRVGLLSD
Sbjct  295   AEGPEAYQEYYIRHTDGCPISSEAERQRLIHCLEAAISRRTSEGIMLELCSDDRVGLLSD  354

Query  664   VTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkk  485
             VTR+ RENGL VTRA V+T G Q  NVFYV DSSGNPV ++ IE +RKEIGQ ++     
Sbjct  355   VTRIFRENGLSVTRAEVTTRGSQATNVFYVIDSSGNPVKSQTIEAVRKEIGQTIL-----  409

Query  484   vaacacasakVPPETAAWSKTSFFFGSLLGKF  389
                     +K PP+ +        F S   KF
Sbjct  410   -RVKEDEYSKSPPQESGRFSLGNLFKSRSEKF  440



>gb|ADE77534.1| unknown [Picea sitchensis]
Length=439

 Score =   468 bits (1205),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 237/402 (59%), Positives = 300/402 (75%), Gaps = 16/402 (4%)
 Frame = -1

Query  1678  INPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVF  1499
             +N PRV +DN  C + T+VKVDS NK GILLE VQVL+DL L I KA VSSDG WFMDVF
Sbjct  1     MNSPRVVIDNAVCGNATLVKVDSANKHGILLEAVQVLTDLKLNINKANVSSDGRWFMDVF  60

Query  1498  HVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD-YTAIELIGRDR  1322
             +VTD++G K+TD   IGYIEK L     T+  +    GK+VGV    D +TAIEL G DR
Sbjct  61    YVTDENGKKLTDEGVIGYIEKTL----ETNPCILPSFGKSVGVEVAADQHTAIELTGTDR  116

Query  1321  PGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKN  1142
             PGLLSEI AVL++L  NVV AEVWTHN+R+AC++YV D+ +   +DD  ++C IEE L+N
Sbjct  117   PGLLSEIFAVLSDLKCNVVEAEVWTHNRRVACLVYVTDEETGAPIDDGQKICKIEELLRN  176

Query  1141  ILRACKDDNNI--AHTSVSMGSTHIDRRLHQMFFADRDYE------GGCLDMEADCPSLK  986
             ++R    ++NI  A T  SMG TH +RRLHQ+ FADRDYE      G       D  + K
Sbjct  177   VMRG---NSNIRGAKTVASMGLTHTERRLHQLMFADRDYEKLDGTVGRAPPPLNDNDNAK  233

Query  985   PNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIR  806
             P+V++++C+E+GYSVV+V+CKDRPKL+FD+VCTLTDM+YVVFHA I S GP   QEYYIR
Sbjct  234   PHVTVENCLERGYSVVNVQCKDRPKLLFDVVCTLTDMEYVVFHATIDSQGPQTHQEYYIR  293

Query  805   HMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVT  626
             H DGC +++E E+ RV++CLEAAI+RR SEG+RLELC  DRVGLLSDVTR+ RENG+ VT
Sbjct  294   HTDGCPVNSEAERQRVIQCLEAAIRRRASEGVRLELCTNDRVGLLSDVTRIFRENGMSVT  353

Query  625   RAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             RA VST G++ VNVFYV D++GNPVD K +E +R+EIG  ++
Sbjct  354   RAEVSTRGDKAVNVFYVTDAAGNPVDPKTVEAVRREIGLTIL  395



>ref|XP_009627377.1| PREDICTED: uncharacterized protein LOC104117932 isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   469 bits (1206),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 310/442 (70%), Gaps = 23/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ TI++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  11    MDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNLVITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI ++LGP    +  ++    ++VGV S  D+
Sbjct  71    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMRSLGPDSCFASSMR----RSVGVTSGMDH  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+ +  A++DP R
Sbjct  127   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEENGGAINDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE----GGCLDMEA  1004
             L ++++ L N+LR      + A T VS G +H +RRLHQ+ FADRDYE     G  D E 
Sbjct  187   LSMMKQLLCNVLRGSNKLRD-AKTIVSDGVSHTERRLHQLMFADRDYERTADEGLDDKE-  244

Query  1003  DCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSAS  824
                  +PNV++ +  +K YSVV++ CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A 
Sbjct  245   -----RPNVNVVNWQDKDYSVVTINCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPEAH  299

Query  823   QEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRE  644
             QEY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ RE
Sbjct  300   QEYCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  359

Query  643   NGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacaca  464
             N L VTRA V+T   + +N+FYVRDSSG PVD KIIE +R+ IGQ ++     V      
Sbjct  360   NSLTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNVKELNPV  419

Query  463   sakVPPETAAWSKTSFFFGSLL  398
               + P        T F FG L 
Sbjct  420   RQESP--------TRFLFGGLF  433



>ref|XP_009627378.1| PREDICTED: uncharacterized protein LOC104117932 isoform X2 [Nicotiana 
tomentosiformis]
Length=446

 Score =   468 bits (1205),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 310/442 (70%), Gaps = 23/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ TI++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  9     MDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNLVITKAYI  68

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI ++LGP    +  ++    ++VGV S  D+
Sbjct  69    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMRSLGPDSCFASSMR----RSVGVTSGMDH  124

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+ +  A++DP R
Sbjct  125   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEENGGAINDPER  184

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE----GGCLDMEA  1004
             L ++++ L N+LR      + A T VS G +H +RRLHQ+ FADRDYE     G  D E 
Sbjct  185   LSMMKQLLCNVLRGSNKLRD-AKTIVSDGVSHTERRLHQLMFADRDYERTADEGLDDKE-  242

Query  1003  DCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSAS  824
                  +PNV++ +  +K YSVV++ CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A 
Sbjct  243   -----RPNVNVVNWQDKDYSVVTINCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPEAH  297

Query  823   QEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRE  644
             QEY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ RE
Sbjct  298   QEYCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  357

Query  643   NGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacaca  464
             N L VTRA V+T   + +N+FYVRDSSG PVD KIIE +R+ IGQ ++     V      
Sbjct  358   NSLTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNVKELNPV  417

Query  463   sakVPPETAAWSKTSFFFGSLL  398
               + P        T F FG L 
Sbjct  418   RQESP--------TRFLFGGLF  431



>ref|XP_009793984.1| PREDICTED: uncharacterized protein LOC104240797 isoform X1 [Nicotiana 
sylvestris]
Length=448

 Score =   468 bits (1204),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 313/441 (71%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ TI++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  11    MDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNLVITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI K+LGP    +  ++    ++VGV +  D+
Sbjct  71    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMR----RSVGVTAGMDH  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+    A+ DP R
Sbjct  127   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAITDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L  +++ L N+LR      + A T VS G +H +RRLHQ+ FADRDYE   G  LD + D
Sbjct  187   LSTMKQLLCNVLRGSNKLRD-AKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLD-DKD  244

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +PNV++ +  +K YSVV++KCKDRPKL+FD +CTLTDMQYVVFH  + ++GP A Q
Sbjct  245   ----RPNVNVVNWQDKDYSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQ  300

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  301   EYCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  360

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + +N+FYVRDSSG PVD KIIE +R+ IGQ ++    +V       
Sbjct  361   SLTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTIL----RVKGNIEEL  416

Query  460   akVPPETAAWSKTSFFFGSLL  398
               VP E    S T F FG L 
Sbjct  417   NPVPQE----SPTRFLFGGLF  433



>ref|XP_009793985.1| PREDICTED: uncharacterized protein LOC104240797 isoform X2 [Nicotiana 
sylvestris]
Length=446

 Score =   468 bits (1203),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 246/441 (56%), Positives = 313/441 (71%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ TI++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  9     MDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNLVITKAYI  68

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI K+LGP    +  ++    ++VGV +  D+
Sbjct  69    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMR----RSVGVTAGMDH  124

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+    A+ DP R
Sbjct  125   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAITDPER  184

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L  +++ L N+LR      + A T VS G +H +RRLHQ+ FADRDYE   G  LD + D
Sbjct  185   LSTMKQLLCNVLRGSNKLRD-AKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLD-DKD  242

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +PNV++ +  +K YSVV++KCKDRPKL+FD +CTLTDMQYVVFH  + ++GP A Q
Sbjct  243   ----RPNVNVVNWQDKDYSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQ  298

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  299   EYCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  358

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + +N+FYVRDSSG PVD KIIE +R+ IGQ ++    +V       
Sbjct  359   SLTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTIL----RVKGNIEEL  414

Query  460   akVPPETAAWSKTSFFFGSLL  398
               VP E    S T F FG L 
Sbjct  415   NPVPQE----SPTRFLFGGLF  431



>gb|KDO70279.1| hypothetical protein CISIN_1g013090mg [Citrus sinensis]
Length=449

 Score =   468 bits (1203),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 310/440 (70%), Gaps = 20/440 (5%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LI+TKAY+S
Sbjct  12    DDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYIS  71

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVF+VTD+ GNK+TD   + YI K LGP+   +  +++     VGV    D+T
Sbjct  72    SDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMRS-----VGVKQSMDHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
             AIEL G DRPGLLSE+SAVL +L  NVV+AEVWTHN R A ++ V D+ +  A+ DP RL
Sbjct  127   AIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAISDPERL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
              VI+E L N+L+   + + +A T VS   TH +RRLHQM FADRDYE    D ++     
Sbjct  187   SVIKELLCNVLKG-SNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTDDDSLDEKQ  245

Query  988   KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI  809
             +PNV++ +C +K YSVV++  KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY+I
Sbjct  246   RPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEYFI  305

Query  808   RHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLV  629
             RH+DG  + ++ E++RV++CL+AAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L V
Sbjct  306   RHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  365

Query  628   TRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVP  449
             TRA V+T   + VN FYV  +SG PVD KII+ +R+ IGQ ++                P
Sbjct  366   TRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTIL-----------KVKGNP  414

Query  448   PETAAWSK---TSFFFGSLL  398
              +  + S+   T F FG L 
Sbjct  415   EDLKSASQDSPTRFLFGGLF  434



>ref|XP_002512031.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF50700.1| amino acid binding protein, putative [Ricinus communis]
Length=443

 Score =   467 bits (1202),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 308/442 (70%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  7     MDDEYEKLFRRLNPPRVVIDNESCKNATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDGGWFMDVF+V DQ GNK+TD   + YI K+LGP+  +TS +      ++VGV    D
Sbjct  67    SSDGGWFMDVFNVRDQDGNKITDEAILDYIRKSLGPESRFTSSM------RSVGVIPSMD  120

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +T+IEL G DRPGLLSE+SAVL +L  NVV+AEVWTHN R A V+ V D+ + +A+ DP 
Sbjct  121   HTSIELTGSDRPGLLSELSAVLTHLKCNVVSAEVWTHNMRAAAVMQVTDEETGSAIIDPE  180

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL  I+E L N+L+        A T VS G TH +RRLHQM FADRDYE    D E    
Sbjct  181   RLSRIKELLCNVLKGSNKFRG-AKTVVSHGVTHTERRLHQMMFADRDYERA--DDEVLDE  237

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  +K YSVV+++ KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  238   KQRPNVSVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAYQEY  297

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  298   YIRHIDGSPVKSDAERMRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  357

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T   + +N FYVRD+SG  VD K IE +R+ IGQ ++               
Sbjct  358   TVTRAEVTTRDGKAINTFYVRDASGYLVDGKTIESIRQVIGQTIL-----------KVKS  406

Query  454   VPPE---TAAWSKTSFFFGSLL  398
              P E    +  S T F FG L 
Sbjct  407   NPDELKPVSQESPTRFLFGGLF  428



>ref|XP_009793986.1| PREDICTED: uncharacterized protein LOC104240797 isoform X3 [Nicotiana 
sylvestris]
Length=438

 Score =   467 bits (1202),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 245/441 (56%), Positives = 312/441 (71%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ TI++VDS NK GILLEVVQVL+DL+L+ITKAY+
Sbjct  1     MDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNLVITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT+Q GNK+TD   + YI K+LGP    +  ++    ++VGV +  D+
Sbjct  61    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMR----RSVGVTAGMDH  116

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D+    A+ DP R
Sbjct  117   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAITDPER  176

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE---GGCLDMEAD  1001
             L  +++ L N+LR      + A T VS G +H +RRLHQ+ FADRDYE   G  LD +  
Sbjct  177   LSTMKQLLCNVLRGSNKLRD-AKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLDDKD-  234

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +PNV++ +  +K YSVV++KCKDRPKL+FD +CTLTDMQYVVFH  + ++GP A Q
Sbjct  235   ----RPNVNVVNWQDKDYSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQ  290

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EY IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN
Sbjct  291   EYCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  350

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V+T   + +N+FYVRDSSG PVD KIIE +R+ IGQ ++    +V       
Sbjct  351   SLTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTIL----RVKGNIEEL  406

Query  460   akVPPETAAWSKTSFFFGSLL  398
               VP E    S T F FG L 
Sbjct  407   NPVPQE----SPTRFLFGGLF  423



>ref|XP_006450386.1| hypothetical protein CICLE_v10010775mg [Citrus clementina]
 ref|XP_006483395.1| PREDICTED: uncharacterized protein LOC102630166 [Citrus sinensis]
 gb|ESR63626.1| hypothetical protein CICLE_v10010775mg [Citrus clementina]
 gb|KDO61789.1| hypothetical protein CISIN_1g048063mg [Citrus sinensis]
Length=484

 Score =   469 bits (1206),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 241/436 (55%), Positives = 306/436 (70%), Gaps = 29/436 (7%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPP--RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSD  1562
             M + CWPYFDPE++TL  RI  P  RV +DN S +DCT+VKVDSV+K G+LLE+VQVL+D
Sbjct  1     MNKVCWPYFDPEFDTLPERIYGPTCRVCIDNESMEDCTVVKVDSVSKQGLLLEMVQVLTD  60

Query  1561  LDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGY--TSDVLKTCP  1388
             ++L I+K+Y+SSD GWFMDVFHV D+HGNK+TD   I YI++A+G  G   +S V KT  
Sbjct  61    MNLTISKSYISSDAGWFMDVFHVKDEHGNKLTDQKVINYIQQAIGTTGEIPSSAVAKTYT  120

Query  1387  GKNV-GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVN  1211
              K V G     ++TAIE+ G DRPGL SEISA LA+LH N+V A  W+HN R+ACV YV+
Sbjct  121   NKAVFGSEYPSEHTAIEMTGTDRPGLFSEISAALADLHCNIVEAHAWSHNDRLACVAYVS  180

Query  1210  DKVSCNAVDDPSRLCVIEEQLKNILRACKD----DNNIAHTSVSMG--------STHIDR  1067
             D+ +   +DDP RL  IEE +  +LRA  +    + +I    V            T+++R
Sbjct  181   DQSTDTPIDDPGRLATIEEYITTVLRATAERSPSETHINPLQVKANGFPCGDCIKTNVER  240

Query  1066  RLHQMFFADRDYEGGC-LDMEADCPS-----------LKPNVSIDHCVEKGYSVVSVKCK  923
             RLHQ+  + RD++G C  +M    PS            +  V I+ C EKGYS+VSV CK
Sbjct  241   RLHQLMLSVRDFDGQCGPNMSRSTPSSAVGFGDEEGMRRTAVYIESCEEKGYSIVSVDCK  300

Query  922   DRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLE  743
             DRP+LMFD VCTLTDMQYVVFHA+I   G  A QEY+IRH+DG  L+TEGEK+RV+KCLE
Sbjct  301   DRPRLMFDTVCTLTDMQYVVFHASIGCHGDYAFQEYFIRHIDGYALNTEGEKERVIKCLE  360

Query  742   AAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSS  563
             AAI+RRV EG+RLELCA +RVGLLSD+TRVLRENGL V RA V+T GE+ VN FY+RD S
Sbjct  361   AAIERRVCEGVRLELCAANRVGLLSDITRVLRENGLAVVRAHVATKGEKSVNAFYLRDIS  420

Query  562   GNPVDTKIIEGLRKEI  515
             GN VD   +E ++KEI
Sbjct  421   GNEVDMDFVESMKKEI  436



>ref|XP_010324768.1| PREDICTED: uncharacterized protein LOC101260963 isoform X2 [Solanum 
lycopersicum]
Length=446

 Score =   467 bits (1202),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 312/438 (71%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQ+L+DL+L+ITKAY+
Sbjct  9     MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQILTDLNLVITKAYI  68

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT Q GNK+TD   + YI K+LGP    +  ++    ++VG+ +  DY
Sbjct  69    SSDGGWFMDVFNVTTQDGNKITDEAMLDYIMKSLGPDSSFASSMR----RSVGLTTGMDY  124

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+ AVL NL  NVV AEVWTHN R A ++ V D+ +   ++DP R
Sbjct  125   TSIELIGSDRPGLLSEMRAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGTINDPER  184

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L ++++ L N+LR C +    A T VS G +H +RRLHQ+ FADRDYE    ++  +   
Sbjct  185   LSMMKQLLCNVLR-CSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVSDE--K  241

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNVS+ +  ++ YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  242   GRPNVSVVNWQDRDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPIAHQEYC  301

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L 
Sbjct  302   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  361

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN+FYVRDSSG PVD KIIE +R+ IGQ ++    +V         V
Sbjct  362   VTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESVRQTIGQTIL----RVKGNIGELNPV  417

Query  451   PPETAAWSKTSFFFGSLL  398
             P E    S T F FG L 
Sbjct  418   PQE----SPTRFLFGGLF  431



>ref|XP_009784019.1| PREDICTED: uncharacterized protein LOC104232494 [Nicotiana sylvestris]
Length=449

 Score =   467 bits (1202),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 306/441 (69%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY+
Sbjct  12    MDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKRGILLEVVQILTDLNLIITKAYI  71

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF+VT+Q GNK+T+   + YI K+LGP+   +  ++    ++VGV +  D+
Sbjct  72    CSDGGWFMDVFNVTNQEGNKITEEPILDYIMKSLGPESCFASSMR----RSVGVTTGMDH  127

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D  +  AV DP R
Sbjct  128   TSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDENGGAVSDPER  187

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L ++++ L N+LR      + A T VS G TH +RRLHQ+ FADRDYE    D   D   
Sbjct  188   LTMVKKLLCNVLRGSNKSRD-AKTLVSHGVTHTERRLHQLMFADRDYERATGDGSDD--K  244

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  245   ERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDTEGPEAYQEYC  304

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  305   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  364

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + +N FYV DSSG PVD KIIE +R+ IGQ ++                
Sbjct  365   VTRAEVTTRAGKALNTFYVSDSSGYPVDAKIIESVRQTIGQTIL-----------RVKGN  413

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E       S T F FG L 
Sbjct  414   PEELNPVQQESPTRFLFGGLF  434



>ref|XP_004228421.1| PREDICTED: uncharacterized protein LOC101260963 isoform X1 [Solanum 
lycopersicum]
Length=448

 Score =   467 bits (1202),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 312/438 (71%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQ+L+DL+L+ITKAY+
Sbjct  11    MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQILTDLNLVITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT Q GNK+TD   + YI K+LGP    +  ++    ++VG+ +  DY
Sbjct  71    SSDGGWFMDVFNVTTQDGNKITDEAMLDYIMKSLGPDSSFASSMR----RSVGLTTGMDY  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+ AVL NL  NVV AEVWTHN R A ++ V D+ +   ++DP R
Sbjct  127   TSIELIGSDRPGLLSEMRAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGTINDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L ++++ L N+LR C +    A T VS G +H +RRLHQ+ FADRDYE    ++  +   
Sbjct  187   LSMMKQLLCNVLR-CSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVSDE--K  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNVS+ +  ++ YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  244   GRPNVSVVNWQDRDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPIAHQEYC  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L 
Sbjct  304   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN+FYVRDSSG PVD KIIE +R+ IGQ ++    +V         V
Sbjct  364   VTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESVRQTIGQTIL----RVKGNIGELNPV  419

Query  451   PPETAAWSKTSFFFGSLL  398
             P E    S T F FG L 
Sbjct  420   PQE----SPTRFLFGGLF  433



>ref|XP_011020651.1| PREDICTED: uncharacterized protein LOC105122947 isoform X1 [Populus 
euphratica]
Length=447

 Score =   467 bits (1201),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 22/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK G LLEVVQVL+DL+LIITKAYV
Sbjct  11    MDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGKLLEVVQVLTDLNLIITKAYV  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LG     ++   T   ++ GV    D+
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEAILDYITKSLG-----TEPCFTSSKRSFGVKQSMDH  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIEL G DRPGLLSE+SAVLA+L  NV+ AEVWTHN R A V+ V D  + +A+ DP +
Sbjct  126   TAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDPEK  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+        A T VS G TH +RRLHQM FADRDYE    D+  +   
Sbjct  186   LSKIKELLCNLLKGSNKYRG-ARTVVSHGVTHTERRLHQMMFADRDYERANNDVLDE--K  242

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNVS+ +  EK YSV++++ KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEYY
Sbjct  243   QRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEYY  302

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             I+H+DG  + +E E+ R+++CLEAAI+RRVSEGL+LELC  DR+GLLSDVTR+ REN L 
Sbjct  303   IKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFRENSLT  362

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN FYV D+SG PVD K I+ +R+ IGQ ++                
Sbjct  363   VTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTIL-----------KVKGS  411

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E    +  S T F FG L 
Sbjct  412   PEELKPVSQESPTRFLFGGLF  432



>ref|XP_010324799.1| PREDICTED: uncharacterized protein LOC101260963 isoform X3 [Solanum 
lycopersicum]
Length=438

 Score =   466 bits (1200),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 312/438 (71%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQ+L+DL+L+ITKAY+
Sbjct  1     MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQILTDLNLVITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT Q GNK+TD   + YI K+LGP    +  ++    ++VG+ +  DY
Sbjct  61    SSDGGWFMDVFNVTTQDGNKITDEAMLDYIMKSLGPDSSFASSMR----RSVGLTTGMDY  116

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+ AVL NL  NVV AEVWTHN R A ++ V D+ +   ++DP R
Sbjct  117   TSIELIGSDRPGLLSEMRAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGTINDPER  176

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L ++++ L N+LR C +    A T VS G +H +RRLHQ+ FADRDYE    ++  +   
Sbjct  177   LSMMKQLLCNVLR-CSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVSDE--K  233

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNVS+ +  ++ YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  234   GRPNVSVVNWQDRDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPIAHQEYC  293

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L 
Sbjct  294   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  353

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN+FYVRDSSG PVD KIIE +R+ IGQ ++    +V         V
Sbjct  354   VTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESVRQTIGQTIL----RVKGNIGELNPV  409

Query  451   PPETAAWSKTSFFFGSLL  398
             P E    S T F FG L 
Sbjct  410   PQE----SPTRFLFGGLF  423



>ref|XP_011020660.1| PREDICTED: uncharacterized protein LOC105122947 isoform X2 [Populus 
euphratica]
Length=443

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 22/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK G LLEVVQVL+DL+LIITKAYV
Sbjct  7     MDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGKLLEVVQVLTDLNLIITKAYV  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LG     ++   T   ++ GV    D+
Sbjct  67    SSDGGWFMDVFNVTDQDGNKVTDEAILDYITKSLG-----TEPCFTSSKRSFGVKQSMDH  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIEL G DRPGLLSE+SAVLA+L  NV+ AEVWTHN R A V+ V D  + +A+ DP +
Sbjct  122   TAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDPEK  181

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+        A T VS G TH +RRLHQM FADRDYE    D+  +   
Sbjct  182   LSKIKELLCNLLKGSNKYRG-ARTVVSHGVTHTERRLHQMMFADRDYERANNDVLDE--K  238

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNVS+ +  EK YSV++++ KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEYY
Sbjct  239   QRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEYY  298

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             I+H+DG  + +E E+ R+++CLEAAI+RRVSEGL+LELC  DR+GLLSDVTR+ REN L 
Sbjct  299   IKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFRENSLT  358

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN FYV D+SG PVD K I+ +R+ IGQ ++                
Sbjct  359   VTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTIL-----------KVKGS  407

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E    +  S T F FG L 
Sbjct  408   PEELKPVSQESPTRFLFGGLF  428



>ref|XP_008459879.1| PREDICTED: uncharacterized protein LOC103498865 isoform X1 [Cucumis 
melo]
Length=452

 Score =   467 bits (1201),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/408 (57%), Positives = 311/408 (76%), Gaps = 9/408 (2%)
 Frame = -1

Query  1723  CWPY---FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L  R+NPPRV++DN S +  T++KVDS NK G LLEVVQVL+DL+L
Sbjct  3     CWSLSLPLDDEFEKLVNRMNPPRVTIDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQHGNK+++ +    I+++LGP+  +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQHGNKLSENDVAERIQQSLGPRARSFRSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAAEEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGF  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
             ++ DP RL  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+   LD
Sbjct  179   SISDPDRLGKIKQLLLFVLKGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDQDDLD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++C +KGY+VV+++  DRPKL+FD VCTLTDMQYVV+HA + ++GP
Sbjct  238   CGSTSERRKPLVTVENCADKGYTVVNLRSPDRPKLLFDTVCTLTDMQYVVYHATVIAEGP  297

Query  832   SASQ-EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
              ASQ EYYIRHMDG  + +E E+ RV+ CLEAAI+RR SEG+RLELC++DR GLLSDVTR
Sbjct  298   EASQQEYYIRHMDGSPISSEAERQRVIHCLEAAIRRRTSEGIRLELCSEDRAGLLSDVTR  357

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             + RENGL VTRA V+T G Q VNVFYV D+SGNPV +++IE +RKEIG
Sbjct  358   IFRENGLSVTRAEVTTRGTQAVNVFYVTDASGNPVKSEMIEAVRKEIG  405



>ref|XP_009356452.1| PREDICTED: uncharacterized protein LOC103947287 [Pyrus x bretschneideri]
Length=447

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/438 (55%), Positives = 301/438 (69%), Gaps = 16/438 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DLDLI+ KAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLDLIVRKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             +SDGGWFMDVF+VTDQ GNKV D   + YI K+LGP+   +  +++     VGV    D 
Sbjct  71    ASDGGWFMDVFNVTDQDGNKVADEEVLEYIHKSLGPEARFASSMRS-----VGVKQSMDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL NL  NVV+AEVWTHN R A V+ V D+ +  A+ D  R
Sbjct  126   TVIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMRVTDEETGLAITDSQR  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+        A T VS   TH DRRLHQM FADRDYE   +D       
Sbjct  186   LARIKELLCNVLKGSNKTRG-ARTVVSHAVTHTDRRLHQMMFADRDYER--VDDNVLDDK  242

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +P+VS+ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA+I ++GP A QEYY
Sbjct  243   QRPDVSVVNLHDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQEYY  302

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             I+H+DG  + ++ E+ RV++CLEAAI+RRVSE L+LELC  DRVGLLSDVTR+ REN L 
Sbjct  303   IKHVDGSPVKSDAERQRVIQCLEAAIERRVSEDLKLELCTTDRVGLLSDVTRIFRENSLT  362

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + VN FYVRD+SG PVD+K IE +R+ IGQ ++            S + 
Sbjct  363   VTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQAIGQTILKVKGNTEDTKTGSEES  422

Query  451   PPETAAWSKTSFFFGSLL  398
             P        T F FG L 
Sbjct  423   P--------TRFLFGGLF  432



>ref|XP_007153472.1| hypothetical protein PHAVU_003G038400g [Phaseolus vulgaris]
 gb|ESW25466.1| hypothetical protein PHAVU_003G038400g [Phaseolus vulgaris]
Length=451

 Score =   466 bits (1200),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 295/405 (73%), Gaps = 8/405 (2%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAY  1535
             Y D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LIITKAY
Sbjct  14    YMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAY  73

Query  1534  VSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             +SSDGGWFMD F+VT Q GNKVTD   + YI K+LGP+        T P ++VGV    D
Sbjct  74    ISSDGGWFMDAFNVTGQDGNKVTDEAILDYIRKSLGPESCV-----TSPIRSVGVEQTMD  128

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +T IEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++V D+ + +A+ DP 
Sbjct  129   HTVIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEETGSAITDPK  188

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL +++E L N+L         A T V+   TH +RRLHQM FADRDYE    D  A   
Sbjct  189   RLSIVKELLCNVLGGGNKKRG-AKTVVTDEVTHTERRLHQMMFADRDYERDSDD--AFDE  245

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV++ +  +  YSVV+++CKDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  246   KQRPNVNVVNWSDNNYSVVTIQCKDRPKLLFDTVCTLTDMEYVVFHAKIDAEGPEAYQEY  305

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             +I+H+DG  + ++ E+ RV++CL AAI+RRVS+GL+LELC  DRVGLLSDVTR+ REN L
Sbjct  306   FIKHIDGSPMKSDAERQRVIQCLAAAIERRVSDGLKLELCTTDRVGLLSDVTRIFRENSL  365

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VTRA VST G + VN FYVR +SG PVD K IE +R+ IG  ++
Sbjct  366   TVTRAEVSTKGGKAVNTFYVRGASGFPVDLKTIESIRQTIGNTIL  410



>ref|XP_002312346.1| hypothetical protein POPTR_0008s10860g [Populus trichocarpa]
 gb|EEE89713.1| hypothetical protein POPTR_0008s10860g [Populus trichocarpa]
Length=443

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 305/442 (69%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK G LLEVVQVL+DL+LIITKAYV
Sbjct  7     LDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGKLLEVVQVLTDLNLIITKAYV  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LG +  +TS +       + GV    D
Sbjct  67    SSDGGWFMDVFNVTDQDGNKVTDEAILDYITKSLGTESCFTSSM------GSFGVKQSID  120

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL G DRPGLLSE+SAVLA+L  NV+ AEVWTHN R A V+ V D  + +A+ DP 
Sbjct  121   HTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDPE  180

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             +L  ++E L N+L+        A T VS G TH +RRLHQM FADRDYE    D+  +  
Sbjct  181   KLSRVKELLCNVLKGSNKYRG-ARTVVSHGVTHTERRLHQMMFADRDYERANNDVLDE--  237

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  EK YSV++++ KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  238   KQRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEY  297

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + +E E+ R+++CLEAAI+RRVSEGL+LELC KDR+GLLSDVTR+ REN L
Sbjct  298   YIKHVDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTKDRIGLLSDVTRIFRENSL  357

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T   + VN FYV D+SG PVD K I+ +R+  GQ ++               
Sbjct  358   TVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQATGQTIL-----------KVKG  406

Query  454   VPPE---TAAWSKTSFFFGSLL  398
              P E    +  S T F FG L 
Sbjct  407   SPEELKPVSQESPTRFLFGGLF  428



>ref|XP_009105455.1| PREDICTED: uncharacterized protein LOC103831311 isoform X2 [Brassica 
rapa]
Length=450

 Score =   466 bits (1198),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 307/441 (70%), Gaps = 15/441 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DLDL ITKAY+
Sbjct  7     MDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  67    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D ++ +AV DP R
Sbjct  122   TVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSDPER  181

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC--  998
             L  I+  L+N+L+        A T VS+G  H DRRLHQM F DRDYE   LD E+    
Sbjct  182   LSRIKSLLRNVLKGSNTPKE-AKTVVSLGEVHTDRRLHQMMFEDRDYEN--LDDESSNVQ  238

Query  997   -PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A Q
Sbjct  239   DERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQ  298

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN
Sbjct  299   EYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFREN  358

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V T G + VN FYV D+SG  +D K I+ +R+ IG+ ++    K        
Sbjct  359   SLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTIL--KVKNKPKEQQQ  416

Query  460   akVPPETAAWSKTSFFFGSLL  398
              + PP  +  S T F FG L 
Sbjct  417   REKPP--SQESPTRFLFGGLF  435



>ref|XP_010257938.1| PREDICTED: uncharacterized protein LOC104597875 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   465 bits (1197),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 302/438 (69%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN +CK  T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  11    MDDEYEKFVRRMNPPRVVIDNEACKSATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTD+ GNK+ D   + YI K+LG        ++    ++VGV    ++
Sbjct  71    SSDGGWFMDVFNVTDREGNKLKDECLLEYISKSLGADSSYVPSMR----RSVGVEQSTNH  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IEL G DRPGLLSE+ AVL  L  NVV  EVWTHN R A V+ V D+ +  A+ DP R
Sbjct  127   TSIELTGTDRPGLLSEVCAVLTCLKCNVVNGEVWTHNTRAAAVMLVTDEETGAAITDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+   +    A T VS+G TH +RRLHQM FADRDYE    D +     
Sbjct  187   LSKIKEMLCNVLKG-NNKTREAKTVVSLGVTHTERRLHQMMFADRDYERS--DSDTLDEK  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
             L+PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA + ++G  A QEYY
Sbjct  244   LRPNVTVVNWHDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEGAEAYQEYY  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  304   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLS  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V T   + +N FYVRD++GNPVD K I+ +R+ IGQ ++              + 
Sbjct  364   VTRAEVMTRAGKAINTFYVRDAAGNPVDAKTIDSIREAIGQTIL--------QVRGCFES  415

Query  451   PPETAAWSKTSFFFGSLL  398
             P   A  S T F FG L 
Sbjct  416   PKSQAQESPTRFLFGGLF  433



>ref|XP_004239021.1| PREDICTED: uncharacterized protein LOC101259744 [Solanum lycopersicum]
Length=449

 Score =   465 bits (1196),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 305/441 (69%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQ+L+DL+ IITKAY+
Sbjct  12    MDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQILTDLNFIITKAYI  71

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF+VT+Q GNK+T+   + YI K+LGP    +  ++    ++VGV +  D+
Sbjct  72    CSDGGWFMDVFNVTNQEGNKITEEPILDYIMKSLGPDSCFASSMR----RSVGVTTGMDH  127

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D  +  A+ D  +
Sbjct  128   TSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDETGGAIADAEK  187

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +I++ L N+LR      + A T +S G TH DRRLHQ+ FADRDYE    D   D   
Sbjct  188   LSMIKKLLCNVLRGSNKSRD-AKTLLSHGVTHTDRRLHQLMFADRDYERATGDGSDD--K  244

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  245   ERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDTEGPEAYQEYC  304

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L 
Sbjct  305   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  364

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA VST   + +N FYVRDSSG PVDTKIIE +R+ IGQ ++                
Sbjct  365   VTRAEVSTRAGKALNTFYVRDSSGYPVDTKIIESVRQTIGQTIL-----------RVKGS  413

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E       S T F FG L 
Sbjct  414   PEELNPVQQESPTRFLFGGLF  434



>ref|XP_009105454.1| PREDICTED: uncharacterized protein LOC103831311 isoform X1 [Brassica 
rapa]
Length=454

 Score =   465 bits (1197),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 307/441 (70%), Gaps = 15/441 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DLDL ITKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D ++ +AV DP R
Sbjct  126   TVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC--  998
             L  I+  L+N+L+        A T VS+G  H DRRLHQM F DRDYE   LD E+    
Sbjct  186   LSRIKSLLRNVLKGSNTPKE-AKTVVSLGEVHTDRRLHQMMFEDRDYEN--LDDESSNVQ  242

Query  997   -PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A Q
Sbjct  243   DERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQ  302

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN
Sbjct  303   EYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFREN  362

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V T G + VN FYV D+SG  +D K I+ +R+ IG+ ++    K        
Sbjct  363   SLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTIL--KVKNKPKEQQQ  420

Query  460   akVPPETAAWSKTSFFFGSLL  398
              + PP  +  S T F FG L 
Sbjct  421   REKPP--SQESPTRFLFGGLF  439



>ref|XP_010257936.1| PREDICTED: uncharacterized protein LOC104597875 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   465 bits (1197),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 302/438 (69%), Gaps = 15/438 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN +CK  T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  25    MDDEYEKFVRRMNPPRVVIDNEACKSATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  84

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTD+ GNK+ D   + YI K+LG        ++    ++VGV    ++
Sbjct  85    SSDGGWFMDVFNVTDREGNKLKDECLLEYISKSLGADSSYVPSMR----RSVGVEQSTNH  140

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IEL G DRPGLLSE+ AVL  L  NVV  EVWTHN R A V+ V D+ +  A+ DP R
Sbjct  141   TSIELTGTDRPGLLSEVCAVLTCLKCNVVNGEVWTHNTRAAAVMLVTDEETGAAITDPER  200

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+E L N+L+   +    A T VS+G TH +RRLHQM FADRDYE    D +     
Sbjct  201   LSKIKEMLCNVLKG-NNKTREAKTVVSLGVTHTERRLHQMMFADRDYERS--DSDTLDEK  257

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
             L+PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFHA + ++G  A QEYY
Sbjct  258   LRPNVTVVNWHDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEGAEAYQEYY  317

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  318   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLS  377

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V T   + +N FYVRD++GNPVD K I+ +R+ IGQ ++              + 
Sbjct  378   VTRAEVMTRAGKAINTFYVRDAAGNPVDAKTIDSIREAIGQTIL--------QVRGCFES  429

Query  451   PPETAAWSKTSFFFGSLL  398
             P   A  S T F FG L 
Sbjct  430   PKSQAQESPTRFLFGGLF  447



>ref|XP_010556116.1| PREDICTED: uncharacterized protein LOC104825486 [Tarenaya hassleriana]
Length=455

 Score =   465 bits (1196),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 299/404 (74%), Gaps = 6/404 (1%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E E   IR+NPP+V++DN S +  T+VKVDS NK G LLEVVQVL+DLDL+I +AYVS
Sbjct  11    DNELEKFVIRMNPPKVTIDNASSRKATLVKVDSANKRGSLLEVVQVLTDLDLLIRRAYVS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY-  1352
             SDG WFMDVFHVTD++GNKV + N    I+ +LGP+ Y+         ++VGV    +  
Sbjct  71    SDGEWFMDVFHVTDKNGNKVMEENIAERIQLSLGPRTYSF----RARNRSVGVQGASEKS  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IE+ GRDRPGLLS++ AVLA+ + NVVAAEVWTHN R+A V+Y+ D+ + +A++DP+R
Sbjct  127   TSIEITGRDRPGLLSDVFAVLADNNCNVVAAEVWTHNSRMASVVYITDETTGSAIEDPTR  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             +  I++ L  +L   +D   IA+T+V MGSTH +RRLHQM + +RDY+    D  +    
Sbjct  187   ISKIKQLLLYVLEGNRD-KRIANTAVLMGSTHKERRLHQMMYDNRDYDVAYTDDRSTSER  245

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              KP V++++C +K Y+V +++C DRPKL FD VCTLTDMQYVV+HA + ++GP A QEYY
Sbjct  246   RKPIVTVENCTDKAYTVANLRCSDRPKLFFDAVCTLTDMQYVVYHATVIAEGPEAYQEYY  305

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + +E E+ R++ CLEAAI+RR+SEG+RLELC +DRVGLLSDVTR+ RENGL 
Sbjct  306   IRHVDGGPVSSEAERQRLIHCLEAAIKRRISEGIRLELCGEDRVGLLSDVTRIFRENGLS  365

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             VTRA V+T G Q VN FYV DSSGNPV    IE +R EIG+ ++
Sbjct  366   VTRAEVTTRGSQAVNTFYVTDSSGNPVKRTAIETVRNEIGRAIL  409



>emb|CDY33557.1| BnaC06g29950D [Brassica napus]
Length=453

 Score =   464 bits (1195),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 239/443 (54%), Positives = 309/443 (70%), Gaps = 16/443 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DLDL ITKAY+
Sbjct  7     MDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VT Q GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  67    SSDGGWFMDVFNVTHQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D ++ +AV DP R
Sbjct  122   TVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSDPER  181

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE G + ++ D  +
Sbjct  182   LSLIKSLLRNVLKGSNTPKE-AKTVVSQGEVHTDRRLHQMMFEDRDYENGVM-VDDDSSN  239

Query  991   L-----KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
             +     +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A
Sbjct  240   VQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  299

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEYY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ R
Sbjct  300   FQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacac  467
             EN L VTRA V T G + VN FYV D+SG  +D K I+ +R+ IG+ ++    K      
Sbjct  360   ENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTLL--KVKNKPKDQ  417

Query  466   asakVPPETAAWSKTSFFFGSLL  398
                + PP  +  S T F FG L 
Sbjct  418   QQREKPP--SQESPTRFLFGGLF  438



>ref|XP_006348650.1| PREDICTED: uncharacterized protein LOC102583967 [Solanum tuberosum]
Length=449

 Score =   464 bits (1195),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 305/441 (69%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQ+L+DL+ IITKAY+
Sbjct  12    MDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQILTDLNFIITKAYI  71

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF+VT+Q GNK+T+   + YI K+LGP    +  ++    ++VGV +  D+
Sbjct  72    CSDGGWFMDVFNVTNQDGNKITEEPILDYIMKSLGPDSCFASSMR----RSVGVTTGMDH  127

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D  +  A+ D  +
Sbjct  128   TSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDETGGAIADAEK  187

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +I++ L N+LR      + A T +S G TH DRRLHQ+ FADRDYE    D   D   
Sbjct  188   LSMIKKLLCNVLRGSNKSRD-AKTLLSHGVTHTDRRLHQLMFADRDYERAAGDGSDD--K  244

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FD +CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  245   ERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDTEGPEAYQEYC  304

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L 
Sbjct  305   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  364

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA VST   + +N FYVRDSSG PVDTKIIE +R+ IGQ ++                
Sbjct  365   VTRAEVSTRAGKALNTFYVRDSSGYPVDTKIIESVRQTIGQTIL-----------RVKGS  413

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E       S T F FG L 
Sbjct  414   PEELNPVQQESPTRFLFGGLF  434



>ref|XP_010936426.1| PREDICTED: uncharacterized protein LOC105056061 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   464 bits (1195),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 244/444 (55%), Positives = 309/444 (70%), Gaps = 25/444 (6%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E    R+NPPRV +DN SC + T+V+VDS NK GILLEVVQVL+DL+LI  KAY+S
Sbjct  12    DDEFEKFIRRMNPPRVVIDNESCANATVVRVDSANKYGILLEVVQVLTDLNLITKKAYIS  71

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTI----GYIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             SDGGWFMDVF+VTD+ G K+ + + +     YI K+LG     S  + +C  ++VGV   
Sbjct  72    SDGGWFMDVFNVTDRDGKKIREESKLDEIGNYIRKSLGAD---SAFVPSCR-RSVGVAPS  127

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              DYT IEL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ +  A+ D
Sbjct  128   SDYTVIELTGTDRPGLLSEVSAVLTSLKCNVVNAEVWTHNTRAASVMQVTDEETGLAIID  187

Query  1180  PSRLCVIEEQLKNILRACKDDNNI---AHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             P RL  I+E L N+L+     NNI   A T+VSMG TH DRRLHQM FADRDYE    D 
Sbjct  188   PERLSRIKELLCNVLKG----NNITRGAKTAVSMGVTHTDRRLHQMMFADRDYERS--DK  241

Query  1009  EADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPS  830
             +    S +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFH  + ++GP 
Sbjct  242   DTANESHRPNVTVVNWFDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPE  301

Query  829   ASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVL  650
             A QEYYIRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ 
Sbjct  302   AYQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIF  361

Query  649   RENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaaca  470
             RENGL V RA VST G + +N FYVRD++GN VD K +E +R+ IG  ++          
Sbjct  362   RENGLTVIRAEVSTQGGKAINTFYVRDAAGNSVDAKTLEAIRQAIGLTVL-----QVKGH  416

Query  469   casakVPPETAAWSKTSFFFGSLL  398
                ++ PP+    S T F FG L 
Sbjct  417   MDQSESPPQD---SPTRFLFGGLF  437



>ref|XP_010936425.1| PREDICTED: uncharacterized protein LOC105056061 isoform X1 [Elaeis 
guineensis]
Length=453

 Score =   464 bits (1195),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 244/444 (55%), Positives = 309/444 (70%), Gaps = 25/444 (6%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E    R+NPPRV +DN SC + T+V+VDS NK GILLEVVQVL+DL+LI  KAY+S
Sbjct  13    DDEFEKFIRRMNPPRVVIDNESCANATVVRVDSANKYGILLEVVQVLTDLNLITKKAYIS  72

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTI----GYIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             SDGGWFMDVF+VTD+ G K+ + + +     YI K+LG     S  + +C  ++VGV   
Sbjct  73    SDGGWFMDVFNVTDRDGKKIREESKLDEIGNYIRKSLGAD---SAFVPSCR-RSVGVAPS  128

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              DYT IEL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ +  A+ D
Sbjct  129   SDYTVIELTGTDRPGLLSEVSAVLTSLKCNVVNAEVWTHNTRAASVMQVTDEETGLAIID  188

Query  1180  PSRLCVIEEQLKNILRACKDDNNI---AHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             P RL  I+E L N+L+     NNI   A T+VSMG TH DRRLHQM FADRDYE    D 
Sbjct  189   PERLSRIKELLCNVLKG----NNITRGAKTAVSMGVTHTDRRLHQMMFADRDYERS--DK  242

Query  1009  EADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPS  830
             +    S +PNV++ +  +K YSVV+++CKDRPKL+FD VCTLTDMQYVVFH  + ++GP 
Sbjct  243   DTANESHRPNVTVVNWFDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPE  302

Query  829   ASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVL  650
             A QEYYIRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ 
Sbjct  303   AYQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIF  362

Query  649   RENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaaca  470
             RENGL V RA VST G + +N FYVRD++GN VD K +E +R+ IG  ++          
Sbjct  363   RENGLTVIRAEVSTQGGKAINTFYVRDAAGNSVDAKTLEAIRQAIGLTVL-----QVKGH  417

Query  469   casakVPPETAAWSKTSFFFGSLL  398
                ++ PP+    S T F FG L 
Sbjct  418   MDQSESPPQD---SPTRFLFGGLF  438



>ref|XP_011009617.1| PREDICTED: uncharacterized protein LOC105114683 isoform X1 [Populus 
euphratica]
Length=447

 Score =   464 bits (1194),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 305/442 (69%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D E E L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  11    MDDECEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDGGWFMDVF+VTD  GNKVTD   + YI K+LGP+  + S +      ++VGV    D
Sbjct  71    SSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFISSM------RSVGVKQSMD  124

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ + +A+ DP 
Sbjct  125   HTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSAIIDPE  184

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             +L  I+E L N+L+        A T VS G TH +RRLHQM FADRDYE    D E D  
Sbjct  185   KLSRIKELLCNVLKGSNKSRG-AKTVVSHGVTHTERRLHQMMFADRDYERANND-ELD-E  241

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  EK YSVV++  KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  242   KQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEY  301

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YI+H+DG  + +E E+ R+++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  302   YIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  361

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T   + VN FYV D+SG PVD K I+ +R+ IGQ ++               
Sbjct  362   TVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTIL-----------KVKG  410

Query  454   VPPE---TAAWSKTSFFFGSLL  398
              P E    +  S T F FG L 
Sbjct  411   SPEELKPVSQESPTRFLFGGLF  432



>emb|CDP00474.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   465 bits (1197),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 304/441 (69%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  36    MDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQVLTDLNLIITKAYI  95

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF VTDQ GNK+TD   + YI+K+LGP    +  ++    ++VGV    D+
Sbjct  96    CSDGGWFMDVFKVTDQDGNKITDEGVLDYIQKSLGPDSCFASSMR----RSVGVVPAMDH  151

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V DK +  A+ DP R
Sbjct  152   TSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDKETGAAITDPER  211

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L +I++ L N+L+        A T VS G TH +RRLHQM FADRDYE      E     
Sbjct  212   LAMIKQLLCNVLKGSNKSRE-AKTVVSHGVTHTERRLHQMMFADRDYER--TGHETLNER  268

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FDI+CTLTDMQYVVFH  + ++GP A QEY 
Sbjct  269   ERPNVNVVNWCDKDYSVVTIRCKDRPKLLFDIICTLTDMQYVVFHGNVDAEGPEAHQEYC  328

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             +RH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  329   VRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  388

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA VST   +  N FYV D+SG P+D KII+ +R+ IGQ ++                
Sbjct  389   VTRAEVSTRAGKASNTFYVSDASGYPIDGKIIDSIRQTIGQTIL-----------RVKGC  437

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E   T   S T F FG L 
Sbjct  438   PEELNQTPQESPTRFLFGGLF  458



>ref|XP_006484247.1| PREDICTED: uncharacterized protein LOC102622082 [Citrus sinensis]
Length=449

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 229/403 (57%), Positives = 299/403 (74%), Gaps = 6/403 (1%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LI+TKAY+S
Sbjct  12    DDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYIS  71

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVF+VTD+ GNK+TD   + YI K LGP+   +  +K+     VGV    D+T
Sbjct  72    SDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMKS-----VGVKQSMDHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
             AIEL G DRPGLLSE++AVL +L  NVV+AEVWTHN R A ++ V D+ +  A+ DP RL
Sbjct  127   AIELTGSDRPGLLSEVTAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAITDPERL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
              VI+E L N+L+   + + +A T VS   TH +RRLHQM FADRDYE      ++     
Sbjct  187   SVIKELLCNVLKG-SNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTGDDSLDEKQ  245

Query  988   KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI  809
             +PNV++ +C +K YSVV++  KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY+I
Sbjct  246   RPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEYFI  305

Query  808   RHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLV  629
             RH+DG  + ++ E++RV++CL+AAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L V
Sbjct  306   RHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  365

Query  628   TRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             TRA V+T   + VN FYV  +SG PVD KII+ +R+ IGQ ++
Sbjct  366   TRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTIL  408



>ref|XP_010543092.1| PREDICTED: uncharacterized protein LOC104816118 [Tarenaya hassleriana]
 ref|XP_010543093.1| PREDICTED: uncharacterized protein LOC104816119 [Tarenaya hassleriana]
 ref|XP_010543094.1| PREDICTED: uncharacterized protein LOC104816120 [Tarenaya hassleriana]
Length=452

 Score =   463 bits (1192),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/407 (55%), Positives = 302/407 (74%), Gaps = 13/407 (3%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E E   IR+NPP+V++DN S +  T+VKVDS NK G LLEVVQVL+DLDL+I +AYVS
Sbjct  11    DNELEKFVIRMNPPKVTIDNTSSRKATLVKVDSANKRGSLLEVVQVLTDLDLLIRRAYVS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCP----GKNVGVNSL  1361
             SDG WFMDVFHVTD++GN+V + +    I+++LGP+        TC      ++VGV ++
Sbjct  71    SDGEWFMDVFHVTDKNGNRVMEEDIAETIQQSLGPR--------TCSFRARNRSVGVQAI  122

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              + T+IEL GRDRPGLLS++ AVL + + NVVAAEVWTHN R+A V+Y+ D+ + + +DD
Sbjct  123   SENTSIELTGRDRPGLLSDVFAVLTDNNCNVVAAEVWTHNSRMASVVYITDETTGSVIDD  182

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEAD  1001
             P R+  I++ L  +L   +D   IA+T+V MGSTH +RRLHQM + +RDY+   LD+ + 
Sbjct  183   PDRIAKIKQLLLYVLEGNRD-KRIANTAVLMGSTHKERRLHQMMYDNRDYDMTNLDVGST  241

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 KP +++++C +K Y+VV+++C DRPKL FD VCTLTDMQYVV+HA + ++GP A Q
Sbjct  242   SERRKPVITVENCTDKAYTVVNLRCIDRPKLFFDAVCTLTDMQYVVYHATVIAEGPEAYQ  301

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  + +E E+ R++ CLEAAI+RR SEG+RLELC +DRVGLLSDVTR+ REN
Sbjct  302   EYYIRHVDGGPVSSEAERQRLIHCLEAAIKRRTSEGIRLELCGEDRVGLLSDVTRIFREN  361

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             GL VTRA V+T G Q VN FYV DSSG PV ++ IE +R +IG+ ++
Sbjct  362   GLSVTRAEVTTRGSQAVNAFYVTDSSGKPVKSQTIETVRNQIGRTVL  408



>ref|XP_006437860.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
 gb|ESR51100.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
Length=445

 Score =   463 bits (1191),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 229/403 (57%), Positives = 299/403 (74%), Gaps = 6/403 (1%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQVL+DL+LI+TKAY+S
Sbjct  8     DDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYIS  67

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVF+VTD+ GNK+TD   + YI K LGP+   +  +K+     VGV    D+T
Sbjct  68    SDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMKS-----VGVKQSMDHT  122

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
             AIEL G DRPGLLSE++AVL +L  NVV+AEVWTHN R A ++ V D+ +  A+ DP RL
Sbjct  123   AIELTGSDRPGLLSEVTAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAITDPERL  182

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
              VI+E L N+L+   + + +A T VS   TH +RRLHQM FADRDYE      ++     
Sbjct  183   SVIKELLCNVLKG-SNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTGDDSLDEKQ  241

Query  988   KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYI  809
             +PNV++ +C +K YSVV++  KDRPKL+FD VCTLTDMQYVVFHA I ++GP A QEY+I
Sbjct  242   RPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEYFI  301

Query  808   RHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLV  629
             RH+DG  + ++ E++RV++CL+AAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L V
Sbjct  302   RHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  361

Query  628   TRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             TRA V+T   + VN FYV  +SG PVD KII+ +R+ IGQ ++
Sbjct  362   TRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTIL  404



>ref|XP_008340245.1| PREDICTED: uncharacterized protein LOC103403190 [Malus domestica]
Length=450

 Score =   463 bits (1191),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 233/407 (57%), Positives = 308/407 (76%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CW-PYF--DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW P    D E+E L++RINPPRV+VDN S +  T++KVDS NK G LLE+VQVL+DL+L
Sbjct  3     CWSPSLAADDEFEKLAMRINPPRVTVDNASSRKATLIKVDSANKRGSLLELVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK++D      I+++LGP+G +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAECIQQSLGPRGRSFPSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVL++L  NVVA EVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAATEHTTIELTGRDRPGLLSEVFAVLSDLKCNVVAGEVWTHNSRMASVVYITDEATGR  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP  L  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+    D
Sbjct  179   PIDDPEHLTKIKQLLLYVLKGSRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDMDDAD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++CV+KGY+VV+++C DRPKL+FD VCTLTDM+YVV+HA + ++GP
Sbjct  238   CGSASDRSKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC  DR GLLSDVTR+
Sbjct  298   EAYQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VNVFYV D+SGN V ++ IE +R+EIG
Sbjct  358   FRENGLSVTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIG  404



>ref|XP_010681133.1| PREDICTED: uncharacterized protein LOC104896128 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score =   462 bits (1190),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 236/439 (54%), Positives = 310/439 (71%), Gaps = 17/439 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L+ITKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNESCKNATVIQVDSANRHGILLEVVQILTDLNLVITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+V DQ GNK+TD   + YI+K+LGP         +C G++V V S  ++
Sbjct  71    SSDGGWFMDVFNVIDQDGNKITDEEILDYIQKSLGPDS-------SCFGRSVDVLSSTEH  123

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIELIGRDRPGLLSE++AVL +L  NVV+AE+WTHN R A V+ + D+ +  A+ D  R
Sbjct  124   TAIELIGRDRPGLLSELTAVLTHLKCNVVSAEIWTHNTRAAAVMQITDQGTGYAITDEER  183

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMG-STHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             L  I+E L N+L + +     A T V+   + H +RRLHQM F DRDYE    D E +  
Sbjct  184   LSRIKELLCNVLGSSQSKE--AKTEVNTHVAIHAERRLHQMMFDDRDYEQ-IGDEEDEDE  240

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  +K YSVVSV+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QEY
Sbjct  241   RQRPNVSVVNWYDKDYSVVSVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDAEGSEAYQEY  300

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  + +E E+ RV++CLEAAI+RRVSEGL+LELC  DR GLLSDVTR+ REN L
Sbjct  301   YIRHVDGSPVKSEAERQRVIQCLEAAIKRRVSEGLKLELCTTDRAGLLSDVTRIFRENSL  360

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VT+A V+T G + VN+FYVRD+SG  VD K I+ +R+ IGQ ++            S +
Sbjct  361   TVTQAEVTTRGGKAVNIFYVRDASGYNVDAKTIDSIRQVIGQTIL------KVKGNGSKE  414

Query  454   VPPETAAWSKTSFFFGSLL  398
                + A  +++ F FG L 
Sbjct  415   RKQKVAQETQSGFLFGGLF  433



>gb|KDP41357.1| hypothetical protein JCGZ_15764 [Jatropha curcas]
Length=447

 Score =   462 bits (1189),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 306/442 (69%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+LIITKAY+
Sbjct  11    MDDEYEKLFRRLNPPRVVIDNESCKNATVIRVDSANKHGILLEVVQVLTDLNLIITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDGGWFMDVF+V DQ GNK+ D   + YI K+LGP+  + S +      ++VGV     
Sbjct  71    SSDGGWFMDVFNVRDQDGNKIIDEAILDYIRKSLGPESCFISSM------RSVGVKPSTG  124

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL G DRPGLLSE+SAVL +L  +VV AEVWTHN R A V+ V D+ + +A+ DP 
Sbjct  125   HTAIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMQVTDEETGSAITDPE  184

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL  I+  L N+L+        A T VS G+TH +RRLHQM FADRDYE    D+  +  
Sbjct  185   RLSRIKGLLCNVLKGSNKSRG-AKTVVSHGATHTERRLHQMMFADRDYERADDDVLDE--  241

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNVS+ +  +K YSVV+++ KDRPKL+FD VCTLTDM+YVVFHA I ++GP A QEY
Sbjct  242   KQRPNVSVVNLYDKDYSVVTIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAYQEY  301

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DR+GLLSDVTR+ REN L
Sbjct  302   YIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFRENSL  361

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T   + +N FYVRD+SG PVD K I+ +R+ IGQ ++               
Sbjct  362   TVTRAEVTTRDGKALNTFYVRDASGYPVDAKTIDSIRQVIGQTIL-----------KVKG  410

Query  454   VPPETAAWSK---TSFFFGSLL  398
              P E    S+   T F FG L 
Sbjct  411   NPEEVKQVSQESPTRFLFGGLF  432



>ref|XP_009372243.1| PREDICTED: uncharacterized protein LOC103961427 [Pyrus x bretschneideri]
Length=450

 Score =   462 bits (1189),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 232/407 (57%), Positives = 306/407 (75%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWP---YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L++RINPPRV+VDN S    T++KVDS NK G LLE+VQVL+DL+L
Sbjct  3     CWSPSLAVDDEFEKLALRINPPRVTVDNASSGKATLIKVDSANKRGSLLELVQVLNDLNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             II +AY+SSDG WFMDVFHVTDQ GNK++D      I+++LGP+G +   L+    ++VG
Sbjct  63    IIRRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAECIQQSLGPRGRSFPSLR----RSVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V +  ++T IEL GRDRPGLLSE+ AVL++L  NVVA EVWTHN R+A V+Y+ D+ +  
Sbjct  119   VQAATEHTTIELTGRDRPGLLSEVFAVLSDLKCNVVAGEVWTHNSRMASVVYITDEATGR  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +DDP  L  I++ L  +L+  +D  + A+T+VS+GSTH +RRLHQM +ADRDY+    D
Sbjct  179   PIDDPEHLAKIKQLLLYVLKGNRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDMDDAD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               +     KP V++++CV+KGY+VV+++C DRPKL+FD VCTLTDM+YVV+HA + ++GP
Sbjct  238   CGSASDRSKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH DGC + +EGE+ RV+ CLEAAI+RR SEG+RLELC  DR GLLSDVTR+
Sbjct  298   EAYQEYYIRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL VTRA V+T G Q VNVFYV D+SGN V ++ IE +R+EIG
Sbjct  358   FRENGLSVTRAEVATRGSQAVNVFYVTDASGNQVKSETIEAVRQEIG  404



>ref|XP_009611121.1| PREDICTED: uncharacterized protein LOC104104686 isoform X1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   462 bits (1189),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 313/443 (71%), Gaps = 18/443 (4%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L +R+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+DL+LII +AY+S
Sbjct  11    DDEFEKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTD++GNK+++ N    I+++LGP+G +   L     ++VGV S  + T
Sbjct  71    SDGEWFMDVFHVTDEYGNKLSEDNVAERIQQSLGPRGCSFRSL----ARSVGVQSAAEQT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSEI AVL +   NV+AAEVWTHN R+A V+Y++D+ +  A+DD  RL
Sbjct  127   TIELTGRDRPGLLSEIFAVLTDHRCNVIAAEVWTHNSRMASVVYISDEENGLAIDDTDRL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS-  992
               I + L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY+      + +C S 
Sbjct  187   AKIRQLLLYVLKGDRDRPS-ANTAVSVDSTHKERRLHQMMYADRDYDKD----DTNCISS  241

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                KP V++++C +KGY+VV+++  DRPKL+FD VCTLTDMQYVV+H  I ++G  A QE
Sbjct  242   DRTKPLVTVENCTDKGYTVVNLRGPDRPKLIFDTVCTLTDMQYVVYHGTIIAEGREAYQE  301

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YYIRHMDGC + +E E+ RV++CLEAAI+RR S G+RLELC  DR+G LSDVTR+ RENG
Sbjct  302   YYIRHMDGCPISSEAERQRVIQCLEAAIKRRTSNGIRLELCGDDRIGFLSDVTRIFRENG  361

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L V+RA V+T G Q VNVFYV D+SG+ V ++ IE +RKEIGQ ++             +
Sbjct  362   LSVSRAEVTTRGSQAVNVFYVTDASGSQVKSETIEAVRKEIGQTVL------RVKDDVYS  415

Query  457   kVPPETAAWSKTSFFFGSLLGKF  389
               PP+  A       F S   KF
Sbjct  416   DSPPQQTARFSLGHIFRSSSEKF  438



>ref|XP_002297856.1| hypothetical protein POPTR_0001s13490g [Populus trichocarpa]
 gb|ABK95686.1| unknown [Populus trichocarpa]
 gb|EEE82661.1| hypothetical protein POPTR_0001s13490g [Populus trichocarpa]
Length=448

 Score =   462 bits (1189),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 306/406 (75%), Gaps = 8/406 (2%)
 Frame = -1

Query  1723  CWPYF--DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLI  1550
             CW     D E+E L IR+NPPRV+VDN S +  T++KVDS NK G LLEVVQVL+DL+LI
Sbjct  3     CWSPLTTDDEFEKLVIRMNPPRVTVDNASSRKATLIKVDSANKRGSLLEVVQVLTDLNLI  62

Query  1549  ITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGV  1370
             I +AY+SSDG WFMDVF+VTDQHGNK+++ +    I+++LGP+G +   L+    ++VGV
Sbjct  63    IRRAYISSDGEWFMDVFYVTDQHGNKLSEDDVAERIQQSLGPRGRSFRSLR----RSVGV  118

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
              +  + T IEL GRDRPGLLSEI A+L +L  NVVA+EVWTHN R+A V+Y+ D+ +   
Sbjct  119   QAAAENTTIELTGRDRPGLLSEIFAILTDLKCNVVASEVWTHNSRMASVVYITDEATGLP  178

Query  1189  VDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             +DDP RL  I++ L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY+    D 
Sbjct  179   IDDPDRLTKIKQLLLYVLKGDRDKRS-ANTAVSVDSTHKERRLHQMMYADRDYDMDDADF  237

Query  1009  EADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPS  830
                    KP V++++CV+KGY++V+++C DRPKL+FD VCTLTDMQYVV+H  I ++GP 
Sbjct  238   -GSASERKPFVTLENCVDKGYTIVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEGPE  296

Query  829   ASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVL  650
             A QEY+IRHMDG  + +E E+ RV+ CLEAAI+RR SEG+RLELC++DRVGLLSDVTR+ 
Sbjct  297   ACQEYFIRHMDGSPVSSEAERQRVINCLEAAIRRRTSEGVRLELCSEDRVGLLSDVTRIF  356

Query  649   RENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             RENGL VTRA V+T G Q VNVFYV DSSG PV  + IE +RKEIG
Sbjct  357   RENGLSVTRAEVTTRGSQAVNVFYVTDSSGYPVKNETIEAVRKEIG  402



>emb|CDX95965.1| BnaA07g27660D [Brassica napus]
Length=455

 Score =   462 bits (1189),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 307/441 (70%), Gaps = 15/441 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DLDL ITKAY+
Sbjct  12    MDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLTITKAYI  71

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  72    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  126

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D ++ +AV DP R
Sbjct  127   TVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSDPER  186

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADC--  998
             L  I+  L+N+L+        A T VS+G  H DRRLHQM F DRDY+   LD E+    
Sbjct  187   LSRIKSLLRNVLKGSNTPKE-AKTVVSLGEVHTDRRLHQMMFEDRDYKN--LDDESSNVQ  243

Query  997   -PSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A Q
Sbjct  244   DERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQ  303

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYY+RH+DG  + ++ EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN
Sbjct  304   EYYVRHIDGSPVKSDAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFREN  363

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V T G + VN FYV D+SG  +D K I+ +R+ IG+ ++    K        
Sbjct  364   SLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTIL--KVKNKPKEQQQ  421

Query  460   akVPPETAAWSKTSFFFGSLL  398
              + PP  +  S T F FG L 
Sbjct  422   REKPP--SQESPTRFLFGGLF  440



>ref|XP_010929566.1| PREDICTED: uncharacterized protein LOC105051015 isoform X1 [Elaeis 
guineensis]
Length=463

 Score =   462 bits (1189),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 234/418 (56%), Positives = 303/418 (72%), Gaps = 21/418 (5%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY  L IR+NPPRV+VDN S K  T+VKVDS N+ G LLEVVQ ++DL+L I +AYVS
Sbjct  10    DDEYGKLVIRMNPPRVTVDNTSSKKATLVKVDSSNRHGSLLEVVQAITDLNLTIRRAYVS  69

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEK-------------ALGPKGYTSDVLKTCP  1388
             SDG WFMDVFHV DQ GNK+ D   I  I++             +LG K +    L+   
Sbjct  70    SDGEWFMDVFHVVDQDGNKLHDSEVIDRIQQISAGNINKDFRTMSLGAKAFDLWSLR---  126

Query  1387  GKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVND  1208
              ++VGV + G +T IELIGR+RPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D
Sbjct  127   -RSVGVQASGVHTTIELIGRNRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITD  185

Query  1207  KVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYE  1028
             + +   +DD  RL  I++ L+ +L+  +D  + A+T++S+G TH +RRLHQM +ADRDY+
Sbjct  186   EATGGPIDDADRLSKIKQLLRYVLKGNRDKRS-ANTAISLGVTHTERRLHQMMYADRDYD  244

Query  1027  GGCLDMEADCPS--LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHA  854
              G  D E + PS   K  V++++C +KGYSVV+V+CKDRPKL+FD VCTLTDMQYVVFHA
Sbjct  245   RGDAD-EEESPSDRRKLQVTVENCTDKGYSVVNVRCKDRPKLLFDTVCTLTDMQYVVFHA  303

Query  853   AISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGL  674
              + ++GP A QEYYIRH DG  + +E E+ R++ CLEAAI+RR +EG+RLELC  DRVGL
Sbjct  304   TLIAEGPEAYQEYYIRHSDGLPISSEAERQRLILCLEAAIKRRNTEGVRLELCCDDRVGL  363

Query  673   LSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             LSDVTR+ RENGL VT A VST G Q VNVFYV D+SGNPV ++ IE +R EIG+ ++
Sbjct  364   LSDVTRIFRENGLTVTCAEVSTRGSQAVNVFYVMDASGNPVQSRTIEAIRNEIGEAIL  421



>ref|XP_008776535.1| PREDICTED: uncharacterized protein LOC103696629 [Phoenix dactylifera]
Length=451

 Score =   462 bits (1188),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 300/405 (74%), Gaps = 8/405 (2%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY  L IR+NPPRV+VDN S K  T+VKVDSVN+ G LLEVVQ L+DL+L I +AY+S
Sbjct  11    DDEYGKLVIRMNPPRVTVDNTSSKKATLVKVDSVNRHGSLLEVVQALTDLNLTIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHV DQ GNK+     I  I+++LG K +   +L+    + VGV +   +T
Sbjct  71    SDGEWFMDVFHVVDQDGNKLHGSEVIDRIQQSLGAKAFDLWLLR----RTVGVQASAAHT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IELIGR+RPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D+ +  A+DD   L
Sbjct  127   TIELIGRNRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGGAIDDADHL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL  989
               I+  L  +L+   D  + A T++S+G TH +RRLHQM +ADRDY+ G +D E + PS 
Sbjct  187   SKIKLLLCYVLKGNPDKRS-AKTAISLGVTHTERRLHQMMYADRDYDRGDVD-EEESPSD  244

Query  988   KPN--VSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
             +    V++++C +KGYSVV+V+CKDRPKL+FD VCTLTDMQYVVFHA + ++GP A QEY
Sbjct  245   QSKLLVTVENCSDKGYSVVNVRCKDRPKLLFDTVCTLTDMQYVVFHATLIAEGPEAYQEY  304

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  + +E E+ R++ CLEAAI+RR +EG+RLELC  DR+GLLSDVTR+ RENGL
Sbjct  305   YIRHLDGFPISSEAERRRLILCLEAAIKRRNTEGVRLELCCDDRIGLLSDVTRIFRENGL  364

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
              VT A VST G Q VNVFYV D+SGNPV ++ IE +R EIG+ ++
Sbjct  365   TVTCAEVSTRGSQAVNVFYVMDASGNPVQSQTIEAVRNEIGETIL  409



>ref|XP_006437973.1| hypothetical protein CICLE_v10031521mg [Citrus clementina]
 ref|XP_006484166.1| PREDICTED: uncharacterized protein LOC102625080 isoform X1 [Citrus 
sinensis]
 ref|XP_006484167.1| PREDICTED: uncharacterized protein LOC102625080 isoform X2 [Citrus 
sinensis]
 gb|ESR51213.1| hypothetical protein CICLE_v10031521mg [Citrus clementina]
Length=450

 Score =   461 bits (1187),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 299/397 (75%), Gaps = 5/397 (1%)
 Frame = -1

Query  1702  EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSD  1523
             E+E L +R+NPPRV+VDN S +  T++KVDS NK G LLE+VQVL+DLDLII +AY+SSD
Sbjct  13    EFEKLVLRMNPPRVTVDNTSSRKATLIKVDSANKRGSLLELVQVLNDLDLIIRRAYISSD  72

Query  1522  GGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAI  1343
             G WFMDVFHVTDQ+GNK+++ +    I+++LGP+  +   L+    ++VGV +  ++T I
Sbjct  73    GEWFMDVFHVTDQNGNKLSEDDVSERIQQSLGPRARSFRSLR----RSVGVQAALEHTTI  128

Query  1342  ELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCV  1163
             EL GRDRPGLLSE+ AVL++L  NV+ AEVWTHN R+A V+Y+  + +   +DDP  L  
Sbjct  129   ELTGRDRPGLLSEVFAVLSDLKCNVMGAEVWTHNSRMASVVYITSEATGLPIDDPDTLAK  188

Query  1162  IEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSLKP  983
             I++ L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY+    +  +     KP
Sbjct  189   IKQLLLYVLKGDRDKRS-ANTAVSVDSTHKERRLHQMMYADRDYDMNYAESGSASGRSKP  247

Query  982   NVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRH  803
              V+++ C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++ P A QEYYIRH
Sbjct  248   LVTVESCTDKGYTVVNLRCPDRPKLLFDAVCTLTDMQYVVYHATVIAESPEAYQEYYIRH  307

Query  802   MDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTR  623
             +DG  + +E E+ RV+ CLEAAI+RR SEG+ LELC +DR GLLSDVTR+ RENGL VTR
Sbjct  308   VDGNPISSEAERQRVINCLEAAIKRRTSEGISLELCCEDRAGLLSDVTRIFRENGLSVTR  367

Query  622   AGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             A V+T G Q VNVFYV D+SGNPV ++ IE +RKEIG
Sbjct  368   AEVTTRGSQAVNVFYVVDASGNPVKSETIESVRKEIG  404



>ref|XP_003614264.1| ACR4 [Medicago truncatula]
 gb|AES97222.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=451

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/418 (56%), Positives = 304/418 (73%), Gaps = 8/418 (2%)
 Frame = -1

Query  1753  YSTAVDMARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQ  1574
             + + V+M+ +   Y D EYE L  R+NPPRV +DN + ++ T+++VDS NK GILLEVVQ
Sbjct  3     FISEVNMSYSQSHYMDDEYEKLFRRMNPPRVVIDNGASQNATVIRVDSANKQGILLEVVQ  62

Query  1573  VLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKT  1394
             +L+DL+LIITKAY+SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LGP+   +  +++
Sbjct  63    ILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEVILDYIRKSLGPESCFATTMRS  122

Query  1393  CPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYV  1214
                  VGV    D+TAIEL+G DRPGLLSE+SAVL NL  N+V AEVWTHN R A V++V
Sbjct  123   -----VGVKQTPDHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHV  177

Query  1213  NDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRD  1034
              D+ + +A+ D  RL +I+E L N+L         A T V+  STH DRRLHQM F DRD
Sbjct  178   TDEETGSAITDSQRLSLIKELLCNVLGGGNRKRG-AKTVVTDDSTHTDRRLHQMMFDDRD  236

Query  1033  YEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHA  854
             YE   +D +      +PNV + +  +K YSVV+++C+DRPKL+FD VCTLTDMQYVVFHA
Sbjct  237   YER--VDDDDFDEKQRPNVDVVNWSDKDYSVVTIECRDRPKLVFDTVCTLTDMQYVVFHA  294

Query  853   AISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGL  674
              I ++GP A QEYYI+H+DG  + ++ E+ RV+ CLEAAI+RRVSEGL+LELC  DRVGL
Sbjct  295   NIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGL  354

Query  673   LSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             LS+VTR+ REN L VTRA V+T G + VN FYVR +SG  VD+K IE +R+ IG  ++
Sbjct  355   LSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCIVDSKTIESIRQTIGNTIL  412



>dbj|BAJ33767.1| unnamed protein product [Thellungiella halophila]
Length=451

 Score =   461 bits (1186),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 239/439 (54%), Positives = 304/439 (69%), Gaps = 12/439 (3%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+S
Sbjct  8     DDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYIS  67

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  ++T     VGV    D T
Sbjct  68    SDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSSSMRT-----VGVIPSTDST  122

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D  +  A+ DP RL
Sbjct  123   VIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDPERL  182

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS-  992
               I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++     
Sbjct  183   SRIKNLLRNVLKGSNTPRE-AKTVVSQGEVHTDRRLHQMMFEDRDYEHRVVDDDSSIQDE  241

Query  991   -LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ +DG  A QEY
Sbjct  242   RQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTDGTEAYQEY  301

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             Y+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L
Sbjct  302   YVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  361

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V T G + +N FYV D+SG  +D K ++ +R+ IGQ  +L VK          K
Sbjct  362   TVTRAEVKTKGGKALNTFYVSDASGYSIDAKTLDSIRQTIGQ-TILKVKNNPEEQQQRQK  420

Query  454   VPPETAAWSKTSFFFGSLL  398
              P +    S T F FG L 
Sbjct  421   SPSQE---SPTRFLFGGLF  436



>ref|XP_007045767.1| ACT domain repeat 4 [Theobroma cacao]
 gb|EOY01599.1| ACT domain repeat 4 [Theobroma cacao]
Length=485

 Score =   462 bits (1188),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 238/442 (54%), Positives = 306/442 (69%), Gaps = 24/442 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LII KAY+
Sbjct  11    MDDEYEKFIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIINKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG-YTSDVLKTCPGKNVGVNSLGD  1355
             SSDG WFMDVF+VTDQ GNK+ D   + YI K+LGP+  +TS +      +++GV    D
Sbjct  71    SSDGNWFMDVFNVTDQDGNKIVDEGILDYIMKSLGPESCFTSSM------RSIGVKQSMD  124

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             +TAIEL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+    A+ DP 
Sbjct  125   HTAIELTGSDRPGLLSEVSAVLRHLKCNVVNAEVWTHNTRAAAVMQVTDEEKGTAITDPE  184

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL  I+  L N+L+   + +++A T VS   TH +RRLHQM FADRDYE    D+  D  
Sbjct  185   RLSRIKALLCNVLKGS-NKSSLAKTVVSHSVTHTERRLHQMMFADRDYERTGDDVLDD--  241

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +PNV + +  +K YSVV+++CKDRPKL+FD VCTLTDM YVVFHA I ++GP + QEY
Sbjct  242   KQRPNVDVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMDYVVFHANIDTEGPESYQEY  301

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  + ++ E+ RV +CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L
Sbjct  302   YIRHIDGSPVKSDAERQRVTQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  361

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T   + VN FYVRD+SG PVD K I+ +R+ IGQ ++               
Sbjct  362   TVTRAEVTTKAGKAVNTFYVRDTSGYPVDAKTIDSIRQVIGQTIL-----------KVKG  410

Query  454   VPPETAAWSK---TSFFFGSLL  398
              P ++ + S+   T F FG L 
Sbjct  411   SPEDSKSVSQESPTRFLFGGLF  432



>ref|XP_006391062.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
 gb|ESQ28348.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
Length=455

 Score =   461 bits (1185),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 239/439 (54%), Positives = 304/439 (69%), Gaps = 12/439 (3%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+S
Sbjct  12    DDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYIS  71

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  ++T     VGV    D T
Sbjct  72    SDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSSSMRT-----VGVIPSTDST  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D  +  A+ DP RL
Sbjct  127   VIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDPERL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS-  992
               I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++     
Sbjct  187   SRIKNLLRNVLKGSNTPRE-AKTVVSQGEVHTDRRLHQMMFEDRDYEHRVVDDDSSIQDE  245

Query  991   -LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
               +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ +DG  A QEY
Sbjct  246   RQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTDGTEAYQEY  305

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             Y+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN L
Sbjct  306   YVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  365

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V T G + +N FYV D+SG  +D K ++ +R+ IGQ  +L VK          K
Sbjct  366   TVTRAEVKTKGGKALNTFYVSDASGYSIDAKTLDSIRQTIGQ-TILKVKNNPEEQQQRQK  424

Query  454   VPPETAAWSKTSFFFGSLL  398
              P +    S T F FG L 
Sbjct  425   SPSQE---SPTRFLFGGLF  440



>ref|XP_004297204.1| PREDICTED: uncharacterized protein LOC101300715 [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   460 bits (1183),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 297/404 (74%), Gaps = 7/404 (2%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ T+++VDS NK GILLEVVQ+L+DL+LI+TKAY+
Sbjct  11    MDDEYEKLCRRMNPPRVVIDNEACKNATVIRVDSANKLGILLEVVQILTDLNLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI K+LGP+   +  +++     VGV    D+
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEGVLDYIRKSLGPESCFASSMRS-----VGVIQSMDH  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T +EL G DRPGLLSE+SAVLA L  NVV A+VWTHN R A V+++ ++ +  A+ DP R
Sbjct  126   TTLELSGTDRPGLLSEVSAVLAILKCNVVGAQVWTHNTRAASVMHITNEETGLAITDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I E + N+L+        + T VS   TH +RRLHQM FADRDY+    D       
Sbjct  186   LASIRESVCNVLKGSIKSRG-SRTVVSHTVTHPERRLHQMMFADRDYDR-IKDESVLDDK  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +P+V++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVV+HA I ++GP A QEYY
Sbjct  244   QRPDVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVYHANIDAEGPEAYQEYY  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  304   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             VTRA V+T   + VN FYVR++SGNPVD+K IE +R+EIGQ ++
Sbjct  364   VTRAEVTTKAGKAVNTFYVREASGNPVDSKTIESIRQEIGQTIL  407



>ref|XP_010241627.1| PREDICTED: uncharacterized protein LOC104586168 [Nelumbo nucifera]
Length=496

 Score =   462 bits (1188),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 230/433 (53%), Positives = 304/433 (70%), Gaps = 26/433 (6%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPP--RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSD  1562
             M + CWPYFDPE+E  + RI+ P  RV +DN S +DCTIVKVDSVNK G+LL+VVQ L++
Sbjct  1     MKKVCWPYFDPEFENFTERIHGPSCRVCIDNESFEDCTIVKVDSVNKQGLLLQVVQALTE  60

Query  1561  LDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGK  1382
             ++L I+K+Y+SSD  WFMDVFHVTD+HGNK+TD N I  I++ +  +    D  +   G 
Sbjct  61    MNLFISKSYISSDAEWFMDVFHVTDEHGNKLTDQNVINRIQQVIAKRKDPRDSSQVKSGA  120

Query  1381  NVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKV  1202
               G  + G++TAIEL G DRPGL SEISAVL +L  NVV A  W+HN+R+ACV Y++D+ 
Sbjct  121   GTGRENTGEHTAIELTGTDRPGLFSEISAVLKDLKCNVVEAHAWSHNERLACVAYISDQS  180

Query  1201  SCNAVDDPSRLCVIEEQLKNILRAC------KDDNNIAHTSV--------SMGSTHIDRR  1064
             + + +DDP RL  IEE L  +L A        D+  +    +         + +T+++RR
Sbjct  181   TDSPIDDPRRLATIEEHLATVLGATINGSGTHDEQGVKTAGLPPPGGSINGITTTNVERR  240

Query  1063  LHQMFFADRDYEGGCLDME-ADCPS---------LKPNVSIDHCVEKGYSVVSVKCKDRP  914
             LHQ+ FA RD++G   +   +  PS          K  V+I+ C EK YSVV+V+CKDRP
Sbjct  241   LHQLMFAGRDFDGPPANASLSALPSPAEGEEERNKKIIVTIESCNEKRYSVVTVECKDRP  300

Query  913   KLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAI  734
             KLMFD VCTLTDMQYV+FHA+IS  G SA QEYYIRH++GC L+TE EK RV+KCLEAA+
Sbjct  301   KLMFDTVCTLTDMQYVIFHASISPHGDSAFQEYYIRHINGCPLNTESEKQRVIKCLEAAL  360

Query  733   QRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNP  554
             +RRV EG+RL+LCA +R+GLLSD+TR+LRE GL V RA V T GE+ V+ FYVRD SGN 
Sbjct  361   ERRVCEGVRLKLCANNRIGLLSDITRLLREYGLAVVRADVETQGEKAVDAFYVRDISGNE  420

Query  553   VDTKIIEGLRKEI  515
             VD KI+E +++E+
Sbjct  421   VDMKIVESMKREM  433



>ref|XP_009127699.1| PREDICTED: uncharacterized protein LOC103852547 [Brassica rapa]
Length=457

 Score =   460 bits (1183),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 304/443 (69%), Gaps = 16/443 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  11    MDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S      P + +GV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFS-----TPMRTIGVTPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D  +  A+ DP R
Sbjct  126   TVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T +S G  H DRRLHQM F DRDYE   + ++ D  S
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTVLSHGEVHTDRRLHQMMFEDRDYEHRAV-VDDDSSS  243

Query  991   L-----KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
             +     +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A
Sbjct  244   IQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  303

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEYY+RH+DG  + +E EK RVV+CLEAAI RRVSEGL+LELC  DRVGLLS+VTR+ R
Sbjct  304   YQEYYVRHIDGSPVKSEAEKQRVVQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  363

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacac  467
             EN L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ ++    K      
Sbjct  364   ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTIL--KVKNNPEEQ  421

Query  466   asakVPPETAAWSKTSFFFGSLL  398
                + PP  +  S T F FG L 
Sbjct  422   QQRQKPP--SQESPTRFLFGGLF  442



>ref|XP_011036119.1| PREDICTED: uncharacterized protein LOC105133725 [Populus euphratica]
Length=448

 Score =   459 bits (1182),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 231/410 (56%), Positives = 309/410 (75%), Gaps = 8/410 (2%)
 Frame = -1

Query  1723  CWP--YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLI  1550
             CW     + E+E L IR+NPPRV+VDN S +  T++KVDS NK G LLEVVQVL+DL+L+
Sbjct  3     CWSPLTMNDEFEKLVIRMNPPRVTVDNASSRKATLIKVDSANKRGSLLEVVQVLTDLNLL  62

Query  1549  ITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGV  1370
             IT+AY+SSDG WFMDVF+VTDQHGNK+++ +    I+++LGP+G +   L+    ++VGV
Sbjct  63    ITRAYISSDGEWFMDVFYVTDQHGNKLSEDDVAERIQQSLGPRGRSFRSLR----RSVGV  118

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
              +  + T IEL GRDRPGLLSEI A+L +L  NVVA+EVWTHN R+A V+Y+ D+ +   
Sbjct  119   QAAAENTTIELTGRDRPGLLSEIFAILTDLKCNVVASEVWTHNSRMASVVYITDEATGLP  178

Query  1189  VDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             +DDP RL  I++ L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY+    D 
Sbjct  179   IDDPDRLTKIKQLLLYVLKGDRDKRS-ANTAVSVDSTHKERRLHQMMYADRDYDMDDADF  237

Query  1009  EADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPS  830
                    KP V++++CV+KGY++V+++C DRPKL+FD VCTLTDMQYVV+H  I ++GP 
Sbjct  238   -GSASGRKPFVTVENCVDKGYTIVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEGPE  296

Query  829   ASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVL  650
             A QEY+IRH+DG  + +E E+ RV+ CLEAAI+RR SEG+RLELC++DRVGLLSDVTR+ 
Sbjct  297   ACQEYFIRHVDGSPVSSEAERQRVINCLEAAIRRRTSEGVRLELCSEDRVGLLSDVTRIF  356

Query  649   RENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             RENGL VTRA V+T G Q VNVFYV DSSG PV  + IE +RKEIG  ++
Sbjct  357   RENGLSVTRAEVTTRGFQAVNVFYVTDSSGYPVKNETIEAVRKEIGSTIL  406



>gb|KDO81815.1| hypothetical protein CISIN_1g044728mg [Citrus sinensis]
Length=450

 Score =   459 bits (1182),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 298/397 (75%), Gaps = 5/397 (1%)
 Frame = -1

Query  1702  EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSD  1523
             E+E L +R+NPPRV+VDN S +  T++KVDS NK G LLE+VQVL+DLDLII +AY+SSD
Sbjct  13    EFEKLVLRMNPPRVTVDNTSNRKATLIKVDSANKRGSLLELVQVLNDLDLIIRRAYISSD  72

Query  1522  GGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAI  1343
             G WFMDVFHVTDQ+GNK+++ +    I+++LGP+  +   L+    ++VGV +  ++T I
Sbjct  73    GEWFMDVFHVTDQNGNKLSEDDVSERIQQSLGPRARSFRSLR----RSVGVQAALEHTTI  128

Query  1342  ELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCV  1163
             EL GRDRPGLLSE+ AVL++L  NV+ AEVWTHN R+A V+Y+  + +   +DDP  L  
Sbjct  129   ELTGRDRPGLLSEVFAVLSDLKCNVMGAEVWTHNSRMASVVYITSEATGLPIDDPDTLAK  188

Query  1162  IEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSLKP  983
             I+  L  +L+  +D  + A+T+VS+ STH +RRLHQM +ADRDY+    +  +     KP
Sbjct  189   IKRLLLYVLKGDRDKRS-ANTAVSVDSTHKERRLHQMMYADRDYDMNYAESGSASGRSKP  247

Query  982   NVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRH  803
              V+++ C +KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA + ++ P A QEYYIRH
Sbjct  248   LVTVESCTDKGYTVVNLRCPDRPKLLFDAVCTLTDMQYVVYHATVIAESPEAYQEYYIRH  307

Query  802   MDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTR  623
             +DG  + +E E+ RV+ CLEAAI+RR SEG+ LELC +DR GLLSDVTR+ RENGL VTR
Sbjct  308   VDGNPISSEAERQRVINCLEAAIKRRTSEGISLELCCEDRAGLLSDVTRIFRENGLSVTR  367

Query  622   AGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             A V+T G Q VNVFYV D+SGNPV ++ IE +RKEIG
Sbjct  368   AEVTTRGSQAVNVFYVVDASGNPVKSETIESVRKEIG  404



>emb|CDY65806.1| BnaA02g35780D [Brassica napus]
Length=453

 Score =   459 bits (1182),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 304/443 (69%), Gaps = 16/443 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  7     MDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S      P + +GV    D 
Sbjct  67    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFS-----TPMRTIGVTPSTDS  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D  +  A+ DP R
Sbjct  122   TVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDPER  181

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T +S G  H DRRLHQM F DRDYE   + ++ D  S
Sbjct  182   LSRIKNLLRNVLKGSNTPRE-AKTVLSHGEVHTDRRLHQMMFEDRDYEHRAV-VDDDSSS  239

Query  991   L-----KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
             +     +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A
Sbjct  240   IQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  299

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEYY+RH+DG  + +E EK RVV+CLEAAI RRVSEGL+LELC  DRVGLLS+VTR+ R
Sbjct  300   YQEYYVRHIDGSPVKSEAEKQRVVQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacac  467
             EN L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ ++    K      
Sbjct  360   ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTIL--KVKNNPEEQ  417

Query  466   asakVPPETAAWSKTSFFFGSLL  398
                + PP  +  S T F FG L 
Sbjct  418   QQRQKPP--SQESPTRFLFGGLF  438



>ref|XP_008445429.1| PREDICTED: uncharacterized protein LOC103488452 [Cucumis melo]
Length=448

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 307/450 (68%), Gaps = 22/450 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EY  L  R+NPPRV +DN +CKD T+++VDS NK GILLE VQVL+DL+LI+TKAY+
Sbjct  11    IDDEYVKLIRRMNPPRVVIDNDACKDATVIRVDSANKHGILLEAVQVLTDLNLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             S DG WFMDVF+VTDQ GNKVTD   + YI+++L      SD       ++VGV    DY
Sbjct  71    SCDGCWFMDVFNVTDQDGNKVTDEGVLDYIKRSL-----ESDSCFASSMRSVGVKPSVDY  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIELIG DR GLLSE+SAVL +L  NVV AEVWTHN R A V++V D  + +A+ D  R
Sbjct  126   TAIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSAITDLER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L N+LR     +N A T VS G THI+RRLHQM FADRDYE   LD +A    
Sbjct  186   LSRIKGLLSNVLRGSNSRSNGAKTVVSHGVTHIERRLHQMMFADRDYE--LLDEDAMEDQ  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV + +  +  YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA + ++G  A QEYY
Sbjct  244   QRPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEAYQEYY  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  304   IRHIDGSPVKSDAERQRVIQCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + +N FYVRD SG PVD+K I+ +R+ IGQ ++             +  
Sbjct  364   VTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTIL---------KVKGSSS  414

Query  451   PPETAAWSK---TSFFFGSLLGKFRA*NLV  371
             P E    S+   T F FG   G FR+ + V
Sbjct  415   PKEQKQASQDSPTRFLFG---GLFRSRSFV  441



>ref|XP_010928327.1| PREDICTED: uncharacterized protein LOC105050129 isoform X2 [Elaeis 
guineensis]
 ref|XP_010928328.1| PREDICTED: uncharacterized protein LOC105050129 isoform X2 [Elaeis 
guineensis]
Length=468

 Score =   459 bits (1182),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 311/457 (68%), Gaps = 25/457 (5%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPE+E L+ +I  PRV+VDN SC  CT+VKVDS+NK G+LLEVVQVLSD+DL+I+K+
Sbjct  6     PYFDPEFENLNEKIYGPRVTVDNESCDKCTVVKVDSLNKQGLLLEVVQVLSDMDLVISKS  65

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG--YTSDVLKTCPGKNVGVNS  1364
             Y+SSD  WFMDVFHV DQ GNKV D   I YI++A+G K     S  +K C    V   S
Sbjct  66    YISSDAEWFMDVFHVKDQRGNKVADKKVISYIQQAIGAKRELQNSGEMKKCYDNAVRTES  125

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVD  1184
               D TAIE+IG +RPGL SEISAVLA    NVV A  W+HN  +ACV YV+D+ +  ++D
Sbjct  126   CSDCTAIEMIGTNRPGLFSEISAVLAEQKCNVVEAHAWSHNACLACVAYVSDESTSASID  185

Query  1183  DPSRLCVIEEQLKNILR--ACKDDNNIAHTSVSMGS----THIDRRLHQMFFADRDYEG-  1025
             DP+RL  IE+QL  ILR     D N +   +  +G     + ++RRLHQ+ FA+ D++G 
Sbjct  186   DPNRLATIEDQLSTILRPTTIADHNCMGAKTHFLGCDSSMSRMERRLHQLMFANHDFDGP  245

Query  1024  --------GCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQY  869
                       ++M+      +  VSID C EKGYSVV+V+C DRPKLMFD VCTLTDMQY
Sbjct  246   PGQVSTSFSSINMDHVEEGRRTVVSIDRCAEKGYSVVTVECMDRPKLMFDTVCTLTDMQY  305

Query  868   VVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAK  689
             V+FHA+I+S GP + QEYYIRH DG TLDTE E+ +V+KCLEAAI+RRV EG+RLELCA+
Sbjct  306   VIFHASIASHGPFSYQEYYIRHKDGYTLDTEDERLQVIKCLEAAIERRVCEGVRLELCAE  365

Query  688   DRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQ  509
             + VGLL +VTR+LRE GL V RA ++T GE+  NVFY++D+SGN VD +++E + +E+ Q
Sbjct  366   NSVGLLPNVTRILREYGLTVARADIATDGEKIKNVFYIQDTSGNKVDMRLVELMEREL-Q  424

Query  508   RMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
              +                +PP   +  + SF F  LL
Sbjct  425   PLAFQ-------VKNELLLPPNDTSMERESFSFVGLL  454



>ref|XP_009613079.1| PREDICTED: uncharacterized protein LOC104106280 [Nicotiana tomentosiformis]
Length=449

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 303/441 (69%), Gaps = 21/441 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS NK GILLEVVQVL+DL+L ITKAY+
Sbjct  12    MDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQVLTDLNLTITKAYI  71

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
              SDGGWFMDVF+VT+Q GNK+T+   + YI K+LGP    +  ++    ++VGV +  ++
Sbjct  72    CSDGGWFMDVFNVTNQEGNKITEEPILDYIMKSLGPDSCFASSMR----RSVGVTTGMNH  127

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IELIG DRPGLLSE+SAVL NL  NVV AEVWTHN R A ++ V D  +  AV D  R
Sbjct  128   TSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDENGGAVSDLER  187

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L ++++ L N+LR      + A T VS G TH +RRLHQ+ FADRDYE    D   D   
Sbjct  188   LTMVKKLLCNVLRGSNKSRD-AKTLVSHGVTHTERRLHQLMFADRDYERAMGDGSDD--K  244

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++CKDRPKL+FD +CT+TDMQYVVFH  + ++GP A QEY 
Sbjct  245   ERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTMTDMQYVVFHGNVDTEGPEAYQEYC  304

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  305   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  364

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + +N FYV DSSG PVD KIIE +R+ IGQ ++                
Sbjct  365   VTRAEVTTRAGKALNTFYVSDSSGYPVDAKIIESVRQTIGQTIL-----------RVKGN  413

Query  451   PPE---TAAWSKTSFFFGSLL  398
             P E       S T F FG L 
Sbjct  414   PEELNPVQQESPTRFLFGGLF  434



>gb|EPS70014.1| hypothetical protein M569_04746, partial [Genlisea aurea]
Length=447

 Score =   458 bits (1178),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 236/444 (53%), Positives = 306/444 (69%), Gaps = 23/444 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCT------IVKVDSVNKPGILLEVVQVLSDLDLI  1550
              D EYE    R+NPPRV +DN SCK+ T      + +VDS NK GILLEVVQVL+DL+L+
Sbjct  10    MDDEYEKFIRRMNPPRVVIDNESCKNATSFFVKMLGQVDSANKQGILLEVVQVLTDLNLV  69

Query  1549  ITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGV  1370
             I KAY+ SDGGWFMDVF+VTD  GNK+TD   + YI+K+LGP    +  ++    ++VGV
Sbjct  70    ILKAYMCSDGGWFMDVFNVTDLDGNKITDEGILEYIQKSLGPDSCFASSMR----RSVGV  125

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
              S  ++T+IELIG DRPGLLSE+ AVL NL  NVV AEVWTHN R A V+ V ++ +  A
Sbjct  126   TSSTNHTSIELIGTDRPGLLSEVCAVLTNLKCNVVNAEVWTHNTRAAAVMQVTEEDAGGA  185

Query  1189  VDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             + DP +L ++++ L N+L+     +  A T VS G+TH +RRLHQM F DRDYE     M
Sbjct  186   ITDPEKLSLVKKLLCNVLKGSSSKSREAKTGVSHGATHTERRLHQMMFDDRDYE----RM  241

Query  1009  EADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPS  830
               +  + +PNV+ID   ++ YSVV ++CKDRPKL+FD+VCTLTDMQYVVFH ++ S G  
Sbjct  242   GDNESAHRPNVTIDDWHDRDYSVVMIRCKDRPKLLFDVVCTLTDMQYVVFHGSVESRGSE  301

Query  829   ASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVL  650
             A QEY IRH+DG ++ ++ E+ RVV+CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ 
Sbjct  302   AYQEYCIRHVDGSSVKSDAERQRVVQCLEAAIRRRVSEGLKLELCTNDRVGLLSDVTRIF  361

Query  649   RENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaaca  470
             REN L VTRA VST G + VN FYVRD+SG  VD KII+ +R+ IGQ ++          
Sbjct  362   RENSLTVTRAEVSTRGGKAVNTFYVRDASGYAVDPKIIDSIRQSIGQTVL---------R  412

Query  469   casakVPPETAAWSKTSFFFGSLL  398
                     E  A +++ F FG L 
Sbjct  413   VKGGGGGGEEDAAARSRFLFGGLF  436



>ref|XP_010650073.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100259472 
[Vitis vinifera]
Length=442

 Score =   457 bits (1176),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 229/404 (57%), Positives = 296/404 (73%), Gaps = 7/404 (2%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN +CK+ ++++VDS NK GILLEVVQVL DL+LIITKAY+
Sbjct  7     MDDEYEKLIRRMNPPRVVIDNETCKNASVIRVDSANKHGILLEVVQVLIDLNLIITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNK+TD   + YI+K+LG        ++    ++VGV    D+
Sbjct  67    SSDGGWFMDVFNVTDQDGNKITDEEILDYIQKSLGSDACFISSMR----RSVGVIPSTDH  122

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T+IEL G DRPGLLSE+SAVL +L  +VV AEVWTHN R A V++V D+ +  A+ DP R
Sbjct  123   TSIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMHVTDEETGCAITDPER  182

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  +++ L N+L+        A T VS G TH +RRLHQM FADRDYE    D   +   
Sbjct  183   LSKVKQLLCNVLKGSNKSRE-AKTVVSHGVTHTERRLHQMMFADRDYERIYNDGSDEAQ-  240

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV++ +  +K YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA + ++GP A QEYY
Sbjct  241   -RPNVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVDAEGPEAYQEYY  299

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV++CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  300   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLS  359

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             VTRA V+T   + VN F+VRD+SG PVD K I+ +R+ IGQ ++
Sbjct  360   VTRAEVTTRAGKAVNTFHVRDASGYPVDAKTIDSIREAIGQTIL  403



>gb|ACG60681.1| unknown protein [Brassica oleracea var. alboglabra]
Length=446

 Score =   457 bits (1176),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 300/441 (68%), Gaps = 13/441 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S      P + +GV    D 
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFS-----TPMRTIGVTPSTDS  115

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V D  +  A+ DP R
Sbjct  116   TVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDPER  175

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL---DMEAD  1001
             L  I+  L+N+L+        A T +S G  H DRRLHQM F DRDYE   +   D    
Sbjct  176   LSRIKNLLRNVLKGSNTPRE-AKTVLSHGEVHTDRRLHQMMFEDRDYEHRAVVDDDSSIQ  234

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A Q
Sbjct  235   DERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQ  294

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYY+RH+DG  + +E EK RV++CLEAAI RRVSEGL+LELC  DRVGLLS+VTR+ REN
Sbjct  295   EYYVRHIDGSPVKSEAEKQRVIQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFREN  354

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
              L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ ++    K        
Sbjct  355   SLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTIL--KVKNNPEEQQQ  412

Query  460   akVPPETAAWSKTSFFFGSLL  398
              + PP  +  S T F FG L 
Sbjct  413   RQKPP--SQDSPTRFLFGGLF  431



>ref|XP_004152119.1| PREDICTED: uncharacterized protein LOC101215960 [Cucumis sativus]
 gb|KGN53037.1| hypothetical protein Csa_4G011840 [Cucumis sativus]
Length=449

 Score =   457 bits (1176),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 225/405 (56%), Positives = 302/405 (75%), Gaps = 7/405 (2%)
 Frame = -1

Query  1726  ACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLII  1547
             A  P  D EY+ L IR+NPPRVS+DN S +  T++KVDS N+ G LLEVVQVL+DL+LII
Sbjct  5     ASLPVHD-EYQKLVIRMNPPRVSIDNTSSRKATLIKVDSSNRHGSLLEVVQVLTDLNLII  63

Query  1546  TKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVN  1367
              +AY+SSDG WFMDVFHVTDQ+G K+ D      I+++LGP+  +   L+    ++VGV 
Sbjct  64    RRAYISSDGEWFMDVFHVTDQNGKKLCDDGVGERIQQSLGPRARSFRSLR----RSVGVQ  119

Query  1366  SLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAV  1187
             +  ++T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D  S   +
Sbjct  120   AAAEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDDTSGMPI  179

Query  1186  DDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDME  1007
             DDP  L  I++ L  +L+  +D ++ A+T+VSM STH +RRLHQM +ADRD++       
Sbjct  180   DDPDWLAKIKQLLLYVLKGDRDKHS-ANTAVSMNSTHKERRLHQMMYADRDFDLNYTSCS  238

Query  1006  ADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
                 S +P V++++CVEKGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I ++ P A
Sbjct  239   ESYQS-RPLVTVENCVEKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEEPEA  297

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEY+IRH+DG  + +E E+ RV+ CLEAAI+RR +EG++LELC++DRVGLL+DVTR+ R
Sbjct  298   YQEYFIRHVDGSPISSEAERQRVIHCLEAAIRRRTTEGIKLELCSEDRVGLLTDVTRIFR  357

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             ENGL VTRA V+T G Q VNVFYV D+SGN V ++ I+ +R+ IG
Sbjct  358   ENGLSVTRAEVTTRGTQAVNVFYVTDASGNSVRSETIKAVREAIG  402



>ref|XP_004490252.1| PREDICTED: uncharacterized protein LOC101508719 isoform X3 [Cicer 
arietinum]
Length=472

 Score =   458 bits (1178),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 302/435 (69%), Gaps = 38/435 (9%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPR------------------------------VSVDNISCKDCTI  1625
             Y D EYE L  R+NPPR                              V +DN +CK+ T+
Sbjct  7     YMDDEYEKLFRRMNPPRYQFLFPFFPFNKKIQNFNDYDSLLLTCLFRVVIDNEACKNATV  66

Query  1624  VKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGY  1445
             ++VDS NK GILLEVVQ+L+DL+LIITKAY+SSDGGWFMDVF+VTDQ GNKVTD   + Y
Sbjct  67    IRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEAILDY  126

Query  1444  IEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVV  1265
             I K+LGP+          PG++VGV    D+TAIEL+G DRPGLLSE+SAVL NL  N+V
Sbjct  127   IRKSLGPES-----CFPSPGRSVGVKQTMDHTAIELMGSDRPGLLSEVSAVLTNLKCNIV  181

Query  1264  AAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMG  1085
              AEVWTHN R A V++VND+ + +A+ DP RL +I+E L N+L         A T V+  
Sbjct  182   NAEVWTHNMRAAAVMHVNDEETGSAITDPQRLSLIKELLCNVLGGGNRKRG-AKTVVTDD  240

Query  1084  STHIDRRLHQMFFADRDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLM  905
             STH DRRLHQM FADRDYE   +D +      +PNV++ +  +K YSVV+++ KDRPKL+
Sbjct  241   STHTDRRLHQMMFADRDYER--VDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLL  298

Query  904   FDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRR  725
             FD VCTLTDMQYVVFHA I ++GP A QEYYI+H+DG  + ++ E+ RV++CLEAAI+RR
Sbjct  299   FDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERR  358

Query  724   VSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDT  545
             VSEGL+LE+C  DRVGLLS+VTR+ REN L VTRA V+T G + VN FYVR +SG  VD+
Sbjct  359   VSEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDS  418

Query  544   KIIEGLRKEIGQRMM  500
             K IE +R+ IG  ++
Sbjct  419   KTIESIRQTIGNTIL  433



>ref|XP_004490250.1| PREDICTED: uncharacterized protein LOC101508719 isoform X1 [Cicer 
arietinum]
Length=480

 Score =   458 bits (1179),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 302/435 (69%), Gaps = 38/435 (9%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPR------------------------------VSVDNISCKDCTI  1625
             Y D EYE L  R+NPPR                              V +DN +CK+ T+
Sbjct  15    YMDDEYEKLFRRMNPPRYQFLFPFFPFNKKIQNFNDYDSLLLTCLFRVVIDNEACKNATV  74

Query  1624  VKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGY  1445
             ++VDS NK GILLEVVQ+L+DL+LIITKAY+SSDGGWFMDVF+VTDQ GNKVTD   + Y
Sbjct  75    IRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEAILDY  134

Query  1444  IEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVV  1265
             I K+LGP+          PG++VGV    D+TAIEL+G DRPGLLSE+SAVL NL  N+V
Sbjct  135   IRKSLGPES-----CFPSPGRSVGVKQTMDHTAIELMGSDRPGLLSEVSAVLTNLKCNIV  189

Query  1264  AAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMG  1085
              AEVWTHN R A V++VND+ + +A+ DP RL +I+E L N+L         A T V+  
Sbjct  190   NAEVWTHNMRAAAVMHVNDEETGSAITDPQRLSLIKELLCNVLGGGNRKRG-AKTVVTDD  248

Query  1084  STHIDRRLHQMFFADRDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLM  905
             STH DRRLHQM FADRDYE   +D +      +PNV++ +  +K YSVV+++ KDRPKL+
Sbjct  249   STHTDRRLHQMMFADRDYER--VDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLL  306

Query  904   FDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRR  725
             FD VCTLTDMQYVVFHA I ++GP A QEYYI+H+DG  + ++ E+ RV++CLEAAI+RR
Sbjct  307   FDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERR  366

Query  724   VSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDT  545
             VSEGL+LE+C  DRVGLLS+VTR+ REN L VTRA V+T G + VN FYVR +SG  VD+
Sbjct  367   VSEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDS  426

Query  544   KIIEGLRKEIGQRMM  500
             K IE +R+ IG  ++
Sbjct  427   KTIESIRQTIGNTIL  441



>ref|XP_002304667.1| hypothetical protein POPTR_0003s16620g [Populus trichocarpa]
 gb|EEE79646.1| hypothetical protein POPTR_0003s16620g [Populus trichocarpa]
Length=448

 Score =   457 bits (1176),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 311/409 (76%), Gaps = 14/409 (3%)
 Frame = -1

Query  1723  CWP--YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLI  1550
             CW     D E+E L IR+NPPRV+VDN S +  T+++VDS NK G LLEVVQVL+DL+L+
Sbjct  3     CWSPLTMDDEFEKLVIRMNPPRVTVDNASSRTATLIEVDSANKRGSLLEVVQVLTDLNLL  62

Query  1549  ITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGV  1370
             I +AY+SSDG WFMDVFHVTDQHGNK+++ +    I+++LGP+G +   L+    ++V V
Sbjct  63    IRRAYISSDGEWFMDVFHVTDQHGNKLSEDDVAERIQQSLGPRGPSFRSLR----RSVDV  118

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
                 ++T IEL GRDRPGLLSEI AVLA L  NVVA+E+WTHN R+A V+Y+ D+ +   
Sbjct  119   QGAAEHTTIELTGRDRPGLLSEIFAVLAGLKCNVVASEIWTHNSRMASVVYITDEATGLP  178

Query  1189  VDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             +DDP RL  I++ L  IL   +D  + A+T+VS+GSTH +RRLHQM +ADRDY+      
Sbjct  179   IDDPDRLTKIKQLLLCILIGDRDKRS-ANTAVSVGSTHKERRLHQMMYADRDYDV----D  233

Query  1009  EADCPSLKPN---VSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             +ADC S       V++++CV+KGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I ++
Sbjct  234   DADCSSASERNRFVTVENCVDKGYTVVNLRCPDRPKLIFDTVCTLTDMQYVVYHAIIIAE  293

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRHMDG  +++E E+ R++ CLEAAI+RR SEG+RLELC++DRVGLLSDVT
Sbjct  294   GPEACQEYFIRHMDGSPINSEAERQRLINCLEAAIRRRTSEGVRLELCSEDRVGLLSDVT  353

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             R+ RENGL VTRA V+T G Q VNVF+V DSSG+PV ++ IE +RKEIG
Sbjct  354   RIFRENGLSVTRAEVTTRGSQAVNVFFVTDSSGHPVKSETIEAVRKEIG  402



>ref|XP_004490251.1| PREDICTED: uncharacterized protein LOC101508719 isoform X2 [Cicer 
arietinum]
Length=480

 Score =   458 bits (1179),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 302/435 (69%), Gaps = 38/435 (9%)
 Frame = -1

Query  1714  YFDPEYETLSIRINPPR------------------------------VSVDNISCKDCTI  1625
             Y D EYE L  R+NPPR                              V +DN +CK+ T+
Sbjct  15    YMDDEYEKLFRRMNPPRYQFLFPFFPFNKKIQNFNDYDSLLLTCLFRVVIDNEACKNATV  74

Query  1624  VKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGY  1445
             ++VDS NK GILLEVVQ+L+DL+LIITKAY+SSDGGWFMDVF+VTDQ GNKVTD   + Y
Sbjct  75    IRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEAILDY  134

Query  1444  IEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVV  1265
             I K+LGP+          PG++VGV    D+TAIEL+G DRPGLLSE+SAVL NL  N+V
Sbjct  135   IRKSLGPES-----CFPSPGRSVGVKQTMDHTAIELMGSDRPGLLSEVSAVLTNLKCNIV  189

Query  1264  AAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMG  1085
              AEVWTHN R A V++VND+ + +A+ DP RL +I+E L N+L         A T V+  
Sbjct  190   NAEVWTHNMRAAAVMHVNDEETGSAITDPQRLSLIKELLCNVLGGGNRKRG-AKTVVTDD  248

Query  1084  STHIDRRLHQMFFADRDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLM  905
             STH DRRLHQM FADRDYE   +D +      +PNV++ +  +K YSVV+++ KDRPKL+
Sbjct  249   STHTDRRLHQMMFADRDYER--VDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLL  306

Query  904   FDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRR  725
             FD VCTLTDMQYVVFHA I ++GP A QEYYI+H+DG  + ++ E+ RV++CLEAAI+RR
Sbjct  307   FDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERR  366

Query  724   VSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDT  545
             VSEGL+LE+C  DRVGLLS+VTR+ REN L VTRA V+T G + VN FYVR +SG  VD+
Sbjct  367   VSEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDS  426

Query  544   KIIEGLRKEIGQRMM  500
             K IE +R+ IG  ++
Sbjct  427   KTIESIRQTIGNTIL  441



>ref|XP_010928326.1| PREDICTED: uncharacterized protein LOC105050129 isoform X1 [Elaeis 
guineensis]
Length=502

 Score =   459 bits (1180),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 311/457 (68%), Gaps = 25/457 (5%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPE+E L+ +I  PRV+VDN SC  CT+VKVDS+NK G+LLEVVQVLSD+DL+I+K+
Sbjct  40    PYFDPEFENLNEKIYGPRVTVDNESCDKCTVVKVDSLNKQGLLLEVVQVLSDMDLVISKS  99

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG--YTSDVLKTCPGKNVGVNS  1364
             Y+SSD  WFMDVFHV DQ GNKV D   I YI++A+G K     S  +K C    V   S
Sbjct  100   YISSDAEWFMDVFHVKDQRGNKVADKKVISYIQQAIGAKRELQNSGEMKKCYDNAVRTES  159

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVD  1184
               D TAIE+IG +RPGL SEISAVLA    NVV A  W+HN  +ACV YV+D+ +  ++D
Sbjct  160   CSDCTAIEMIGTNRPGLFSEISAVLAEQKCNVVEAHAWSHNACLACVAYVSDESTSASID  219

Query  1183  DPSRLCVIEEQLKNILR--ACKDDNNIAHTSVSMGS----THIDRRLHQMFFADRDYEG-  1025
             DP+RL  IE+QL  ILR     D N +   +  +G     + ++RRLHQ+ FA+ D++G 
Sbjct  220   DPNRLATIEDQLSTILRPTTIADHNCMGAKTHFLGCDSSMSRMERRLHQLMFANHDFDGP  279

Query  1024  --------GCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQY  869
                       ++M+      +  VSID C EKGYSVV+V+C DRPKLMFD VCTLTDMQY
Sbjct  280   PGQVSTSFSSINMDHVEEGRRTVVSIDRCAEKGYSVVTVECMDRPKLMFDTVCTLTDMQY  339

Query  868   VVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAK  689
             V+FHA+I+S GP + QEYYIRH DG TLDTE E+ +V+KCLEAAI+RRV EG+RLELCA+
Sbjct  340   VIFHASIASHGPFSYQEYYIRHKDGYTLDTEDERLQVIKCLEAAIERRVCEGVRLELCAE  399

Query  688   DRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQ  509
             + VGLL +VTR+LRE GL V RA ++T GE+  NVFY++D+SGN VD +++E + +E+ Q
Sbjct  400   NSVGLLPNVTRILREYGLTVARADIATDGEKIKNVFYIQDTSGNKVDMRLVELMEREL-Q  458

Query  508   RMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
              +                +PP   +  + SF F  LL
Sbjct  459   PLAFQ-------VKNELLLPPNDTSMERESFSFVGLL  488



>ref|XP_008454022.1| PREDICTED: uncharacterized protein LOC103494569 [Cucumis melo]
Length=449

 Score =   457 bits (1175),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 225/405 (56%), Positives = 301/405 (74%), Gaps = 7/405 (2%)
 Frame = -1

Query  1726  ACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLII  1547
             A  P  D EY+ L IR+NPPRVS+DN S +  T++KVDS N+ G LLEVVQVL+DL+LII
Sbjct  5     ASLPVHD-EYQKLVIRMNPPRVSIDNTSSRKATLIKVDSSNRHGSLLEVVQVLTDLNLII  63

Query  1546  TKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVN  1367
              +AY+SSDG WFMDVFHVTDQ+G K+ D      I+++LGP+  +   L+    ++VGV 
Sbjct  64    RRAYISSDGEWFMDVFHVTDQNGKKLCDDGVGERIQQSLGPRARSFRSLR----RSVGVQ  119

Query  1366  SLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAV  1187
             +  ++T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D  S   +
Sbjct  120   AAAEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDDTSGMPI  179

Query  1186  DDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDME  1007
             DDP  L  I++ L  +L+  +D ++ A+T+VSM STH +RRLHQM +ADRD++       
Sbjct  180   DDPDWLAKIKQLLLYVLKGDRDKHS-ANTAVSMNSTHKERRLHQMMYADRDFDLNYTSCS  238

Query  1006  ADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
                 S +P V++++CVEKGY+VV+++C DRPKL+FD VCTLTDMQYVV+H  I ++ P A
Sbjct  239   ESYQS-RPLVTVENCVEKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEEPEA  297

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEY+IRH+DG  + +E E+ RV+ CLEAAI+RR +EG++LELC++DRVGLL+DVTR+ R
Sbjct  298   YQEYFIRHVDGSPISSEAERQRVIHCLEAAIKRRTTEGIKLELCSEDRVGLLTDVTRIFR  357

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             ENGL VTRA VST G Q VNVFYV D+SGN V ++ I+ +R+ IG
Sbjct  358   ENGLSVTRAEVSTRGTQAVNVFYVTDASGNSVRSETIKAVREAIG  402



>ref|XP_006302244.1| hypothetical protein CARUB_v10020277mg [Capsella rubella]
 gb|EOA35142.1| hypothetical protein CARUB_v10020277mg [Capsella rubella]
Length=455

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 303/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L I+KAY+
Sbjct  11    MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTISKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  +++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V++AEVWTHN R A V+ V D ++   + DP R
Sbjct  126   TVIELTGCDRPGLLSELSAVLNHLKCSVLSAEVWTHNTRAAAVMQVTDDLTGCGISDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTVVSQGEVHTDRRLHQMMFEDRDYEQTVVDDDSSIQD  244

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  245   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQE  304

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  305   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  364

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  365   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  423

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  424   KSPSHD---SPTRFLFGGLF  440



>ref|XP_010470880.1| PREDICTED: uncharacterized protein LOC104750738 [Camelina sativa]
Length=455

 Score =   457 bits (1175),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 303/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L I+KAY+
Sbjct  11    MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTISKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V++AEVWTHN R A V++V D ++   V DP R
Sbjct  126   TVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMHVTDDLTGCGVSDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTLVSHGEVHTDRRLHQMMFEDRDYELRVVDDDSSIQD  244

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ + G  A QE
Sbjct  245   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTKGTEAYQE  304

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  305   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  364

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  365   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  423

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  424   KSPSHD---SPTRFLFGGLF  440



>ref|XP_010511930.1| PREDICTED: uncharacterized protein LOC104787960 [Camelina sativa]
Length=455

 Score =   456 bits (1173),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 303/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L I+KAY+
Sbjct  11    MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTISKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V++AEVWTHN R A V+ V D ++   V DP R
Sbjct  126   TVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMQVTDDLTGCGVSDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   ++ ++    
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTLVSHGEVHTDRRLHQMMFEDRDYELRVVEDDSSIQD  244

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                KP+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  245   ERQKPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQE  304

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  305   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  364

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  365   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  423

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  424   KSPTHD---SPTRFLFGGLF  440



>gb|AAF27052.1|AC008262_1 F4N2.2 [Arabidopsis thaliana]
Length=445

 Score =   455 bits (1171),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 302/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  1     MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  60

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  +++     VGV    D 
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMRS-----VGVIPSTDS  115

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V+ AE+WTHN R A V+ V D ++   + DP R
Sbjct  116   TVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISDPER  175

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  176   LSRIKNLLRNVLKGSNTPRE-AKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQD  234

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  235   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQE  294

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  295   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  354

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  355   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  413

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  414   KSPSHE---SPTRFLFGGLF  430



>ref|NP_177067.1| ACT domain-containing protein [Arabidopsis thaliana]
 sp|Q8LJW3.1|ACR4_ARATH RecName: Full=ACT domain-containing protein ACR4; AltName: Full=Protein 
ACT DOMAIN REPEATS 4 [Arabidopsis thaliana]
 gb|AAM93429.1| ACR4 [Arabidopsis thaliana]
 gb|ABJ17112.1| At1g69040 [Arabidopsis thaliana]
 gb|AEE34878.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=451

 Score =   455 bits (1171),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 302/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  7     MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  +++     VGV    D 
Sbjct  67    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMRS-----VGVIPSTDS  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V+ AE+WTHN R A V+ V D ++   + DP R
Sbjct  122   TVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISDPER  181

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  182   LSRIKNLLRNVLKGSNTPRE-AKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQD  240

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  241   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQE  300

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  301   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  360

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  361   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  419

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  420   KSPSHE---SPTRFLFGGLF  436



>ref|NP_974107.1| ACT domain-containing protein [Arabidopsis thaliana]
 gb|AEE34879.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=455

 Score =   456 bits (1172),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 302/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  11    MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  +++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V+ AE+WTHN R A V+ V D ++   + DP R
Sbjct  126   TVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQD  244

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  245   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQE  304

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  305   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  364

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  365   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  423

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  424   KSPSHE---SPTRFLFGGLF  440



>ref|XP_002887219.1| hypothetical protein ARALYDRAFT_476032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63478.1| hypothetical protein ARALYDRAFT_476032 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score =   455 bits (1171),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 301/440 (68%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK  T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  11    MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  +++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V+ AEVWTHN R A V+ V D  +   + DP R
Sbjct  126   TVIELTGCDRPGLLSELSAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCGISDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQD  244

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  245   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQE  304

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  305   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTSDRVGLLSNVTRIFRENS  364

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  365   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  423

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  424   KSPSHE---SPTRFLFGGLF  440



>gb|KGN47669.1| hypothetical protein Csa_6G367150 [Cucumis sativus]
Length=448

 Score =   455 bits (1170),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 304/450 (68%), Gaps = 22/450 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EY  L  R+NPPRV +DN +CKD T+++VDS NK GILLEVVQVL+DL+LI+TKAY+
Sbjct  11    IDDEYVKLIRRMNPPRVVIDNDACKDATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             S DG WFMDVF+VTDQ GNKVTD   + YI+++L      SD       ++VGV    DY
Sbjct  71    SCDGCWFMDVFNVTDQDGNKVTDEGVLDYIKRSL-----ESDSCFASSMRSVGVKPSVDY  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IELIG DR GLLSE+SAVL +L  NVV AEVWTHN R A V++V D  + +A+ D  R
Sbjct  126   TVIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSAITDLER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L N+LR     +  A T VS G THI+RRLHQM FADRDYE   LD +     
Sbjct  186   LSRIKGLLSNVLRGSNSRSKGAKTVVSHGVTHIERRLHQMMFADRDYE--LLDEDVMEDQ  243

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              KPNV + +  +  YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA + ++G  A QEYY
Sbjct  244   QKPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEAYQEYY  303

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV+ CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  304   IRHIDGSPVKSDAERQRVIHCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  363

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + +N FYVRD SG PVD+K I+ +R+ IGQ ++             +  
Sbjct  364   VTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTIL---------KVKGSSS  414

Query  451   PPETAAWSK---TSFFFGSLLGKFRA*NLV  371
             P E    S+   T F FG   G FR+ + V
Sbjct  415   PKEQKQASQDSPTRFLFG---GLFRSRSFV  441



>ref|XP_004144160.1| PREDICTED: uncharacterized protein LOC101218703 [Cucumis sativus]
 ref|XP_004169337.1| PREDICTED: uncharacterized protein LOC101228960 [Cucumis sativus]
Length=444

 Score =   454 bits (1169),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 304/450 (68%), Gaps = 22/450 (5%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EY  L  R+NPPRV +DN +CKD T+++VDS NK GILLEVVQVL+DL+LI+TKAY+
Sbjct  7     IDDEYVKLIRRMNPPRVVIDNDACKDATVIRVDSANKHGILLEVVQVLTDLNLIVTKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             S DG WFMDVF+VTDQ GNKVTD   + YI+++L      SD       ++VGV    DY
Sbjct  67    SCDGCWFMDVFNVTDQDGNKVTDEGVLDYIKRSL-----ESDSCFASSMRSVGVKPSVDY  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IELIG DR GLLSE+SAVL +L  NVV AEVWTHN R A V++V D  + +A+ D  R
Sbjct  122   TVIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSAITDLER  181

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L N+LR     +  A T VS G THI+RRLHQM FADRDYE   LD +     
Sbjct  182   LSRIKGLLSNVLRGSNSRSKGAKTVVSHGVTHIERRLHQMMFADRDYE--LLDEDVMEDQ  239

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              KPNV + +  +  YSVV+++ KDRPKL+FD VCTLTDMQYVVFHA + ++G  A QEYY
Sbjct  240   QKPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEAYQEYY  299

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV+ CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  300   IRHIDGSPVKSDAERQRVIHCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  359

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakV  452
             VTRA V+T   + +N FYVRD SG PVD+K I+ +R+ IGQ ++             +  
Sbjct  360   VTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTIL---------KVKGSSS  410

Query  451   PPETAAWSK---TSFFFGSLLGKFRA*NLV  371
             P E    S+   T F FG   G FR+ + V
Sbjct  411   PKEQKQASQDSPTRFLFG---GLFRSRSFV  437



>ref|XP_004156949.1| PREDICTED: uncharacterized LOC101215960 [Cucumis sativus]
Length=449

 Score =   454 bits (1169),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 301/405 (74%), Gaps = 7/405 (2%)
 Frame = -1

Query  1726  ACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLII  1547
             A  P  D EY+ L IR+NPPRVS+DN S +  T++KVDS N+ G LLEVVQVL+DL+LII
Sbjct  5     ASLPVHD-EYQKLVIRMNPPRVSIDNTSSRKATLIKVDSSNRHGSLLEVVQVLTDLNLII  63

Query  1546  TKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVN  1367
              +AY+SSDG WFMDV HVTDQ+G K+ D      I+++LGP+  +   L+    ++VGV 
Sbjct  64    RRAYISSDGEWFMDVLHVTDQNGKKLCDDGVGERIQQSLGPRARSFRSLR----RSVGVQ  119

Query  1366  SLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAV  1187
             +  ++T IEL GRDRPGLLSE+ AVL +L  NVVAAEVWTHN R+A V+Y+ D  S   +
Sbjct  120   AAAEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDDTSGMPI  179

Query  1186  DDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDME  1007
             DDP  L  I++ L  +L+  +D ++ A+T+VSM STH +RRLHQM +ADRD++       
Sbjct  180   DDPDWLAKIKQLLLYVLKGDRDKHS-ANTAVSMNSTHKERRLHQMMYADRDFDLNYTSCS  238

Query  1006  ADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
                 S +P V++++CVEKGY+VV+++C DRPKL+FD VCTLTDMQYVV+HA I ++ P A
Sbjct  239   ESYQS-RPLVTVENCVEKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEEPEA  297

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEY+IRH+DG  + +E E+ RV+ CLEAAI+RR +EG++LELC++DRVGLL+DVTR+ R
Sbjct  298   YQEYFIRHVDGSPISSEAERQRVIHCLEAAIRRRTTEGIKLELCSEDRVGLLTDVTRIFR  357

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             ENGL VTRA V+T G Q VNVFYV D+SGN V ++ I+ +R+ IG
Sbjct  358   ENGLSVTRAEVTTRGTQAVNVFYVTDASGNSVRSETIKAVREAIG  402



>ref|XP_010250220.1| PREDICTED: uncharacterized protein LOC104592510 isoform X1 [Nelumbo 
nucifera]
Length=500

 Score =   456 bits (1174),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 306/444 (69%), Gaps = 32/444 (7%)
 Frame = -1

Query  1750  STAVDMARACWPYFDPEYETLSIRINPP--RVSVDNISCKDCTIVKVDSVNKPGILLEVV  1577
             S A+ M + CWPYFDPE+E L+ RI+ P  +V +DN SC+DCT+VKVDSVNK G+LL+VV
Sbjct  12    SQALRMEKVCWPYFDPEFENLTERIHGPSCQVCIDNESCEDCTVVKVDSVNKQGLLLQVV  71

Query  1576  QVLSDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGP--------K  1421
             Q L+D++L I+K+Y+SSD GWFMDVFHVTD+HG+K+TD N I +I++A+G         +
Sbjct  72    QALTDMNLHISKSYISSDAGWFMDVFHVTDEHGSKLTDQNVIDHIQQAIGSMKDSAGSSR  131

Query  1420  GYTSDVLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHN  1241
                 +  +       G ++  ++TAIEL G DRPGL SEISA L +L  NVV A  W+HN
Sbjct  132   SQVQNGAEAAEATAAGSDTSTEHTAIELTGTDRPGLFSEISAALTDLGCNVVEAHAWSHN  191

Query  1240  QRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILRA------CKDDNNIAHTSVSMG--  1085
             +R+ACV  ++D+ + + +DDP RL  IE+ L  +L A        ++  +    +  G  
Sbjct  192   ERLACVALISDESTDSRIDDPGRLATIEDHLSTVLAATTNSSGANEEQGVKTAGLPGGGD  251

Query  1084  -----STHIDRRLHQMFFADRDYEG---------GCLDMEADCPSLKPNVSIDHCVEKGY  947
                  +T+++RRLHQ+  A RD++G              E +    K  V+I+ C EKGY
Sbjct  252   GATPTTTNVERRLHQLMLAGRDFDGPPGNSSLSSSPYSTEGEEEGKKTVVTIERCDEKGY  311

Query  946   SVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEK  767
             SVV+V+ +DRPKLMFD VCTLTDMQYV+FHA+ISS G SA QEYYIRH+DG  L+TE EK
Sbjct  312   SVVTVETRDRPKLMFDTVCTLTDMQYVIFHASISSHGDSAFQEYYIRHVDGYALNTESEK  371

Query  766   DRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVN  587
              RV+KCLEAAI+RRV EG+RLELCA +RVGLLSD+TRVLRE GL V RA V T GE+ VN
Sbjct  372   KRVIKCLEAAIERRVCEGVRLELCANNRVGLLSDITRVLREYGLAVVRADVETQGEKAVN  431

Query  586   VFYVRDSSGNPVDTKIIEGLRKEI  515
              FYVRD  GN VD +++E L++E+
Sbjct  432   AFYVRDIYGNEVDMELVESLKREM  455



>ref|XP_009413600.1| PREDICTED: uncharacterized protein LOC103994872 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   454 bits (1169),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 295/404 (73%), Gaps = 9/404 (2%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EYE L IR+NPPRV+VDN S +  T+VKVDS NK G LLEVVQVLSDL L I +AY+S
Sbjct  12    DDEYEKLVIRMNPPRVTVDNTSGRKETLVKVDSANKQGSLLEVVQVLSDLKLTIKRAYIS  71

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHV DQ GNK++D   +  I+++L  +  +   ++    ++VGV +   +T
Sbjct  72    SDGEWFMDVFHVVDQVGNKLSDVGFVDRIQQSLEARALSHQSVR----RSVGVQTEAKHT  127

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
             +IELIGR+RPGLLSEI AVL +L  NVVAAEVWTHN R+A V+YV D+V+   +DD  RL
Sbjct  128   SIELIGRNRPGLLSEIFAVLTDLKCNVVAAEVWTHNSRLASVVYVTDEVTGAPIDDTDRL  187

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEG----GCLDMEAD  1001
               I   L+ +L+  +D  + A T++SM  TH  RRLHQM  AD+ Y      G  + +  
Sbjct  188   SKIRHLLRYVLKGNRDKQS-ARTAISMEPTHAGRRLHQMMLADQQYRKEDDMGQEEEDGT  246

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
               + KP V++++C+EK Y+VV+++CKDRPKL+FD VCTLTDMQYVVFHA I ++GP A Q
Sbjct  247   DGNSKPLVTVENCIEKEYTVVNIRCKDRPKLLFDTVCTLTDMQYVVFHATIITEGPEACQ  306

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIR MDGC + +EGE+  +++ LEAAI+RR +EGLRLELC +DRVGLLSDVTR+ REN
Sbjct  307   EYYIRKMDGCAVSSEGERKLLIQGLEAAIERRSTEGLRLELCCEDRVGLLSDVTRIFREN  366

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQ  509
             GL V +A VST G Q VNVFYV D+SG PV + +I+ +R EIGQ
Sbjct  367   GLSVIQAEVSTRGSQAVNVFYVVDASGKPVQSHMIDAVRSEIGQ  410



>gb|KHG02132.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=445

 Score =   454 bits (1168),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 292/404 (72%), Gaps = 8/404 (2%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE    R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+D++LIITKAY+
Sbjct  9     MDDEYEKFIRRMNPPRVVIDNESCKNATVIRVDSANRHGILLEVVQILTDINLIITKAYI  68

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDG WFMDVF+VTDQ GNK+ D   + YI K+LGP+      +++     VG+    D+
Sbjct  69    SSDGNWFMDVFNVTDQDGNKILDEGILDYIRKSLGPESCFMPSIRS-----VGMKQSMDH  123

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             TAIEL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ +  A+ DP R
Sbjct  124   TAIELTGSDRPGLLSEVSAVLRHLKCNVVNAEVWTHNTRAAAVMQVTDEETETAISDPER  183

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L N+L+   + +++A T VS   TH +RRLHQM FADRDYE    D+  D   
Sbjct  184   LSRIKSLLCNVLKGS-NKSSLAKTVVSHSVTHTERRLHQMMFADRDYERTGGDVLDD--R  240

Query  991   LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYY  812
              +PNV + +  +K YSVV++ CKDRPKL+FD VCTLTDM YVVFHA I + GP + QEYY
Sbjct  241   QRPNVDVVNWHDKDYSVVTIGCKDRPKLLFDTVCTLTDMDYVVFHANIDTLGPDSYQEYY  300

Query  811   IRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLL  632
             IRH+DG  + ++ E+ RV +CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L 
Sbjct  301   IRHLDGSPVKSDAERQRVTQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  360

Query  631   VTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMM  500
             VTRA V+T   + VN FYVRD+SG PVD K I+ +R+ +GQ ++
Sbjct  361   VTRAEVTTKAGKAVNTFYVRDASGYPVDVKTIDSIRQVLGQTIL  404



>ref|XP_010415531.1| PREDICTED: uncharacterized protein LOC104701533 [Camelina sativa]
Length=455

 Score =   454 bits (1169),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 303/440 (69%), Gaps = 12/440 (3%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN S K  T+++VDS N+ GILLEVVQ+L+DL+L I+KAY+
Sbjct  11    MDNEYEKLIRRMNPPRVVIDNDSSKKATVIRVDSANEYGILLEVVQILTDLNLTISKAYI  70

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S  L++     VGV    D 
Sbjct  71    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLRS-----VGVIPSTDS  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL G DRPGLLSE+SAVL +L  +V++AEVWTHN R A V++V D ++   V DP R
Sbjct  126   TVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMHVTDDLTGCGVSDPER  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L+N+L+        A T VS G  H DRRLHQM F DRDYE   +D ++    
Sbjct  186   LSRIKNLLRNVLKGSNTPRE-AKTLVSHGEVHTDRRLHQMMFEDRDYELRVVDDDSSIQD  244

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A QE
Sbjct  245   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQE  304

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YY+RH+DG  + +E EK RV++CLEAAI+RRVSEGL+LELC  DRVGLLS+VTR+ REN 
Sbjct  305   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  364

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ  +L VK          
Sbjct  365   LTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQ-TILKVKNNPQEQQQRQ  423

Query  457   kVPPETAAWSKTSFFFGSLL  398
             K P      S T F FG L 
Sbjct  424   KSPSHD---SPTRFLFGGLF  440



>emb|CDX81587.1| BnaC02g18910D [Brassica napus]
Length=453

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 301/443 (68%), Gaps = 16/443 (4%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D EYE L  R+NPPRV +DN SCK+ T+++VDS N+ GILLEVVQ+L+DL+L ITKAY+
Sbjct  7     MDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  66

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVF+VTDQ GNKVTD   + YI+K+LGP+   S      P + +GV    + 
Sbjct  67    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFS-----TPMRTIGVTPSTES  121

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYV--NDKVSCNAVDDP  1178
             T IEL G DRPGLLSE++AVL +L  +V+ AEVWTHN R A V+ V  +D   C A+ DP
Sbjct  122   TVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTTDDSTGC-AISDP  180

Query  1177  SRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL---DME  1007
              RL  I+  L+N+L+        A T +S G  H DRRLHQM F DRDYE   +   D  
Sbjct  181   ERLSRIKNLLRNVLKGSNTPRE-AKTVLSHGEVHTDRRLHQMMFEDRDYEHRAVVDDDSS  239

Query  1006  ADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSA  827
                   +P+V +D+ ++K YSVV+V+CKDRPKL+FD VCTLTDMQYVVFH ++ ++G  A
Sbjct  240   IQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  299

Query  826   SQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLR  647
              QEYY+RH+DG  + +E EK RV++CLEAAI RRVSEGL+LELC  DRVGLLS+VTR+ R
Sbjct  300   YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  646   ENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacac  467
             EN L VTRA V T G + +N FYV D+SG  +D K I+ +R+ IGQ ++    K      
Sbjct  360   ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTIL--KVKNNPEEQ  417

Query  466   asakVPPETAAWSKTSFFFGSLL  398
                + PP  +  S T F FG L 
Sbjct  418   QQRQKPP--SQESPTRFLFGGLF  438



>ref|XP_003621757.1| hypothetical protein MTR_7g022470 [Medicago truncatula]
 gb|AES77975.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=451

 Score =   453 bits (1165),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 299/403 (74%), Gaps = 10/403 (2%)
 Frame = -1

Query  1711  FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYV  1532
              D E+E L IR+NPPRV+VDN S +  T++KVDS NK G LLEVVQVL+D++LI+ +AY+
Sbjct  10    LDDEFEKLVIRMNPPRVTVDNTSSRTTTLIKVDSANKRGSLLEVVQVLTDMNLIVRRAYI  69

Query  1531  SSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDY  1352
             SSDGGWFMDVFHVTDQ+G K+   +    I+++LGP+  +   ++     +VGV +  ++
Sbjct  70    SSDGGWFMDVFHVTDQNGKKILQEDVADRIQQSLGPRVRSFRSVRR----SVGVQAAAEH  125

Query  1351  TAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSR  1172
             T IEL GRDRPGLLSE+ A+LA+L  NVVAAEVWTHN R+A V+Y+ D  +   +D+P R
Sbjct  126   TTIELTGRDRPGLLSEVFAILADLKCNVVAAEVWTHNSRMASVVYITDDTTGLPIDNPDR  185

Query  1171  LCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS  992
             L  I+  L  +LR   D  N A+T+VS  STH DRRLHQ+ +ADRDY+    D +  C +
Sbjct  186   LAKIKHLLLYVLRGDIDKKN-ANTAVSFCSTHKDRRLHQLMYADRDYD--IYDGDYSCST  242

Query  991   L---KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
                 K NV++D C++KGY+VV+++C DRPKL+FD VCT+TDMQYVV+H  ++++GP A Q
Sbjct  243   NDRNKLNVTVDDCIDKGYTVVNLRCPDRPKLLFDTVCTITDMQYVVYHGTVNAEGPEAYQ  302

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  + +E E+ RV+ CLEAA++RR SEG++LEL  +DRVGLLSDVTR+ REN
Sbjct  303   EYYIRHVDGYPISSEAERQRVIHCLEAAVRRRTSEGVKLELSGEDRVGLLSDVTRIFREN  362

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             GL V RA V+T G Q +NVFYV D SGNPV ++ IE +RKEIG
Sbjct  363   GLSVCRAEVTTRGSQAMNVFYVTDVSGNPVKSETIEAVRKEIG  405



>ref|XP_010250221.1| PREDICTED: uncharacterized protein LOC104592510 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010250223.1| PREDICTED: uncharacterized protein LOC104592510 isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   454 bits (1167),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 228/439 (52%), Positives = 303/439 (69%), Gaps = 32/439 (7%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPP--RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSD  1562
             M + CWPYFDPE+E L+ RI+ P  +V +DN SC+DCT+VKVDSVNK G+LL+VVQ L+D
Sbjct  1     MEKVCWPYFDPEFENLTERIHGPSCQVCIDNESCEDCTVVKVDSVNKQGLLLQVVQALTD  60

Query  1561  LDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGP--------KGYTSD  1406
             ++L I+K+Y+SSD GWFMDVFHVTD+HG+K+TD N I +I++A+G         +    +
Sbjct  61    MNLHISKSYISSDAGWFMDVFHVTDEHGSKLTDQNVIDHIQQAIGSMKDSAGSSRSQVQN  120

Query  1405  VLKTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIAC  1226
               +       G ++  ++TAIEL G DRPGL SEISA L +L  NVV A  W+HN+R+AC
Sbjct  121   GAEAAEATAAGSDTSTEHTAIELTGTDRPGLFSEISAALTDLGCNVVEAHAWSHNERLAC  180

Query  1225  VLYVNDKVSCNAVDDPSRLCVIEEQLKNILRA------CKDDNNIAHTSVSMG-------  1085
             V  ++D+ + + +DDP RL  IE+ L  +L A        ++  +    +  G       
Sbjct  181   VALISDESTDSRIDDPGRLATIEDHLSTVLAATTNSSGANEEQGVKTAGLPGGGDGATPT  240

Query  1084  STHIDRRLHQMFFADRDYEG---------GCLDMEADCPSLKPNVSIDHCVEKGYSVVSV  932
             +T+++RRLHQ+  A RD++G              E +    K  V+I+ C EKGYSVV+V
Sbjct  241   TTNVERRLHQLMLAGRDFDGPPGNSSLSSSPYSTEGEEEGKKTVVTIERCDEKGYSVVTV  300

Query  931   KCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVK  752
             + +DRPKLMFD VCTLTDMQYV+FHA+ISS G SA QEYYIRH+DG  L+TE EK RV+K
Sbjct  301   ETRDRPKLMFDTVCTLTDMQYVIFHASISSHGDSAFQEYYIRHVDGYALNTESEKKRVIK  360

Query  751   CLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVR  572
             CLEAAI+RRV EG+RLELCA +RVGLLSD+TRVLRE GL V RA V T GE+ VN FYVR
Sbjct  361   CLEAAIERRVCEGVRLELCANNRVGLLSDITRVLREYGLAVVRADVETQGEKAVNAFYVR  420

Query  571   DSSGNPVDTKIIEGLRKEI  515
             D  GN VD +++E L++E+
Sbjct  421   DIYGNEVDMELVESLKREM  439



>ref|XP_004984033.1| PREDICTED: uncharacterized protein LOC101763377 isoform X1 [Setaria 
italica]
Length=445

 Score =   452 bits (1163),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 298/439 (68%), Gaps = 21/439 (5%)
 Frame = -1

Query  1702  EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSD  1523
             EY+    ++NPPRV++DN SC + TI+ VDS NK GILLEVVQVL+DL LI+ KAY+SSD
Sbjct  19    EYQKFIKKMNPPRVTIDNTSCANATIIHVDSANKYGILLEVVQVLTDLKLIVKKAYISSD  78

Query  1522  GGWFMDVFHVTDQHGNKVTDGNTIG----YIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             GGWFMDVF+VT+Q G K+ D + +     YI K++ P             + +GV    D
Sbjct  79    GGWFMDVFNVTNQSGQKIMDESVLQGIKDYIYKSIAP----GSCFLPSRRRAIGVEPSSD  134

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             YT IEL G DRPGLLSE+SAVL NL  NVV AEVWTHN+R A V+ V D+ S  A+ D  
Sbjct  135   YTLIELTGTDRPGLLSEVSAVLTNLDCNVVNAEVWTHNERAAAVIQVTDRKSGLAISDAD  194

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL  I+E L+N+ +    D   A T+V+MG TH +RRLHQM   DRDYE    D     P
Sbjct  195   RLGRIKEWLRNVFKGRSRD---AKTTVAMGITHTERRLHQMMLEDRDYERYDKDRANANP  251

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
                P VS+ + ++K YSVV+++CKDRPKL+FD VCTLTDMQYVV+H ++ ++GP A QEY
Sbjct  252   --MPMVSVVNWLQKDYSVVTMRCKDRPKLLFDTVCTLTDMQYVVYHGSVDTEGPEAYQEY  309

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  +++E E+ R+++CLEAAI+RRVSEGL+LEL   DRVGLLSDVTR+ RENGL
Sbjct  310   YIRHIDGSPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGL  369

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T G + +N FYVRD++G+ V+ K +E +R+EIGQ ++              +
Sbjct  370   TVTRAEVATRGNKAINTFYVRDTAGSSVELKTLEAIRQEIGQTVL--------QVKGHPE  421

Query  454   VPPETAAWSKTSFFFGSLL  398
              P   A  S T F F SL 
Sbjct  422   HPKSPAQESPTRFLFSSLF  440



>ref|XP_004984034.1| PREDICTED: uncharacterized protein LOC101763377 isoform X2 [Setaria 
italica]
Length=441

 Score =   452 bits (1162),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 298/439 (68%), Gaps = 21/439 (5%)
 Frame = -1

Query  1702  EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSD  1523
             EY+    ++NPPRV++DN SC + TI+ VDS NK GILLEVVQVL+DL LI+ KAY+SSD
Sbjct  15    EYQKFIKKMNPPRVTIDNTSCANATIIHVDSANKYGILLEVVQVLTDLKLIVKKAYISSD  74

Query  1522  GGWFMDVFHVTDQHGNKVTDGNTIG----YIEKALGPKGYTSDVLKTCPGKNVGVNSLGD  1355
             GGWFMDVF+VT+Q G K+ D + +     YI K++ P             + +GV    D
Sbjct  75    GGWFMDVFNVTNQSGQKIMDESVLQGIKDYIYKSIAP----GSCFLPSRRRAIGVEPSSD  130

Query  1354  YTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPS  1175
             YT IEL G DRPGLLSE+SAVL NL  NVV AEVWTHN+R A V+ V D+ S  A+ D  
Sbjct  131   YTLIELTGTDRPGLLSEVSAVLTNLDCNVVNAEVWTHNERAAAVIQVTDRKSGLAISDAD  190

Query  1174  RLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCP  995
             RL  I+E L+N+ +    D   A T+V+MG TH +RRLHQM   DRDYE    D     P
Sbjct  191   RLGRIKEWLRNVFKGRSRD---AKTTVAMGITHTERRLHQMMLEDRDYERYDKDRANANP  247

Query  994   SLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEY  815
                P VS+ + ++K YSVV+++CKDRPKL+FD VCTLTDMQYVV+H ++ ++GP A QEY
Sbjct  248   --MPMVSVVNWLQKDYSVVTMRCKDRPKLLFDTVCTLTDMQYVVYHGSVDTEGPEAYQEY  305

Query  814   YIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGL  635
             YIRH+DG  +++E E+ R+++CLEAAI+RRVSEGL+LEL   DRVGLLSDVTR+ RENGL
Sbjct  306   YIRHIDGSPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGL  365

Query  634   LVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasak  455
              VTRA V+T G + +N FYVRD++G+ V+ K +E +R+EIGQ ++              +
Sbjct  366   TVTRAEVATRGNKAINTFYVRDTAGSSVELKTLEAIRQEIGQTVL--------QVKGHPE  417

Query  454   VPPETAAWSKTSFFFGSLL  398
              P   A  S T F F SL 
Sbjct  418   HPKSPAQESPTRFLFSSLF  436



>gb|KHG00039.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=445

 Score =   451 bits (1161),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 302/439 (69%), Gaps = 24/439 (5%)
 Frame = -1

Query  1702  EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSD  1523
             EYE    R+NPPRV +DN +CK+ T+++VD  N+ GILLEVVQ+L+DL+LII KAY+S+D
Sbjct  12    EYEKFIRRMNPPRVVIDNEACKNATVIRVDCANEHGILLEVVQILTDLNLIINKAYISAD  71

Query  1522  GGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYTAI  1343
             G WFMDVF+VT+Q GNK+TD   + YI K+LGP+   +  +++     VGV    D+T I
Sbjct  72    GNWFMDVFNVTNQDGNKITDEGILDYITKSLGPESCFTSAMRS-----VGVKQTMDHTEI  126

Query  1342  ELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCV  1163
             EL G DRPGLLSE+SAVL +L  NVV AEVWTHN R A V+ V D+ +  ++ D  RL +
Sbjct  127   ELTGSDRPGLLSELSAVLKHLKCNVVNAEVWTHNTRAAAVMQVTDEETGTSITDLERLSM  186

Query  1162  IEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSLKP  983
             I+  L N+L+   + +++A T VS   TH DRRLHQM FADRDYE    D+  D    +P
Sbjct  187   IKALLCNVLKGS-NKSSLAKTIVSHSVTHTDRRLHQMMFADRDYEQTGDDVLED--RQRP  243

Query  982   NVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRH  803
             NV + +  +K YSVV+++CKDRPKL+FD VCTLTDM YVVFHA I ++GP + QEYYIRH
Sbjct  244   NVDVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMGYVVFHAKIDTEGPESYQEYYIRH  303

Query  802   MDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTR  623
             +DG  + ++ E+ RV +CLEAAI+RRVSEGL+LELC  DRVGLLSDVTR+ REN L V+R
Sbjct  304   IDGSPVKSDAERQRVTQCLEAAIKRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTVSR  363

Query  622   AGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasakVPPE  443
             A V+T   + VN FYVRD+SG PVD K IE +R+ IGQ ++              K  PE
Sbjct  364   AEVTTKDGKAVNTFYVRDASGYPVDAKTIEFIRQVIGQTIL------------KVKGSPE  411

Query  442   ----TAAWSKTSFFFGSLL  398
                  +  S T F FG L 
Sbjct  412   DVKSVSQESPTRFLFGGLF  430



>ref|XP_011020811.1| PREDICTED: uncharacterized protein LOC105123048 [Populus euphratica]
 ref|XP_011020812.1| PREDICTED: uncharacterized protein LOC105123048 [Populus euphratica]
Length=448

 Score =   452 bits (1162),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 309/409 (76%), Gaps = 14/409 (3%)
 Frame = -1

Query  1723  CWP--YFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLI  1550
             CW     D E+E L IR+NPPRV+VDN S +  T++KVDS NK G LLEVVQVL+DL+L+
Sbjct  3     CWSPLTMDDEFEKLVIRMNPPRVTVDNASNRKATLIKVDSANKRGSLLEVVQVLTDLNLL  62

Query  1549  ITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGV  1370
             IT+AY+SSDG WFMDVFHVTDQHGNK+++ +    I+++LGP+G +   L+    ++V V
Sbjct  63    ITRAYISSDGEWFMDVFHVTDQHGNKLSEDDVAERIKQSLGPRGPSFRSLR----RSVDV  118

Query  1369  NSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNA  1190
                 + T IEL GRDRPGLLSEI AVLA+L  NVVA+E+WTHN R+A V+Y+ D+ +   
Sbjct  119   QGAAENTTIELTGRDRPGLLSEIFAVLADLKCNVVASEIWTHNSRMASVVYITDEATGLP  178

Query  1189  VDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDM  1010
             +DDP RL  I++ L  IL   +D  + A+T+VS+G TH +RRLHQM +ADRDY+      
Sbjct  179   IDDPDRLTKIKQLLLCILMGDRDKRS-ANTAVSVGFTHKERRLHQMMYADRDYDV----D  233

Query  1009  EADCPSLKPN---VSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSD  839
             +ADC S       V++++CV+KGY+VV+++C DRPKL+FD VCTLTDMQYVV HA I ++
Sbjct  234   DADCSSASERNRFVTVENCVDKGYTVVNLRCPDRPKLIFDTVCTLTDMQYVVNHAIIIAE  293

Query  838   GPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVT  659
             GP A QEY+IRH+DG  + +E E+ R++ CLEAAI+RR SEG+RLELC++DRVGLLSDVT
Sbjct  294   GPEACQEYFIRHVDGSPITSEAERQRLINCLEAAIRRRTSEGVRLELCSEDRVGLLSDVT  353

Query  658   RVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             R+ RENGL VTRA V+T G Q VNVF+V DSSG+PV ++ IE +RKEIG
Sbjct  354   RIFRENGLSVTRAEVTTRGSQAVNVFFVTDSSGHPVKSETIEAVRKEIG  402



>ref|XP_007139290.1| hypothetical protein PHAVU_008G016800g [Phaseolus vulgaris]
 gb|ESW11284.1| hypothetical protein PHAVU_008G016800g [Phaseolus vulgaris]
Length=450

 Score =   451 bits (1161),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/408 (55%), Positives = 305/408 (75%), Gaps = 10/408 (2%)
 Frame = -1

Query  1723  CW----PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             CW    P  D E+E L IR+NPPRV+VDN+S +  T++KVDS N+ G LLEVVQVL+D++
Sbjct  3     CWSSPLPLHD-EFEKLVIRMNPPRVTVDNVSSRTDTVIKVDSANRRGSLLEVVQVLTDMN  61

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L + +AY+SSDG WFMDVFHVTDQ+G K    +    I+++LGP+  +   L+    ++V
Sbjct  62    LGVRRAYISSDGEWFMDVFHVTDQNGKKFEQDDVADRIQQSLGPRASSFRSLR----RSV  117

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ + 
Sbjct  118   GVQAEAEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATG  177

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              ++D+P RL  I++ L  +L+   D  + A+T+VS+GSTH DRRLHQ+ +ADRDY+    
Sbjct  178   LSIDNPDRLAKIKQLLLYVLKGDIDKKS-ANTAVSVGSTHKDRRLHQLMYADRDYDIDDG  236

Query  1015  DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
             D  +     K  V++D C++KGY+VV+++C DRPKL+FD VCTLTDMQYVV+H  + ++G
Sbjct  237   DSGSTSDRNKLLVTVDDCIDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEG  296

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
             P A QEY+IRH+DGC + +E E+ RV+ CLEAAI+RR SEG++LELC +DRVGLLSDVTR
Sbjct  297   PEAYQEYFIRHVDGCPISSEAERQRVIHCLEAAIRRRTSEGIKLELCGEDRVGLLSDVTR  356

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             + RENGLLV RA V+T G Q +NVFYV D +GNPV ++ IE +RKEIG
Sbjct  357   IFRENGLLVNRAEVTTRGTQAMNVFYVTDVTGNPVKSETIEAVRKEIG  404



>ref|XP_008788826.1| PREDICTED: uncharacterized protein LOC103706491 isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   452 bits (1162),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 233/419 (56%), Positives = 295/419 (70%), Gaps = 18/419 (4%)
 Frame = -1

Query  1717  PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKA  1538
             PYFDPE+E L+ ++  PRVSVDN SC  CT+VKVDS+NK  +LLEVVQVLSD+DL I+K+
Sbjct  6     PYFDPEFENLNEKMYGPRVSVDNESCDKCTVVKVDSLNKQDLLLEVVQVLSDVDLFISKS  65

Query  1537  YVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKG--YTSDVLKTCPGKNVGVNS  1364
             YVSSD  WFMDVFHV DQ GNKVTD   I YI++A+G +     S  +K C    VG  S
Sbjct  66    YVSSDAEWFMDVFHVKDQQGNKVTDKKVISYIQQAIGARRELQNSGEMKKCYDNAVGTES  125

Query  1363  LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVD  1184
               D TAIE+IG +RPGL SEISAVLA    NVV A  W+HN  +ACV YV+D+ +   +D
Sbjct  126   CSDCTAIEMIGTNRPGLFSEISAVLAEQRCNVVEAHAWSHNACLACVAYVSDESTSACID  185

Query  1183  DPSRLCVIEEQLKNILRAC--KDDNNIAHTSVSMGS----THIDRRLHQMFFADRDYEGG  1022
             DP+RL  IE+QL  ILR     DDN     +  +G     +H +RRLHQ+  A+RD++G 
Sbjct  186   DPNRLATIEDQLSTILRPTMIADDNPRGAKTHFLGCDSSMSHTERRLHQLMLANRDFDGP  245

Query  1021  CLDMEADCPSL---------KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQY  869
                +     S+         K  VSID C EKGYS+V+V+C DRPKLMFD VCTLTDMQY
Sbjct  246   PGQVSTSLSSISMDHVEGGRKTVVSIDRCAEKGYSIVTVECMDRPKLMFDTVCTLTDMQY  305

Query  868   VVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKD-RVVKCLEAAIQRRVSEGLRLELCA  692
             V+FHA+ +S G  A QEYYIRH DG TLDTE E+  +V+KCLEAAI+RRV EGLRLELCA
Sbjct  306   VIFHASSASHGLFAYQEYYIRHKDGYTLDTEDERRLQVIKCLEAAIERRVCEGLRLELCA  365

Query  691   KDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEI  515
             ++ VGLL +VTR+LRE GL + RA ++T GE+  NVFY++D SGN VD +++E +++E+
Sbjct  366   ENSVGLLPNVTRILREYGLTIARADIATDGEKMKNVFYIQDISGNKVDMRLVELMKREL  424



>gb|EAZ23437.1| hypothetical protein OsJ_07127 [Oryza sativa Japonica Group]
Length=610

 Score =   456 bits (1173),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 258/463 (56%), Positives = 312/463 (67%), Gaps = 36/463 (8%)
 Frame = -1

Query  1666  RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTD  1487
             RV +DN +C DCT+VKVDS+NK GILLEVVQVLSDLDL I+KAY++SDGGWFMDVFHV D
Sbjct  149   RVCIDNSTCSDCTLVKVDSMNKNGILLEVVQVLSDLDLAISKAYITSDGGWFMDVFHVVD  208

Query  1486  QHGNKVTDGNTIGYIEKALGPKGYTSDVLK--TCPGKNVGVNSLGDYTAIELIGRDRPGL  1313
             + G KVTD  TI +IEKALGP        K  + P ++VG++S+GD+TAIEL G DR GL
Sbjct  209   KQGQKVTDEKTIKHIEKALGPDSNLLGGAKGGSSPVRSVGMHSIGDHTAIELKGPDRTGL  268

Query  1312  LSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILR  1133
             LSE+ AVLA L  NV+AAEVWTH  R+ACV+YVND  S  AV DP RL  IE +L+ +LR
Sbjct  269   LSEVFAVLAELGCNVLAAEVWTHRARVACVVYVNDVASGQAVGDPCRLSRIEHRLRLVLR  328

Query  1132  A-----------CKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL-  989
                              N   +  +  +TH+DRRLHQ+  AD D +           S  
Sbjct  329   GHAGGDDGDGDDGPAHANFFSSGGAGSNTHVDRRLHQLMHADVDADDDDGLDSRAIVSGE  388

Query  988   ---------KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
                      +P V+++HC EK YSVV+VKC+DR KL+FDIVCTLTDM YVV HA++SSDG
Sbjct  389   AGNAAAAEERPVVTVEHCEEKDYSVVNVKCRDRSKLLFDIVCTLTDMHYVVSHASVSSDG  448

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
                 QE YIR  DG TL  + E  RV+KCLEAAI RRVSEG  LELC +DRVGLLSDVTR
Sbjct  449   IYGIQELYIRRKDGRTLQKD-EAGRVIKCLEAAISRRVSEGFTLELCGRDRVGLLSDVTR  507

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaa  476
             VLRE+GL VTRA V+TVG Q +NVFYVRD+SG PVD K IEGLR ++G  +MLNVKKV +
Sbjct  508   VLREHGLTVTRADVTTVGGQAINVFYVRDASGEPVDMKTIEGLRVQVGHTVMLNVKKVPS  567

Query  475   caca-----------sakVPPETAAWSKTSFF-FGSLLGKFRA  383
                +            +   P + A S+TSFF FG+L  K RA
Sbjct  568   SPSSSSAAAAAAANGKSPGQPASGALSRTSFFSFGNLFAKLRA  610



>ref|XP_004136481.1| PREDICTED: uncharacterized protein LOC101219701 [Cucumis sativus]
 ref|XP_004169538.1| PREDICTED: uncharacterized LOC101219701 [Cucumis sativus]
 gb|KGN60082.1| hypothetical protein Csa_3G876050 [Cucumis sativus]
Length=469

 Score =   451 bits (1160),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 231/467 (49%), Positives = 317/467 (68%), Gaps = 35/467 (7%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPP--RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSD  1562
             M   CWPYFDP+++TL  RIN P  RV +DN S +DCTIVKVDS+NK G+LLEVVQ+L+D
Sbjct  1     MKNVCWPYFDPDFDTLPERINGPTCRVCIDNESMEDCTIVKVDSLNKQGLLLEVVQILTD  60

Query  1561  LDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGK  1382
             L+L I+K+Y+S D GWFMDVFHV D++ +K+TD   I  I++A+G      +  KT    
Sbjct  61    LNLSISKSYISCDAGWFMDVFHVKDENSHKLTDQKVINSIQQAIGTTKGPDNSAKTRRYV  120

Query  1381  NVGVNS--LGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVND  1208
             N  +NS   G++TAIE+ G DRPGL SEISA LA+LH NVV A  W+HN R+AC+ Y++D
Sbjct  121   NKLLNSDNSGEHTAIEMTGTDRPGLFSEISAALADLHCNVVEAHAWSHNARLACIAYISD  180

Query  1207  KVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSV--------SMGSTHIDRRLHQM  1052
             + + + ++DP RL  IEE L  +LRA       + T          +  +T+++RRLHQ+
Sbjct  181   QSTDSPIEDPHRLANIEEHLSTVLRAATAPPIASWTHTLQQEVKISATITTNVERRLHQL  240

Query  1051  FFADRDYEGGCLDMEADCPSLKPN---------VSIDHCVEKGYSVVSVKCKDRPKLMFD  899
               + +DY     D  ++  S +P          VSI+ C +KGYS+VS++CKDRP+LMFD
Sbjct  241   LVSVKDY-----DWTSESISRRPKRKEEWRKTTVSIESCDQKGYSIVSIECKDRPRLMFD  295

Query  898   IVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVS  719
              VCTLTDMQYV+FHA+ISS   +A QEY+IRH++G  L+++ +K RVVKCLEAAI+RRV 
Sbjct  296   TVCTLTDMQYVIFHASISSKKDNAFQEYFIRHVNGYALNSDYDKHRVVKCLEAAIERRVC  355

Query  718   EGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKI  539
             EG+RLELCA +RVGLLSD+TRVLRENGL V RA ++T GE+ +N FYV+D SG  VD ++
Sbjct  356   EGVRLELCANNRVGLLSDITRVLRENGLNVVRADIATQGEKAINAFYVKDISGKEVDMEM  415

Query  538   IEGLRKEIGQRMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
             +E ++KEIG  ++            +   PP T   +++ F F  +L
Sbjct  416   VESVKKEIGPVVL---------RVKNETSPPSTPQITRSRFSFSDML  453



>ref|XP_003552661.1| PREDICTED: uncharacterized protein LOC100816426 [Glycine max]
Length=450

 Score =   450 bits (1157),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 228/408 (56%), Positives = 302/408 (74%), Gaps = 10/408 (2%)
 Frame = -1

Query  1723  CW----PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             CW    P  D E+E L IR+NPPRV+VDNIS    T++KVDS NK G LLEVVQVL+D++
Sbjct  3     CWYSPHPLHD-EFEKLVIRMNPPRVAVDNISSGTDTVIKVDSANKRGSLLEVVQVLTDMN  61

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L + +AY+SSDG WFMDVFHVTDQ+G K    +    I+++LGP+  +   L+    ++V
Sbjct  62    LSVRRAYISSDGEWFMDVFHVTDQNGKKFMQDDVADRIQQSLGPRASSFRSLR----RSV  117

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ + 
Sbjct  118   GVQAEAEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATG  177

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              ++DDP RL  I++ L  +L+   D  + A+T+VS+GSTH DRRLHQ+ +ADRDY+    
Sbjct  178   LSIDDPDRLAKIKQLLLYVLKGDIDKKS-ANTAVSVGSTHKDRRLHQLMYADRDYDVDDG  236

Query  1015  DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
             D  +     K  V++D C++KGY+VV+++C DRPKL+FD VCTLTDMQYVV+H  + ++G
Sbjct  237   DSGSTSDRNKLLVTVDDCIDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEG  296

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
             P A QEYYIRH+DG  + +E E+ RV+ CLEAA++RR SEG++LELC +DRVGLLSDVTR
Sbjct  297   PEAYQEYYIRHVDGSPISSEAERQRVIHCLEAAVRRRTSEGIKLELCGEDRVGLLSDVTR  356

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             + RENGL V RA V+T G Q +NVFYV D SGNPV ++ IE +RKEIG
Sbjct  357   IFRENGLSVNRAEVTTRGSQAMNVFYVTDVSGNPVKSETIETVRKEIG  404



>gb|KHN13850.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=450

 Score =   450 bits (1157),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 228/408 (56%), Positives = 301/408 (74%), Gaps = 10/408 (2%)
 Frame = -1

Query  1723  CW----PYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             CW    P  D E+E L IR+NPPRV+VDNIS    T++KVDS NK G LLEVVQVL+D++
Sbjct  3     CWYSPHPLHD-EFEKLVIRMNPPRVAVDNISSGTDTVIKVDSANKRGSLLEVVQVLTDMN  61

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNV  1376
             L + +AY+SSDG WFMDVFHVTDQ+G K    +    I+++LGP+  +   L+    ++V
Sbjct  62    LSVRRAYISSDGEWFMDVFHVTDQNGKKFMQDDVADRIQQSLGPRASSFRSLR----RSV  117

Query  1375  GVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSC  1196
             GV +  ++T IEL GRDRPGLLSE+ AVLA+L  NVVAAEVWTHN R+A V+Y+ D+ + 
Sbjct  118   GVQAEAEHTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATG  177

Query  1195  NAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCL  1016
              ++DDP RL  I++ L  +L+   D    A+T+VS+GSTH DRRLHQ+ +ADRDY+    
Sbjct  178   LSIDDPDRLAKIKQLLLYVLKGDIDKKR-ANTAVSVGSTHKDRRLHQLMYADRDYDVDDG  236

Query  1015  DMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
             D  +     K  V++D C++KGY+VV+++C DRPKL+FD VCTLTDMQYVV+H  + ++G
Sbjct  237   DSGSTSDRNKLLVTVDDCIDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEG  296

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
             P A QEYYIRH+DG  + +E E+ RV+ CLEAA++RR SEG++LELC +DRVGLLSDVTR
Sbjct  297   PEAYQEYYIRHVDGSPISSEAERQRVIHCLEAAVRRRTSEGIKLELCGEDRVGLLSDVTR  356

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
             + RENGL V RA V+T G Q +NVFYV D SGNPV ++ IE +RKEIG
Sbjct  357   IFRENGLSVNRAEVTTRGSQAMNVFYVTDVSGNPVKSETIETVRKEIG  404



>ref|XP_004492064.1| PREDICTED: uncharacterized protein LOC101498352 [Cicer arietinum]
Length=451

 Score =   449 bits (1156),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 297/407 (73%), Gaps = 8/407 (2%)
 Frame = -1

Query  1723  CWPY---FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDL  1553
             CW      D E+E L IR+NPPRV+VDN S +  T++KVDS NK G LLEVVQVL+D++L
Sbjct  3     CWTSSLPLDDEFEKLVIRMNPPRVTVDNTSSRTTTLIKVDSANKRGSLLEVVQVLTDMNL  62

Query  1552  IITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVG  1373
             I+ +AY+SSDGGWFMDVFHVTDQ+G K    +    I+++LGP+  +   ++     +VG
Sbjct  63    IVRRAYISSDGGWFMDVFHVTDQNGKKCLQEDVADRIQQSLGPRVRSFRSVRR----SVG  118

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V S+ ++T IEL GRDR GLLSE+ A+LA+L  NVVAAEVWTHN R+A V+Y+ D V+  
Sbjct  119   VQSVAEHTTIELTGRDRQGLLSEVFAILADLKCNVVAAEVWTHNSRMASVVYITDDVTGL  178

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLD  1013
              +D+P RL  I+  L  +L+   D  N A+T+VS  STH +RRLHQ+ +ADRDY+    D
Sbjct  179   PIDNPDRLAKIKHLLLYVLKGDVDKKN-ANTAVSFASTHKERRLHQLMYADRDYDIYDGD  237

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               A     K +V++D C++KGY+VV++KC DRPKL+FD VCTLTDMQYVV+H  + ++GP
Sbjct  238   SCATSDRNKLHVTVDDCIDKGYTVVNLKCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEGP  297

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A QEYYIRH+DG  + +E E+ RV+ CLEAA++RR SEG++LEL   DRVGLLSDVTR+
Sbjct  298   EAYQEYYIRHVDGYPISSEAERQRVIHCLEAAVRRRTSEGIKLELSGDDRVGLLSDVTRI  357

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              RENGL V RA V+T G Q +NVFYV D SGNPV ++ I+ +RKEIG
Sbjct  358   FRENGLSVCRAEVTTRGSQAMNVFYVTDVSGNPVKSETIDAVRKEIG  404



>gb|EAZ27314.1| hypothetical protein OsJ_11253 [Oryza sativa Japonica Group]
Length=455

 Score =   449 bits (1156),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 239/455 (53%), Positives = 307/455 (67%), Gaps = 21/455 (5%)
 Frame = -1

Query  1744  AVDMARACWPY-FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVL  1568
             AVD   +C  +  D EY+    ++NPPRV +DN SCK+ T+V VDS NK GILLEVVQVL
Sbjct  3     AVDGETSCSSWDSDDEYQKFIQKMNPPRVVIDNTSCKNATVVHVDSANKYGILLEVVQVL  62

Query  1567  SDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNT----IGYIEKALGPKGYTSDVL  1400
             ++L LI+ KAY+SSDGGWFMDVF+VTDQ+G K+ D +     + YI K LG         
Sbjct  63    TELQLIVKKAYISSDGGWFMDVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADS----CF  118

Query  1399  KTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVL  1220
                  ++VGV    DYT IEL G DRPGLLSE+SAVL NL  NVV AEVWTHN+R A V+
Sbjct  119   LPSRRRSVGVEPSSDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVM  178

Query  1219  YVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFAD  1040
              V D+ +  A+ D  RL  I+E+L  + +      +   T+V+MG TH +RRLHQ+   D
Sbjct  179   QVMDRKTGLAISDTQRLARIKERLSYVFKGSNRSQD-TKTTVTMGITHTERRLHQLMLED  237

Query  1039  RDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVF  860
             RDYE    D     P+  P VS+ + ++K YSVV+++CKDRPKL+FD VCTLTDMQYVVF
Sbjct  238   RDYERYDKDRTNVNPT--PVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVF  295

Query  859   HAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRV  680
             H ++ S+GP A QEYYIRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LEL   DRV
Sbjct  296   HGSVDSEGPEAYQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRV  355

Query  679   GLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSG-NPVDTKIIEGLRKEIGQRM  503
             GLLSDVTR+ RENGL VTRA VST G++ VN FYVRD++G + VD K +E +R+EIGQ +
Sbjct  356   GLLSDVTRIFRENGLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTV  415

Query  502   MLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
             +              K PP+    S + F F SL 
Sbjct  416   L-----QVKGHPDHRKSPPQE---SPSRFLFSSLF  442



>gb|EAY90442.1| hypothetical protein OsI_12028 [Oryza sativa Indica Group]
Length=455

 Score =   449 bits (1156),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 239/455 (53%), Positives = 307/455 (67%), Gaps = 21/455 (5%)
 Frame = -1

Query  1744  AVDMARACWPY-FDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVL  1568
             AVD   +C  +  D EY+    ++NPPRV +DN SCK+ T+V VDS NK GILLEVVQVL
Sbjct  3     AVDGETSCSSWDSDDEYQKFIQKMNPPRVVIDNTSCKNATVVHVDSANKYGILLEVVQVL  62

Query  1567  SDLDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNT----IGYIEKALGPKGYTSDVL  1400
             ++L LI+ KAY+SSDGGWFMDVF+VTDQ+G K+ D +     + YI K LG         
Sbjct  63    TELQLIVKKAYISSDGGWFMDVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADS----CF  118

Query  1399  KTCPGKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVL  1220
                  ++VGV    DYT IEL G DRPGLLSE+SAVL NL  NVV AEVWTHN+R A V+
Sbjct  119   LPSRRRSVGVEPSSDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVM  178

Query  1219  YVNDKVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFAD  1040
              V D+ +  A+ D  RL  I+E+L  + +      +   T+V+MG TH +RRLHQ+   D
Sbjct  179   QVMDRETGLAISDTQRLARIKERLSYVFKGSNRSQD-TKTTVTMGITHTERRLHQLMLED  237

Query  1039  RDYEGGCLDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVF  860
             RDYE    D     P+  P VS+ + ++K YSVV+++CKDRPKL+FD VCTLTDMQYVVF
Sbjct  238   RDYERYDKDRTNVNPT--PVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVF  295

Query  859   HAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRV  680
             H ++ S+GP A QEYYIRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LEL   DRV
Sbjct  296   HGSVDSEGPEAYQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRV  355

Query  679   GLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSG-NPVDTKIIEGLRKEIGQRM  503
             GLLSDVTR+ RENGL VTRA VST G++ VN FYVRD++G + VD K +E +R+EIGQ +
Sbjct  356   GLLSDVTRIFRENGLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTV  415

Query  502   MLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
             +              K PP+    S + F F SL 
Sbjct  416   L-----QVKGHPDHRKSPPQE---SPSRFLFSSLF  442



>ref|XP_008466435.1| PREDICTED: uncharacterized protein LOC103503843 [Cucumis melo]
Length=469

 Score =   450 bits (1157),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 229/467 (49%), Positives = 317/467 (68%), Gaps = 35/467 (7%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPP--RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSD  1562
             M   CWPYFDP+++TL  RIN P  RV +DN S +DCTIVKVDS+NK G+LLEVVQ+L+D
Sbjct  1     MKNVCWPYFDPDFDTLPERINGPTCRVCIDNESMEDCTIVKVDSLNKQGLLLEVVQILTD  60

Query  1561  LDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKT--CP  1388
             L+L I+K+Y+S D GWFMDVFHV D++ +K+TD   I  I++A+G      +  KT    
Sbjct  61    LNLSISKSYISCDAGWFMDVFHVKDENSHKLTDQKVINSIQQAIGTTKGPDNSSKTRRYV  120

Query  1387  GKNVGVNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVND  1208
              K +  ++ G++TAIE+ G DRPGL SEISA LA+LH NVV A  W+HN R+AC+ Y++D
Sbjct  121   NKFLNADNSGEHTAIEMTGTDRPGLFSEISAALADLHCNVVEAHAWSHNARLACIAYISD  180

Query  1207  KVSCNAVDDPSRLCVIEEQLKNILRACKDDNNIAHTSV--------SMGSTHIDRRLHQM  1052
             + + + ++DP RL  IEE L  +LRA       + T          +  +T+++RRLHQ+
Sbjct  181   QSTDSPIEDPHRLANIEEHLSTVLRAATAPPIASWTHTLQQEVKISATITTNVERRLHQL  240

Query  1051  FFADRDYEGGCLDMEADCPSLKPN---------VSIDHCVEKGYSVVSVKCKDRPKLMFD  899
               + +DY     D  ++  S +P          VSI+ C +KGYS+VS++CKDRP+LMFD
Sbjct  241   LVSVKDY-----DWTSESISKRPKRNEDWRKTMVSIESCDQKGYSIVSIECKDRPRLMFD  295

Query  898   IVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVS  719
              VCTLTDMQYV+FHA+ISS   +A QEY+IRH++G  L+++ +K RVVKCLEAAI+RRV 
Sbjct  296   TVCTLTDMQYVIFHASISSKKDNAFQEYFIRHVNGYALNSDYDKHRVVKCLEAAIERRVC  355

Query  718   EGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKI  539
             EG+RLELCA +RVGLLSD+TRVLRENGL V RA ++T GE+ +N FYV+D SG  VD ++
Sbjct  356   EGVRLELCANNRVGLLSDITRVLRENGLNVVRADIATQGEKAINAFYVKDISGKEVDMEM  415

Query  538   IEGLRKEIGQRMMLNvkkvaacacasakVPPETAAWSKTSFFFGSLL  398
             +E ++KEIG  ++            +   PP T   +++ F F  +L
Sbjct  416   VESVKKEIGPVVL---------RVKNETSPPSTPQITRSRFSFSDML  453



>ref|XP_008668558.1| PREDICTED: ACR4 isoform X1 [Zea mays]
 tpg|DAA45791.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=459

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 307/450 (68%), Gaps = 21/450 (5%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY+     +NPPRV++DN SC + T++ VDS NK GILLEVVQVL+DL LI+ KAY+S
Sbjct  17    DDEYQKFIQNMNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKKAYIS  76

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIG----YIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             SDGGWFMDVF VT+Q G+K+TD + +     YI K++GP             + VGV   
Sbjct  77    SDGGWFMDVFTVTNQSGHKITDESVLQGIKDYIYKSIGPDS----CFLPSRRRAVGVEPS  132

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              D+T IEL G DRPGLLSE+SAVL +L  NVV+AE+WTHN R A V+ V D+ S  AV D
Sbjct  133   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  192

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSV-SMGSTHIDRRLHQMFFADRDYEGGCLD---  1013
               R+  I+ +L N+ R    D   A T+V + G+TH +RRLHQM F DRDYE    D   
Sbjct  193   AERVGRIKGRLYNVFRGRSRD---AKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGR  249

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               A   +  P VS+ + ++K YSVV+V+C+DRPKL+FD VCTLTDMQYVVFH ++ ++GP
Sbjct  250   AAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGP  309

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A Q+YYIRH+DGC +++E E+ R+++CLEAAI+RRVSEGL+LEL   DRVGLLSDVTR+
Sbjct  310   EAYQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRI  369

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaac  473
              RENGL VTRA VST G++ VN FYVRD++G+ V+ + +E +R+EIGQ ++         
Sbjct  370   FRENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVL------QVK  423

Query  472   acasakVPPETAAWSKTSFFFGSLLGKFRA  383
                    PP  A  S T F F SLL + R+
Sbjct  424   GHPEQPKPPVAAQDSPTRFLFSSLLFRPRS  453



>ref|NP_197914.1| ACT domain-containing protein [Arabidopsis thaliana]
 sp|F4JWR0.1|ACR2_ARATH RecName: Full=ACT domain-containing protein ACR2; AltName: Full=Protein 
ACT DOMAIN REPEATS 2 [Arabidopsis thaliana]
 gb|AED93426.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=500

 Score =   451 bits (1159),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 303/443 (68%), Gaps = 39/443 (9%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRI-NPP-RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSD  1562
             M + CWPYFDP+++ L  RI  PP RV +DN S +DCT+VKV+S NK G+LLEVVQ+L+D
Sbjct  1     MQKVCWPYFDPDFDNLGERIYGPPCRVYIDNDSIQDCTVVKVNSENKQGLLLEVVQILTD  60

Query  1561  LDLIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGK  1382
             ++LIITK+Y+SSDGGWFMDVFHV D+HGNK+TD + I +I+ A+G     SD +K     
Sbjct  61    MNLIITKSYISSDGGWFMDVFHVKDEHGNKLTDKSVINHIKHAIGTSRRESDFIKASEAN  120

Query  1381  NVGVNSL-------GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACV  1223
             N   NSL       G++TAIE+ G DRPGL SEI A  A+LH NV+ A  W+HN R+AC+
Sbjct  121   N---NSLEPQLADHGEHTAIEMTGTDRPGLFSEIFAAFADLHCNVMEAHAWSHNARLACI  177

Query  1222  LYVNDKVSCNAVDDPSRLCVIEEQLKNILRACKD---------------DNNIAHTSVSM  1088
              YV+D  +   +DDPSRL  IE+ L  ++RA  D               D  +A      
Sbjct  178   AYVSDDNTHTPIDDPSRLASIEDHLSTVIRATADPASNSTHVGHKENETDGFLAGQGKGC  237

Query  1087  GSTHIDRRLHQMFFADRDY-EGGCLDMEADCPSLKPN-----------VSIDHCVEKGYS  944
              +++++RRLHQ+  + RD+ E  C        S K             VSI +C E+GYS
Sbjct  238   MNSNMERRLHQLMLSVRDFDEPFCEPSSLSLLSSKLEYCDHKERKTTIVSIGNCEERGYS  297

Query  943   VVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKD  764
             +V+VK KDR +LMFD +CTL DMQYV+FHAA+ SDG  A QEY+IRH+DG  L+TEGEK+
Sbjct  298   IVTVKSKDRRRLMFDTICTLVDMQYVIFHAALRSDGADAFQEYFIRHIDGRALNTEGEKE  357

Query  763   RVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNV  584
             RV+KCLEAAI+RRV EG++LELCA++RVGLLSD+TRVLRENGL V RA V T G++ +N 
Sbjct  358   RVIKCLEAAIERRVCEGVKLELCAENRVGLLSDITRVLRENGLTVVRADVETQGQKSLNA  417

Query  583   FYVRDSSGNPVDTKIIEGLRKEI  515
             FYVRD SGN +D + +E ++KE+
Sbjct  418   FYVRDISGNKIDMEFVESVKKEM  440



>ref|NP_001050359.1| Os03g0413100 [Oryza sativa Japonica Group]
 gb|AAS07063.1| putative ACT domain containing protein, ACR4, with alternative 
splicing forms [Oryza sativa Japonica Group]
 gb|ABF96586.1| ACT domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12273.1| Os03g0413100 [Oryza sativa Japonica Group]
 dbj|BAF46923.1| ACT-domain repeat protein 7 [Oryza sativa Japonica Group]
 dbj|BAG88644.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   449 bits (1154),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 301/442 (68%), Gaps = 20/442 (5%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY+    ++NPPRV +DN SCK+ T+V VDS NK GILLEVVQVL++L LI+ KAY+S
Sbjct  13    DDEYQKFIQKMNPPRVVIDNTSCKNATVVHVDSANKYGILLEVVQVLTELQLIVKKAYIS  72

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNT----IGYIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             SDGGWFMDVF+VTDQ+G K+ D +     + YI K LG              ++VGV   
Sbjct  73    SDGGWFMDVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADS----CFLPSRRRSVGVEPS  128

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              DYT IEL G DRPGLLSE+SAVL NL  NVV AEVWTHN+R A V+ V D+ +  A+ D
Sbjct  129   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISD  188

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEAD  1001
               RL  I+E+L  + +      +   T+V+MG TH +RRLHQ+   DRDYE    D    
Sbjct  189   TQRLARIKERLSYVFKGSNRSQD-TKTTVTMGITHTERRLHQLMLEDRDYERYDKDRTNV  247

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
              P+  P VS+ + ++K YSVV+++CKDRPKL+FD VCTLTDMQYVVFH ++ S+GP A Q
Sbjct  248   NPT--PVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAYQ  305

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LEL   DRVGLLSDVTR+ REN
Sbjct  306   EYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFREN  365

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSG-NPVDTKIIEGLRKEIGQRMMLNvkkvaacaca  464
             GL VTRA VST G++ VN FYVRD++G + VD K +E +R+EIGQ ++            
Sbjct  366   GLTVTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTVL-----QVKGHPD  420

Query  463   sakVPPETAAWSKTSFFFGSLL  398
               K PP+    S + F F SL 
Sbjct  421   HRKSPPQE---SPSRFLFSSLF  439



>gb|KDP32101.1| hypothetical protein JCGZ_12562 [Jatropha curcas]
Length=477

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 316/468 (68%), Gaps = 29/468 (6%)
 Frame = -1

Query  1735  MARACWPYFDPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLD  1556
             M  A  PY DPE+E+L  RI PPRV +DN SC+DCT+VKVDS NK GILLE+VQVL+DLD
Sbjct  1     MEIAYQPYIDPEFESLIERIYPPRVCIDNDSCQDCTLVKVDSANKHGILLEMVQVLTDLD  60

Query  1555  LIITKAYVSSDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKAL--GPKGYTSDVLKTCPGK  1382
             L+I+K+Y+SSDGGWFMDVFHVTDQ GNK+TD + I YI++ L    KG  S  L+ C  +
Sbjct  61    LVISKSYISSDGGWFMDVFHVTDQLGNKITDESLILYIQQELCANRKGGISQELQNCLKR  120

Query  1381  NVGVNSLG-DYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDK  1205
              V    +  ++TAIE+ G DRPGLLSEISAVLA L   V AA VWTHN R AC++Y+ D+
Sbjct  121   EVRPRHVSTEHTAIEMTGTDRPGLLSEISAVLAELECQVTAAVVWTHNARAACIIYLEDR  180

Query  1204  VSCNAVDDPSRLCVIEEQLKNILRA---CKDDNNIAHTSVSMGSTHIDRRLHQMFFADRD  1034
             +    + DP+RL  IEEQL+N++ A     +  ++   +   G TH +RRLHQ+ +++ D
Sbjct  181   LRGGPITDPNRLGHIEEQLENVVDAHHGVGERRSLRLITPVAGQTHTERRLHQLMYSNID  240

Query  1033  YEGGC------LDMEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQ  872
             Y   C      +    +C   K +VSI+ C EKGYSVV+++ +DRPKL+FD +C LTDMQ
Sbjct  241   YAPCCSCTDTGVGHRRNCT--KIHVSIESCKEKGYSVVNMRSRDRPKLLFDTLCVLTDMQ  298

Query  871   YVVFHAAISSDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCA  692
             YVVFHAA+SS G  A QEY+IRH DG TLDTEGE+ ++ +CL AAI+RRVS GLRL+LC 
Sbjct  299   YVVFHAAVSSMGTMADQEYFIRHKDGFTLDTEGERHKLTQCLIAAIERRVSHGLRLDLCT  358

Query  691   KDRVGLLSDVTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIG  512
              +R+GLLSD+TR  RENGL ++RA + T GE  V  FYV D+SG+ ++   IE +RKEIG
Sbjct  359   HNRIGLLSDMTRAFRENGLSISRAEMGTQGETAVGSFYVTDASGDEINPLTIEVVRKEIG  418

Query  511   QRMMLNvkkvaacacasakVPPETAAWSKTS----------FFFGSLL  398
               +++        +       P TA+ S+TS          F  GSLL
Sbjct  419   GSVLV-----VNKSPDWTPRSPSTASMSRTSSGSIGDDKPRFSLGSLL  461



>ref|NP_001142223.1| ACR4 [Zea mays]
 gb|ACF87927.1| unknown [Zea mays]
 gb|ACN27877.1| unknown [Zea mays]
 tpg|DAA45792.1| TPA: ACR4 [Zea mays]
Length=458

 Score =   449 bits (1154),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 307/450 (68%), Gaps = 21/450 (5%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY+     +NPPRV++DN SC + T++ VDS NK GILLEVVQVL+DL LI+ KAY+S
Sbjct  16    DDEYQKFIQNMNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKKAYIS  75

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIG----YIEKALGPKGYTSDVLKTCPGKNVGVNSL  1361
             SDGGWFMDVF VT+Q G+K+TD + +     YI K++GP             + VGV   
Sbjct  76    SDGGWFMDVFTVTNQSGHKITDESVLQGIKDYIYKSIGPDS----CFLPSRRRAVGVEPS  131

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              D+T IEL G DRPGLLSE+SAVL +L  NVV+AE+WTHN R A V+ V D+ S  AV D
Sbjct  132   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  191

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSV-SMGSTHIDRRLHQMFFADRDYEGGCLD---  1013
               R+  I+ +L N+ R    D   A T+V + G+TH +RRLHQM F DRDYE    D   
Sbjct  192   AERVGRIKGRLYNVFRGRSRD---AKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGR  248

Query  1012  MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGP  833
               A   +  P VS+ + ++K YSVV+V+C+DRPKL+FD VCTLTDMQYVVFH ++ ++GP
Sbjct  249   AAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGP  308

Query  832   SASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRV  653
              A Q+YYIRH+DGC +++E E+ R+++CLEAAI+RRVSEGL+LEL   DRVGLLSDVTR+
Sbjct  309   EAYQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRI  368

Query  652   LRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaac  473
              RENGL VTRA VST G++ VN FYVRD++G+ V+ + +E +R+EIGQ ++         
Sbjct  369   FRENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVL------QVK  422

Query  472   acasakVPPETAAWSKTSFFFGSLLGKFRA  383
                    PP  A  S T F F SLL + R+
Sbjct  423   GHPEQPKPPVAAQDSPTRFLFSSLLFRPRS  452



>ref|XP_009394314.1| PREDICTED: uncharacterized protein LOC103979823 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   448 bits (1153),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 303/441 (69%), Gaps = 24/441 (5%)
 Frame = -1

Query  1702  EYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSD  1523
             EYE    R+NPPRV VDN SC D T++KVDS NK GILLEVVQVL DL+LIITKAY+SSD
Sbjct  14    EYEKFIRRMNPPRVVVDNDSCADATVIKVDSANKHGILLEVVQVLMDLNLIITKAYISSD  73

Query  1522  GGWFMDVFHVTDQHGNKVTDGNTI----GYIEKALGPKGYTSDVLKTCPGKNVGVNSL--  1361
             GGWFMDVF+V D+ GNK+ +   +    G+I K+LG +          P +   ++ +  
Sbjct  74    GGWFMDVFNVRDRDGNKIGEEMKLNEINGFIRKSLGEES------SYIPSRRRSIDFMPS  127

Query  1360  GDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDD  1181
              D+T+IEL G DRPGLLSE+ AVL++L  NVV AEVWTHN R A V+ V+DK +  A+ D
Sbjct  128   SDHTSIELTGTDRPGLLSEVCAVLSDLECNVVNAEVWTHNTRAAAVMQVSDKGTGTAIAD  187

Query  1180  PSRLCVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEAD  1001
             P +L  I++ L N+L+        A T+VS+G+TH +RRLHQM F DRDYE    D    
Sbjct  188   PEKLSRIKKLLYNVLKGSNKSRE-AKTAVSVGATHTERRLHQMMFDDRDYERSGEDDGNV  246

Query  1000  CPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQ  821
             C   +P V++ +  +K YS+V+++CKDRPKL+FD VCTLTDMQYVVFH  + ++GP A Q
Sbjct  247   CH--RPKVTVVNWFDKDYSMVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEAYQ  304

Query  820   EYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLREN  641
             EYYIRH+DG  +++E E+ RV++CLEAAI+RRVSEGL+LELC  DR+GLLSDVTR+ REN
Sbjct  305   EYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRMGLLSDVTRIFREN  364

Query  640   GLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacas  461
             GL VTRA V+T G +  N+FYVRD++GN VD K ++ +R EIGQ ++             
Sbjct  365   GLTVTRAEVTTKGGKVFNIFYVRDAAGNSVDPKTLDDIRAEIGQTVL-----QVKGHSDH  419

Query  460   akVPPETAAWSKTSFFFGSLL  398
              K P E    S T F  GSL 
Sbjct  420   LKSPQE----SPTRFLLGSLF  436



>gb|ACG25547.1| ACR4 [Zea mays]
Length=458

 Score =   448 bits (1153),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 310/454 (68%), Gaps = 29/454 (6%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D EY+     +NPPRV++DN SC + T++ VDS NK GILLEVVQVL+DL LI+ KAY+S
Sbjct  16    DDEYQKFIQNMNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKKAYIS  75

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIG----YIEKALGPKGYTSDVLKTC--PGKN--VG  1373
             SDGGWFMDVF VT+Q G+K+TD + +     YI K++GP         +C  P +   VG
Sbjct  76    SDGGWFMDVFTVTNQSGHKITDESVLQGIKDYIYKSIGPD--------SCFLPSRRXAVG  127

Query  1372  VNSLGDYTAIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCN  1193
             V    D+T IEL G DRPGLLSE+SAVL +L  NVV+AE+WTHN R A V+ V D+ S  
Sbjct  128   VEPSSDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGL  187

Query  1192  AVDDPSRLCVIEEQLKNILRACKDDNNIAHTSV-SMGSTHIDRRLHQMFFADRDYEGGCL  1016
             AV D  R+  I+ +L N+ R    D   A T+V + G+TH +RRLHQM F DRDYE    
Sbjct  188   AVSDAERVGRIKGRLYNVFRGRSRD---AKTAVATTGATHPERRLHQMMFEDRDYERRGK  244

Query  1015  D---MEADCPSLKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAIS  845
             D     A   +  P VS+ + ++K YSVV+V+C+DRPKL+FD VCTLTDMQYVVFH ++ 
Sbjct  245   DDGRAAASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVD  304

Query  844   SDGPSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSD  665
             ++GP A Q+YYIRH+DGC +++E E+ R+++CLEAAI+RRVSEGL+LEL   DRVGLLSD
Sbjct  305   TEGPEAYQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSD  364

Query  664   VTRVLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkk  485
             VTR+ RENGL VTRA VST G++ VN FYVRD++G+ V+ + +E +R+EIGQ ++     
Sbjct  365   VTRIFRENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVL-----  419

Query  484   vaacacasakVPPETAAWSKTSFFFGSLLGKFRA  383
                        PP  A  S T F F SLL + R+
Sbjct  420   -QVKGHPEQPKPPVAAQDSPTRFLFSSLLFRPRS  452



>gb|EAY86274.1| hypothetical protein OsI_07644 [Oryza sativa Indica Group]
Length=608

 Score =   453 bits (1166),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 258/461 (56%), Positives = 312/461 (68%), Gaps = 34/461 (7%)
 Frame = -1

Query  1666  RVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVSSDGGWFMDVFHVTD  1487
             RV +DN +C D T+VKVDS+NK GILLEVVQVLSDLDL I+KAY++SDGGWFMDVFHV D
Sbjct  149   RVCIDNSTCSDFTLVKVDSMNKNGILLEVVQVLSDLDLAISKAYITSDGGWFMDVFHVVD  208

Query  1486  QHGNKVTDGNTIGYIEKALGPKGYTSDVLK--TCPGKNVGVNSLGDYTAIELIGRDRPGL  1313
             + G KVTD  TI +IEKALGP        K  + P ++VG++S+GD+TAIEL G DR GL
Sbjct  209   KQGQKVTDEKTIKHIEKALGPDSNLLGGAKGGSSPVRSVGMHSIGDHTAIELKGPDRTGL  268

Query  1312  LSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRLCVIEEQLKNILR  1133
             LSE+ AVLA L  NV+AAEVWTH  R+ACV+YVND  S  AV DP RL  IE +L+ +LR
Sbjct  269   LSEVFAVLAELGCNVLAAEVWTHRARVACVVYVNDVASGQAVGDPCRLSRIEHRLRLVLR  328

Query  1132  A-----------CKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPSL-  989
                              N   +  +  +TH+DRRLHQ+  AD D +           S  
Sbjct  329   GHAGGDDGDGDDGPAHANFFSSGGAGSNTHVDRRLHQLMHADVDADDDDGLDSRAIVSGE  388

Query  988   ---------KPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDG  836
                      +P V+++HC EK YSVV+VKC+DR KL+FDIVCTLTDM YVV HA++SSDG
Sbjct  389   AGNAAAAEERPVVTVEHCEEKDYSVVNVKCRDRSKLLFDIVCTLTDMHYVVSHASVSSDG  448

Query  835   PSASQEYYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTR  656
                 QE YIR  DG TL  + E  RV+KCLEAAI RRVSEG  LELC +DRVGLLSDVTR
Sbjct  449   IYGIQELYIRRKDGRTLQKD-EAGRVIKCLEAAISRRVSEGFTLELCGRDRVGLLSDVTR  507

Query  655   VLRENGLLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaa  476
             VLRE+GL VTRA V+TVG Q +NVFYVRD+SG PVD K IEGLR ++G  +MLNVKKV +
Sbjct  508   VLREHGLTVTRADVTTVGGQAINVFYVRDASGEPVDMKTIEGLRVQVGHTVMLNVKKVPS  567

Query  475   cacasakV---------PPETAAWSKTSFF-FGSLLGKFRA  383
                +S+            P + A S+TSFF FG+L  K RA
Sbjct  568   SPSSSSSAAAANGKSPGQPASGALSRTSFFSFGNLFAKLRA  608



>ref|XP_009799495.1| PREDICTED: uncharacterized protein LOC104245573 isoform X1 [Nicotiana 
sylvestris]
Length=449

 Score =   447 bits (1149),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 231/443 (52%), Positives = 308/443 (70%), Gaps = 18/443 (4%)
 Frame = -1

Query  1708  DPEYETLSIRINPPRVSVDNISCKDCTIVKVDSVNKPGILLEVVQVLSDLDLIITKAYVS  1529
             D E+E L +R+NPPRV+VDN S K  T++KVDS NK G LLEVVQVL+DL+LII +AY+S
Sbjct  11    DDEFEKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYIS  70

Query  1528  SDGGWFMDVFHVTDQHGNKVTDGNTIGYIEKALGPKGYTSDVLKTCPGKNVGVNSLGDYT  1349
             SDG WFMDVFHVTD++GNK+++ N    I+++LGP+G +   L+    ++VGV S  + T
Sbjct  71    SDGEWFMDVFHVTDEYGNKLSEDNVAERIQQSLGPRGCSFRSLE----RSVGVQSAAEQT  126

Query  1348  AIELIGRDRPGLLSEISAVLANLHFNVVAAEVWTHNQRIACVLYVNDKVSCNAVDDPSRL  1169
              IEL GRDRPGLLSEI AVL +   NVVAAEVWTHN R+A V+Y+  + +  A+DD  RL
Sbjct  127   TIELTGRDRPGLLSEIFAVLTDHRCNVVAAEVWTHNSRMASVVYITHEENGLAIDDTDRL  186

Query  1168  CVIEEQLKNILRACKDDNNIAHTSVSMGSTHIDRRLHQMFFADRDYEGGCLDMEADCPS-  992
               I + L  +L+  +D  + A+T+VS+ STH +RRLHQM +A    +      + DC S 
Sbjct  187   AKIRQLLLYVLKGDRDRRS-ANTAVSVDSTHKERRLHQMMYA----DRDYDKDDTDCISS  241

Query  991   --LKPNVSIDHCVEKGYSVVSVKCKDRPKLMFDIVCTLTDMQYVVFHAAISSDGPSASQE  818
                KP V++++C +KGY+VV+++  DRPKL+FD VCTLTDMQYVV+H  I ++G  A QE
Sbjct  242   DRTKPLVTVENCADKGYTVVNLRGADRPKLIFDTVCTLTDMQYVVYHGTIIAEGRGAYQE  301

Query  817   YYIRHMDGCTLDTEGEKDRVVKCLEAAIQRRVSEGLRLELCAKDRVGLLSDVTRVLRENG  638
             YYIRHMDGC + +E E+ RV++CLEAAI+RR S G+RLELC  DR+G LSDVTR+ RENG
Sbjct  302   YYIRHMDGCPISSEAERQRVIQCLEAAIKRRTSNGIRLELCGDDRIGFLSDVTRIFRENG  361

Query  637   LLVTRAGVSTVGEQGVNVFYVRDSSGNPVDTKIIEGLRKEIGQRMMLNvkkvaacacasa  458
             L V+RA V+T G Q VNVFYV D+SG+ V ++ I+ +RKEIGQ ++             +
Sbjct  362   LSVSRAEVTTRGSQAVNVFYVTDASGSQVKSETIQAVRKEIGQTVL------RVKDDVYS  415

Query  457   kVPPETAAWSKTSFFFGSLLGKF  389
               PP+  A       F S   KF
Sbjct  416   DSPPQQTARFSLGHIFRSSSEKF  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6033350497260