BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20776_g1_i4 len=1946 path=[311:0-540 4109:541-628 852:629-730
3794:731-815 954:816-1151 25:1152-1185 @59@!:1186-1564
310:1565-1945]

Length=1946
                                                                      Score     E

ref|XP_011074997.1|  PREDICTED: monocopper oxidase-like protein SKS1    290   6e-174   
ref|XP_007017814.1|  SKU5 similar 18                                    260   2e-167   
ref|XP_004238621.2|  PREDICTED: monocopper oxidase-like protein SKS1    293   2e-165   
ref|XP_006342060.1|  PREDICTED: monocopper oxidase-like protein S...    287   2e-163   
ref|XP_006390272.1|  hypothetical protein EUTSA_v10018365mg             254   5e-158   
ref|XP_010540177.1|  PREDICTED: monocopper oxidase-like protein SKS1    236   3e-157   
ref|XP_009128132.1|  PREDICTED: monocopper oxidase-like protein SKS1    252   8e-155   
emb|CDY13534.1|  BnaC02g23450D                                          252   3e-154   
ref|XP_002889045.1|  hypothetical protein ARALYDRAFT_476726             256   2e-153   
ref|XP_006301090.1|  hypothetical protein CARUB_v10021484mg             254   1e-152   
gb|KHG15299.1|  Monocopper oxidase-like protein SKU5                    241   7e-152   
gb|KFK42011.1|  hypothetical protein AALP_AA2G201000                    248   9e-152   
ref|XP_009397600.1|  PREDICTED: L-ascorbate oxidase homolog             236   9e-149   
ref|XP_010271560.1|  PREDICTED: monocopper oxidase-like protein SKU5    261   5e-148   
ref|XP_004952386.1|  PREDICTED: monocopper oxidase-like protein S...    245   2e-142   
ref|XP_002300700.2|  multi-copper oxidase type 1 family protein         237   8e-140   Populus trichocarpa [western balsam poplar]
ref|XP_010236377.1|  PREDICTED: monocopper oxidase-like protein SKS1    239   3e-138   
gb|EMT03662.1|  Monocopper oxidase-like protein SKS1                    235   1e-136   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             234   4e-135   
ref|XP_002967301.1|  hypothetical protein SELMODRAFT_86988              241   4e-133   
ref|XP_002981392.1|  hypothetical protein SELMODRAFT_178788             223   1e-132   
ref|XP_002960418.1|  hypothetical protein SELMODRAFT_229918             238   3e-132   
ref|XP_002969915.1|  hypothetical protein SELMODRAFT_410532             221   5e-132   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             226   1e-131   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           225   1e-131   
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             215   2e-131   
gb|KHN33820.1|  L-ascorbate oxidase like                                226   4e-131   
ref|NP_173603.1|  SKU5 similar 8 protein                                226   6e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             227   9e-131   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             220   1e-130   
gb|KHF99506.1|  L-ascorbate oxidase                                     225   1e-130   
ref|XP_002524823.1|  multicopper oxidase, putative                      230   1e-130   Ricinus communis
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             223   2e-130   
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             227   2e-130   
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             229   3e-130   
emb|CDP02462.1|  unnamed protein product                                235   3e-130   
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             228   4e-130   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             227   5e-130   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             216   7e-130   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             218   1e-129   
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             220   2e-129   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         223   3e-129   
ref|NP_001053555.1|  Os04g0561900                                       226   4e-129   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67167.1|  H0211B05.4                                             226   5e-129   Oryza sativa [red rice]
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    222   5e-129   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             224   7e-129   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             215   9e-129   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             222   1e-128   
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             216   1e-128   
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-128   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             231   3e-128   Populus trichocarpa [western balsam poplar]
gb|AGJ03718.1|  multicopper oxidase                                     216   3e-128   
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             215   3e-128   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             215   3e-128   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             221   3e-128   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             223   3e-128   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             216   4e-128   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             215   5e-128   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          231   6e-128   
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             214   6e-128   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             220   9e-128   Vitis vinifera
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             223   9e-128   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             212   1e-127   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             216   1e-127   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             216   1e-127   
emb|CAN83942.1|  hypothetical protein VITISV_013559                     220   2e-127   Vitis vinifera
emb|CDY68834.1|  BnaCnng60730D                                          224   2e-127   
ref|XP_002510630.1|  multicopper oxidase, putative                      216   2e-127   Ricinus communis
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             211   3e-127   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   230   3e-127   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             224   3e-127   
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             220   3e-127   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             220   3e-127   
ref|XP_001777221.1|  predicted protein                                  205   3e-127   
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             214   4e-127   
emb|CDP07321.1|  unnamed protein product                                226   4e-127   
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             230   4e-127   
gb|KHG07318.1|  L-ascorbate oxidase                                     228   5e-127   
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             226   5e-127   
gb|KEH36280.1|  multi-copper oxidase-like protein                       224   5e-127   
gb|KHF99853.1|  L-ascorbate oxidase                                     223   5e-127   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             223   6e-127   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             221   6e-127   
emb|CDY55201.1|  BnaCnng28410D                                          223   7e-127   
ref|XP_004292333.1|  PREDICTED: monocopper oxidase-like protein S...    196   7e-127   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             220   7e-127   
gb|ACJ85585.1|  unknown                                                 223   8e-127   Medicago truncatula
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    214   8e-127   
gb|KEH40258.1|  multi-copper oxidase-like protein                       224   8e-127   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             224   8e-127   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             220   9e-127   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         214   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             219   1e-126   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          226   1e-126   
gb|ABK25324.1|  unknown                                                 208   1e-126   Picea sitchensis
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    226   2e-126   
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-126   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             223   2e-126   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         218   2e-126   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             217   2e-126   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             226   2e-126   
emb|CBI18560.3|  unnamed protein product                                225   3e-126   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             225   3e-126   Vitis vinifera
gb|ABR18324.1|  unknown                                                 210   4e-126   Picea sitchensis
emb|CDX73238.1|  BnaC06g36860D                                          220   4e-126   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             221   4e-126   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             223   5e-126   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             217   5e-126   
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         216   5e-126   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             218   7e-126   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             223   9e-126   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             214   1e-125   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             213   1e-125   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             208   1e-125   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             210   1e-125   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             223   1e-125   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             211   2e-125   
gb|EYU46107.1|  hypothetical protein MIMGU_mgv1a003243mg                190   2e-125   
ref|XP_009358973.1|  PREDICTED: monocopper oxidase-like protein SKU5    196   2e-125   
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             233   2e-125   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             218   2e-125   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             205   2e-125   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-125   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             218   2e-125   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             214   3e-125   
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   232   3e-125   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-125   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             208   3e-125   
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             233   3e-125   
gb|AFK35121.1|  unknown                                                 223   3e-125   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             215   3e-125   
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    214   3e-125   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    215   3e-125   
emb|CDY43557.1|  BnaC02g16540D                                          223   4e-125   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             215   4e-125   
gb|ABK25092.1|  unknown                                                 210   4e-125   Picea sitchensis
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             220   4e-125   
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             220   5e-125   
ref|XP_007049589.1|  SKU5 similar 3                                     194   6e-125   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             227   7e-125   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             216   8e-125   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             224   8e-125   
ref|NP_177743.1|  SKU5-like 5 protein                                   216   9e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87633.1|  BnaA07g32400D                                          219   9e-125   
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   1e-124   
ref|XP_002522337.1|  multicopper oxidase, putative                      213   1e-124   Ricinus communis
emb|CDX81353.1|  BnaC09g07640D                                          222   1e-124   
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   1e-124   
gb|KEH20500.1|  multi-copper oxidase-like protein                       214   1e-124   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             220   2e-124   
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             216   2e-124   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             218   2e-124   
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             218   2e-124   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-124   
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             216   2e-124   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             225   2e-124   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             215   2e-124   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             216   3e-124   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-124   
gb|AAL09733.1|  At1g76160/T23E18_10                                     216   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             214   3e-124   
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             216   3e-124   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         213   4e-124   
gb|KHN42054.1|  L-ascorbate oxidase like                                215   4e-124   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             220   4e-124   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             220   4e-124   
gb|AAM97070.1|  pectinesterase, putative                                214   4e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18626.1|  BnaA09g07690D                                          220   5e-124   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             225   5e-124   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             206   6e-124   
ref|NP_173604.1|  SKU5 similar 7 protein                                212   6e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KHN36198.1|  L-ascorbate oxidase like                                216   7e-124   
gb|KEH29685.1|  multi-copper oxidase-like protein                       223   7e-124   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             226   7e-124   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             215   7e-124   
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             212   7e-124   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             229   9e-124   
ref|XP_008235896.1|  PREDICTED: monocopper oxidase-like protein SKU5    192   9e-124   
ref|XP_002522339.1|  multicopper oxidase, putative                      220   1e-123   Ricinus communis
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             213   1e-123   
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             207   1e-123   
emb|CDP19581.1|  unnamed protein product                                209   1e-123   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             213   1e-123   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             215   1e-123   
ref|NP_193932.1|  protein SKU5 similar 4                                219   1e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    214   1e-123   
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                236   2e-123   
ref|XP_007201183.1|  hypothetical protein PRUPE_ppa003275mg             192   2e-123   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-123   
ref|XP_010416484.1|  PREDICTED: monocopper oxidase-like protein SKS1    212   2e-123   
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-123   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             212   2e-123   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    214   2e-123   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             207   2e-123   
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         211   3e-123   Populus trichocarpa [western balsam poplar]
gb|ACN40384.1|  unknown                                                 194   3e-123   Picea sitchensis
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             218   3e-123   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             212   3e-123   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             212   3e-123   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   217   3e-123   
emb|CDX82897.1|  BnaC01g13470D                                          219   3e-123   
ref|XP_002866726.1|  predicted protein                                  211   3e-123   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             212   4e-123   
gb|KHG02352.1|  L-ascorbate oxidase                                     217   4e-123   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             227   5e-123   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             215   5e-123   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             217   6e-123   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             221   6e-123   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             209   7e-123   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             215   8e-123   
emb|CDX79120.1|  BnaA01g11870D                                          218   9e-123   
gb|KDP45242.1|  hypothetical protein JCGZ_15107                         193   1e-122   
ref|XP_010482094.1|  PREDICTED: monocopper oxidase-like protein S...    192   1e-122   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             205   1e-122   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     225   1e-122   Vitis vinifera
gb|KHG25743.1|  L-ascorbate oxidase                                     225   1e-122   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg             232   2e-122   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-122   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-122   
ref|XP_006847483.1|  hypothetical protein AMTR_s00163p00059030          190   2e-122   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             207   2e-122   
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog             205   3e-122   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             204   3e-122   
ref|XP_002984579.1|  hypothetical protein SELMODRAFT_445960             211   3e-122   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             216   3e-122   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             221   4e-122   
emb|CDY01453.1|  BnaA07g12260D                                          214   4e-122   
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             230   4e-122   
ref|XP_002978641.1|  hypothetical protein SELMODRAFT_418427             211   5e-122   
emb|CAA65634.1|  PS60                                                   204   5e-122   Nicotiana tabacum [American tobacco]
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             203   6e-122   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             224   6e-122   
emb|CDY67479.1|  BnaCnng55180D                                          209   6e-122   
ref|XP_011080540.1|  PREDICTED: monocopper oxidase-like protein SKU5    194   7e-122   
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             211   7e-122   
ref|NP_195433.1|  protein SKU5 similar 15                               218   7e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   226   8e-122   
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       211   9e-122   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24296.1|  Unknown protein                                         211   9e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35790.1|  BnaA08g04510D                                          209   9e-122   
ref|NP_564479.1|  SKU5 similar 6                                        211   9e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             206   1e-121   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             214   1e-121   
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             207   1e-121   
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             209   1e-121   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             213   1e-121   
ref|NP_569041.1|  protein SKU5 similar 17                               206   1e-121   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08634.1|  pectinesterase like protein                            207   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-121   
dbj|BAC83966.1|  putative PS60                                          222   2e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099223.1|  PREDICTED: L-ascorbate oxidase homolog             225   2e-121   
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             209   2e-121   
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-121   
gb|AAM61328.1|  pectinesterase-like protein                             206   2e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KHN21220.1|  L-ascorbate oxidase like                                224   2e-121   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             223   2e-121   
ref|XP_008447201.1|  PREDICTED: monocopper oxidase-like protein S...    196   2e-121   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             203   3e-121   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-121   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-121   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   211   3e-121   
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    206   3e-121   
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-121   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             212   4e-121   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             224   4e-121   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             223   4e-121   
ref|XP_004972824.1|  PREDICTED: monocopper oxidase-like protein S...    193   4e-121   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             213   5e-121   
emb|CDY31468.1|  BnaC05g15770D                                          207   6e-121   
ref|XP_002527262.1|  multicopper oxidase, putative                      195   6e-121   Ricinus communis
ref|XP_009392633.1|  PREDICTED: monocopper oxidase-like protein SKU5    191   9e-121   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                208   9e-121   
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             211   9e-121   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             223   1e-120   
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    208   1e-120   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             221   1e-120   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             213   1e-120   
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         204   1e-120   Populus trichocarpa [western balsam poplar]
gb|EEC82126.1|  hypothetical protein OsI_26158                          223   2e-120   Oryza sativa Indica Group [Indian rice]
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    222   2e-120   
ref|XP_007140706.1|  hypothetical protein PHAVU_008G134900g             186   2e-120   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             224   2e-120   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             216   2e-120   
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   220   2e-120   
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             208   3e-120   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    215   3e-120   
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             219   3e-120   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          222   3e-120   
gb|KFK31321.1|  hypothetical protein AALP_AA6G097300                    189   3e-120   
ref|XP_002518462.1|  multicopper oxidase, putative                      223   3e-120   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    200   4e-120   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             198   4e-120   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    215   5e-120   
ref|XP_006296162.1|  hypothetical protein CARUB_v10025315mg             214   5e-120   
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             215   6e-120   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             213   7e-120   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             211   8e-120   
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             215   9e-120   
ref|XP_006659842.1|  PREDICTED: monocopper oxidase-like protein S...    187   1e-119   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             197   1e-119   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         210   1e-119   
ref|XP_002321241.2|  hypothetical protein POPTR_0014s17590g             190   1e-119   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             221   1e-119   
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             216   1e-119   
ref|XP_010472357.1|  PREDICTED: L-ascorbate oxidase homolog             216   2e-119   
ref|XP_001771342.1|  predicted protein                                  197   2e-119   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             223   3e-119   
ref|XP_010429313.1|  PREDICTED: L-ascorbate oxidase homolog             214   3e-119   
ref|XP_004492214.1|  PREDICTED: monocopper oxidase-like protein S...    184   4e-119   
gb|EEC77800.1|  hypothetical protein OsI_16980                          226   4e-119   
gb|EEE61490.1|  hypothetical protein OsJ_15776                          226   5e-119   
ref|XP_010908415.1|  PREDICTED: monocopper oxidase-like protein S...    184   7e-119   
emb|CDP05323.1|  unnamed protein product                                197   8e-119   
ref|XP_011009333.1|  PREDICTED: monocopper oxidase-like protein S...    192   8e-119   
ref|XP_010417106.1|  PREDICTED: L-ascorbate oxidase homolog             213   8e-119   
ref|XP_006345715.1|  PREDICTED: monocopper oxidase-like protein S...    192   9e-119   
ref|XP_010908414.1|  PREDICTED: monocopper oxidase-like protein S...    184   1e-118   
ref|XP_011029027.1|  PREDICTED: monocopper oxidase-like protein SKS1    233   1e-118   
ref|XP_002523382.1|  multicopper oxidase, putative                      204   1e-118   
ref|XP_009626424.1|  PREDICTED: monocopper oxidase-like protein SKU5    191   1e-118   
ref|XP_002445068.1|  hypothetical protein SORBIDRAFT_07g003590          186   1e-118   
ref|XP_010069591.1|  PREDICTED: monocopper oxidase-like protein S...    185   2e-118   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             207   2e-118   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             207   2e-118   
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-118   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             204   2e-118   
ref|XP_003573491.1|  PREDICTED: monocopper oxidase-like protein SKU5    195   2e-118   
ref|XP_004307804.1|  PREDICTED: monocopper oxidase-like protein S...    191   3e-118   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          188   3e-118   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             220   3e-118   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             209   4e-118   
ref|XP_004247026.1|  PREDICTED: monocopper oxidase-like protein S...    190   5e-118   
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    216   6e-118   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             224   6e-118   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             219   7e-118   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             207   7e-118   
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             204   7e-118   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             219   7e-118   
gb|ACL53812.1|  unknown                                                 216   8e-118   
emb|CDY12788.1|  BnaC07g16450D                                          196   8e-118   
gb|KHM99211.1|  L-ascorbate oxidase like                                198   8e-118   
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    217   8e-118   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    201   9e-118   
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             205   9e-118   
ref|XP_004148963.1|  PREDICTED: monocopper oxidase-like protein S...    191   1e-117   
ref|XP_008467211.1|  PREDICTED: monocopper oxidase-like protein SKS1    190   1e-117   
ref|XP_006840959.1|  hypothetical protein AMTR_s00085p00024720          196   1e-117   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   1e-117   
dbj|BAK06240.1|  predicted protein                                      182   2e-117   
emb|CDP03969.1|  unnamed protein product                                189   2e-117   
gb|KHN10921.1|  Monocopper oxidase-like protein SKU5                    182   2e-117   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             201   2e-117   
gb|KDO58565.1|  hypothetical protein CISIN_1g007633mg                   186   3e-117   
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             200   3e-117   
ref|XP_003530843.2|  PREDICTED: monocopper oxidase-like protein S...    182   3e-117   
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             205   4e-117   
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog             204   4e-117   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          222   4e-117   
ref|XP_006447987.1|  hypothetical protein CICLE_v10014680mg             186   4e-117   
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog             205   4e-117   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             206   4e-117   
ref|XP_010106221.1|  Monocopper oxidase-like protein SKS1               182   6e-117   
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             202   7e-117   
ref|NP_175953.1|  protein SKU5 similar 12                               203   8e-117   
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    199   1e-116   
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             217   1e-116   
ref|XP_002510943.1|  multicopper oxidase, putative                      183   1e-116   
ref|XP_010678961.1|  PREDICTED: monocopper oxidase-like protein SKU5    181   1e-116   
gb|EYU30502.1|  hypothetical protein MIMGU_mgv1a003271mg                185   1e-116   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      212   1e-116   
ref|XP_008437127.1|  PREDICTED: monocopper oxidase-like protein SKU5    182   2e-116   
ref|XP_006643620.1|  PREDICTED: monocopper oxidase-like protein S...    185   3e-116   
ref|XP_008381156.1|  PREDICTED: monocopper oxidase-like protein SKU5    179   3e-116   
ref|XP_008439091.1|  PREDICTED: monocopper oxidase-like protein SKS1    185   3e-116   
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   3e-116   
ref|XP_009340589.1|  PREDICTED: monocopper oxidase-like protein SKS1    183   3e-116   
ref|XP_008376163.1|  PREDICTED: monocopper oxidase-like protein SKS1    183   3e-116   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             195   3e-116   
ref|XP_011016148.1|  PREDICTED: monocopper oxidase-like protein SKS1    182   3e-116   
ref|XP_010241477.1|  PREDICTED: monocopper oxidase-like protein SKU5    187   3e-116   
ref|XP_006368173.1|  monocopper oxidase precursor family protein        182   3e-116   
ref|XP_011010922.1|  PREDICTED: monocopper oxidase-like protein SKS1    182   4e-116   
ref|XP_004143622.1|  PREDICTED: monocopper oxidase-like protein S...    192   4e-116   
ref|XP_011033926.1|  PREDICTED: monocopper oxidase-like protein SKU5    182   5e-116   
ref|XP_004147587.1|  PREDICTED: monocopper oxidase-like protein S...    184   5e-116   
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             201   5e-116   
ref|XP_002318885.1|  Monocopper oxidase-like protein SKS1 precursor     182   6e-116   
ref|NP_565554.1|  protein SKU5 similar 16                               210   6e-116   
ref|XP_009401796.1|  PREDICTED: monocopper oxidase-like protein SKU5    183   6e-116   
ref|XP_009374490.1|  PREDICTED: monocopper oxidase-like protein SKS1    183   6e-116   
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             215   8e-116   
ref|XP_007039921.1|  Cupredoxin superfamily protein isoform 1           184   8e-116   
ref|XP_008794814.1|  PREDICTED: monocopper oxidase-like protein SKU5    184   8e-116   
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             205   8e-116   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             202   9e-116   
ref|XP_002880518.1|  hypothetical protein ARALYDRAFT_320180             211   1e-115   
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             200   1e-115   
ref|XP_008809034.1|  PREDICTED: monocopper oxidase-like protein SKU5    183   1e-115   
ref|XP_002321832.1|  Monocopper oxidase-like protein SKS1 precursor     181   2e-115   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          204   2e-115   
emb|CDY10549.1|  BnaC03g70650D                                          197   2e-115   
ref|XP_011029949.1|  PREDICTED: monocopper oxidase-like protein SKS1    183   2e-115   
ref|XP_011076336.1|  PREDICTED: monocopper oxidase-like protein SKU5    195   2e-115   
gb|KGN57269.1|  hypothetical protein Csa_3G175700                       185   2e-115   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             197   2e-115   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    203   2e-115   
ref|XP_010941125.1|  PREDICTED: monocopper oxidase-like protein S...    184   3e-115   
ref|XP_009339705.1|  PREDICTED: monocopper oxidase-like protein SKU5    177   3e-115   
ref|XP_010482484.1|  PREDICTED: monocopper oxidase-like protein SKS2    187   3e-115   
ref|XP_002303520.1|  monocopper oxidase precursor family protein        181   3e-115   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    203   3e-115   
ref|XP_010093686.1|  Monocopper oxidase-like protein SKU5               186   3e-115   
ref|XP_003568965.2|  PREDICTED: monocopper oxidase-like protein SKU5    189   4e-115   
emb|CDY48757.1|  BnaA02g30180D                                          187   4e-115   
ref|XP_010443342.1|  PREDICTED: monocopper oxidase-like protein SKS2    187   4e-115   
emb|CDY24188.1|  BnaC01g37680D                                          197   4e-115   
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    203   4e-115   
dbj|BAK04971.1|  predicted protein                                      208   4e-115   
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             201   5e-115   
ref|XP_002523381.1|  multicopper oxidase, putative                      202   5e-115   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             197   5e-115   
ref|XP_004148141.1|  PREDICTED: monocopper oxidase-like protein S...    184   6e-115   
ref|XP_004171460.1|  PREDICTED: monocopper oxidase-like protein S...    192   6e-115   
dbj|BAK05994.1|  predicted protein                                      199   7e-115   
gb|EPS61896.1|  hypothetical protein M569_12896                         197   7e-115   
ref|XP_011018259.1|  PREDICTED: monocopper oxidase-like protein SKU5    182   9e-115   
emb|CDY56013.1|  BnaA08g29220D                                          196   1e-114   
ref|XP_010442654.1|  PREDICTED: monocopper oxidase-like protein SKS2    185   1e-114   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             201   1e-114   
ref|XP_009129727.1|  PREDICTED: monocopper oxidase-like protein SKU5    187   1e-114   
emb|CDP04133.1|  unnamed protein product                                194   1e-114   
ref|XP_009759912.1|  PREDICTED: monocopper oxidase-like protein SKU5    187   1e-114   
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    197   1e-114   
gb|AFW57322.1|  hypothetical protein ZEAMMB73_984434                    187   1e-114   
gb|AFW57318.1|  monocopper oxidase                                      187   1e-114   
gb|EYU31325.1|  hypothetical protein MIMGU_mgv1a003381mg                196   2e-114   
ref|XP_010438904.1|  PREDICTED: monocopper oxidase-like protein SKS1    185   2e-114   
ref|XP_009382348.1|  PREDICTED: monocopper oxidase-like protein SKU5    186   2e-114   
ref|NP_001151974.1|  LOC100285611                                       187   2e-114   
gb|AES78952.2|  multi-copper oxidase-like protein                       176   2e-114   
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         203   2e-114   
ref|XP_008447202.1|  PREDICTED: monocopper oxidase-like protein S...    189   2e-114   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     213   2e-114   
ref|XP_010259022.1|  PREDICTED: monocopper oxidase-like protein SKU5    183   3e-114   
ref|NP_564697.1|  SKU5 similar 14                                       194   3e-114   
emb|CDY05676.1|  BnaC02g38610D                                          185   3e-114   
ref|XP_009127298.1|  PREDICTED: monocopper oxidase-like protein SKS2    184   3e-114   
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             203   4e-114   
ref|XP_010100824.1|  Monocopper oxidase-like protein SKU5               177   4e-114   
emb|CDX89433.1|  BnaA01g14600D                                          180   5e-114   
ref|XP_006401971.1|  hypothetical protein EUTSA_v10013035mg             178   6e-114   
ref|XP_004298662.1|  PREDICTED: monocopper oxidase-like protein S...    181   7e-114   
gb|KHG18768.1|  Monocopper oxidase-like protein SKU5                    179   8e-114   
ref|XP_010422207.1|  PREDICTED: monocopper oxidase-like protein SKU5    181   8e-114   
ref|XP_009395352.1|  PREDICTED: monocopper oxidase-like protein SKU5    194   9e-114   
ref|XP_002864114.1|  hypothetical protein ARALYDRAFT_918182             186   9e-114   
ref|XP_003608760.1|  Monocopper oxidase-like protein SKU5               188   9e-114   
gb|EMT08995.1|  L-ascorbate oxidase-like protein                        231   1e-113   
ref|XP_010676176.1|  PREDICTED: monocopper oxidase-like protein SKU5    193   1e-113   
ref|XP_006283388.1|  hypothetical protein CARUB_v10004433mg             184   1e-113   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             197   1e-113   
ref|XP_010433669.1|  PREDICTED: monocopper oxidase-like protein SKS1    184   1e-113   
ref|XP_007014658.1|  SKU5 similar 13                                    191   1e-113   
ref|XP_006490102.1|  PREDICTED: monocopper oxidase-like protein S...    184   2e-113   
ref|XP_004515738.1|  PREDICTED: monocopper oxidase-like protein S...    180   2e-113   
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog             230   2e-113   
emb|CDY46940.1|  BnaAnng08180D                                          184   2e-113   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             192   2e-113   
ref|NP_194254.2|  monocopper oxidase-like protein SKS1                  185   2e-113   
emb|CAA23065.1|  Pollen-specific protein precursor like                 185   2e-113   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             194   3e-113   
ref|XP_011101121.1|  PREDICTED: monocopper oxidase-like protein SKS1    191   3e-113   
ref|NP_001056550.1|  Os06g0104300                                       172   3e-113   
ref|NP_199961.1|  Monocopper oxidase-like protein SKS2                  184   4e-113   
ref|XP_010448456.1|  PREDICTED: monocopper oxidase-like protein SKS1    184   4e-113   
ref|XP_006421690.1|  hypothetical protein CICLE_v10004595mg             183   4e-113   
emb|CDX91586.1|  BnaC02g15740D                                          181   4e-113   
ref|XP_006661934.1|  PREDICTED: monocopper oxidase-like protein S...    188   4e-113   
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             194   4e-113   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   201   5e-113   
ref|NP_001041735.1|  Os01g0100400                                       186   5e-113   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             196   5e-113   
ref|XP_010035024.1|  PREDICTED: monocopper oxidase-like protein SKS1    178   5e-113   
ref|XP_007155628.1|  hypothetical protein PHAVU_003G217800g             184   7e-113   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             202   7e-113   
gb|KHG00652.1|  Monocopper oxidase-like protein SKS1                    184   7e-113   
gb|ACF86554.2|  unknown                                                 194   8e-113   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             195   9e-113   
ref|XP_003523887.2|  PREDICTED: monocopper oxidase-like protein S...    181   1e-112   
ref|XP_009134269.1|  PREDICTED: monocopper oxidase-like protein SKU5    174   1e-112   
gb|KDO65449.1|  hypothetical protein CISIN_1g007635mg                   183   1e-112   
ref|XP_006396765.1|  hypothetical protein EUTSA_v10028533mg             174   1e-112   
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             200   1e-112   
ref|XP_008671991.1|  PREDICTED: uncharacterized protein LOC100278...    180   1e-112   
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             199   2e-112   
ref|XP_009139031.1|  PREDICTED: monocopper oxidase-like protein SKS1    176   2e-112   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        206   2e-112   
emb|CDX94466.1|  BnaC01g17180D                                          179   2e-112   
dbj|BAK00320.1|  predicted protein                                      183   2e-112   
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    194   3e-112   



>ref|XP_011074997.1| PREDICTED: monocopper oxidase-like protein SKS1 [Sesamum indicum]
Length=504

 Score =   290 bits (743),  Expect(4) = 6e-174, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 172/220 (78%), Gaps = 4/220 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D++VGA+RPNPQGS+HYG INVTR +VL+  +A + G+ RY +NGVSF++PDTPLKLA
Sbjct  288   RSDLSVGASRPNPQGSYHYGSINVTRMLVLKNDVAFINGQNRYTVNGVSFLHPDTPLKLA  347

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++N+S V+  G IP+ P  +    L   GVSVI T  HD+  +VF NPL S QTWH DG
Sbjct  348   DYYNLSNVFVPGIIPDAPSNS----LPHLGVSVIDTKYHDYAHVVFQNPLFSPQTWHSDG  403

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGMG GIW    M +YN+ DA+YRSTVQVYP SWTA+ + +DN GMWNLRS +A+
Sbjct  404   FNFFVVGMGLGIWDEGKMDTYNMVDAIYRSTVQVYPLSWTAILIELDNMGMWNLRSQDAE  463

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             + Y+GQE+YI+VKG E DPSKISPRDE+PIP NVIKCG+A
Sbjct  464   KWYMGQEVYIRVKGVEQDPSKISPRDESPIPQNVIKCGRA  503


 Score =   217 bits (553),  Expect(4) = 6e-174, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +1

Query  145  LGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGT  324
            LGV+KKVIVINDQFPGPLLN +TNDV+N+NIHNNL E FLM+WNGVQ+R +SWQDGVQ T
Sbjct  3    LGVDKKVIVINDQFPGPLLNATTNDVVNINIHNNLTESFLMTWNGVQMRRNSWQDGVQET  62

Query  325  NCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDL  504
            NCPI PG+NWTYSFQLKDQIGSYFYFPSL   KAAGGYGPIR+ N  VV  PF  PDY+ 
Sbjct  63   NCPILPGENWTYSFQLKDQIGSYFYFPSLLFQKAAGGYGPIRVNNRAVVPIPFAQPDYEY  122

Query  505  DILISDWYTEDIQVI  549
            D+LI DWY  D Q++
Sbjct  123  DVLIGDWYNADYQLL  137


 Score =   129 bits (324),  Expect(4) = 6e-174, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TY LRISNVG+KT+LNFRIQ H M LVETEGSYTVKH +++LDIHVGQSYSV+V A  
Sbjct  170   GATYRLRISNVGLKTALNFRIQDHQMLLVETEGSYTVKHYYESLDIHVGQSYSVLVTAKN  229

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPL  1115
                G+S+YM A+ RF  ++  G+G VRY+ F+G P  PL
Sbjct  230   QTEGSSFYMVAASRFIPVELIGVGIVRYSGFQGKPREPL  268


 Score = 47.8 bits (112),  Expect(4) = 6e-174, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            ++LR +LD   +L  P GILING GP QA+ DFQPG +
Sbjct  135  QLLRLALDGGSVLPLPDGILINGLGPNQATFDFQPGAT  172



>ref|XP_007017814.1| SKU5 similar 18 [Theobroma cacao]
 gb|EOY15039.1| SKU5 similar 18 [Theobroma cacao]
Length=566

 Score =   260 bits (665),  Expect(4) = 2e-167, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 159/224 (71%), Gaps = 5/224 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++A GAARPNPQGSFHYG INV+RT++LE  +  +  K R+ +NG+SF++PDTPLKL 
Sbjct  347   RWNLAAGAARPNPQGSFHYGSINVSRTLILENNVTLIGSKRRFTVNGISFLHPDTPLKLV  406

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F    V+  G I + P  T   L    G SVI  + HDF  IVF NPL  +QTWH+DG
Sbjct  407   DNFKFKDVFLPGIIRDRPSTTPPSL----GTSVIDAHYHDFYHIVFQNPLSELQTWHIDG  462

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGM  G W       YN+ DAV RST+QV+P SWTA+ V +DN GMWNLRS NA+
Sbjct  463   YNFFVVGMDWGTWDESKRAGYNMIDAVSRSTIQVHPSSWTAILVQVDNLGMWNLRSQNAE  522

Query  1727  QRYLGQELYIKVKG-PEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
               YLGQELY++VK   +DD + IS RDEAP+P NVIKCG+AA+L
Sbjct  523   NWYLGQELYLRVKSLGQDDSATISARDEAPMPENVIKCGRAAKL  566


 Score =   228 bits (580),  Expect(4) = 2e-167, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 135/183 (74%), Gaps = 9/183 (5%)
 Frame = +1

Query  28   NGTVALPLVCSLIVLSLFVCVS---------SEERFYDWTVSFSTRSILGVEKKVIVIND  180
            +G   L L  SL    L +C+S         S E FYDWTVS+S R+ LGV+K+VIVIND
Sbjct  14   DGIYLLNLRRSLTSSKLCLCISLLVALADGGSSELFYDWTVSYSQRAPLGVDKQVIVIND  73

Query  181  QFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTY  360
             FPGP+LN +TNDV+N+NIHN L +PFLM+WNG+Q+R +SWQDGVQ TNCPI PG+NWTY
Sbjct  74   MFPGPVLNATTNDVVNINIHNELTDPFLMTWNGIQMRRNSWQDGVQETNCPILPGQNWTY  133

Query  361  SFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDI  540
            SFQLKDQIGS+FYFPSL L KAAGGYG IR+ N  V+  PFP P  + D+LI DWY  + 
Sbjct  134  SFQLKDQIGSFFYFPSLLLQKAAGGYGAIRVNNRTVIPIPFPKPYKEYDVLIGDWYNANY  193

Query  541  QVI  549
             V+
Sbjct  194  GVL  196


 Score =   129 bits (325),  Expect(4) = 2e-167, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TY LRISNVG+KTSLNFRIQ H M LVETEGSYTV+  +D+LDIHVGQSYSV+V A  
Sbjct  229   GVTYRLRISNVGLKTSLNFRIQEHLMLLVETEGSYTVQQLYDSLDIHVGQSYSVLVAAKN  288

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               N  SYYM AS RF+  +  GIG +RY    G+PG PL   P
Sbjct  289   QTNAKSYYMVASSRFTSSEQFGIGIIRYPGSVGDPGVPLPSGP  331


 Score = 45.1 bits (105),  Expect(4) = 2e-167, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPG  736
            VLR S++    L  P GILING GP QAS +F+PG
Sbjct  195  VLRASVEDGNSLPLPDGILINGQGPNQASFEFEPG  229



>ref|XP_004238621.2| PREDICTED: monocopper oxidase-like protein SKS1 [Solanum lycopersicum]
Length=554

 Score =   293 bits (750),  Expect(4) = 2e-165, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 171/223 (77%), Gaps = 4/223 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+ VGAAR NPQGS+ YG IN++RT++L+   A + G+ RY +NGVSF++P TPLKLA
Sbjct  336   RTDLLVGAARRNPQGSYVYGSINISRTLILQNGEAALDGQNRYTVNGVSFLHPRTPLKLA  395

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F +S V+E G +P  P       + R G+SVI  N HDF  IVF NPL S+QTWH DG
Sbjct  396   DYFQLSDVFEPGFLPASPVDD----VPRLGISVIDANYHDFVHIVFQNPLDSLQTWHSDG  451

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGMG G W    M +YN+ DA+YRST+QVYPYSWTA+ + +DN+GMWNLRS +A+
Sbjct  452   YNFFVVGMGRGKWEVEKMETYNMIDAIYRSTIQVYPYSWTAILIKLDNQGMWNLRSQDAE  511

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             + YLGQELYIKVKG  +DPSKISPRDEAPIPANVIKCGK A L
Sbjct  512   KWYLGQELYIKVKGDVNDPSKISPRDEAPIPANVIKCGKVADL  554


 Score =   215 bits (548),  Expect(4) = 2e-165, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +1

Query  85   CVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFL  264
             V S+   +DW VS S+ +++G  K+VI+IN+QFPGPLLN +TNDV+ VN++NNL EPFL
Sbjct  30   SVHSKLLHFDWVVSISSNALIGDPKEVIMINNQFPGPLLNTTTNDVVIVNVYNNLTEPFL  89

Query  265  MSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGP  444
            M+WNGVQLR +SWQDGV+GTNCPI PGKNWTY FQ+KDQIGS+FYFPSL   KAAGGYGP
Sbjct  90   MTWNGVQLRRNSWQDGVEGTNCPIMPGKNWTYKFQMKDQIGSFFYFPSLFFQKAAGGYGP  149

Query  445  IRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
            IRI N   V  PF  PDY+ DILI DWY ++ +
Sbjct  150  IRINNVETVPLPFTRPDYEYDILIGDWYFDEYK  182


 Score =   108 bits (271),  Expect(4) = 2e-165, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TY LRISN+G+KT+LNF+IQ H M LVETEG+YT K    +LDIHVGQSYSV+V A  
Sbjct  217   GATYRLRISNIGLKTTLNFKIQDHEMLLVETEGAYTSKKYHQSLDIHVGQSYSVLVTAKN  276

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNP  1103
             H   +SY+M AS RF   + SG+  +RY  F   P
Sbjct  277   HSYNSSYHMVASSRFIPRKLSGLAIIRYPNFDVEP  311


 Score = 38.5 bits (88),  Expect(4) = 2e-165, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR SL+    + FP  ILING   +QA+ +FQPG +
Sbjct  182  KDLRISLEDGCKMPFPDAILINGMRSDQATFEFQPGAT  219



>ref|XP_006342060.1| PREDICTED: monocopper oxidase-like protein SKS1-like [Solanum 
tuberosum]
Length=540

 Score =   287 bits (735),  Expect(4) = 2e-163, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 169/221 (76%), Gaps = 4/221 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+ VGAAR NPQGS+ YG IN++RT++L+   A + G+ RY +NGVSF++P TPLKLA
Sbjct  323   RTDLLVGAARRNPQGSYVYGSINISRTLILQNGEAALDGQNRYTVNGVSFLHPRTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F +S V+E G +P  P       + R GVSVI  N HDF  +VF NPL S+QTWH DG
Sbjct  383   DYFQLSDVFEPGFVPAAPVDD----VPRLGVSVIDANYHDFVHVVFQNPLDSLQTWHSDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGMG G W    M +YN+ DA+YRST+QVYPYSWTA+ + +DN+GMWNLRS +A+
Sbjct  439   YNFFVVGMGRGKWEEGKMETYNMIDAIYRSTIQVYPYSWTAILIKLDNQGMWNLRSQDAE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             + YLGQELYI+VKG  +DP KISPRDEAPIPANVIKCGK A
Sbjct  499   KWYLGQELYIRVKGDVNDPFKISPRDEAPIPANVIKCGKVA  539


 Score =   213 bits (542),  Expect(4) = 2e-163, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = +1

Query  61   LIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIH  240
            +  +S F  V S+   +DW VS S+   +G  K+VI+IN+QFPGPLLN +TNDV+ +N++
Sbjct  9    IFTISTFGSVHSKLLHFDWVVSVSSNVPIGDPKEVIMINNQFPGPLLNTTTNDVVIINVY  68

Query  241  NNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLH  420
            NNL EPFLM+WNGVQLR +SWQDGV+GTNCPI PGK WTY FQ+KDQIGS+FYFPSL   
Sbjct  69   NNLTEPFLMTWNGVQLRRNSWQDGVEGTNCPIMPGKKWTYKFQMKDQIGSFFYFPSLFFQ  128

Query  421  KAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
            KAAGGYGPIRI N   V  PF  PDY+ DILI DWY ++ +
Sbjct  129  KAAGGYGPIRINNVETVPLPFARPDYEYDILIGDWYFDEYK  169


 Score =   112 bits (281),  Expect(4) = 2e-163, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TY LRISNVG+KT+LNF+IQ H M LVETEG+YT+K    NLDIHVGQSYSV+V A  
Sbjct  204   GATYRLRISNVGLKTTLNFKIQDHEMLLVETEGAYTLKKYHQNLDIHVGQSYSVLVTAKN  263

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNP  1103
             H  G+SY+M AS RF   + SG+  +RY  F   P
Sbjct  264   HSYGSSYHMLASSRFIPRELSGLASIRYPGFDVEP  298


 Score = 36.2 bits (82),  Expect(4) = 2e-163, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR SL+    + FP  ILING    QA  +FQPG +
Sbjct  169  KDLRISLEDGCKMPFPDAILINGMRSNQAIFEFQPGAT  206



>ref|XP_006390272.1| hypothetical protein EUTSA_v10018365mg [Eutrema salsugineum]
 gb|ESQ27558.1| hypothetical protein EUTSA_v10018365mg [Eutrema salsugineum]
Length=546

 Score =   254 bits (650),  Expect(4) = 5e-158, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 151/223 (68%), Gaps = 5/223 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+ VGAARPNPQGS+HYGR+NVTRT++ +  +     K RY +NGVSFV+P+TPLKL 
Sbjct  328   REDLDVGAARPNPQGSYHYGRVNVTRTLIFQNDVMTSSNKLRYTVNGVSFVFPETPLKLV  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF +         P  P           G SV+     DF  IVF NPL  +Q+WH+DG
Sbjct  388   DHFQLKNTIVPDMFPTYPSNKTPSF----GTSVVDIRYKDFVHIVFENPLDELQSWHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGMG G WS      YNL DAV RST+QVYPYSW A+ +AMDN+GMWN+RS  A+
Sbjct  444   YNFFVVGMGFGGWSESKRAGYNLVDAVSRSTIQVYPYSWVAILIAMDNQGMWNVRSQKAE  503

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             Q YLGQELY++VKG  ++DPS I  +DE PIP N I+CG+  Q
Sbjct  504   QWYLGQELYLRVKGDGQEDPSNIPVQDECPIPENFIRCGRILQ  546


 Score =   215 bits (548),  Expect(4) = 5e-158, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +1

Query  28   NGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
            N  V + L+ S+++L L    +     Y+W VS+S RS+LG  K++IVIND FPGP+L+ 
Sbjct  3    NVVVEVLLLISMVLLELSNAFAPSVS-YEWVVSYSQRSVLGANKQIIVINDMFPGPILSA  61

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
            +  D++NVNI N+L EPFLM+WNG+Q+R +SWQDGV+GTNCPI PG NWTY FQ+KDQIG
Sbjct  62   TAGDIVNVNIFNHLTEPFLMTWNGLQMRKNSWQDGVRGTNCPILPGTNWTYRFQIKDQIG  121

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SYFYFP+L L KAAGGYG IR+Y+  +V  PFP PD + DILI DW+  D +V+
Sbjct  122  SYFYFPTLLLQKAAGGYGSIRVYSPELVQVPFPHPDGEFDILIGDWFYTDHRVM  175


 Score =   115 bits (289),  Expect(4) = 5e-158, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+KTSLNFRIQ H+M LVETEGSY  KH + +LDIHVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLKTSLNFRIQDHDMLLVETEGSYVQKHTYSSLDIHVGQSYSVLVTAKT  267

Query  999   HKNG--ASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                G   SYY+ AS RF+    SGI  +RY     +P  P+  +P
Sbjct  268   DPVGIYRSYYIFASARFTNFYLSGIALIRYPNSPLDPVGPVPAAP  312


 Score = 45.8 bits (107),  Expect(4) = 5e-158, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            +V+R SLD    L  P GILING GPE+    FQPGK+
Sbjct  173  RVMRASLDNGLSLATPDGILINGRGPEETFFAFQPGKT  210



>ref|XP_010540177.1| PREDICTED: monocopper oxidase-like protein SKS1 [Tarenaya hassleriana]
Length=543

 Score =   236 bits (603),  Expect(4) = 3e-157, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 151/221 (68%), Gaps = 5/221 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+D+ VGAAR N QGSFHY  INV+RT+VL   +   + K RY +NG+SFV+P+TPLKLA
Sbjct  324   RLDLNVGAARQNAQGSFHYADINVSRTLVLRNDVVLNWEKLRYTVNGISFVHPETPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ++  +      + P  T   L    G +V+      F  IV  NPL  +Q+WH+DG
Sbjct  384   DHFQLNDTFTPDLFRDFPPETPPSL----GTAVVDVLYESFLHIVLENPLEDLQSWHMDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGMG G WS  +  +YNL DA+ RSTVQVYPYSWTA+ VAMDN+GMWN+RS   +
Sbjct  440   HNFFVVGMGFGAWSWSNGVTYNLVDAISRSTVQVYPYSWTAILVAMDNQGMWNVRSQTVE  499

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGKA  1846
               +LGQELY +VKG  +++P  I  RDE+PIP N ++CGK 
Sbjct  500   NWFLGQELYFRVKGEGQENPKNIPVRDESPIPENFLRCGKV  540


 Score =   225 bits (574),  Expect(4) = 3e-157, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  109  YDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQL  288
            + W VS+S RS+LG EK++IVIN  FPGPLLNG+TNDV N+N+HNNL EPFL++WNGVQ+
Sbjct  27   HQWVVSYSQRSLLGAEKQIIVINGMFPGPLLNGTTNDVFNINVHNNLTEPFLITWNGVQM  86

Query  289  RGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPV  468
            R +SWQDGV+GTNCPIPPGKNWTY+FQ+KDQIGSYFYFP L L KAAGG+GPIR+ N   
Sbjct  87   RRNSWQDGVRGTNCPIPPGKNWTYNFQIKDQIGSYFYFPFLLLQKAAGGFGPIRLNNLDS  146

Query  469  VHPPFPCPDYDLDILISDWYTED  537
            V PPFP PD + D+LI DW+  D
Sbjct  147  VPPPFPRPDGEFDVLIGDWFNSD  169


 Score =   122 bits (306),  Expect(4) = 3e-157, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
               GKTY LRISNVG+KTSLNFRIQGH+M LVETEGSY  K  +D+LD+HVGQSYSV+V A
Sbjct  204   EPGKTYRLRISNVGLKTSLNFRIQGHDMLLVETEGSYVQKQHYDSLDVHVGQSYSVLVTA  263

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRY  1082
              E  +  SYYM A+ RF+    SG+G VRY
Sbjct  264   KEKISNTSYYMIATSRFTEFNMSGLGLVRY  293


 Score = 44.7 bits (104),  Expect(4) = 3e-157, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR SLD    L  P GILING GP++A  DF+PGK+
Sbjct  173  LRASLDTGISLPMPDGILINGLGPKEAVFDFEPGKT  208



>ref|XP_009128132.1| PREDICTED: monocopper oxidase-like protein SKS1 [Brassica rapa]
 emb|CDY39058.1| BnaA02g17470D [Brassica napus]
Length=545

 Score =   252 bits (644),  Expect(4) = 8e-155, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 152/220 (69%), Gaps = 5/220 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+AVGAARPNPQGS+HYGR+NV+RTI+L+  +     + RY +NGVSFV+P+TPLKLA
Sbjct  328   REDLAVGAARPNPQGSYHYGRVNVSRTIILQNDVMSSSNRLRYTVNGVSFVFPETPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF +         P  P         R G SV+     DF  IVF NPL   Q+WH+DG
Sbjct  388   DHFQLKNTIVPNMFPTYPSNK----TPRFGTSVVDIRYRDFVHIVFENPLDESQSWHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNF+VVGMG G WS      YNL DAV RST+QV+PYSW A+ +AMDN+GMWN+RS  A+
Sbjct  444   YNFWVVGMGFGGWSESKRAGYNLVDAVSRSTIQVFPYSWVAILIAMDNQGMWNVRSQKAE  503

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGK  1843
             Q YLG+ELY +VKG  ++DP  I  RDE+PIP N ++CG+
Sbjct  504   QWYLGEELYFRVKGDGQEDPRNIPTRDESPIPENFLRCGR  543


 Score =   210 bits (535),  Expect(4) = 8e-155, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +1

Query  109  YDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQL  288
            Y+W VS+S RSILG  K+VIVIND FPGP+L  +  DV+NVNI N+L EPFLM+WNG+Q+
Sbjct  29   YEWVVSYSERSILGANKQVIVINDMFPGPILKATAGDVVNVNIFNHLTEPFLMTWNGLQM  88

Query  289  RGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPV  468
            R +SWQDGV+GTNCPI PG NWTY FQ+KDQIGSYFYFP+L   KAAGGYG IR+Y+  +
Sbjct  89   RKNSWQDGVRGTNCPILPGTNWTYRFQIKDQIGSYFYFPTLLFQKAAGGYGSIRVYSPEL  148

Query  469  VHPPFPCPDYDLDILISDWYTEDIQ  543
            V  PFP PD + DILI DW+  D +
Sbjct  149  VPVPFPRPDGEFDILIGDWFYTDYR  173


 Score =   112 bits (279),  Expect(4) = 8e-155, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+KTSLNFRIQ H+M LVETEGSY  K    NLDIHVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLKTSLNFRIQDHDMLLVETEGSYVQKRTLSNLDIHVGQSYSVLVTAKT  267

Query  999   HKNGA--SYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                G+  SYY+ AS RFS    +G+  +RY     +P  P+  +P
Sbjct  268   DPIGSHRSYYIFASTRFSNSYMTGLALIRYPNSPVDPVGPVPAAP  312


 Score = 46.2 bits (108),  Expect(4) = 8e-155, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            +R SLD    L  P GIL NGHGPE+A   FQPGK+
Sbjct  175  MRASLDNGLSLATPDGILFNGHGPEEAFFAFQPGKT  210



>emb|CDY13534.1| BnaC02g23450D [Brassica napus]
Length=545

 Score =   252 bits (644),  Expect(4) = 3e-154, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 152/220 (69%), Gaps = 5/220 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+AVGAARPNPQGS+HYGR+NV+RTI+L+  +     + RY +NGVSFV+P+TPLKLA
Sbjct  328   REDLAVGAARPNPQGSYHYGRVNVSRTIILQNDVMSSSNRLRYTVNGVSFVFPETPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF +         P  P         R G SV+     DF  IVF NPL   Q+WH+DG
Sbjct  388   DHFQLKNTIVPNMFPTYPSNK----TPRFGTSVVDIRYRDFVHIVFENPLDESQSWHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNF+VVGMG G WS      YNL DAV RST+QV+PYSW A+ +AMDN+GMWN+RS  A+
Sbjct  444   YNFWVVGMGFGGWSESKRAGYNLVDAVSRSTIQVFPYSWVAILIAMDNQGMWNVRSQKAE  503

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGK  1843
             Q YLG+ELY +VKG  ++DP  I  RDE+PIP N ++CG+
Sbjct  504   QWYLGEELYFRVKGDGQEDPRNIPTRDESPIPENFLRCGR  543


 Score =   208 bits (530),  Expect(4) = 3e-154, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +1

Query  109  YDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQL  288
            Y+W VS+S RSILG  K+VI+IND FPGP+L  +  DV+NVNI N+L EPFLM+WNG+Q+
Sbjct  29   YEWVVSYSERSILGANKQVILINDMFPGPILKATAGDVVNVNIVNHLTEPFLMTWNGLQM  88

Query  289  RGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPV  468
            R +SWQDGV+GTNCPI PG NWTY FQ+KDQIGSYFYFP+L   KAAGGYG IR+Y+  +
Sbjct  89   RKNSWQDGVRGTNCPILPGTNWTYRFQIKDQIGSYFYFPTLLFQKAAGGYGSIRVYSPEL  148

Query  469  VHPPFPCPDYDLDILISDWYTEDIQ  543
            V  PFP PD + DILI DW+  D +
Sbjct  149  VPVPFPRPDGEFDILIGDWFYTDYR  173


 Score =   112 bits (279),  Expect(4) = 3e-154, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+KTSLNFRIQ H+M LVETEGSY  K    NLDIHVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLKTSLNFRIQDHDMLLVETEGSYVQKRTLSNLDIHVGQSYSVLVTAKT  267

Query  999   HKNGA--SYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                G+  SYY+ AS RFS    +G+  +RY     +P  P+  +P
Sbjct  268   DPIGSHRSYYIFASTRFSNSYMTGLALIRYPNSPVDPVGPVPAAP  312


 Score = 46.2 bits (108),  Expect(4) = 3e-154, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            +R SLD    L  P GIL NGHGPE+A   FQPGK+
Sbjct  175  MRASLDNGLSLATPDGILFNGHGPEEAFFAFQPGKT  210



>ref|XP_002889045.1| hypothetical protein ARALYDRAFT_476726 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65304.1| hypothetical protein ARALYDRAFT_476726 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   256 bits (653),  Expect(4) = 2e-153, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 154/221 (70%), Gaps = 5/221 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+D+ VGAAR NPQGS+HYGRINVTRTI+L   +    GK RY INGVSFVYPDTPLKL 
Sbjct  328   RMDLNVGAARSNPQGSYHYGRINVTRTIILHNDVMLSSGKLRYTINGVSFVYPDTPLKLV  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ++        P  P      L    G SV+  +  DF  IVF NPL  ++++H+DG
Sbjct  388   DHFQLNDTIIPDMFPVYPSNKTPSL----GTSVVDIHYKDFVHIVFQNPLFELESYHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVG G G WS      YNL DAV RST+QVYPYSW A+ +AMDN+GMWN+RS  A+
Sbjct  444   YNFFVVGYGFGAWSESKRAGYNLVDAVSRSTIQVYPYSWAAILIAMDNQGMWNVRSQKAE  503

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGKA  1846
             Q YLGQELY++VKG  ++DPS I  RDE PIP NVI+CGK 
Sbjct  504   QWYLGQELYMRVKGEGQEDPSNIPVRDENPIPGNVIRCGKV  544


 Score =   215 bits (547),  Expect(4) = 2e-153, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 128/174 (74%), Gaps = 7/174 (4%)
 Frame = +1

Query  37   VALPLVCSLIVLSL---FVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
            V + ++ SL++L L   F  + S    Y W VS+S R ILG  K+VIVIND FPGP+LN 
Sbjct  6    VEVVVLISLVILELSYAFAPIVS----YQWVVSYSQRFILGGNKQVIVINDMFPGPMLNA  61

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
            + NDV+ VNI NNL EPFLM+WNG+QLR +SWQDGV+GTNCPI PG NWTY FQ+KDQIG
Sbjct  62   TANDVIIVNIFNNLHEPFLMTWNGLQLRKNSWQDGVRGTNCPILPGTNWTYRFQVKDQIG  121

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SYFYFPSL L KAAGGYG IRIY   +V  PFP PD + DILI DW+  D  V+
Sbjct  122  SYFYFPSLLLQKAAGGYGAIRIYTPELVPVPFPKPDEEYDILIGDWFYADHTVM  175


 Score =   103 bits (258),  Expect(4) = 2e-153, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
               GKTY LRISNVG+KT LNFRIQ H+M LVETEG+Y  K  + +LDIHVGQSYSV+V A
Sbjct  206   EPGKTYRLRISNVGLKTCLNFRIQDHDMLLVETEGTYVQKRVYSSLDIHVGQSYSVLVTA  265

Query  993   LEHKNG--ASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
                  G   SYY+ A+ RF+     G   +RY     +P  P+  +P  +
Sbjct  266   KTDPVGIYRSYYIYATARFTDFYLGGRALIRYPNSPLDPVGPVPLAPASW  315


 Score = 41.6 bits (96),  Expect(4) = 2e-153, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            V+R SLD    L  P GIL NG GPE+    F+PGK+
Sbjct  174  VMRASLDTGHSLPKPDGILFNGRGPEETFFAFEPGKT  210



>ref|XP_006301090.1| hypothetical protein CARUB_v10021484mg [Capsella rubella]
 gb|EOA33988.1| hypothetical protein CARUB_v10021484mg [Capsella rubella]
Length=545

 Score =   254 bits (650),  Expect(4) = 1e-152, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 155/221 (70%), Gaps = 5/221 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+D+ VGAAR NPQGS+HYGRINVTRTI+L   +    G+ RY INGVSFVYP+TPLKLA
Sbjct  328   RMDLNVGAARSNPQGSYHYGRINVTRTIILHNDVMLSSGRLRYTINGVSFVYPETPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ++        P  P      L    G SV+  +  DF  IVF NPL  ++++H+DG
Sbjct  388   DHFQLNDTIIPDMFPNYPSNKTPSL----GTSVVDIHYKDFVHIVFQNPLFELESYHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVG G G WS      YNL DAV RST+QVYPYSW A+ +AMDN+GMWN+RS  A+
Sbjct  444   YNFFVVGYGFGAWSESKRAGYNLVDAVSRSTIQVYPYSWAAILIAMDNQGMWNVRSQKAE  503

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGKA  1846
             Q YLGQELY++VKG  ++DPS I  RDE PIP NVI+CG+ 
Sbjct  504   QWYLGQELYMRVKGEGQEDPSNIPVRDENPIPENVIRCGRV  544


 Score =   220 bits (561),  Expect(4) = 1e-152, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 128/168 (76%), Gaps = 6/168 (4%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEER----FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            LV  L++  LFV   S        Y W VS+S RSILG  K++IVIND FPGP+LN + N
Sbjct  5    LVEVLVLTFLFVLELSYAYAPIVLYQWVVSYSQRSILGGNKQIIVINDMFPGPILNATAN  64

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D++ VNI NNL+EPFLM+WNG+QLR +SWQDGV+GTNCPIPPG NWTY FQ+KDQIGSYF
Sbjct  65   DIIIVNIFNNLNEPFLMTWNGLQLRKNSWQDGVRGTNCPIPPGTNWTYRFQVKDQIGSYF  124

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHP-PFPCPDYDLDILISDWYTED  537
            YFPSL L KAAGGYG IRI NTP + P PFP PDY+ DILI DW+  D
Sbjct  125  YFPSLLLQKAAGGYGAIRI-NTPELVPVPFPTPDYEYDILIGDWFYSD  171


 Score = 99.8 bits (247),  Expect(4) = 1e-152, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK Y LRISNVG+KT LNFRIQ H+M LVETEG+Y  K  + +LDIHVGQSYSV+V A  
Sbjct  208   GKMYRLRISNVGLKTCLNFRIQDHDMLLVETEGTYVQKRVYSSLDIHVGQSYSVLVTAKT  267

Query  999   HKNG--ASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
                G   SYY+ A+ RF      GI  +   Q+  +P  P+   PL
Sbjct  268   DPVGISRSYYILATARFVDFYLGGIALI---QYPNSPIDPVGSVPL  310


 Score = 39.3 bits (90),  Expect(4) = 1e-152, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGK  739
            +R SLD    L  P GIL NG GPE+    F+PGK
Sbjct  175  MRASLDTGHSLPNPDGILFNGRGPEETFFAFEPGK  209



>gb|KHG15299.1| Monocopper oxidase-like protein SKU5 [Gossypium arboreum]
Length=545

 Score =   241 bits (614),  Expect(4) = 7e-152, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 149/226 (66%), Gaps = 12/226 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+   AARPNPQGS+HYG I +TRT++LE  +  +  K R+ ING+SF++ DTPLKL 
Sbjct  329   RWDLIASAARPNPQGSYHYGTIPITRTLILENNVMVIGSKRRFTINGISFMHSDTPLKLL  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ++         E   +     L     S++     DF  IVF NPL  VQ+WH+DG
Sbjct  389   DYFQLN---------EESKYAAAAALPSSATSIVDAFYRDFFHIVFQNPLLEVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGMG G+W       YN+ DAV RSTVQVYP SWTA+ + +DN G WNLRS NA+
Sbjct  440   YNFFVVGMGWGLWDESKKAGYNIVDAVSRSTVQVYPLSWTAILMELDNIGTWNLRSQNAE  499

Query  1727  QRYLGQELYIKVKGPE---DDPSKISPRDEAPIPANVIKCGKAAQL  1855
               YLGQELYI+VKG     D+ S IS RDEAPIP NVIKCG+AA L
Sbjct  500   NWYLGQELYIRVKGVWNWFDEQSDISARDEAPIPDNVIKCGRAADL  545


 Score =   202 bits (514),  Expect(4) = 7e-152, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +C+  +L LF    S+  FYDWTVS+S  + LGV+K+VIVIN  FPGP+L  STNDV+NV
Sbjct  14   LCTCFLLVLFYRGWSQ-LFYDWTVSYSQLAPLGVDKQVIVINGMFPGPVLYASTNDVVNV  72

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            +IHNNL EPFLM+WNGVQ+R  SWQDGVQ TNCPI PG+NWTYSFQLKDQIGS+FYFPSL
Sbjct  73   SIHNNLREPFLMTWNGVQMRKDSWQDGVQETNCPILPGQNWTYSFQLKDQIGSFFYFPSL  132

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
             LHKAAGGYG I + N P++  PFP P  D  +LI DW+  D +
Sbjct  133  LLHKAAGGYGAIHLNNLPIIPIPFPQPYKDYAVLIGDWFNADYR  176


 Score =   129 bits (323),  Expect(4) = 7e-152, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  825   TYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALEHK  1004
             TY LRISNVG+KTSLNFRI+GH M LVETEGSY ++  +D+LDIHVGQSYSV+V A    
Sbjct  213   TYRLRISNVGLKTSLNFRIEGHPMLLVETEGSYLIQQYYDSLDIHVGQSYSVLVTAKNQA  272

Query  1005  NGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             NG SYYM AS RF++++ SGIG + Y    G+P  PL   P
Sbjct  273   NGKSYYMVASSRFTILEHSGIGVIHYPDSAGDPVGPLPLGP  313


 Score = 38.9 bits (89),  Expect(4) = 7e-152, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR SL+    L  P GILING GP QA  +F+P  +
Sbjct  178  LRASLENGVFLPHPDGILINGLGPNQARFEFEPSAT  213



>gb|KFK42011.1| hypothetical protein AALP_AA2G201000 [Arabis alpina]
Length=536

 Score =   248 bits (632),  Expect(4) = 9e-152, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+AVGAARPNPQGS+HYGR+NV RT++ +  +     K RY INGVSFVY +TPLKL 
Sbjct  318   REDLAVGAARPNPQGSYHYGRVNVARTLIFQNDVMTSQNKLRYTINGVSFVYSETPLKLI  377

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ++        P  P+      L   G SV+     +F  IVF NP   +++WH+DG
Sbjct  378   DHFQLNNTIVPDMFPVYPNSNKPPSL---GTSVVDIRYKEFVHIVFENPQFEMESWHIDG  434

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGMG G WS      YNL DAV RST+QVYPYSW A+ +AMDN+GMWN+RS  A+
Sbjct  435   YNFFVVGMGFGAWSESKRAGYNLLDAVSRSTIQVYPYSWVAILIAMDNQGMWNVRSQKAE  494

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGK  1843
               YLGQELY++VKG  ++DP  I  RDE+PIP NVI+CG+
Sbjct  495   NWYLGQELYLRVKGEGQEDPRNIPVRDESPIPENVIRCGR  534


 Score =   209 bits (532),  Expect(4) = 9e-152, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            + SL++L L   ++  +  Y+W VS+S RSI G  K++IVIND FPGP+L  +  DV+ +
Sbjct  1    MISLVILELSDALAPTDS-YEWVVSYSQRSIHGANKQIIVINDMFPGPILTATAGDVVTI  59

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            NI N+L EPFLM+WNG+Q+R +SWQDGV GTNCPI PG NWTYSFQ+KDQIGSYFYFPSL
Sbjct  60   NIFNHLSEPFLMTWNGLQMRKNSWQDGVLGTNCPILPGTNWTYSFQIKDQIGSYFYFPSL  119

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             L KAAGGYG IR+Y   +V  PFP PD + DILI DW+  D
Sbjct  120  LLQKAAGGYGSIRVYAPELVPIPFPRPDGEFDILIGDWFYTD  161


 Score =   109 bits (272),  Expect(4) = 9e-152, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+K+SLNFRIQ H+M LVETEGSY  K  + NLDIHVGQSYSV+V A  
Sbjct  198   GKTYRLRISNVGLKSSLNFRIQDHDMLLVETEGSYVQKRIYSNLDIHVGQSYSVLVTAKS  257

Query  999   HKNG--ASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                G   SYY+ AS RF+    +G+  +RY     +P  P+  +P
Sbjct  258   DTVGIYRSYYILASTRFTNFFMTGLALIRYPNSPIDPVGPVPAAP  302


 Score = 44.3 bits (103),  Expect(4) = 9e-152, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            +R +LD    L  P GILINGHGP  A  +FQPGK+
Sbjct  165  MRAALDNGLSLANPDGILINGHGPGHAFFEFQPGKT  200



>ref|XP_009397600.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=556

 Score =   236 bits (602),  Expect(4) = 9e-149, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 152/222 (68%), Gaps = 5/222 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+ VGAARPNPQGS+ YG IN++RTIVL+     +  + RYAINGVSFVYPDTPLKLA
Sbjct  333   RWDLKVGAARPNPQGSYRYGHINISRTIVLQNDEVMIGDRTRYAINGVSFVYPDTPLKLA  392

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+  G +P+ P      +    G  V+      F +I+F N   S+Q+WHLDG
Sbjct  393   DYFGIPGVFMAGEVPDEPSGRKPTI----GTPVVDAIYKSFVEIIFQNNESSIQSWHLDG  448

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGM  G W+     +YN+ DA++RSTVQVYP SWTA+ VA DN GMWN+RS   +
Sbjct  449   YNFFVVGMEEGKWNFCSRSTYNMVDAIFRSTVQVYPNSWTAILVAFDNMGMWNIRSQELE  508

Query  1727  QRYLGQELYIKVKGPEDDPSKI-SPRDEAPIPANVIKCGKAA  1849
             +R LGQELY++V   + + + + +PRDE P   +++ CGKAA
Sbjct  509   RRQLGQELYMRVNWDDANNNTVPNPRDEMPFSPDLLLCGKAA  550


 Score =   216 bits (551),  Expect(4) = 9e-149, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = +1

Query  37   VALPLVCSLIVLSL-------FVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
             A+P+V  L+  +        FV     E +YDW VSF+  S  GVEKKVIVIND+ PGP
Sbjct  5    AAMPVVFLLLTFTFAFSFHGCFVHAGDPELYYDWNVSFAKVSPFGVEKKVIVINDRLPGP  64

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
            LLN +TN++++VN++N LDEPFL++WNGVQ+R +SW DGV GTNCPIPPGKNWTY  Q+K
Sbjct  65   LLNVTTNNLVSVNVYNYLDEPFLLTWNGVQMRRNSWNDGVPGTNCPIPPGKNWTYHMQVK  124

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
            DQIGS+FYFPSL    AAGGYGPIRI N  ++  PF  P  DLDILI+DWY  D Q
Sbjct  125  DQIGSFFYFPSLGFQMAAGGYGPIRIDNRVIIPIPFSFPQDDLDILIADWYDMDYQ  180


 Score =   112 bits (281),  Expect(4) = 9e-149, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +3

Query  816   AGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKAL  995
             +G TY LRISNVGIKT+LNFRIQGH M LVETEGSYT+K  +D+LDIHVGQSYSV+V A 
Sbjct  214   SGATYRLRISNVGIKTTLNFRIQGHKMLLVETEGSYTLKQYYDSLDIHVGQSYSVLVTA-  272

Query  996   EHKNGASYYMSASPRFSLMQASGIGFVRYNQF---RGNPGTPLSKSPLKF  1136
             +     SYY+ AS RF  +   G+  + Y+     + + G P   SP  +
Sbjct  273   DQPPSTSYYIVASSRFVELDLFGVAIINYDDGSNKKPSGGIPEGPSPFDY  322


 Score = 35.4 bits (80),  Expect(4) = 9e-149, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            +R+++D+   L  P GILING  PE+A+  F+ G +
Sbjct  182  MRDAVDQGFPLSLPDGILINGLPPEKANFTFKSGAT  217



>ref|XP_010271560.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nelumbo nucifera]
Length=546

 Score =   261 bits (666),  Expect(4) = 5e-148, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 158/224 (71%), Gaps = 5/224 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R D+AVGAARPNPQGSF YG INV+RTI+LE  M  +  + RY +NG+SFV+ DTPLKLA
Sbjct  327   RWDLAVGAARPNPQGSFRYGLINVSRTIILENDMTVIGSRQRYTVNGISFVHSDTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F +  V+ +  IP+ P      L    G SV+     DF  IVF NPL ++QTWH DG
Sbjct  387   DYFQLGDVFAINAIPDKPDGRNPAL----GTSVMDLRYRDFIHIVFQNPLPTMQTWHFDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGM  G W      +YN+ DAV RSTVQVYP +WTA+ V +DN+GMWN RS +A+
Sbjct  443   YNFFVVGMDEGKWDESKRLAYNMLDAVSRSTVQVYPNAWTAIMVELDNQGMWNFRSQDAE  502

Query  1727  QRYLGQELYIKVKGP-EDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             + YLGQELY++VKG  +DDPS +  RDE PIP NVI+CG+A  +
Sbjct  503   KWYLGQELYVRVKGEGQDDPSTVPARDELPIPTNVIRCGRAGSM  546


 Score =   191 bits (485),  Expect(4) = 5e-148, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +1

Query  79   FVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEP  258
            FV   +   F+DWTVS+S  S LGV K+VIVINDQFPGP+LN +TNDV+NVN+ N L EP
Sbjct  21   FVESDTPHLFFDWTVSYSQVSPLGVPKQVIVINDQFPGPVLNVTTNDVVNVNVLNKLTEP  80

Query  259  FLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGY  438
             L +WNGVQ R +SWQDGVQGTNCPIPPG+NWTYSFQ+KDQIGS+FYFPS+   KAAGGY
Sbjct  81   LLFTWNGVQQRKNSWQDGVQGTNCPIPPGQNWTYSFQVKDQIGSFFYFPSVLFQKAAGGY  140

Query  439  GPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
            G IR+ N  V+  PFP P  + D+LI DWY  D +
Sbjct  141  GAIRVNNRVVIPLPFPRPLQEFDVLIGDWYNADYR  175


 Score =   112 bits (281),  Expect(4) = 5e-148, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TY LRISNVG+KT LNFRI+GH M LVETEGSYT++  +  LDIHVGQSYSV+V A  
Sbjct  210   GATYRLRISNVGLKTCLNFRIEGHLMLLVETEGSYTLQQYYQTLDIHVGQSYSVLVTA-N  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
              K+G SY+M A  RFS+ + +G   + Y   +GN   PL   P  F
Sbjct  269   QKSGMSYHMVAVSRFSVPELAGAAVIHYPGSQGNSKGPLPTGPDPF  314


 Score = 33.9 bits (76),  Expect(4) = 5e-148, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR SLD+   L  P GILING  P QA+  F+ G +
Sbjct  177  LRVSLDKGIPLPQPDGILINGLAPYQANFAFRTGAT  212



>ref|XP_004952386.1| PREDICTED: monocopper oxidase-like protein SKS1-like [Setaria 
italica]
Length=554

 Score =   245 bits (626),  Expect(4) = 2e-142, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 157/224 (70%), Gaps = 9/224 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++  GAARPNPQGSF YGRINVTRTI+L    A V G+ R  +NGVSF    TPLKLA
Sbjct  334   RMNLTCGAARPNPQGSFRYGRINVTRTILLRNGDAEVGGRRRCTVNGVSFADAATPLKLA  393

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF+++GV+ +  +   P    +  L   G +VI     DF QIVF N L S+QTWHLDG
Sbjct  394   DHFDVAGVFAV--VSGRPERRRQPSL---GTAVIDARYRDFVQIVFENRLPSLQTWHLDG  448

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFV GMG G WS      YNL DA+YRSTVQVYP SWTAV V++DNEGMWNLRS + D
Sbjct  449   YSFFVAGMGWGKWSPDARLKYNLIDAIYRSTVQVYPASWTAVLVSLDNEGMWNLRSQSLD  508

Query  1727  QRYLGQELYIKV-KGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             +RYLGQE+YI+V +G  + P   +PRDE P+P+N + CGKA  L
Sbjct  509   RRYLGQEIYIRVSQGSSEVP---NPRDELPMPSNALLCGKAMSL  549


 Score =   208 bits (530),  Expect(4) = 2e-142, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVC--VSSEER--FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
            +A  L   L++L    C    +E R  F DW VS++ RS LGV K+VI IN + PGP+LN
Sbjct  6    LATILAAILVLLGSSQCYTAGAENRHVFLDWEVSYAVRSPLGVAKRVIAINGRLPGPMLN  65

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
             +TNDV +VN+ N LDEPFL++WNG+Q+R +SW DGV GTNC IPPG+NWTY FQ KD++
Sbjct  66   LTTNDVAHVNVVNTLDEPFLLTWNGLQMRRNSWNDGVAGTNCAIPPGENWTYVFQAKDEV  125

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
            GS+FY PSL LH AAGG+GPIR+ N PVV  PF  PD + D+LI DWY  D++
Sbjct  126  GSFFYRPSLGLHAAAGGHGPIRVNNRPVVAVPFDQPDGEFDVLIGDWYNMDVK  178


 Score = 88.2 bits (217),  Expect(4) = 2e-142, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G+TY LR+SNVG +TSL+FRIQGH + LVE EG+YT++  + +LD+H GQS SV+V A +
Sbjct  213   GRTYRLRVSNVGTRTSLSFRIQGHKLQLVEAEGTYTLQKHYASLDVHPGQSLSVLVAA-D  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
                  SYYM  S  F   +  G+G V Y
Sbjct  272   QPPRPSYYMVVSSLFIKPELFGVGNVLY  299


 Score = 37.7 bits (86),  Expect(4) = 2e-142, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = +2

Query  608  DYMVL*LKVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            D+  + +K ++  LDR   L  P GILING GP  A   F+PG++
Sbjct  171  DWYNMDVKEMKGYLDRGRDLPSPDGILINGLGPYAADFTFKPGRT  215



>ref|XP_002300700.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79973.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=496

 Score =   237 bits (605),  Expect(4) = 8e-140, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +1

Query  46   PLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            P      + SL V V  +   YDWTVSFS R+ L + K+VIVINDQFPGPLLN +TNDVL
Sbjct  3    PFSLLFYLSSLAVLVDGKSLSYDWTVSFSHRAPLALTKQVIVINDQFPGPLLNATTNDVL  62

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
            N+NIHNNL EPFLM+WNG+Q+R +SWQDGVQ TNCPI PG+NWTYSFQ+KDQIGS+FYFP
Sbjct  63   NINIHNNLTEPFLMTWNGLQMRRNSWQDGVQETNCPILPGRNWTYSFQVKDQIGSFFYFP  122

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SL LHKAAGGYGPIR+ N  V+  PFP P  D+D+LI DWY+ D
Sbjct  123  SLLLHKAAGGYGPIRVNNREVIPIPFPQPHGDIDVLIGDWYSAD  166


 Score =   174 bits (442),  Expect(4) = 8e-140, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 117/178 (66%), Gaps = 7/178 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++ GAARPNPQGS+HYG INV+RTIVL      +  +  Y +NGVSFV   TPLK+A
Sbjct  321   RWNLSAGAARPNPQGSYHYGSINVSRTIVLRNGETDI-NRHLYTVNGVSFVSQGTPLKMA  379

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F +  + + G  P+ P       ++    SVI  N  +F  +VF NP  S+QTWHLDG
Sbjct  380   DYFELETL-KTGIFPDTPIGNG---ISTLDTSVINANYREFYHLVFENPTPSLQTWHLDG  435

Query  1547  YNFFVVGM--GPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             YNFFVVGM  G   W      +YNL DAV RSTVQVYP+ WTAV V +DN+G+WNLRS
Sbjct  436   YNFFVVGMEFGTSSWEEDMKATYNLNDAVSRSTVQVYPFGWTAVMVMLDNQGLWNLRS  493


 Score =   119 bits (298),  Expect(4) = 8e-140, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TY LRISNVG+KTSLNFRIQ H M LVETEGSYT +  + NLDIHVGQSYSV+V A  
Sbjct  203   GATYRLRISNVGLKTSLNFRIQDHLMLLVETEGSYTAQQTYSNLDIHVGQSYSVLVTAKN  262

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               +G SYYM AS R +  +  G+G +RY      P  PL   P
Sbjct  263   QTSGKSYYMVASSRLTDAELFGVGVIRYPNSDDFPSGPLPPGP  305


 Score = 39.7 bits (91),  Expect(4) = 8e-140, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L+ P GILING GP +   +FQPG +
Sbjct  170  LRALLDNGTGLQNPSGILINGRGPNETVFEFQPGAT  205



>ref|XP_010236377.1| PREDICTED: monocopper oxidase-like protein SKS1 [Brachypodium 
distachyon]
Length=565

 Score =   239 bits (610),  Expect(4) = 3e-138, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 155/223 (70%), Gaps = 7/223 (3%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++  GAARPNPQGSFHY  INVTRT++L+  +A + G+ R  +NGV+F    TPLKLA
Sbjct  339   RMNLTSGAARPNPQGSFHYASINVTRTVLLQNGVADIDGRRRCTVNGVTFANTGTPLKLA  398

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F + GV+ +  +   P    R  L   G +VI  +  DF QIVFHN L S+QTWHLDG
Sbjct  399   DYFRVPGVFTV--VSGRPERRNRPAL---GTTVIDASYKDFVQIVFHNRLPSLQTWHLDG  453

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFV GMG G WS     +YNL DAVYRST+QVYP SWTAV V +DNEGMWNLRS + +
Sbjct  454   YSFFVAGMGWGKWSPDTRSTYNLVDAVYRSTIQVYPASWTAVLVYLDNEGMWNLRSQDLE  513

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQE+Y++V     + S   PRDE P+P+N + CGKA  L
Sbjct  514   KKYLGQEVYLRVSQGNSEVSD--PRDELPMPSNALLCGKATGL  554


 Score =   202 bits (513),  Expect(4) = 3e-138, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 115/151 (76%), Gaps = 6/151 (4%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMS-----  270
            F DW VS++ RS LGV KKVI IN  FPGPLLN +TNDV +VN+ N LDEPFL++     
Sbjct  31   FLDWEVSYAVRSPLGVAKKVIAINGDFPGPLLNLTTNDVAHVNVLNTLDEPFLLTCAAMQ  90

Query  271  -WNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPI  447
              NG+Q+R +SW DGV GTNCPI PG+NWTY FQ+KD++GS+FY PSL LH AAGG+GPI
Sbjct  91   CRNGLQMRRNSWNDGVAGTNCPIRPGENWTYVFQVKDEVGSFFYRPSLGLHAAAGGHGPI  150

Query  448  RIYNTPVVHPPFPCPDYDLDILISDWYTEDI  540
            R+ N PV+  PFP PD DLD+L+ DWY  D+
Sbjct  151  RVNNRPVIDVPFPRPDGDLDVLVGDWYNMDV  181


 Score = 85.5 bits (210),  Expect(4) = 3e-138, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +3

Query  816   AGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKAL  995
             AG+TY LR+SNVG +TSL+FRIQGH + LVE EG+YT +  + +LD+H GQS SV+V A 
Sbjct  216   AGRTYRLRVSNVGTRTSLSFRIQGHKLLLVEAEGTYTAQKHYASLDVHPGQSLSVLVAAD  275

Query  996   EHKNGASYYMSASPRFSLMQASGIGFVRY  1082
             +      YY   S  F   +  G+G V Y
Sbjct  276   QAPK--PYYTVVSSLFVTPELFGVGTVLY  302


 Score = 38.5 bits (88),  Expect(4) = 3e-138, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  608  DYMVL*LKVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            D+  + +  +R+ LD+   L  P GILI+G GP +ASL F+ G++
Sbjct  175  DWYNMDVSEMRQHLDKGSDLPSPDGILIDGLGPYEASLTFKAGRT  219



>gb|EMT03662.1| Monocopper oxidase-like protein SKS1 [Aegilops tauschii]
Length=549

 Score =   235 bits (600),  Expect(4) = 1e-136, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 156/223 (70%), Gaps = 8/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++  GAARPNPQGSFHYG INVTRT++L+   + + G+ R  +NGV+F    TPLKLA
Sbjct  333   RMNLTSGAARPNPQGSFHYGDINVTRTLLLQNDESDIGGRRRCTVNGVAFANAGTPLKLA  392

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I+GV+++  +   P      +    G +VI  +  D+ QIVF N L S+QTWHLDG
Sbjct  393   DYFRIAGVFKV--VSGRPERRNPFI----GTTVIDASYRDYVQIVFENRLPSMQTWHLDG  446

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G WS     +YNL DA+YRSTVQVYP SWTAV V +DNEGMWNLRS + +
Sbjct  447   HSFFVVGMAWGKWSPDARSTYNLVDAMYRSTVQVYPTSWTAVLVYLDNEGMWNLRSQDVE  506

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             +RYLGQELY++V   + D     PRDE P+P+N + CG+A +L
Sbjct  507   KRYLGQELYLRVS--QGDSGVPDPRDELPMPSNALLCGRATRL  547


 Score =   196 bits (497),  Expect(4) = 1e-136, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            + +V + I+ S  V       F +W VS+S RS LGV K+VI IN + PGPLLN +TNDV
Sbjct  7    VAIVLAGILHSALVAAEDRHVFLNWEVSYSLRSPLGVSKRVIAINGRLPGPLLNLTTNDV  66

Query  223  LNVNIHNNLDEPFLMS------WNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
             +VN+ N LDEPFL++       NG+Q+R +SW DG  GTNC I PG+NWTY FQ KD+I
Sbjct  67   AHVNVVNTLDEPFLLTCSSIVCRNGLQMRRNSWNDGGAGTNCAIQPGENWTYVFQAKDEI  126

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
            GS+FY PSL LH AAGG+GPIR+ N PV+  PFP PD + D+LI DWY  D +
Sbjct  127  GSFFYRPSLGLHAAAGGHGPIRVNNRPVIDVPFPQPDGEFDVLIGDWYNMDAK  179


 Score = 90.5 bits (223),  Expect(4) = 1e-136, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +3

Query  816   AGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKAL  995
             AG+TY LR+SNVG +TSLNFR+QGH + LVE EG+YT++  + +LD+H GQS SV+V A 
Sbjct  213   AGRTYRLRVSNVGTRTSLNFRLQGHKLLLVEAEGTYTLQKHYASLDVHPGQSVSVLVAAD  272

Query  996   EHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLK  1133
             +     +YYM  S  F L +  G+  V Y      P  P   +PL 
Sbjct  273   QAPK--AYYMVVSSLFVLPEIFGVATVLYAGSGEQP--PSGDAPLD  314


 Score = 38.5 bits (88),  Expect(4) = 1e-136, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  608  DYMVL*LKVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            D+  +  K ++E LDR+  L  P GILING GP +A + F+ G++
Sbjct  172  DWYNMDAKEMKELLDRSRGLPPPDGILINGLGPYEAEVTFKAGRT  216



>ref|XP_008798222.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   234 bits (597),  Expect(4) = 4e-135, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG INVTRTI L    A+V GK RYA+N VS+V PDTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINVTRTIRLANSAAQVNGKQRYAVNSVSYVEPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF I GV+ LG+I + P  T   L      SV+  +   F +IVF N    VQ+WHLDG
Sbjct  383   DHFKIGGVFRLGSISDNPTGTKVYL----DTSVMAADFRTFVEIVFENKESIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNF+VVGM  G WS    + YNL+DAV R T QVYP SWTAVYV +DN GMWN+R+    
Sbjct  439   YNFWVVGMDGGKWSPASRKGYNLRDAVSRCTAQVYPRSWTAVYVMLDNVGMWNVRTEFWS  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             +RYLGQ+ Y++V  P +     S RDE PIP N + CGKA 
Sbjct  499   RRYLGQQFYLRVYSPLE-----SIRDEYPIPKNALLCGKAT  534


 Score =   198 bits (503),  Expect(4) = 4e-135, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 1/172 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            T A  L+C L + S+FV   S  RF+ W V+F     LGV ++ I+IN QFPGP +   +
Sbjct  5    TAAFALLCCLSI-SIFVGAESPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVS  63

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND L +N+HN+L EPFL+SWNGVQ R +SW+DGV GTNCPIPPGKN+TY  Q KDQIGS+
Sbjct  64   NDNLIINVHNSLTEPFLISWNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQAKDQIGSF  123

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            FYFPSL+ HKAAGG+G  RI + P++  PFP P  D  +LI DWY  + +V+
Sbjct  124  FYFPSLYFHKAAGGFGGFRILSRPLIPVPFPEPAGDYTVLIGDWYKANHKVL  175


 Score = 79.0 bits (193),  Expect(4) = 4e-135, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK Y LRISNVG++ SLN RIQGH M LVE EG++T+++ + ++DIHVGQS SV++ A +
Sbjct  208   GKIYRLRISNVGLQHSLNIRIQGHKMKLVEVEGTHTLQNTYSSIDIHVGQSVSVLITADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY++ S RF+    +    + Y+  R     P+   P
Sbjct  268   PPK--DYYVAVSTRFTTTTLTTTAVLHYSNSREKVSGPIPGGP  308


 Score = 43.5 bits (101),  Expect(4) = 4e-135, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGK  739
            KVLR  LDR   L FP GILING GP  AS     GK
Sbjct  173  KVLRARLDRGKKLPFPDGILINGRGPNGASFTVDQGK  209



>ref|XP_002967301.1| hypothetical protein SELMODRAFT_86988 [Selaginella moellendorffii]
 gb|EFJ31900.1| hypothetical protein SELMODRAFT_86988 [Selaginella moellendorffii]
Length=537

 Score =   241 bits (615),  Expect(4) = 4e-133, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 154/223 (69%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++  GAARPNPQGSFHYG INV+RTI L      + GK R+A+N +S+  PDTPLKLA
Sbjct  323   RWNLTAGAARPNPQGSFHYGVINVSRTIKLFNTAPMINGKQRFAVNDISYFNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++ I GV+ L +IP+ P+F+   L    G SV+  + H F +I+F N    +Q+WH+DG
Sbjct  383   DYYKIPGVFSLNSIPDSPYFSTPFL----GTSVLNVDYHSFIEIIFQNNEEVIQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y FFVVG GPG W+     +YNL DAV RST QVYP SWTA+++++DN GMW +RS N  
Sbjct  439   YQFFVVGFGPGAWNDTSRLTYNLYDAVARSTTQVYPMSWTAIFMSLDNVGMWEIRSQNPA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+LY++V  PE+  S      E PIP+NV++CGKA  L
Sbjct  499   RQYLGQDLYMRVYNPEEARST-----ETPIPSNVLRCGKAVGL  536


 Score =   181 bits (460),  Expect(4) = 4e-133, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = +1

Query  85   CVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEP  258
            C   E+   +++W VSF   + LG  ++VI IN+Q PGP +  +TN+ L +N+ N+LDEP
Sbjct  18   CARGEDPYLYFEWNVSFVDLAPLGAPQRVIAINNQLPGPEIAVTTNNNLEINVFNSLDEP  77

Query  259  FLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGY  438
             L +WN V +R SSWQDGV GTNCPIPPG NWTY FQ+KDQIGS FY+PSL + +AAGGY
Sbjct  78   LLFTWNAVWMRRSSWQDGVLGTNCPIPPGANWTYKFQVKDQIGSGFYYPSLLMQRAAGGY  137

Query  439  GPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            G IRIYN  V+  PF  P  D+ +LI DWY ++
Sbjct  138  GGIRIYNRAVIAVPFAPPAGDITMLIGDWYKQN  170


 Score = 94.4 bits (233),  Expect(4) = 4e-133, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +3

Query  822   KTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALEH  1001
              TY LRISNVGI T+LNFRI+GH M LVETEGSYTV++ +D+LD+HVGQSYSV++   + 
Sbjct  208   NTYRLRISNVGISTTLNFRIEGHRMLLVETEGSYTVQNFYDSLDVHVGQSYSVIITTDQA  267

Query  1002  KNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                  +++ AS RF +   +G+  + Y+      G  L   P
Sbjct  268   P--GDFHIVASSRFGVPVLTGLATLHYSNSPSTLGGTLPPGP  307


 Score = 30.8 bits (68),  Expect(4) = 4e-133, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR +LD   M+  P G+LING GP  +    +P  +
Sbjct  174  LRGTLDAGFMIGAPDGVLINGRGPYGSYFVVEPANT  209



>ref|XP_002981392.1| hypothetical protein SELMODRAFT_178788 [Selaginella moellendorffii]
 gb|EFJ17580.1| hypothetical protein SELMODRAFT_178788 [Selaginella moellendorffii]
Length=537

 Score =   223 bits (567),  Expect(4) = 1e-132, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 149/230 (65%), Gaps = 12/230 (5%)
 Frame = +2

Query  1172  CFNLDRV---DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVY  1342
              FN  R    ++  GAARPNPQGSFHYG IN+++T+ L      + GK R+A+NG+S+++
Sbjct  317   SFNQARTIKWNLTAGAARPNPQGSFHYGLINISKTVKLANSAPAINGKQRFAVNGISYMH  376

Query  1343  PDTPLKLADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRS  1522
             P TPLKLAD + I GV+   +IPE P           G SV+      F +I+F N    
Sbjct  377   PGTPLKLADFYKIGGVFSPNSIPEYPDGRS----PYNGASVLSGTYRSFMEIIFQNNENP  432

Query  1523  VQTWHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMW  1702
             VQ+WH+DGY FFVVGMGPG W+     +YNL DAV RSTVQVY  SWTA+ + +DN GMW
Sbjct  433   VQSWHIDGYAFFVVGMGPGDWTTSSRLTYNLVDAVARSTVQVYAKSWTAIMLELDNVGMW  492

Query  1703  NLRSGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             N+RS N  ++YLGQE Y++V  PE DP+ I+     PIP NV+ CGKA +
Sbjct  493   NVRSQNVIRQYLGQEFYMRVVNPE-DPNGIN----EPIPQNVLLCGKAKK  537


 Score =   184 bits (468),  Expect(4) = 1e-132, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            +F+DW VSF + S LGV ++VI IN QFPGP L  +TN+ + +N+ N+LDEP L++WNG+
Sbjct  28   QFHDWNVSFVSTSPLGVNQRVIAINGQFPGPELETTTNNNVVINLRNSLDEPLLLTWNGL  87

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            QLR  SWQDG  GTNCPI PG+NWTY FQ KDQIG++ YFPSL L +AAGGYG IRI+N 
Sbjct  88   QLRRDSWQDGTLGTNCPIMPGQNWTYQFQAKDQIGTFSYFPSLLLQRAAGGYGGIRIHNR  147

Query  463  PVVHPPFPCPDYDLDILISDWY  528
             V+  PF  P  +L +LI DWY
Sbjct  148  AVIPVPFAPPFAELTVLIGDWY  169


 Score =   100 bits (250),  Expect(4) = 1e-132, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 2/93 (2%)
 Frame = +3

Query  804   LLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVM  983
             L    GKTY LRISNVG  +SLNFRIQGH M LVETEGSYT +  +D+LD+HVGQSYSV+
Sbjct  204   LTVQPGKTYRLRISNVGSVSSLNFRIQGHKMKLVETEGSYTAQALYDSLDVHVGQSYSVL  263

Query  984   VKALEHKNGASYYMSASPRFSLMQASGIGFVRY  1082
             +     ++   +Y+ A+ RFSL + +G+  + Y
Sbjct  264   ITT--DQSPKDFYIMATSRFSLPEITGVAVLHY  294


 Score = 38.5 bits (88),  Expect(4) = 1e-132, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR +LDR  M+    G+LING GP   +L  QPGK+
Sbjct  176  LRAALDRGEMIGKGDGVLINGRGPYGTTLTVQPGKT  211



>ref|XP_002960418.1| hypothetical protein SELMODRAFT_229918 [Selaginella moellendorffii]
 gb|EFJ37957.1| hypothetical protein SELMODRAFT_229918 [Selaginella moellendorffii]
Length=537

 Score =   238 bits (608),  Expect(4) = 3e-132, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 153/223 (69%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++  GAARPNPQGSFHYG INV+RTI L      + GK R+A+N +S+  PDTPLKLA
Sbjct  323   RWNLTAGAARPNPQGSFHYGVINVSRTIKLFNTAPMINGKQRFAVNDISYFNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++ I GV+ L +IP+ P+F+   L    G SV+  + H F +I+F N    +Q+WH+DG
Sbjct  383   DYYKIPGVFSLNSIPDSPYFSTPFL----GTSVLNVDYHSFIEIIFQNNEEVIQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y FFVVG GPG W+     +YNL DAV RST QVYP SWTA+++++DN GMW +RS N  
Sbjct  439   YQFFVVGFGPGAWNDTSRLTYNLYDAVARSTTQVYPMSWTAIFMSLDNVGMWEIRSQNPA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+LY++V  PE+  S      E  IP+NV++CGKA  L
Sbjct  499   RQYLGQDLYMRVYNPEEARST-----ETAIPSNVLRCGKAVGL  536


 Score =   182 bits (461),  Expect(4) = 3e-132, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = +1

Query  85   CVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEP  258
            C   E+   +++W VSF   + LG  ++VI IN+Q PGP +  +TN+ L +N+ N+LDEP
Sbjct  18   CARGEDPYLYFEWNVSFVDLAPLGAPQRVIAINNQLPGPEIAVTTNNNLEINVFNSLDEP  77

Query  259  FLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGY  438
             L +WN V +R SSWQDGV GTNCPIPPG NWTY FQ+KDQIGS FY+PSL + +AAGGY
Sbjct  78   LLFTWNAVWMRRSSWQDGVLGTNCPIPPGANWTYKFQVKDQIGSGFYYPSLLMQRAAGGY  137

Query  439  GPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            G IRIYN  V+  PF  P  D+ +LI DWY ++
Sbjct  138  GGIRIYNRAVIAVPFAPPAGDITMLIGDWYKQN  170


 Score = 94.4 bits (233),  Expect(4) = 3e-132, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +3

Query  822   KTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALEH  1001
              TY LRISNVGI T+LNFRI+GH M LVETEGSYTV++ +D+LD+HVGQSYSV++   + 
Sbjct  208   NTYRLRISNVGISTTLNFRIEGHRMLLVETEGSYTVQNFYDSLDVHVGQSYSVIITTDQA  267

Query  1002  KNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                  +++ AS RF +   +G+  + Y+      G  L   P
Sbjct  268   P--GDFHIVASSRFGVPVLTGLATLHYSNSPSTLGGTLPPGP  307


 Score = 30.8 bits (68),  Expect(4) = 3e-132, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR +LD   M+  P G+LING GP  +    +P  +
Sbjct  174  LRGTLDAGFMIGAPDGVLINGRGPYGSYFVVEPANT  209



>ref|XP_002969915.1| hypothetical protein SELMODRAFT_410532 [Selaginella moellendorffii]
 gb|EFJ29039.1| hypothetical protein SELMODRAFT_410532 [Selaginella moellendorffii]
Length=537

 Score =   221 bits (563),  Expect(4) = 5e-132, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 149/230 (65%), Gaps = 12/230 (5%)
 Frame = +2

Query  1172  CFNLDRV---DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVY  1342
              FN  R    ++  GAARPNPQGSFHYG IN+++T+ L      + GK R+A+NG+S+++
Sbjct  317   SFNQARTIKWNLTAGAARPNPQGSFHYGLINISKTVKLANSAPAINGKQRFAVNGISYMH  376

Query  1343  PDTPLKLADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRS  1522
             P TPLKLAD + I GV+   +IP+ P           G SV+      F +I+F N    
Sbjct  377   PGTPLKLADFYKIGGVFSPNSIPDYPDGRS----PYNGASVLSGTYRSFMEIIFQNNENP  432

Query  1523  VQTWHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMW  1702
             VQ+WH+DGY FFVVGMGPG W+     +YNL DAV RSTVQVY  SWTA+ + +DN GMW
Sbjct  433   VQSWHIDGYAFFVVGMGPGDWTTSSRLTYNLVDAVARSTVQVYAKSWTAIMLELDNVGMW  492

Query  1703  NLRSGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             N+RS N  ++YLGQE Y++V  PE DP+ I+     PIP NV+ CGKA +
Sbjct  493   NVRSQNVIRQYLGQEFYMRVVNPE-DPNGIN----EPIPQNVLLCGKAKK  537


 Score =   184 bits (467),  Expect(4) = 5e-132, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            +F+DW VSF   S LGV ++VI IN QFPGP L  +TN+ + +N+ N+LDEP L++WNG+
Sbjct  28   QFHDWNVSFVNTSPLGVNQRVIAINGQFPGPELETTTNNNVVINLRNSLDEPLLLTWNGL  87

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            QLR  SWQDG  GTNCPI PG+NWTY FQ KDQIG++ YFPSL L +AAGGYG IRI+N 
Sbjct  88   QLRRDSWQDGTLGTNCPIMPGQNWTYQFQAKDQIGTFSYFPSLLLQRAAGGYGGIRIHNR  147

Query  463  PVVHPPFPCPDYDLDILISDWY  528
             V+  PF  P  +L +LI DWY
Sbjct  148  AVIPVPFAPPFAELTVLIGDWY  169


 Score =   100 bits (249),  Expect(4) = 5e-132, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +3

Query  801   VLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSV  980
              L    GKTY LRISNVG  +SLNFRIQGH M LVETEGSYT +  +D+LD+HVGQSYSV
Sbjct  203   TLTVQPGKTYRLRISNVGSVSSLNFRIQGHKMKLVETEGSYTAQALYDSLDVHVGQSYSV  262

Query  981   MVKALEHKNGASYYMSASPRFSLMQASGIGFVRY  1082
             ++     ++   +Y+ A+ RFSL + +G+  + Y
Sbjct  263   LITT--DQSPKDFYIMATSRFSLPELTGVAVLHY  294


 Score = 38.5 bits (88),  Expect(4) = 5e-132, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR +LDR  M+    G+LING GP   +L  QPGK+
Sbjct  176  LRAALDRGEMIGKGDGVLINGRGPYGTTLTVQPGKT  211



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   226 bits (577),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RYAIN VS+V PDTPLKLA
Sbjct  329   RTNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAINSVSYVAPDTPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+  G+I + P      L      SV+Q +   F +IVF N  + VQ++HLDG
Sbjct  389   DYFKISGVFRPGSISDRPTGGGIYL----DTSVLQADYRTFVEIVFQNNEKIVQSYHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R T QVYP+SWTA+Y+A+DN GMWNLRS    
Sbjct  445   YSFFVVGMDGGQWTPASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNVGMWNLRSEFWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE P+P N I CG+A+
Sbjct  505   RQYLGQQLYLRVY-----TASTSIRDEFPVPKNAILCGRAS  540


 Score =   184 bits (467),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 120/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
             TV   L+C  + +SLF    +E+  RF++W V++     LGV +  I+IN QFPGP ++
Sbjct  9    ATVGSLLLC--VAISLFHIAGAEDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIH  66

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQI
Sbjct  67   SVTNDNLIINVFNSLDEPFLLSWNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQI  126

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GS++YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  127  GSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  177


 Score = 91.7 bits (226),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  214   GKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RFS    +  G +RY+
Sbjct  272   DQPAQDYYIVFSSRFSYKVLTTTGVLRYS  300


 Score = 40.8 bits (94),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP   SL+ + GK+
Sbjct  180  TLKARLDRGKKLPFPDGILINGRGPNGVSLNVEQGKT  216



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   225 bits (574),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L    + + GK RYA+N VSF+  DTPLKLA
Sbjct  325   RRNLTASGPRPNPQGSYHYGLINTTRTIRLASSASIINGKQRYAVNSVSFIPADTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNISGV+ LG+IP  P      L      SV+  +   +T+IVF NP  ++Q+WH+DG
Sbjct  385   DYFNISGVFSLGSIPVGPTGGGAYLQ----TSVMAADFRGYTEIVFENPEDTLQSWHIDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G W+     +YNL+D + R TVQVYP SWTAVY+ +DN GMWN+RS N  
Sbjct  441   HNFFVVGMDGGQWTPASRLTYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMWNVRSENWA  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE PIP N + CG+A
Sbjct  501   RQYLGQQFYLRVYSPAK-----SWRDEYPIPRNALLCGRA  535


 Score =   192 bits (488),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = +1

Query  55   CSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLN  228
            C ++V+ L  C + E+  RF+ W V++     LGV+++ I+IN QFPGP +   TN+ L 
Sbjct  11   CFMLVMLLVSCTNGEDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLI  70

Query  229  VNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPS  408
            +N+ N+LD+PFL+SWNGVQ R +SWQDGV GTNCPIPPG N+TY+ Q+KDQIGSYFYFPS
Sbjct  71   INVFNSLDQPFLISWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPS  130

Query  409  LHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            L LHKAAGGYG  RI +  V+  PFP P  D  IL  DWY ++
Sbjct  131  LALHKAAGGYGGFRILSRSVIPVPFPPPAADYTILAGDWYKKN  173


 Score = 96.7 bits (239),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH + LVE EG++T+++ +D+LDIH+GQSYSV+V A  
Sbjct  210   GKTYRFRISNVGLTTSINFRIQGHKLLLVEVEGTHTLQNTYDSLDIHLGQSYSVLVTA--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+ AS RF+    +    + Y+   G    PL   P
Sbjct  268   DQPAQDYYIVASTRFTSQVLATTAVLHYSNSAGTVSGPLPGGP  310


 Score = 28.9 bits (63),  Expect(4) = 1e-131, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +     GK+
Sbjct  177  LKAILDSGSDLPFPDGLLINGRGANGYTFTVDQGKT  212



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   215 bits (548),  Expect(4) = 2e-131, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN+T+T +L     +V GK RY IN VSFV  DTPLKLA
Sbjct  327   RTNLTASGPRPNPQGSYHYGLINLTKTYILASAAGQVNGKQRYGINSVSFVPADTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G++ + P      L      SV+  +   F +IVF N    VQ++HLDG
Sbjct  387   DYFKISGVFRVGSVSDRPTGGNLYL----DTSVLGADYRTFVEIVFQNDEDIVQSYHLDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y FFVVGM  G W+      YNL+DAV RST QVYP+SWTA+Y+++DN GMWNLR+    
Sbjct  443   YQFFVVGMDGGKWTTASRNGYNLRDAVARSTTQVYPFSWTAIYLSLDNVGMWNLRTEFWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       S  S RDE PIP N   CG+A+
Sbjct  503   RQYLGQQLYLRVY-----TSSTSIRDEYPIPRNARLCGRAS  538


 Score =   188 bits (478),  Expect(4) = 2e-131, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 117/165 (71%), Gaps = 2/165 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            L+C  +  SL   V++E+  RF+ W V++     LGV ++ I+IN QFPGP +N  TND 
Sbjct  11   LLCLSLTASLLAVVTAEDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDN  70

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +N+ N+LDEPFL+SWNG+Q R +S+QDGV GT CPIPPG+N TY  Q+KDQIGS++YF
Sbjct  71   LIINVFNSLDEPFLLSWNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQIGSFYYF  130

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  131  PSLAFHKAAGGFGGIRILSRPRIPVPFPDPSGDYTVLIGDWYKSN  175


 Score = 94.0 bits (232),  Expect(4) = 2e-131, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  212   GKTYRLRISNVGLQHSLNFRIQDHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              + G  YY+  S RFS    +  G + Y+   G    P+   P
Sbjct  270   DQPGHDYYIVVSSRFSTPILTTTGILHYSGAGGQVSGPIPGGP  312


 Score = 44.7 bits (104),  Expect(4) = 2e-131, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP Q SL F+ GK+
Sbjct  178  TLKAHLDRGKKLPFPDGILINGRGPNQFSLTFEQGKT  214



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   226 bits (577),  Expect(4) = 4e-131, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RYAIN VS+V PDTPLKLA
Sbjct  322   RTNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAINSVSYVAPDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+  G+I + P      L      SV+Q +   F +IVF N  + VQ++HLDG
Sbjct  382   DYFKISGVFRPGSISDRPTGGGIYL----DTSVLQADYRTFVEIVFQNNEKIVQSYHLDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R T QVYP+SWTA+Y+A+DN GMWNLRS    
Sbjct  438   YSFFVVGMDGGQWTPASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNVGMWNLRSEFWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE P+P N I CG+A+
Sbjct  498   RQYLGQQLYLRVY-----TASTSIRDEFPVPKNAILCGRAS  533


 Score =   182 bits (462),  Expect(4) = 4e-131, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = +1

Query  58   SLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            + + +SLF    +E+  RF++W V++     LGV +  I+IN QFPGP ++  TND L +
Sbjct  9    ATVAISLFHIAGAEDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   NVFNSLDEPFLLSWNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
              HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  129  AFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  170


 Score = 91.7 bits (226),  Expect(4) = 4e-131, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  207   GKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RFS    +  G +RY+
Sbjct  265   DQPAQDYYIVFSSRFSYKVLTTTGVLRYS  293


 Score = 41.2 bits (95),  Expect(4) = 4e-131, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP   SL+ + GK+
Sbjct  173  TLKARLDRGKKLPFPDGILINGRGPNGVSLNVEQGKT  209



>ref|NP_173603.1| SKU5 similar 8 protein [Arabidopsis thaliana]
 gb|AAF16544.1|AC013482_18 T26F17.6 [Arabidopsis thaliana]
 gb|ABE65639.1| multi-copper oxidase type I family protein [Arabidopsis thaliana]
 gb|AEE30162.1| SKU5 similar 8 protein [Arabidopsis thaliana]
Length=551

 Score =   226 bits (575),  Expect(4) = 6e-131, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             + ++A    RPNPQG++HYG+I VTRTI L      + GK RYA+N  SF   DTPLKLA
Sbjct  323   KTNLAASGPRPNPQGTYHYGKIKVTRTIKLASSAGNINGKQRYAVNSASFYPTDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I+GVY  G+IP+ P  T+  +   P  SV+QT+   F +IVF N    VQTWHLDG
Sbjct  383   DYFKIAGVYNPGSIPDQP--THGAIY--PVTSVMQTDYKAFVEIVFENWEDIVQTWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WSA   + YNL DAV R TVQVYP SWTA+YV++DN GMWNLRS   +
Sbjct  439   YSFFVVGMELGKWSAASRKVYNLNDAVSRCTVQVYPRSWTAIYVSLDNVGMWNLRSELWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE  IP N + CG+A 
Sbjct  499   RQYLGQQFYMRVYTPS-----TSLRDEYLIPKNALLCGRAT  534


 Score =   179 bits (455),  Expect(4) = 6e-131, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            +K+VN T    ++  L  L  FV      +F++W V++   S L V ++ I+IN +FPGP
Sbjct  3    VKSVNTTA---MILGLFFLISFVAAEDPYKFFEWHVTYGNISPLKVAQQGILINGKFPGP  59

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             +   TND L +N+ N+LDEPFL+SW+G++   +S+QDGV GT CPIPPGKN+TY+ Q+K
Sbjct  60   DIAAVTNDNLIINVFNHLDEPFLISWSGIRNWRNSYQDGVYGTTCPIPPGKNYTYALQVK  119

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            DQIGS++YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  120  DQIGSFYYFPSLGFHKAAGGFGAIRISSRPRIPVPFPAPAGDYTVLIGDWYKTN  173


 Score = 95.1 bits (235),  Expect(4) = 6e-131, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTIQTPFSSLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
              +    YY+  S RF+       G + Y+   G    P+ ++P++ 
Sbjct  267   DQPAKDYYIVVSSRFTSKILITAGVLHYSNSAGPVSGPIPEAPIQL  312


 Score = 40.8 bits (94),  Expect(4) = 6e-131, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L FP GILING G   A+L+ +PGK+
Sbjct  175  KDLRAQLDNGGKLPFPDGILINGRG-SGATLNIEPGKT  211



>ref|XP_006425823.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
 ref|XP_006466654.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR39063.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
Length=539

 Score =   227 bits (578),  Expect(4) = 9e-131, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 151/220 (69%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+IN TRTIVL      + GK RYA+NG+S+V  DTPLKLA
Sbjct  324   RWNLTANAARPNPQGSFHYGKINTTRTIVLANSAPLINGKLRYAVNGISYVNSDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G++ + +I  +P        +    SV+Q NLH++ ++VF N  +++Q+WHLDG
Sbjct  384   DYFNIPGIFSVNSIQSVPSGG----ASSVATSVMQVNLHEYIEVVFQNNEKTMQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+A   R+YNL D + R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  440   YDFWVVGYGSGQWAAEKRRTYNLADTLTRHTAQVYPQSWTAILVSLDNQGMWNMRSAIWE  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV          S  +E  IP+N++ CGKA
Sbjct  500   RQYLGQQFYLKVWNAVH-----SLANEYDIPSNILVCGKA  534


 Score =   185 bits (469),  Expect(4) = 9e-131, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RFY WTV+  T S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+PFL++WNG+
Sbjct  30   RFYTWTVTSGTLSPLGVPQEVILINGQFPGPRLDVVTNDNIILNVINKLDQPFLLTWNGI  89

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCPIPP  N+TY FQ KDQIGSYFYFPS  +H+AAGGYG I IY  
Sbjct  90   KQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSYFYFPSTLMHRAAGGYGGINIYQR  149

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            P +  P+P  D D  +LI DW+  + +++
Sbjct  150  PRIPIPYPIQDGDFTLLIGDWFKTNHKIL  178


 Score = 94.0 bits (232),  Expect(4) = 9e-131, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS NFRIQGH M LVE EGS+T+++ +D+LD+HVGQS SV+V    
Sbjct  209   GKTYMFRISNVGLSTSFNFRIQGHTMKLVEVEGSHTIQNIYDSLDVHVGQSVSVLVTF--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y         PL   P
Sbjct  267   NQPPKDYYIVASTRFTKNVLTATAVLHYTNSHSPASGPLPTGP  309


 Score = 34.3 bits (77),  Expect(4) = 9e-131, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            K+LR++LD    L FP G+LING G
Sbjct  176  KILRQTLDSGKSLPFPDGVLINGQG  200



>ref|XP_010063104.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW70294.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=540

 Score =   220 bits (560),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  TRTI L     +V GK RYA+N VSF+  DTPLKLA
Sbjct  322   RTNLTASGPRPNPQGSYHYGLITPTRTIRLSSSAGQVNGKQRYAVNSVSFIPADTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I + P      L      +V+  +   F +IVF N    VQ+WHLDG
Sbjct  382   DYFNIGGVFRVNSISDRPTGGGIYL----DTAVLGVDYRAFVEIVFENNENIVQSWHLDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV+RST QVYPYSWTA+YVA+DN GMWNLR+    
Sbjct  438   YSFFVVGMDGGQWTTASRNQYNLRDAVFRSTTQVYPYSWTAIYVALDNVGMWNLRTEFWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             + YLGQ+LY++V       +  S RDE PIP N + CG+A
Sbjct  498   RHYLGQQLYLRVY-----TTSTSLRDEFPIPKNALLCGRA  532


 Score =   184 bits (468),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 118/165 (72%), Gaps = 3/165 (2%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            +C+ + ++LF  +   E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND 
Sbjct  6    ICASLAVALFFAIVGAENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  65

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +N+ N+LD PFL+SW+G+Q R +S++DGV GT CPIPPG+N+TY FQ+KDQIGS+FYF
Sbjct  66   LIINVFNSLDVPFLISWSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYF  125

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PSL  HKAAGG+G IRI + P++  PF  P  D  +LI DWY  +
Sbjct  126  PSLKFHKAAGGFGGIRILSRPLIPVPFAEPAGDYTVLIGDWYKAN  170


 Score = 93.2 bits (230),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+  SLNFRIQGH M LVE EG++ ++  F +LD+HVGQSYSV+V A  
Sbjct  207   GKTYRLRISNVGLMNSLNFRIQGHKMLLVEVEGTHVMQTHFSSLDVHVGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RFS    +  G +RY+
Sbjct  265   DQPAQDYYIVVSTRFSSQILTTTGILRYS  293


 Score = 42.4 bits (98),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L  +LDR   LK+P GILING GP   S D Q GK+
Sbjct  173  TLIATLDRGKKLKYPDGILINGRGPNGISFDVQQGKT  209



>gb|KHF99506.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   225 bits (574),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLINTTRTIRLANSAGQVNGKQRYAVNSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I G++ +G+I + P+     L      SV+Q +   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIGGIFRVGSISDNPYGGKIYL----DTSVMQADYRAFIEIVFQNNENIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+    R YNL+DAV R T QVYP SWTA+YVA+DN GMWNLRS    
Sbjct  439   YSFFVVGMDGGQWTTASRRGYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVY-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   187 bits (475),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 120/169 (71%), Gaps = 4/169 (2%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            +A+ L+C+     LF    SE+  RF+DW V+F     LGV +  I+IN QFPGP ++  
Sbjct  5    LAVVLLCA--TAGLFAIAGSEDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSV  62

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TND L +N+HN+L+EPFL+SW+G+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS
Sbjct  63   TNDNLIINVHNSLNEPFLISWSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            +FYFPSL  HKAAGG+G IRI + P +  PFP P  D  +L+ DWY  +
Sbjct  123  FFYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLVGDWYKSN  171


 Score = 86.7 bits (213),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H +TLVE EG++T++  + ++D+H+GQS SV+ KA  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIQNHRLTLVEVEGTHTLQTTYSSIDLHLGQSCSVLFKA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY++ S RF+    +    +RY+
Sbjct  266   DQPAKDYYIAVSTRFTSRVLTSTAILRYS  294


 Score = 40.4 bits (93),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L FP GILING GP  AS + + GK+
Sbjct  175  LKARLDRGKKLPFPDGILINGRGPGGASFNVEQGKT  210



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   230 bits (586),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 148/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG +N TRTI L+   + + GK RYA+N VSF   DTPLKLA
Sbjct  325   RRNLSASGPRPNPQGSYHYGLVNTTRTIRLQNSASMINGKQRYAVNSVSFTPADTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ LG+IP+ P      L      SV+  +   + ++VF NP  ++Q+WH+DG
Sbjct  385   DHFNIPGVFSLGSIPDNPTGGGAYLQ----TSVMAADFRGYAEVVFDNPEDTLQSWHIDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G WS     SYNL+D + R TVQVYP SWTAVY+ +DN GMWN+RS N  
Sbjct  441   HNFFVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMWNVRSENWA  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
              +YLGQ+ Y++V  P +     S RDE PIP+N + CG+AA
Sbjct  501   HQYLGQQFYLRVYSPAN-----SWRDEYPIPSNALLCGRAA  536


 Score =   188 bits (478),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            ++ + L  C++ E+  RFY W +S+     LGV+++ I+IN QFPGP +   TND L +N
Sbjct  13   VVAVLLVTCINGEDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPGKN+TY  Q+KDQIGSYFYFPSL 
Sbjct  73   VFNSLDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLG  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            +HKAAGGYG  +I +  V+  PFP P  D  +L  DW+
Sbjct  133  MHKAAGGYGGFKIASRSVIPVPFPPPAGDFTVLAGDWF  170


 Score = 92.8 bits (229),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++T+++ +D+LDIH+GQSYSV+V A  
Sbjct  210   GKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHTLQNTYDSLDIHLGQSYSVLVTA--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +    + Y+   G+   P    P
Sbjct  268   DQPAQDYYIVVSTRFTSQVFTTTSILHYSNSAGSVSGPPPGGP  310


 Score = 28.5 bits (62),  Expect(4) = 1e-130, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +     GK+
Sbjct  177  LKAILDGGSDLPFPDGLLINGRGSNGYTFSVDQGKT  212



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   223 bits (568),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 147/224 (66%), Gaps = 15/224 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN++RTI L    A+V  K RYA+N VSF   DTPLKLA
Sbjct  331   RTNLTASGPRPNPQGSYHYGLINISRTITLVSSTAQVNKKQRYAVNSVSFTPADTPLKLA  390

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARP---GVSVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             D+FNI G++++G+IP+ P         RP     SV+  +   F ++VF N    +Q+WH
Sbjct  391   DYFNIGGIFQVGSIPDSPS-------GRPMYLDTSVMGADFRAFVEVVFQNHENIIQSWH  443

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             +DGY+F+VVGM  G+W+      YNL+DAV RST QVYP SWTA+Y+A+DN GMWN+RS 
Sbjct  444   IDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNMRSE  503

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
                ++YLGQ+ Y++V  P       S RDE PIP N + CGKAA
Sbjct  504   FWARQYLGQQFYLRVYLPVG-----SIRDEYPIPKNALLCGKAA  542


 Score =   200 bits (509),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            L L CS+++L     V++E+  RF+DWT+++     LGV+++VI+IN QFPGP +   TN
Sbjct  14   LSLFCSILLLLELAFVAAEDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVTN  73

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N+HNNL EPFL+SWNGVQ R +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS+F
Sbjct  74   DNLIINVHNNLTEPFLLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFF  133

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            YFPSL  HKAAGG+G I+I + P +  PFP P  D  +LI DWY
Sbjct  134  YFPSLAFHKAAGGFGAIKILSRPRIPVPFPDPAGDFSLLIGDWY  177


 Score = 89.7 bits (221),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ +LNFRIQGH+M LVE EG++T++  + +LD+HVGQSYSV++   +
Sbjct  216   GKTYRLRISNVGLQNTLNFRIQGHDMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLITVDQ  275

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +    + Y+  + +   P+   P
Sbjct  276   APK--DYYIVVSTRFTNKIFTSTAILHYSNSQQSVSGPIPSGP  316


 Score = 26.2 bits (56),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 19/38 (50%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LD    L FP  +LING  P   +   + GK+
Sbjct  182  KKLQSVLDFGHRLPFPQAVLINGR-PSGTTFTVEQGKT  218



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   227 bits (579),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RYAIN VS+V PDTPLKLA
Sbjct  329   RTNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAINSVSYVVPDTPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+  G+I + P      L      SV+Q +  +F +IVF N    VQ++HLDG
Sbjct  389   DYFKISGVFRPGSISDRPTGGGIYL----DTSVLQADYRNFVEIVFQNNENIVQSYHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R T QVYP+SWTA+Y+A+DN GMWNLRS    
Sbjct  445   YSFFVVGMDGGQWTTASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNVGMWNLRSEFWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE P+P N I CG+A+
Sbjct  505   RQYLGQQLYLRVY-----TTSTSIRDEFPVPKNAILCGRAS  540


 Score =   180 bits (457),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
             TV   L+C  + +SLF    +E+  RF++W +++     LGV +  I+IN QFPGP ++
Sbjct  9    ATVGSLLLC--VAISLFHIAGAEDPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIH  66

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIP GKN+TY  Q+KDQI
Sbjct  67   SVTNDNLIINVFNSLDEPFLLSWNGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQI  126

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            G+++YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  127  GTFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  177


 Score = 91.7 bits (226),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  214   GKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTMYSSLDVHVGQSYSVLVTA--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RFS    +  G +RY+
Sbjct  272   DQPAQDYYIVVSTRFSYKVLTTTGVLRYS  300


 Score = 39.7 bits (91),  Expect(4) = 2e-130, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP   S + + GK+
Sbjct  180  TLKARLDRGKKLPFPDGILINGRGPNGVSFNVEQGKT  216



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   229 bits (585),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 148/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN +RTIVL     +V+GK RYA+N VS+V PDTPLKLA
Sbjct  330   RTNLTASGPRPNPQGSYHYGLINTSRTIVLASSAGQVHGKQRYAMNSVSYVAPDTPLKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+  G+I + P      L      SV+QT+   F +IVF N    VQ++HLDG
Sbjct  390   DYFKISGVFRPGSISDRPSGGGIYL----DTSVLQTDYRTFVEIVFQNNENIVQSYHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G+W+A     YNL DAV R T QVYP SWTA+YVA+DN GMWNLRS    
Sbjct  446   YSFFVVGMDGGLWTAASRNQYNLHDAVSRCTTQVYPMSWTAIYVALDNVGMWNLRSEFWA  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE P+P N I CG+A+
Sbjct  506   RQYLGQQLYMRVY-----TTSTSIRDEFPVPKNAILCGRAS  541


 Score =   176 bits (447),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF++W V++     LGV ++ I+IN QFPGP ++  TND L +N+ N+LDEPFL+SWNG+
Sbjct  34   RFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSWNGI  93

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +S++DGV GT CPI PGKN+TY  Q+KDQIGS++YFPSL  HKA GG+G IRI + 
Sbjct  94   QQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGSFYYFPSLAFHKAGGGFGGIRILSR  153

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
            P +  PFP PD D  +LI DWY  +
Sbjct  154  PRIPVPFPDPDGDYTVLIGDWYKSN  178


 Score = 92.4 bits (228),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++TV+  + +LD+HVGQSYSV+V A  
Sbjct  215   GKTYRLRISNVGLEHSLNFRIQNHKMKLVEVEGTHTVQTTYSSLDVHVGQSYSVLVTA--  272

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RFS    +  G +RY+
Sbjct  273   DQPARDYYIVVSTRFSYKVLTTSGVLRYS  301


 Score = 40.0 bits (92),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             LR  LD    L FP GILING GP  AS + + GK+
Sbjct  181  TLRAHLDNGKKLPFPDGILINGRGPNGASFNVEQGKT  217



>emb|CDP02462.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   235 bits (600),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 154/225 (68%), Gaps = 19/225 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I+VT+  VL      + GK R+A+NGVS+V PDTPLKLA
Sbjct  325   RWNLTANAARPNPQGSFHYGKISVTKRFVLANSAPLINGKQRFAVNGVSYVNPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMP-----HFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQT  1531
             DHFNI GV+ L +I   P     H+         GVSV+ T+LHDF +IVF N  RS+Q+
Sbjct  385   DHFNIPGVFGLNSIESSPSGVSPHY---------GVSVLSTSLHDFMEIVFQNNERSLQS  435

Query  1532  WHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLR  1711
             WHLDGY+F+VVG G G W+     +YNL+DA+ R T QVYP SWTA+ V++DN+GMWNLR
Sbjct  436   WHLDGYDFWVVGYGAGQWTQASRATYNLEDALTRHTAQVYPNSWTAILVSLDNQGMWNLR  495

Query  1712  SGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             S   +++YLGQ++Y++V  P       S  +E  IP NV+ CGKA
Sbjct  496   SAIWEKQYLGQQVYLRVYTPTP-----SLANEYDIPTNVLLCGKA  535


 Score =   181 bits (458),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (67%), Gaps = 3/174 (2%)
 Frame = +1

Query  37   VALPLVCSLIVL---SLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
            V L LVC+++        V      R+Y WTV++ T S LG  ++VI+IN QFPGP L+ 
Sbjct  5    VMLYLVCAILAFWSSGSLVTAEDAYRYYTWTVTYGTASPLGFSQQVILINGQFPGPKLDL  64

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCP+PP  N+TY FQ KDQIG
Sbjct  65   VTNDNVILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPVPPNSNYTYKFQAKDQIG  124

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SY YFPS  LHK AG +G + I+   V+  P+P P  D  +LI DWY  + +V+
Sbjct  125  SYTYFPSTLLHKTAGAFGALNIWQRSVISIPYPKPVGDFTLLIGDWYKYNHKVL  178


 Score = 92.8 bits (229),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG KTSLNFRIQ H + LVE EGS+ +++ +D+LD+HVGQS +V+V   +
Sbjct  209   GKTYMFRISNVGFKTSLNFRIQNHKLKLVEVEGSHVIQNTYDSLDVHVGQSATVLVTFDQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+    +    + Y   R     PL   P
Sbjct  269   PPK--DYYIVASTRFTEKVLTATAVLHYTNSRTAVSGPLPAGP  309


 Score = 29.6 bits (65),  Expect(4) = 3e-130, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            KVL++ LD    L FP G+LING      S D
Sbjct  176  KVLQQRLDAGKNLPFPDGVLINGQAHPSFSGD  207



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   228 bits (581),  Expect(4) = 4e-130, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RYAIN VS+V PDTPLKLA
Sbjct  330   RTNLTASGPRPNPQGSYHYGLINTTKTIILSSSPGQVNGKQRYAINSVSYVAPDTPLKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I + P      L      SV+Q +   F +IVF N    +Q++HLDG
Sbjct  390   DYFKISGVFRVGSISDRPTGGGIYL----DTSVLQADYRSFVEIVFQNNENIIQSYHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R T QVYPYSWTA+YVA+DN GMWNLRS    
Sbjct  446   YSFFVVGMDGGQWTTASRNQYNLRDAVARCTTQVYPYSWTAIYVALDNVGMWNLRSEFWA  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CGKA+
Sbjct  506   RQYLGQQFYLRVY-----TTSTSIRDEFPIPKNALLCGKAS  541


 Score =   183 bits (465),  Expect(4) = 4e-130, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  70   LSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHN  243
            +SLF    +E+  RF++W V++     LGV ++ I+IN QFPGP ++  TND L +N+ N
Sbjct  21   ISLFHITEAEDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFN  80

Query  244  NLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHK  423
            +LDEPFL+SWNG+Q R +S++DGV GT CPIPPG+N+TY  Q+KDQIGS++YFPSL  HK
Sbjct  81   SLDEPFLISWNGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLSFHK  140

Query  424  AAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            AAGG+G IRI + P +  PFP PD D  +LI DWY  +
Sbjct  141  AAGGFGGIRILSRPRIPVPFPDPDGDYTVLIGDWYKSN  178


 Score = 89.7 bits (221),  Expect(4) = 4e-130, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H + LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  215   GKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  272

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
              +    YY+  S RFS    +  G +RY
Sbjct  273   DQPSQDYYIVVSTRFSSKILTTTGVLRY  300


 Score = 37.0 bits (84),  Expect(4) = 4e-130, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LD+   L  P GILING GP + S + + GK+
Sbjct  181  TLKAHLDKGKKLPIPDGILINGRGPNEISFNVEQGKT  217



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   227 bits (579),  Expect(4) = 5e-130, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (69%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYAIN VSF+  DTPLKLA
Sbjct  327   RRNLTASGPRPNPQGSYHYGLINTTRTIRLANSAPIINGKQRYAINSVSFIPADTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ LG+IP+ P  +   L      SV+  +   +T++VF N   SVQ++H+DG
Sbjct  387   DHFNIPGVFTLGSIPDSPTGSGAYLQT----SVMSADFRAYTEVVFENLEDSVQSYHIDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGMG G W+     +YNL+D + RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  443   HHFFVVGMGRGEWTPASRLTYNLRDTISRSTVQVYPKSWTALYMPLDNVGMWNIRSQNWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE+P+P+NV+ CG+A
Sbjct  503   RQYLGQQFYLRVYSPVN-----SWRDESPVPSNVLHCGRA  537


 Score =   183 bits (464),  Expect(4) = 5e-130, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            LPL+  +++      +  E+  RFY W V++     LGV+++ I+IN QFPGP +   TN
Sbjct  9    LPLMAMVMMFLHVNFIHGEDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTN  68

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N+ NNLDEPFL+SWNGV+ R +SWQDGV GTNCPIPPGKN+TY  Q+KDQIGS++
Sbjct  69   DNLIINVFNNLDEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFY  128

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YFPSL  HKAAGG+G I I +  V+  PFP P  +  IL  DW+ ++
Sbjct  129  YFPSLAFHKAAGGFGSINIASRSVIPVPFPSPAGEFSILTGDWFKQN  175


 Score = 96.7 bits (239),  Expect(4) = 5e-130, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH MT+VE EG++TV++ +D+LDIH+GQSYSV++ A  
Sbjct  212   GKTYRFRISNVGLTTSVNFRIQGHKMTVVEVEGTHTVQNAYDSLDIHLGQSYSVLLTA--  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +    +RY+   G+   P    P
Sbjct  270   DQPAQDYYIVVSTRFTSQVLTATSTLRYSNSAGSVSGPPPGGP  312


 Score = 30.4 bits (67),  Expect(4) = 5e-130, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LINGHG    +     GK+
Sbjct  179  LKAILDGGHDLPFPDGLLINGHGSNGYTFTVDQGKT  214



>ref|XP_010266952.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=546

 Score =   216 bits (550),  Expect(4) = 7e-130, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYA+N VSF+  DTPLK+A
Sbjct  328   RTNLTASGPRPNPQGSYHYGLINTTRTIKLVNSAGLINGKQRYAVNSVSFIPADTPLKIA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV+ LG+I + P      L      +V+  +   F +IVF N    +Q+WHLDG
Sbjct  388   DFFKIGGVFRLGSISDNPTGGGMYL----DTAVMPADFRAFIEIVFENHEDIIQSWHLDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G+W+      YNL+DA+ R T QVYP SWTA+YVA+DN GMWNLRS    
Sbjct  444   YSFFVVGMDGGLWTPASRLQYNLRDAIARCTTQVYPKSWTAIYVALDNVGMWNLRSEFWA  503

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A+
Sbjct  504   RQYLGQQFYLRVYSPVE-----SIRDEYPIPRNALVCGRAS  539


 Score =   188 bits (477),  Expect(4) = 7e-130, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            +P V S I++ L   V +E+  RF+ W V++     LGV ++ I+IN QFPGP +   TN
Sbjct  10   VPAVLSAILVFLLAFVRAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTN  69

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N++N+L EPFL+SWNGV  R +SWQDGV GTNCPIPPGKN+TY  Q+KDQIGS+F
Sbjct  70   DNLIINVYNSLPEPFLISWNGVLQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFF  129

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  130  YFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDFTVLIGDWYKAN  176


 Score = 94.0 bits (232),  Expect(4) = 7e-130, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQGH M LVE EG++TV+  F +LD+HVGQSYSV+V A  
Sbjct  213   GKTYRFRISNVGLQNSLNFRIQGHRMKLVEVEGTHTVQTTFSSLDVHVGQSYSVLVTA--  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+ +  +  G + Y+
Sbjct  271   DQPAQDYYIVVSTRFTSVVLTTTGVLHYS  299


 Score = 39.3 bits (90),  Expect(4) = 7e-130, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+ +LDR   L FP GILING GP  A    + GK+
Sbjct  179  TLKATLDRGKKLHFPDGILINGRGPNGAYFTVEQGKT  215



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   218 bits (554),  Expect(4) = 1e-129, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T TI L+     + GK RYA+N VSF+  DTPLKLA
Sbjct  323   RRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTAPTINGKQRYAVNSVSFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+IP+ P      L      SV+  +   F ++VF NP  ++Q+WH+DG
Sbjct  383   DYFKIPGVFSVGSIPDNPTGGGAYLQ----TSVMAADFRGFAEVVFENPEDTLQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFF VGM  G W+     +YNL+D + R TVQVYP SWTAVYV +DN GMWN+RS N  
Sbjct  439   HNFFAVGMDGGEWTPASRLTYNLRDTISRCTVQVYPKSWTAVYVPLDNVGMWNIRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V       S  S RDE PIP+N + CG+A
Sbjct  499   RQYLGQQFYLRVYS-----SANSWRDEYPIPSNALLCGRA  533


 Score =   191 bits (486),  Expect(4) = 1e-129, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            + C L+V  L  C   E   RF++W V++     LGV+++ I+IN QFPGP +   TND 
Sbjct  7    ICCLLLVFMLVSCTRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +++ N LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPGKN+TY  Q+KDQIGSYFYF
Sbjct  67   LIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PSL  HKAAGGYG I+I + P++  PF  P  D  IL  DWY ++
Sbjct  127  PSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKN  171


 Score = 99.0 bits (245),  Expect(4) = 1e-129, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH M LVE EG++T+++ +D+LDIH+GQSYSV+V+A +
Sbjct  208   GKTYRFRISNVGISTSINFRIQGHKMLLVEVEGTHTLQNTYDSLDIHLGQSYSVLVRADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                G  YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  268   PPQG--YYIVISTRFTSQVLSATSVLHYSNSAGSVSGPPPGGPTTQ  311


 Score = 28.1 bits (61),  Expect(4) = 1e-129, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G++ING G    +     GK+
Sbjct  175  LKAILDSGSDLPFPDGLVINGRGSNANTFTVDQGKT  210



>ref|XP_010555198.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   220 bits (560),  Expect(4) = 2e-129, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 151/222 (68%), Gaps = 5/222 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYGR+N++RTIVLE    ++ GK RYAINGVSFV  DTP+KLA
Sbjct  330   RTNLTASGPRPNPQGSYHYGRVNISRTIVLESTAGQLNGKQRYAINGVSFVEADTPIKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G IP+ P      +  R   +V+  +   F +IVF N  + +Q++HLDG
Sbjct  390   DYFKI-GVFRVGNIPDTPRGGRGAM--RQETAVMGADHRAFVEIVFQNREKIIQSYHLDG  446

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL DAV R T+QVYP SWTA+YVA+DN GMWNLRS +  
Sbjct  447   YSFWVVGMDRGRWTPERRGEYNLWDAVSRCTIQVYPKSWTAMYVALDNVGMWNLRSQSWG  506

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQ+ Y++V  P  +  ++  R+E P+P N + CG+A +
Sbjct  507   RRYLGQQFYVRVHSPVRNEYRL--RNEYPLPPNALLCGRADK  546


 Score =   201 bits (512),  Expect(4) = 2e-129, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +1

Query  37   VALPLVCSLIVLSL--FVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
            V L +  +++V+S+   V V +E+  RF+DWTVS+     LG  ++ I+IN QFPGP + 
Sbjct  6    VGLVMAMAVVVMSMGRVVVVDAEDPYRFFDWTVSYGLIYPLGFPQRGILINGQFPGPNIY  65

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N+HN+LDEPFL+SWNGVQ+R +S+QDGV GT CPIPPGKN+TY FQ+KDQI
Sbjct  66   SVTNDNLIINVHNDLDEPFLLSWNGVQMRKNSYQDGVYGTTCPIPPGKNFTYVFQVKDQI  125

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            GS+FYFPSL LHKAAGG+G +RI + P++  PFP P  DL +LI DW+  D + +
Sbjct  126  GSFFYFPSLGLHKAAGGFGGLRILSRPLIPVPFPDPSGDLTLLIGDWFKRDHKTL  180


 Score = 90.1 bits (222),  Expect(4) = 2e-129, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = +3

Query  795   CLVLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSY  974
             CL++ +  GKTY LRISNVG++ SLN RIQGH + LVE EG++T++  + +LD+HVGQSY
Sbjct  208   CLMVER--GKTYRLRISNVGLQHSLNLRIQGHKLKLVEVEGTHTIQSTYSSLDVHVGQSY  265

Query  975   SVMVKALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
             SV+V  ++  +   Y++  S RFS    +    +RY+  R
Sbjct  266   SVLV-TMDQPDHLDYHIVVSTRFSTKPLTVTATLRYSNSR  304


 Score = 24.3 bits (51),  Expect(4) = 2e-129, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            K L+  +DR   L  P  +LING G
Sbjct  178  KTLKGIVDRGHKLPLPDALLINGKG  202



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   223 bits (569),  Expect(4) = 3e-129, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L+     + GK RYA+N VSF+  DTPLKLA
Sbjct  323   RKNLTASGPRPNPQGSYHYGLINTTRTIRLQNSAPIINGKQRYAVNSVSFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ LG+IP+ P      L      SV+  +   + +I+F N   +VQ+WH+DG
Sbjct  383   DHFNIPGVFSLGSIPDNPTGGGAYLQT----SVMAADFRGYAEIIFENTEDTVQSWHVDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +  FVVGM  G WS     SYNL+D + R+TVQVYP SWTAVY+ +DN GMWN+RS N  
Sbjct  439   HILFVVGMDGGQWSPASRLSYNLRDTISRNTVQVYPKSWTAVYMPLDNVGMWNIRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
              +YLGQ+ Y++V  P +     S RDE PIP N I CG+AA
Sbjct  499   HQYLGQQFYLRVYSPAN-----SWRDEYPIPTNTILCGRAA  534


 Score =   192 bits (488),  Expect(4) = 3e-129, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +1

Query  52   VCS-LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            VCS +++L L  CVS E+  RFY W V++     LGV+++ I+IN QFPGP +   TN+ 
Sbjct  7    VCSFMVILLLLTCVSGEDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNEN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +NI N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSYFYF
Sbjct  67   LIINIFNSLDEPFLLSWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGSYFYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PSL +HKAAGG G  +I +  V+  PFP P  D  +L  DW+ ++
Sbjct  127  PSLGMHKAAGGIGGFKIASRSVIPVPFPPPAGDFTVLAGDWFKKN  171


 Score = 94.0 bits (232),  Expect(4) = 3e-129, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++T+++ +D+LDIH+GQSYSV+V A  
Sbjct  208   GKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHTLQNTYDSLDIHLGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
              +    YY+  S RF+    +    + Y+   G+     PG P ++
Sbjct  266   DQPAQDYYIVVSTRFTSQVLTATSTLHYSNSAGSVSGPPPGGPTTQ  311


 Score = 25.8 bits (55),  Expect(4) = 3e-129, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING      +     GK+
Sbjct  175  LKAILDGGSDLPFPDGLLINGRASNGYTFTVDQGKT  210



>ref|NP_001053555.1| Os04g0561900 [Oryza sativa Japonica Group]
 emb|CAE01850.2| OSJNBa0084K11.18 [Oryza sativa Japonica Group]
 dbj|BAF15469.1| Os04g0561900 [Oryza sativa Japonica Group]
 dbj|BAG92144.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92535.1| unnamed protein product [Oryza sativa Japonica Group]
Length=554

 Score =   226 bits (577),  Expect(4) = 4e-129, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 149/229 (65%), Gaps = 11/229 (5%)
 Frame = +2

Query  1175  FNLD-----RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFV  1339
             F+LD     R ++     RPNPQGS+HYG INVTRTI L     RV GK RYA+NGVSFV
Sbjct  319   FSLDQARSIRTNLTASGPRPNPQGSYHYGSINVTRTIRLANSAGRVAGKQRYAVNGVSFV  378

Query  1340  YPDTPLKLADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLR  1519
               DTPLKLAD++ IS V+ LG IP+ P             +V+ ++   F +IVF N   
Sbjct  379   EADTPLKLADYYRISDVFRLGGIPDAPPAGAAAAPRS-EAAVMDSDYRSFLEIVFENSED  437

Query  1520  SVQTWHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGM  1699
             SVQ WHLDGY+ FVVGM  G+WS    +SYNL DAV R TVQVYP +WTAV VA+DN GM
Sbjct  438   SVQIWHLDGYSLFVVGMDRGVWSEQSRKSYNLVDAVSRCTVQVYPRAWTAVLVALDNVGM  497

Query  1700  WNLRSGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             WNLRS +  +RY GQ+ Y++V  P       S RDE PIP+N ++CG+A
Sbjct  498   WNLRSEDWARRYQGQQFYLRVYTPSH-----SFRDELPIPSNALRCGRA  541


 Score =   191 bits (486),  Expect(4) = 4e-129, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 120/176 (68%), Gaps = 9/176 (5%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEE-----RFYDWTVSFSTRSILGVEKKVIVIND  180
            M +     AL  VC    + +FV VSS       RF+DW V+    + LGV+++ I+IN 
Sbjct  1    MSSRRSMGALAAVC----VCMFVFVSSARAEDPYRFFDWEVTTGNINPLGVQQQGILING  56

Query  181  QFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTY  360
            QFPGP ++  TND L VN+HN L EPFL+SWNG+Q R +SWQDGV GTNCPIPPG+N+TY
Sbjct  57   QFPGPEIDCQTNDNLIVNVHNRLSEPFLLSWNGLQHRKNSWQDGVSGTNCPIPPGQNFTY  116

Query  361  SFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
              Q KDQIGS+FYFPSL  HKAAGG+G IRI + P++  PF  P  +  +LI DWY
Sbjct  117  QMQAKDQIGSFFYFPSLAFHKAAGGFGAIRIRSRPLIPVPFDPPAGEYTMLIGDWY  172


 Score = 80.5 bits (197),  Expect(4) = 4e-129, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LR+SNVG++++LN RIQ HNMTLVE EG++TV++ + +L +H GQS SV+  A  
Sbjct  212   GKTYRLRVSNVGLQSTLNLRIQDHNMTLVEVEGTHTVQNTYSSLYVHAGQSLSVLFTA--  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
             ++    Y ++ S RF+    +    +RY
Sbjct  270   NRPPGVYQITVSTRFAKRALNSSAVLRY  297


 Score = 36.2 bits (82),  Expect(4) = 4e-129, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LD    L  P GILING GP  AS   + GK+
Sbjct  177  KALQAMLDSGKQLPSPDGILINGKGPNGASFTVEQGKT  214



>emb|CAH67167.1| H0211B05.4 [Oryza sativa Indica Group]
Length=554

 Score =   226 bits (577),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 149/229 (65%), Gaps = 11/229 (5%)
 Frame = +2

Query  1175  FNLD-----RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFV  1339
             F+LD     R ++     RPNPQGS+HYG INVTRTI L     RV GK RYA+NGVSFV
Sbjct  319   FSLDQARSIRTNLTASGPRPNPQGSYHYGSINVTRTIRLANSAGRVAGKQRYAVNGVSFV  378

Query  1340  YPDTPLKLADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLR  1519
               DTPLKLAD++ IS V+ LG IP+ P             +V+ ++   F +IVF N   
Sbjct  379   EADTPLKLADYYRISDVFRLGGIPDAPPAGAAAAPRS-EAAVMDSDYRSFLEIVFENSED  437

Query  1520  SVQTWHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGM  1699
             SVQ WHLDGY+ FVVGM  G+WS    +SYNL DAV R TVQVYP +WTAV VA+DN GM
Sbjct  438   SVQIWHLDGYSLFVVGMDRGVWSEQSRKSYNLVDAVSRCTVQVYPRAWTAVLVALDNVGM  497

Query  1700  WNLRSGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             WNLRS +  +RY GQ+ Y++V  P       S RDE PIP+N ++CG+A
Sbjct  498   WNLRSEDWARRYQGQQFYLRVYTPSH-----SFRDELPIPSNALRCGRA  541


 Score =   191 bits (486),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 120/176 (68%), Gaps = 9/176 (5%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEE-----RFYDWTVSFSTRSILGVEKKVIVIND  180
            M +     AL  VC    + +FV VSS       RF+DW V+    + LGV+++ I+IN 
Sbjct  1    MSSRRSMGALAAVC----VCMFVFVSSARAEDPYRFFDWEVTTGNINPLGVQQQGILING  56

Query  181  QFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTY  360
            QFPGP ++  TND L VN+HN L EPFL+SWNG+Q R +SWQDGV GTNCPIPPG+N+TY
Sbjct  57   QFPGPEIDCQTNDNLIVNVHNRLSEPFLLSWNGLQHRKNSWQDGVSGTNCPIPPGQNFTY  116

Query  361  SFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
              Q KDQIGS+FYFPSL  HKAAGG+G IRI + P++  PF  P  +  +LI DWY
Sbjct  117  QMQAKDQIGSFFYFPSLAFHKAAGGFGAIRIRSRPLIPVPFDPPAGEYTMLIGDWY  172


 Score = 80.5 bits (197),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LR+SNVG++++LN RIQ HNMTLVE EG++TV++ + +L +H GQS SV+  A  
Sbjct  212   GKTYRLRVSNVGLQSTLNLRIQDHNMTLVEVEGTHTVQNTYSSLYVHAGQSLSVLFTA--  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
             ++    Y ++ S RF+    +    +RY
Sbjct  270   NRPPGVYQITVSTRFAKRALNSSAVLRY  297


 Score = 36.2 bits (82),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LD    L  P GILING GP  AS   + GK+
Sbjct  177  KALQAMLDSGKQLPSPDGILINGKGPNGASFTVEQGKT  214



>ref|XP_009630901.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   222 bits (565),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG+INV+RTI L      V  K RYA+NGVSF+  DTPLKLA
Sbjct  329   RTNLTASGPRPNPQGSYHYGQINVSRTIRLANSAGLVDRKQRYAVNGVSFIPADTPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++NI GV+E+G+IP+ P  T R +      +V+  +   F +IVF N    +Q+WHLDG
Sbjct  389   DYYNIKGVFEVGSIPDQP--TGRQI--HLDTAVMGADYRSFVEIVFENRENIMQSWHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS    R YNL DAV R T QVYP SWTA+YV +DN GMWNLR+    
Sbjct  445   YSFFVVGMDEGRWSPASKRQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRTQFWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE PIP N + CG+A
Sbjct  505   RQYLGQQFYLRVYTPVQ-----SFRDEYPIPKNALHCGRA  539


 Score =   180 bits (456),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            V +L + ++   V +E+  R++DW +S+     LGV ++ I+IN QFPGP +   TND L
Sbjct  14   VVALYMQTVCRVVVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNL  73

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +NIHN+L EPFL++WNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS+FYFP
Sbjct  74   IINIHNDLPEPFLLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFP  133

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SL  HKAAGG+G IRI + P +  PF  P  D  ILI DWY  D + +
Sbjct  134  SLKFHKAAGGFGGIRILSRPRIPVPFLEPAGDFTILIGDWYKTDHKAL  181


 Score = 93.2 bits (230),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
              +GKTY LRISNVG++ SLNFRIQGH M LVE EG++T++    +LD+HVGQSYSV+V A
Sbjct  212   ESGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGTHTIQTTLSSLDVHVGQSYSVLVTA  271

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
                +    YY++ S RF+    +    + Y+  R
Sbjct  272   --DQPAQDYYIAVSSRFATQILNSTAILHYSNSR  303


 Score = 39.7 bits (91),  Expect(4) = 5e-129, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LDR  MLKFP+GI ING G + A    + GK+
Sbjct  179  KALQTVLDRGKMLKFPNGIQINGLGRDGAKFTVESGKT  216



>ref|XP_004987010.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=553

 Score =   224 bits (572),  Expect(4) = 7e-129, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 141/221 (64%), Gaps = 5/221 (2%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG INVTRTI L      V GK RYA+NGVSF   DTPLKLA
Sbjct  323   RTNMTASGPRPNPQGSYHYGSINVTRTIRLANSAGSVGGKLRYAVNGVSFAEADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++NISGV+ LG IP+ P         R   +V+ ++   F ++V  N    VQ+WHLDG
Sbjct  383   DYYNISGVFRLGGIPDAPPAGGATEEVRSETAVMDSDHRSFVEVVLENSEDGVQSWHLDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++ FVVGM  G W+     SYNL DAV R TVQVYP  WTAV +A+DN GMWN+RS    
Sbjct  443   HSVFVVGMDVGTWTEQSRDSYNLVDAVSRCTVQVYPRGWTAVLIALDNVGMWNMRSEVWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             +RYLGQ+ Y++V  P       S RDE PIP N + CG+AA
Sbjct  503   RRYLGQQFYLRVYTPTP-----SFRDELPIPENALLCGRAA  538


 Score =   194 bits (494),  Expect(4) = 7e-129, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 5/168 (3%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE-----RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            L++  +F+ ++S       RF+ W +++     LGV ++ I+IN QFPGP +   TN+ L
Sbjct  8    LLLACIFLLINSASAEAPYRFFGWNITYGEIRPLGVSQQGILINGQFPGPTIESQTNENL  67

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+HNNL +PFL+SWNG+Q R  SWQDGV GTNCPIPPG+N+TY  Q KDQIGS+FYFP
Sbjct  68   IINVHNNLPDPFLLSWNGLQQRKDSWQDGVSGTNCPIPPGQNFTYHLQAKDQIGSFFYFP  127

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SL  HKAAGG+G IRI++ P++  PFP PD +  +LI DWYT   + +
Sbjct  128  SLAFHKAAGGFGAIRIHSRPLIPVPFPSPDDEYTVLIGDWYTASHKAL  175


 Score = 86.3 bits (212),  Expect(4) = 7e-129, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ +LNF IQGHNMTLVE EG++TV++ + ++D+H GQS SV+  A  
Sbjct  209   GKTYRLRISNVGLQNTLNFLIQGHNMTLVEVEGTHTVQNSYTSVDVHAGQSLSVLFTA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    Y+++ S RF          +RY    G     L  +P
Sbjct  267   DRQARDYHIAISTRFINTTLRSTAVIRYAGSSGPAFEALPDAP  309


 Score = 28.9 bits (63),  Expect(4) = 7e-129, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILING-HGPEQASLDFQPGKS  742
            K L++ LD    L  P GILING   P+ A+   + GK+
Sbjct  173  KALQDLLDSGKELPSPDGILINGKRSPDGANFTVEQGKT  211



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   215 bits (547),  Expect(4) = 9e-129, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN+T+T VL+    +V GK RY +N VSFV  DTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGLINLTKTYVLQNSAGQVNGKQRYGVNSVSFVPADTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+  +   F +IVF N    +Q+WHLDG
Sbjct  386   DYFKIGGVFRVGSISDRPTGGGLYL----DTSVLGADYRAFVEIVFQNNEDIIQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+     +YNL+DAV R T QVYP SWTA+Y+ +DN GMWNLR+    
Sbjct  442   YSFFVVGMDGGQWTTASRNAYNLRDAVSRCTTQVYPKSWTAIYIPLDNVGMWNLRTEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  P       S RDE PIP N   CG+A+
Sbjct  502   RQYLGQQLYLRVYTPS-----TSIRDEYPIPRNARLCGRAS  537


 Score =   182 bits (462),  Expect(4) = 9e-129, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L + +LF    +E+  RF++W V++     LGV +K I+IN QFPGP ++  TND L +N
Sbjct  14   LCLAALFSIAVAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIIN  73

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  74   VFNSLDEPFLLSWNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLA  133

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  134  FHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKAN  174


 Score = 94.4 bits (233),  Expect(4) = 9e-129, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISN+G++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  211   GKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              + G  YY+ AS RF+    +  G V Y    G    P    P
Sbjct  269   DQPGQDYYLVASSRFTSPILTTTGTVHYANSAGKVSGPPPGGP  311


 Score = 42.4 bits (98),  Expect(4) = 9e-129, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP   SL+F+ GK+
Sbjct  177  TLKAHLDRGKKLPFPDGILINGRGPGGFSLNFEQGKT  213



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   222 bits (566),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN++RTI LE    +V GK RYA+N VSF+  DTPLKLA
Sbjct  327   RTNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNGKQRYAVNSVSFIPADTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+  +   F +IVF N    VQ+WH+DG
Sbjct  387   DYFKIGGVFRVGSIQDQPTGGNIYL----DTSVMGADFRGFIEIVFQNHENIVQSWHIDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNF+VVGM  G+W+      YNL+DAV R T QVYP SWTA+YVA+DN GMWN+RS    
Sbjct  443   YNFWVVGMNGGVWTPASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNVRSEFWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A
Sbjct  503   RQYLGQQFYLRVYSPVE-----SIRDEYPIPKNALLCGRA  537


 Score =   184 bits (467),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            +C +  L++F  V+  E   RF+ W V++     LGV ++ I+IN QFPGP +   TND 
Sbjct  11   LCVVYFLAMFAIVARAESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDN  70

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +N+HN+L EPFL+SWNGVQ R +S++DGV GT CPIPPGKN+TY  Q+KDQIGSYFYF
Sbjct  71   LIINVHNSLPEPFLISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYF  130

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PS+   KAAGG+G IRI + P++  PFP P  D  +LI DWY  +
Sbjct  131  PSVGFQKAAGGFGGIRILSRPLIPVPFPEPAGDFTVLIGDWYKAN  175


 Score = 90.1 bits (222),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQGH M LVE EG++T++  + +LD+HVGQSYSV+V   +
Sbjct  212   GKTYRFRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLVTMDQ  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
                   +Y++ S RF+    +  G + Y+    NP  P+S
Sbjct  272   PPQ--DFYIAVSTRFTNKVLTSAGTLHYS----NPARPVS  305


 Score = 36.2 bits (82),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILINGHG   AS   + GK+
Sbjct  179  LKAVLDRGHRLPSPDGILINGHGSNGASFTVEQGKT  214



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   216 bits (550),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN+T+T VL+    +V GK RY +N VSFV  DTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGLINLTKTYVLQNSAGQVNGKQRYGVNSVSFVPADTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+  +   F +IVF N    +Q+WHLDG
Sbjct  386   DYFKIGGVFRVGSISDRPTGGGLYL----DTSVLGADYRAFVEIVFQNNEDIIQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+     +YNL+DAV R T QVYP SWTA+Y+ +DN GMWNLR+    
Sbjct  442   YSFFVVGMDGGQWTTASRSAYNLRDAVSRCTTQVYPKSWTAIYIPLDNVGMWNLRTEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       S  S RDE PIP N + CG+A+
Sbjct  502   RQYLGQQLYLRVY-----TSSTSIRDEYPIPRNALLCGRAS  537


 Score =   182 bits (462),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L + +LF    +E+  RF++W V++     LGV +K I+IN QFPGP ++  TND L +N
Sbjct  14   LCLAALFSMAVAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIIN  73

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  74   VFNSLDEPFLLSWNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLA  133

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  134  FHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKAN  174


 Score = 94.4 bits (233),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISN+G++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  211   GKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              + G  YY+ AS RF+    +  G V Y    G    P    P
Sbjct  269   DQPGQDYYLVASSRFTSPILTTTGTVHYANSAGKVSGPPPGGP  311


 Score = 40.0 bits (92),  Expect(4) = 1e-128, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L  P GILING GP   SL+F+ GK+
Sbjct  177  TLKAHLDRGKKLPLPDGILINGRGPGGFSLNFEQGKT  213



>ref|XP_009758923.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=549

 Score =   219 bits (559),  Expect(4) = 2e-128, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG+INVTRTI L      V  K RYA+NGVSF+  DTPLKLA
Sbjct  332   RTNLTASGPRPNPQGSYHYGQINVTRTIRLANSAGLVDRKQRYAVNGVSFIPADTPLKLA  391

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++NI+GV+E+G+I + P   +  L      +V+  +   F +IVF N    +Q+WHLDG
Sbjct  392   DYYNITGVFEVGSIADQPTGRHIHL----DTAVMGADYRAFVEIVFENRENIMQSWHLDG  447

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS    + YNL DAV R T QVYP SWTA+Y+ +DN GMWNLR+    
Sbjct  448   YSFFVVGMDKGRWSPESKKQYNLIDAVSRCTTQVYPRSWTAIYIPLDNVGMWNLRTQFWA  507

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE PIP N + CGKA
Sbjct  508   RQYLGQQFYLRVYTPVQ-----SYRDEYPIPKNALHCGKA  542


 Score =   181 bits (459),  Expect(4) = 2e-128, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            V +L + ++   V +E+  R++DW +S+     LGV ++ I+IN QFPGP +   TND L
Sbjct  17   VVALYMQTVCRVVVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNL  76

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+HN+L EPFL++WNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS+FYFP
Sbjct  77   IINVHNDLPEPFLLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFP  136

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SL  HKAAGG+G IRI + P +  PFP P  D  ILI DWY  + + +
Sbjct  137  SLKFHKAAGGFGGIRILSRPRIPVPFPEPAGDFTILIGDWYKTNHKAL  184


 Score = 92.8 bits (229),  Expect(4) = 2e-128, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
              +GKTY LRISNVG++ SLNFRIQGH M LVE EG++T++    +LD+HVGQSYSV+V A
Sbjct  215   ESGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGTHTIQTTLSSLDVHVGQSYSVLVTA  274

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
                +    YY++ S RF+    +    + Y+  R
Sbjct  275   --DQPAQDYYIAISSRFTTQILNSTAILHYSNSR  306


 Score = 38.9 bits (89),  Expect(4) = 2e-128, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LDR  MLKFP GI ING G + A    + GK+
Sbjct  182  KALQTILDRGKMLKFPDGIQINGLGRDGAKFTVESGKT  219



>ref|XP_002320467.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
 gb|EEE98782.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
Length=532

 Score =   231 bits (590),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 148/223 (66%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRT+ L+     + GK RYA+N VSF+  DTPLKLA
Sbjct  319   RRNLTASGPRPNPQGSYHYGLINTTRTVRLQNSAPIINGKQRYAVNSVSFISADTPLKLA  378

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DH+NI GV+ LG+IP+ P      L      SV+  +   + +IVF NP  +VQ+WH+DG
Sbjct  379   DHYNIPGVFSLGSIPDSPTGGGAYLQ----TSVMAADFRGYAEIVFENPEDNVQSWHIDG  434

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G WS     SYNL+D + R TVQVYP SWTAVY+ +DN GMWN+RS N  
Sbjct  435   HNFFVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPESWTAVYMPLDNVGMWNVRSENWA  494

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+AA L
Sbjct  495   RQYLGQQFYLRVYSPAN-----SWRDEYPIPTNALLCGRAAGL  532


 Score =   179 bits (455),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L VL L  C + E+  RF+ W V++     LGV+++ I+IN QFPGP +   TND L ++
Sbjct  7    LAVLLLVTCTAGEDAYRFHTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIIS  66

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SWNGVQ R +SWQDGV GTNC IPPG+N+TY  Q+KDQIGSYFYFPSL 
Sbjct  67   VFNSLDEPFLISWNGVQQRRNSWQDGVYGTNCAIPPGQNFTYVLQVKDQIGSYFYFPSLG  126

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            +HKAAGG+G  +I +  V+  PF  P  D   L  DW+ ++
Sbjct  127  MHKAAGGFGGFKIASRSVIPVPFSPPSGDFTFLAGDWFKKN  167


 Score = 89.7 bits (221),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++++++ +D+LDIH+GQSYSV+V A +
Sbjct  204   GKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYDSLDIHLGQSYSVLVTADQ  263

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
               +   Y++  S RF+    +    + Y+   G+    +S +PL
Sbjct  264   AAH--DYFIVVSTRFTSQVLTTTSILHYSNSAGS----VSDTPL  301


 Score = 31.6 bits (70),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +    PGK+
Sbjct  171  LKAILDGGSDLPFPDGLLINGRGSNGYTFTVDPGKT  206



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   216 bits (551),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T TI L+     + GK RYA+N VSF+  DTPLKLA
Sbjct  323   RRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTGPTINGKQRYAVNSVSFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G IP+ P      L      SV+  +   F ++VF NP  ++Q+WH+DG
Sbjct  383   DYFKIPGVFSVGNIPDNPTGGGAYLQ----TSVMAADFRGFAEVVFENPEDTLQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFF VGM  G W+     +YNL+D + R TVQVYP SWTAVYV +DN GMWN+RS N  
Sbjct  439   HNFFAVGMDGGEWTPASRLTYNLRDTISRCTVQVYPKSWTAVYVPLDNVGMWNIRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V       S  S RDE PIP+N + CG+A
Sbjct  499   RQYLGQQFYLRVYS-----SANSWRDEYPIPSNALLCGRA  533


 Score =   188 bits (478),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            + C L+V  L  C   E   RF++W V++     LGV+++ I+IN QFPGP +   TND 
Sbjct  7    ICCLLLVFMLVSCTRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +++ N LDEPFL+SWNGVQ R +SWQDGV GTNCPI PGKN+TY  Q+KDQIGSYFYF
Sbjct  67   LIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGSYFYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PSL  HKAAGGYG I+I + P++  PF  P  D  IL  DWY ++
Sbjct  127  PSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKN  171


 Score = 99.0 bits (245),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH M LVE EG++T+++ +D+LDIH+GQSYSV+V+A +
Sbjct  208   GKTYRFRISNVGISTSINFRIQGHKMLLVEVEGTHTLQNTYDSLDIHLGQSYSVLVRADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                G  YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  268   PPQG--YYIVISTRFTSQVLSATSVLHYSNSAGSVSGPPPGGPTTQ  311


 Score = 28.1 bits (61),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G++ING G    +     GK+
Sbjct  175  LKAILDSGSDLPFPDGLVINGRGSNANTFTVDQGKT  210



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   215 bits (547),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG+INVTRTI L      V  K RYA+NGVSF+  DTPLKLA
Sbjct  329   RTNLTASGPRPNPQGSYHYGQINVTRTIRLANHAGLVDKKQRYAVNGVSFIPADTPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++NI GV+++G+I + P      L      +V+  +   F +IVF N    VQ+WHLDG
Sbjct  389   DYYNIDGVFKVGSIQDKPAGRKIHL----DTAVMGADYRAFVEIVFENRENIVQSWHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS      YNL DAV R T QVYP SWTA+YV +DN GMWNLRS    
Sbjct  445   YSFFVVGMDVGRWSPASKNQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRSQFWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE PIP N + CG+A
Sbjct  505   RQYLGQQFYLRVYTPVK-----SFRDEYPIPKNALHCGRA  539


 Score =   184 bits (466),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 124/182 (68%), Gaps = 5/182 (3%)
 Frame = +1

Query  16   MKTVNGT----VALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQ  183
            M++ NG     +AL L+   + L   V      R++DW +++     LG+ ++ I+IN Q
Sbjct  1    MRSENGRRWCWIAL-LLALYMELEGVVVAEDPYRYFDWRITYGDIYPLGIRQQGILINGQ  59

Query  184  FPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYS  363
            FPGP ++  TND L +N+HN+L +PFL++WNG+Q R +S++DGV GT CPIPPG+N+TY 
Sbjct  60   FPGPDIHSVTNDNLIINVHNDLHDPFLLTWNGLQQRKNSFEDGVYGTTCPIPPGQNFTYI  119

Query  364  FQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQ  543
             Q+KDQIGS+FYFPSL  HKAAGG+G IRI + P +  PFP P  D  ILI DWY  D +
Sbjct  120  MQVKDQIGSFFYFPSLQFHKAAGGFGGIRILSRPRIPVPFPEPAGDFTILIGDWYKTDHK  179

Query  544  VI  549
            V+
Sbjct  180  VL  181


 Score = 95.1 bits (235),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQGH MTLVE EG++T++    +LD+HVGQSYSV+V A  
Sbjct  214   GKTYRLRISNVGLQNSLNFRIQGHKMTLVEVEGTHTIQTTLSSLDVHVGQSYSVLVTA--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
              +    YY++ S RF+    +    + Y+  R
Sbjct  272   DQPAQDYYIAVSSRFTTQILNSTAILHYSNSR  303


 Score = 38.5 bits (88),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVL+  LDR   L FP GI ING G + A    +PGK+
Sbjct  179  KVLQTILDRGKRLTFPDGIQINGLGRDGAKFTVEPGKT  216



>ref|XP_011039228.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=538

 Score =   215 bits (548),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 146/218 (67%), Gaps = 9/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++   AARPNPQGS+HYG+I  T+T+ L      + GK RYA+N VS++  DTPLKLAD+
Sbjct  325   NLTASAARPNPQGSYHYGKITPTKTVALANSAPLINGKQRYAVNRVSYINSDTPLKLADY  384

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ + +I   P      L      SV+  NLHDF ++VF N  +++Q+WHLDGY+
Sbjct  385   FGIPGVFSVDSIESSPSGGAAFL----STSVMSANLHDFLEVVFQNDEKTMQSWHLDGYD  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             F+V+G G G W++    +YNL DA+ R TVQVYP SWTA+YV++DN+GMWN+RS   +++
Sbjct  441   FWVIGYGNGQWTSAKRSTYNLVDALTRHTVQVYPKSWTAIYVSLDNQGMWNMRSAIWERQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V          S  +E  IP+N ++CGKA
Sbjct  501   YLGQQFYLRVWTQVH-----SLANEYDIPSNALRCGKA  533


 Score =   191 bits (486),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L L+C ++ +     V++++  R+Y WTV++ T  +L V ++VI+IN QFPGP L+ 
Sbjct  4    AVLLHLLCGVLAVLSASLVNADDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDV  63

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  64   VTNDNIILNLFNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  123

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            S+ YFPS  LH+AAGGYG I IY  P +  PFP PD D  +LI DWY    Q +
Sbjct  124  SFTYFPSTLLHRAAGGYGAINIYERPKIPIPFPVPDGDFTLLIGDWYKTSHQTL  177


 Score = 97.8 bits (242),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH+M LVE EGS+TV++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNVGMSTSLNFRIQGHSMKLVEVEGSHTVQNIYDSLDVHVGQSVAVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YY+ AS RF+    +    + Y+  R     PL  +P
Sbjct  266   NQSPKDYYIIASTRFNRKILTTTAVLHYSNSRTPASGPLPAAP  308


 Score = 27.3 bits (59),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            + LR  LD    L FP G+LING 
Sbjct  175  QTLRAYLDSGRTLPFPDGVLINGQ  198



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score =   221 bits (563),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI+L      + GK RY IN VS+V PDTPLKLA
Sbjct  321   RTNLTASGPRPNPQGSYHYGLINTTRTIILSSSAGIINGKQRYGINSVSYVAPDTPLKLA  380

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +GTI + P      L      SV+QT+   F +IVF N    +Q++HLDG
Sbjct  381   DYFKIPGVFRVGTISDRPTGGGIYL----DTSVMQTDYRTFVEIVFQNDEDVIQSYHLDG  436

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+A     YNL+DAV R T QVYP SWTA+Y+ +DN GMWNLRS    
Sbjct  437   YSFFVVGMDGGQWTAASKNQYNLRDAVSRCTTQVYPKSWTAIYIPLDNVGMWNLRSEFWA  496

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE P+P N + CG+A+
Sbjct  497   RQYLGQQFYMRVY-----TTSTSIRDEYPVPKNALLCGRAS  532


 Score =   180 bits (456),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 119/172 (69%), Gaps = 6/172 (3%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            V +L+ LSLF   +  E   RF++W V++     LGV ++ I+IN QFPGP ++  TND 
Sbjct  5    VAALLCLSLFAVAAVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDN  64

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +N+ N+LD+PFL+SWNGVQ R +S++DGV GT CPIPPG N+TY  Q+KDQIGS++YF
Sbjct  65   LIINVFNSLDQPFLLSWNGVQQRRNSFEDGVWGTTCPIPPGGNFTYILQVKDQIGSFYYF  124

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYT---EDIQVI  549
            PSL  HKAAGG+G +RI + P +  PF  P  D  +LI DWY     D+Q I
Sbjct  125  PSLAFHKAAGGFGGLRILSRPRIPVPFDDPAGDYTVLIGDWYKFNHTDLQAI  176


 Score = 92.8 bits (229),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H + LVE EG++TV+  + +LD+HVGQSYSV+V A  
Sbjct  206   GKTYRLRISNVGLENSLNFRIQNHKLKLVEVEGTHTVQTTYSSLDVHVGQSYSVLVTA--  263

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
              + G  YY+  S RF+    +    +RY
Sbjct  264   DQPGQDYYIVVSSRFTSTVLTSTAILRY  291


 Score = 37.7 bits (86),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L FP GILING G   AS + + GK+
Sbjct  173  LQAILDRGSKLPFPDGILINGRGSNGASFNVEQGKT  208



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   223 bits (567),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFTPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+Q +   F +IVF NP   VQ+WHLDG
Sbjct  383   DYFKIDGVFRVGSISDHPTGGGIYL----DTSVMQADYRAFVEIVFENPEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R TVQVYP SWTA+YVA+DN GMWN+RS    
Sbjct  439   YSFFVVGMDGGQWTPASRNEYNLRDAVARCTVQVYPNSWTAIYVALDNVGMWNVRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVY-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   186 bits (472),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 5/174 (3%)
 Frame = +1

Query  22   TVNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
             VN + A   +  +   SL    ++E+  RF+DW V++     LGV ++ I+IN QFPGP
Sbjct  2    AVNASFAAAFIVGI---SLIFAAAAEDPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGP  58

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             ++  TND L +N+ N+LDEPFL+SWNG+Q R +S+QDGV GT CPIPPGKN+TY  Q+K
Sbjct  59   DIHSVTNDNLIINVFNSLDEPFLISWNGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVK  118

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            DQIGS++YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  119  DQIGSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 94.4 bits (233),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  266   DQPAQDYYIVVSSRFTSPVLTTTGVLRYSNSAGPVSGPIPGGP  308


 Score = 28.5 bits (62),  Expect(4) = 3e-128, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L    GILING G   A+L+ + GK+
Sbjct  176  LRVQLDSGNKLPLADGILINGRG-SGATLNVEQGKT  210



>ref|XP_004231076.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=536

 Score =   216 bits (550),  Expect(4) = 4e-128, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG+INVTRTI L      V  K RYA+NGVSF+  DTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGQINVTRTIRLANHAGLVDKKQRYAVNGVSFIPADTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++NI GV+++G+I + P  T R +      +V+  +   F +IVF N    VQ+WHLDG
Sbjct  386   DYYNIDGVFKVGSIQDKP--TGRNI--HLDTAVMGADYRAFVEIVFENRENIVQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  GIWS      YNL DAV R T QVYP SWTA+YV +DN GMWNLRS    
Sbjct  442   YSFFVVGMDVGIWSPASKNQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRSQFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLG + Y++V  P       S RDE PIP N + CG+A
Sbjct  502   RQYLGHQFYLRVYTPVK-----SYRDEYPIPKNALHCGRA  536


 Score =   187 bits (476),  Expect(4) = 4e-128, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 120/178 (67%), Gaps = 0/178 (0%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            M++  G     +  +L+ +   V      R++DW +++     LGV ++ I+IN QFPGP
Sbjct  1    MRSEKGRSWCWIALALLYMEGVVVAEDPYRYFDWRITYGDIHPLGVRQQGILINGQFPGP  60

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             +   TND L +N+HN+L  PFL++WNG+Q R +S+QDGV GT CPIPPGKN+TY+ Q+K
Sbjct  61   DIYSVTNDNLIINVHNHLPHPFLLTWNGLQQRKNSFQDGVYGTTCPIPPGKNFTYTMQVK  120

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            DQIGS+FYFPSL  HKAAGG+G IRI + P +  PFP P  D  ILI DWY  D +V+
Sbjct  121  DQIGSFFYFPSLQFHKAAGGFGGIRILSRPKIPVPFPEPAGDFTILIGDWYKTDHKVL  178


 Score = 91.7 bits (226),  Expect(4) = 4e-128, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRI NVG++ SLNFRIQGH M LVE EG++T++    +LDIHVGQSYSV+V A  
Sbjct  211   GKTYRLRICNVGLQNSLNFRIQGHKMKLVEVEGTHTIQTTLSSLDIHVGQSYSVLVTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY++ S RF+    +    + Y   +     P    P
Sbjct  269   DQRAQDYYIAVSSRFTTQILNSTAILHYRNSKKTVSGPPPPGP  311


 Score = 36.2 bits (82),  Expect(4) = 4e-128, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVL+  LD    L FP GI ING G + A    +PGK+
Sbjct  176  KVLKTILDHGKKLPFPDGIQINGLGRDGAKFTVEPGKT  213



>ref|XP_011013814.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=538

 Score =   215 bits (547),  Expect(4) = 5e-128, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 146/218 (67%), Gaps = 9/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++   AARPNPQGS+HYG+I  T+T+ L      + GK RYA+N VS++  DTPLKLAD+
Sbjct  325   NLTASAARPNPQGSYHYGKITPTKTVALANSAPLINGKQRYAVNRVSYINSDTPLKLADY  384

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ + +I   P      L      SV+  NLHDF ++VF N  +++Q+WHLDGY+
Sbjct  385   FGIPGVFSVDSIESSPSGGAAFL----STSVMSANLHDFLEVVFQNDEKTMQSWHLDGYD  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             F+V+G G G W++    +YNL DA+ R TVQVYP SWTA+YV++DN+GMWN+RS   +++
Sbjct  441   FWVIGYGNGQWTSAKRSTYNLVDALTRHTVQVYPKSWTAIYVSLDNQGMWNMRSAIWERQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V          S  +E  IP+N ++CGKA
Sbjct  501   YLGQQFYLRVWTQVH-----SLANEYDIPSNALRCGKA  533


 Score =   191 bits (486),  Expect(4) = 5e-128, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L L+C ++ +     V++++  R+Y WTV++ T  +L V ++VI+IN QFPGP L+ 
Sbjct  4    AVLLHLLCGVLAVLSASLVNADDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDV  63

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  64   VTNDNIILNLFNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  123

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            S+ YFPS  LH+AAGGYG I IY  P +  PFP PD D  +LI DWY    Q +
Sbjct  124  SFTYFPSTLLHRAAGGYGAINIYERPKIPIPFPVPDGDFTLLIGDWYKTSHQTL  177


 Score = 97.4 bits (241),  Expect(4) = 5e-128, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH+M LVE EGS+TV++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNVGMSTSLNFRIQGHSMKLVEVEGSHTVQNIYDSLDVHVGQSVAVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y+  R     PL  +P
Sbjct  266   NQAPKDYYIIASTRFNRKILTTTAVLHYSNSRPPASGPLPAAP  308


 Score = 27.3 bits (59),  Expect(4) = 5e-128, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            + LR  LD    L FP G+LING 
Sbjct  175  QTLRAYLDSGRTLPFPDGVLINGQ  198



>ref|XP_007047152.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
 gb|EOX91309.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
Length=538

 Score =   231 bits (589),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 152/220 (69%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+TIVL    + + GK RY +NGVSFV PDTPLKLA
Sbjct  323   RWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I ++P        A    SV+ T+LHDF ++VF N   ++Q+WHLDG
Sbjct  383   DYFNIPGVFSMSSIQDLPSGG----AATVATSVVPTSLHDFIEVVFQNNENTMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  439   YDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAMWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+NV+ CGKA
Sbjct  499   RQYLGQQFYLRVWTPVR-----SFANEYDIPSNVLLCGKA  533


 Score =   174 bits (442),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            V L L+  ++ +     V++E+   +Y WTV++ TRS+LGV ++VI+INDQFPGP L   
Sbjct  5    VMLRLLFGVLAVLSVSLVNAEDPYLYYTWTVTYGTRSLLGVPQQVILINDQFPGPKLEVV  64

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TN+ + +N+ N LD+PFL++WNGV+ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS
Sbjct  65   TNNNIILNLINKLDQPFLLTWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGS  124

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            Y YFPS  +H+AAGG+G + IY+  V+  P+  PD D  +LI DWY
Sbjct  125  YTYFPSTLMHRAAGGFGALNIYHRSVIPIPYANPDGDFTLLIGDWY  170


 Score = 94.0 bits (232),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH M LVE EGS+ +++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y   +     PL  +P
Sbjct  266   NQPPKDYYIVASTRFTKTVLTATAVLHYTNSQTPVSGPLPAAP  308


 Score = 31.2 bits (69),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+++LD    L FP G+LING    Q +   + GK+
Sbjct  175  KTLQQTLDSGKSLPFPDGVLINGQ--TQTTFSGEQGKT  210



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   214 bits (544),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTIVL      V GK RYA+N VSF+  DTPLK+A
Sbjct  320   RTNLTASGPRPNPQGSYHYGMINTTRTIVLSNSAGIVNGKQRYAVNSVSFIPADTPLKVA  379

Query  1367  DHFNISGVYELGTIPEMPHF--TYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHL  1540
             D F I GV+ +G+I + P+    Y+        SV+  +   F +IVF N    +Q+WH 
Sbjct  380   DFFKIGGVFRVGSISDWPNGGGIYQ------DTSVMGADYRAFVEIVFQNNEDLIQSWHF  433

Query  1541  DGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGN  1720
             DGY+FFVVGM  G W++     YNL+DA+ R TVQVYP SW+A+YVA+DN GMWN+RS  
Sbjct  434   DGYSFFVVGMDGGQWTSNSRNQYNLRDAIARCTVQVYPKSWSAIYVALDNVGMWNIRSEF  493

Query  1721  ADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
               ++YLGQ+ Y++V  P       S RDE PIP N + CG+A 
Sbjct  494   WARQYLGQQFYLRVYTPS-----TSLRDEYPIPKNALLCGRAT  531


 Score =   185 bits (470),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             + +S F  V +E+  RF+DW V++ T   LG+ ++ I+IN QFPGP ++  TND + +N
Sbjct  7    FLFISFFAIVGAEDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIIN  66

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  67   VFNSLDEPFLLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLG  126

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  127  FHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYQAN  167


 Score = 93.6 bits (231),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+++SLNFRIQGH M +VE EG++T++ +F +LD+HVGQSYSV+V A  
Sbjct  205   GKTYRLRISNVGLQSSLNFRIQGHRMKVVEVEGTHTLQTEFSSLDVHVGQSYSVLVTA--  262

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTP  1112
              +    +Y+  S RF+    +    +RY    G+     PG P
Sbjct  263   DQPAQDFYIVVSSRFTTPILTTTAILRYANSAGSVQGPPPGGP  305


 Score = 38.1 bits (87),  Expect(4) = 6e-128, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (3%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQ-ASLDFQPGKS  742
             LR  LD   ML  P GILING GP + AS++ + GK+
Sbjct  170  TLRAQLDNGSMLPLPDGILINGRGPNRTASINVEQGKT  207



>ref|XP_002285913.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18890.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   220 bits (560),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  +RTI L     +V GK RYA+N VS+V  DTPLK+A
Sbjct  323   RTNLTASGPRPNPQGSYHYGMITTSRTIRLASSAGQVNGKQRYAVNSVSYVPGDTPLKVA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV+ +G+I + P      L      SV+  +   F +IVF NP   +Q+WH+DG
Sbjct  383   DFFKIGGVFRVGSISDNPTGGGVYL----DTSVMGADFRAFVEIVFENPEDIIQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G+W+A     YNL+DAV RST QVYP SWTA+YVA+DN GMWN+RS    
Sbjct  439   YSFFVVGMDGGLWTANSRNQYNLRDAVARSTTQVYPKSWTAIYVALDNVGMWNVRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P +     S RDE PIP N + CGKA+
Sbjct  499   RQYLGQQFYLRVYSPVE-----SIRDEFPIPKNALLCGKAS  534


 Score =   181 bits (460),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = +1

Query  76   LFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNL  249
            LF  V++E+  RF+ W V+F     LGV ++ I+IN QFPGP +   TND L +N++N+L
Sbjct  16   LFTIVAAEDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSL  75

Query  250  DEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAA  429
             EPFL+SW+GVQ R +S++DGV GT CPIPPG+N+TY  Q+KDQIGS+FYFPSL  HKAA
Sbjct  76   TEPFLLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAA  135

Query  430  GGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GG+G IRI + P +  PFP P  D+ +LI DWY  +
Sbjct  136  GGFGGIRILSRPRIPVPFPDPAGDITVLIGDWYKAN  171


 Score = 90.1 bits (222),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRFRISNVGLQNSLNFRIQDHKMVLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    +Y+  S RF+    +  G +RY+
Sbjct  266   DQPAQDFYIVVSTRFTSQVLTTTGILRYS  294


 Score = 38.9 bits (89),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP   S   + GK+
Sbjct  174  TLKAILDRGKKLHFPDGILINGRGPNGVSFTVEQGKT  210



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   223 bits (567),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN++RTI LE    +V GK RYA+N VSF+  DTPLKLA
Sbjct  327   RTNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNGKQRYAVNSVSFIPADTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+  +   F +IVF N    VQ+WH+DG
Sbjct  387   DYFKIGGVFRVGSIQDQPTGGNIYL----DTSVMGADFRGFIEIVFQNHENIVQSWHIDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNF+VVGM  G+W+      YNL+DAV R T QVYP SWTA+YVA+DN GMWN+RS    
Sbjct  443   YNFWVVGMNGGVWTPASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNVRSEFWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A
Sbjct  503   RQYLGQQFYLRVYSPVE-----SIRDEYPIPKNALLCGRA  537


 Score =   184 bits (467),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            +C +  L++F  V+  E   RF+ W V++     LGV ++ I+IN QFPGP +   TND 
Sbjct  11   LCVVYFLAMFAIVARAESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDN  70

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +N+HN+L EPFL+SWNGVQ R +S++DGV GT CPIPPGKN+TY  Q+KDQIGSYFYF
Sbjct  71   LIINVHNSLPEPFLISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYF  130

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PS+   KAAGG+G IRI + P++  PFP P  D  +LI DWY  +
Sbjct  131  PSVGFQKAAGGFGGIRILSRPLIPVPFPEPAGDFTVLIGDWYKAN  175


 Score = 86.7 bits (213),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQGH M LVE EG++T++  + +LD+HVGQSYSV+V   +
Sbjct  212   GKTYRFRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLVTMDQ  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
                   +Y++ S RF+    +  G + Y+
Sbjct  272   PPQ--DFYIAVSTRFTNKVLTSTGTLHYS  298


 Score = 36.6 bits (83),  Expect(4) = 9e-128, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILINGHG   AS   + GK+
Sbjct  179  LKSVLDRGHRLPSPDGILINGHGSNGASFTVEQGKT  214



>ref|XP_008241557.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=539

 Score =   212 bits (540),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG++  T+TI+L      +  K RYA N VS+V PDTPLKLA
Sbjct  324   RWNLTANAARPNPQGSYHYGKVTTTKTIILANSAPLINEKQRYAFNRVSYVNPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GVY   +I  +P  +    +A P   V+  +LHDF +IVF N   ++Q+ HLDG
Sbjct  384   DYFNIPGVYSSDSIQTVPS-SGSAFIATP---VVPASLHDFLEIVFQNNENTLQSMHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+A   R+YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  440   YDFWVVGYGFGQWTAAKRRTYNLVDALTRHTAQVYPNSWTTILVSLDNQGMWNLRSAIWE  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+N + CGKA
Sbjct  500   RQYLGQQFYLRVWNPVR-----SLANEYNIPSNTLLCGKA  534


 Score =   193 bits (491),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L LVC ++ +     V +E+  +FY WTV++ TRS LGV ++VI+IN QFPGP L+ 
Sbjct  5    AVLLHLVCGVLAVFSVAVVKAEDPYKFYTWTVTYGTRSPLGVPQQVILINGQFPGPRLDV  64

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNC IPP  N+TY FQ KDQIG
Sbjct  65   VTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCAIPPNSNYTYKFQTKDQIG  124

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            SY YFPS  LH+AAG +G I IY  P +  PFP PD D  +L+ DWY
Sbjct  125  SYTYFPSTQLHRAAGAFGAINIYERPRIPIPFPNPDGDFTLLVGDWY  171


 Score = 95.1 bits (235),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH++ LVE EGS+T+++ +D+LD+HVGQS +V+V    
Sbjct  209   GKTYMFRISNVGLSTSLNFRIQGHSLKLVEVEGSHTIQNTYDSLDVHVGQSVAVLVTL--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             ++    YY+ AS RF+ +  +    + Y     N  TP+S
Sbjct  267   NQPPKDYYIVASTRFTKLVLTATSVLHYT----NSHTPVS  302


 Score = 29.3 bits (64),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+++LD    L FP G+LING 
Sbjct  176  KALQQTLDSGKSLPFPAGVLINGQ  199



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   216 bits (551),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN++RTI LE   A V  K RYA+N VSF+  DTPLKLA
Sbjct  328   RTNLTASGPRPNPQGSYHYGLINISRTIKLESSAALVNRKQRYAVNSVSFIPADTPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F+I GV+ +G+IP+ P      L      SV+  +   F +IVF N    VQ+WH+DG
Sbjct  388   DYFSIDGVFRIGSIPDFPSGKTMFL----DTSVMGADYRAFIEIVFQNHENIVQSWHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G+W+      YNL+DAV R T QVYP SWTA+Y+++DN GMWN+RS    
Sbjct  444   YSFWVVGMDGGVWTPASREQYNLRDAVSRCTTQVYPKSWTAIYMSLDNVGMWNIRSEFWA  503

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE  +P N + CGKA
Sbjct  504   RQYLGQQFYLRVYTPVK-----SFRDEYNVPDNALLCGKA  538


 Score =   191 bits (484),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = +1

Query  64   IVLSLFVCVS---SEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            +VL LF+ ++   S  RF+DW V++     LGV ++ I+IN QFPGP +   TND + +N
Sbjct  17   LVLGLFINIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYIN  76

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+L EPFL+SWNGVQ R +S+QDGV GT CPIPPG+N+TY  Q+KDQIGSYFYFPSL 
Sbjct  77   VHNSLPEPFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLA  136

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IR+ + P++  PFP P  D  +LI DWYT +
Sbjct  137  FHKAAGGFGSIRVLSRPLIPVPFPEPAADYTLLIGDWYTAN  177


 Score = 85.9 bits (211),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RI+NVG++ SLNFR+Q H + LVE EG++T+++ + +LD+HVGQSYSV++ A  
Sbjct  214   GKTYRFRITNVGLQHSLNFRVQDHELKLVEVEGTHTMQNTYSSLDVHVGQSYSVLITA--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLK  1133
              +    +Y++ S RF+    +    + Y+    + G P+   P +
Sbjct  272   DQPSRDFYIAVSTRFAPKVLTSTAILHYSDSTTSVGGPIPGGPTE  316


 Score = 37.0 bits (84),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP+GI+ING GP   +   + GK+
Sbjct  180  TLKTILDRGHRLPFPNGIVINGRGPSATTFTVEKGKT  216



>ref|XP_008440238.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   216 bits (550),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+TIVL    A + GK RYAIN VS+V  DTPLKLA
Sbjct  323   RWNLTANAARPNPQGSFHYGKIIPTKTIVLATSAALINGKQRYAINRVSYVNSDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + ++  +P      +      SV+ T LHDF +IVF N   +VQ++HLDG
Sbjct  383   DYFNIPGVFSVDSLQSLPSDGPAFI----ATSVLPTALHDFVEIVFQNNENTVQSFHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G WS     SYNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  439   YDFWVVGYGYGQWSQDSRNSYNLVDALTRHTAQVYPNSWTTILVSLDNQGMWNLRSSIWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+N + CGKA
Sbjct  499   RQYLGQQFYLRVWTPTQ-----SLANEYNIPSNALLCGKA  533


 Score =   186 bits (473),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 119/176 (68%), Gaps = 7/176 (4%)
 Frame = +1

Query  1    ERQTTMKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVIND  180
            E+Q  ++ + G +AL L  SL      V   +  RFY WTV++ T S LGV ++VI+IN 
Sbjct  2    EKQGLLRLIFGALAL-LSVSL------VNAENPYRFYTWTVTYGTISPLGVPQQVILING  54

Query  181  QFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTY  360
            QFPGP L   TND + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIPP  N+TY
Sbjct  55   QFPGPKLEVVTNDNIILNLFNKLDEPLLLTWNGIKQRKNSWQDGVVGTNCPIPPNSNYTY  114

Query  361  SFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            SFQ KDQIGS+ YFPS   HKAAGG+G + +Y  P +  P+P  D D  +LI DWY
Sbjct  115  SFQTKDQIGSFAYFPSTQFHKAAGGFGALNVYQRPRIPIPYPIQDGDFTLLIGDWY  170


 Score = 95.1 bits (235),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH M LVE EGS+T+++ +D+LD+HVGQS SV+V   +
Sbjct  208   GKTYMFRISNVGLSTSLNFRIQGHKMKLVEVEGSHTLQNLYDSLDVHVGQSLSVLVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+    +    + Y+        PL   P
Sbjct  268   APK--DYYIVASTRFTKTVLTATAVLHYSNSNSPVSGPLPAGP  308


 Score = 31.6 bits (70),  Expect(4) = 1e-127, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+ESLD  G L  P G+LING 
Sbjct  175  KSLQESLDSGGSLPLPDGVLINGQ  198



>emb|CAN83942.1| hypothetical protein VITISV_013559 [Vitis vinifera]
Length=541

 Score =   220 bits (560),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  +RTI L     +V GK RYA+N VS+V  DTPLK+A
Sbjct  323   RTNLTASGPRPNPQGSYHYGMIXTSRTIRLASSAGQVNGKQRYAVNSVSYVPGDTPLKVA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV+ +G+I + P      L      SV+  +   F +IVF NP   +Q+WH+DG
Sbjct  383   DFFKIGGVFRVGSISBNPTGGGXYL----DTSVMGADFRAFVEIVFENPEDIIQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G+W+A     YNL+DAV RST QVYP SWTA+YVA+DN GMWN+RS    
Sbjct  439   YSFFVVGMDGGLWTANSRNQYNLRDAVARSTTQVYPKSWTAIYVALDNVGMWNVRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P +     S RDE PIP N + CGKA+
Sbjct  499   RQYLGQQFYLRVYSPVE-----SIRDEFPIPKNALLCGKAS  534


 Score =   181 bits (460),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = +1

Query  76   LFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNL  249
            LF  V++E+  RF+ W V+F     LGV ++ I+IN QFPGP +   TND L +N++N+L
Sbjct  16   LFTIVAAEDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSL  75

Query  250  DEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAA  429
             EPFL+SW+GVQ R +S++DGV GT CPIPPG+N+TY  Q+KDQIGS+FYFPSL  HKAA
Sbjct  76   TEPFLLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAA  135

Query  430  GGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GG+G IRI + P +  PFP P  D+ +LI DWY  +
Sbjct  136  GGFGGIRILSRPRIPVPFPDPAGDITVLIGDWYKAN  171


 Score = 89.0 bits (219),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRFRISNVGLQNSLNFRIQDHKMVLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    +Y   S RF+    +  G +RY+
Sbjct  266   DQPAQDFYXVVSTRFTSQVLTTTGILRYS  294


 Score = 38.9 bits (89),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING GP   S   + GK+
Sbjct  174  TLKAILDRGKKLHFPDGILINGRGPNGVSFTVEQGKT  210



>emb|CDY68834.1| BnaCnng60730D, partial [Brassica napus]
Length=549

 Score =   224 bits (570),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  331   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFKPADTPLKLA  390

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY +G++   P      L      SV+Q +   F +IVF NP   VQTWHLDG
Sbjct  391   DYFKIDGVYRVGSVQSQPTGGGIYL----DTSVLQADYRTFVEIVFENPENIVQTWHLDG  446

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DA+ R TVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  447   YSFWVVGMDGGKWSPDSRNEYNLRDALARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  506

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N + CG+A+
Sbjct  507   RQYLGQQLYLRVY-----TTSTSLRDEFPIPKNALLCGRAS  542


 Score =   184 bits (467),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   IVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNI  237
            IV S+   V++E+  RF++W V++     LGV ++ I+I+ +FPGP ++  TND L +NI
Sbjct  21   IVFSILFAVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINI  80

Query  238  HNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHL  417
             NNLDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  
Sbjct  81   FNNLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAF  140

Query  418  HKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  141  HKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  180


 Score = 91.7 bits (226),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A +
Sbjct  216   GKTYRLRISNVGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTADQ  275

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               +   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  276   PAH--DYYVVVSSRFTSTVLTTTGVLRYSGSSGGVSGPIPGGP  316


 Score = 29.6 bits (65),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  184  LKAKLDSGRKLPLPDGILINGRG-TGATLNVEQGKT  218



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   216 bits (550),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN +RTI+L     +V GK RYA+N VSF+  DTPLKLA
Sbjct  328   RTNLTASGPRPNPQGSYHYGMINTSRTIILASSAGQVNGKQRYAVNSVSFIPQDTPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV++  +I + P+     L      SV+  +   F +IVF N    VQ+WHLDG
Sbjct  388   DFFKIPGVFKENSISDRPYGGGIYL----DTSVLTVDYRAFVEIVFQNNEDIVQSWHLDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W++     YNL+DAV R T QVYP SWTA+YV +DN GMWNLR+    
Sbjct  444   YSFFVVGMDGGQWTSASRDQYNLRDAVARCTAQVYPMSWTAIYVPLDNVGMWNLRTEFWA  503

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N + CGKA+
Sbjct  504   RQYLGQQLYLRVY-----TTSTSLRDEYPIPKNALTCGKAS  539


 Score =   187 bits (474),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 4/166 (2%)
 Frame = +1

Query  52   VCSL--IVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            +C+L  I +S F  V +E+  RF++W V++     LG+ ++ I+IN QFPGP ++  TND
Sbjct  11   ICTLFCIAVSFFAIVGAEDPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTND  70

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++Y
Sbjct  71   NLIINVFNSLDEPFLLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYY  130

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL  HKAAGG+G IRI + P +  PF  PD D  ILI DWY  +
Sbjct  131  FPSLAFHKAAGGFGGIRILSRPRIPVPFADPDGDYTILIGDWYKSN  176


 Score = 92.0 bits (227),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +3

Query  804   LLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVM  983
             L    GKTY LRISN+G++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+
Sbjct  208   LTVEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVL  267

Query  984   VKALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               A   + G  YY+  S RF+    +  G + Y+   G+   P    P
Sbjct  268   FTA--DQPGQDYYIVVSSRFTTQVLTTTGVLHYSNSAGSVSGPPPGGP  313


 Score = 34.7 bits (78),  Expect(4) = 2e-127, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING GP    L  + GK+
Sbjct  180  LKAHLDNGKKLPFPDGILINGRGPSGYYLTVEQGKT  215



>ref|XP_007204826.1| hypothetical protein PRUPE_ppa003926mg [Prunus persica]
 gb|EMJ06025.1| hypothetical protein PRUPE_ppa003926mg [Prunus persica]
Length=539

 Score =   211 bits (537),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG++  T+TI+L      +  K RYA N VS+V PDTPLKLA
Sbjct  324   RWNLTANAARPNPQGSYHYGKVTPTKTIILANSAPLINEKQRYAFNRVSYVNPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GVY   +I  +P  +    +A P   V+  +LHDF +IVF N   ++Q+ HLDG
Sbjct  384   DYFNIPGVYSSDSIQTVPS-SGSTFIATP---VVPASLHDFLEIVFQNNENTLQSMHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+A   R+YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  440   YDFWVVGYGFGQWTAAKRRTYNLVDALTRHTAQVYPNSWTTILVSLDNQGMWNLRSAIWE  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+N + CGKA
Sbjct  500   RQYLGQQFYLRVWNPVR-----SLANEYNIPSNTLLCGKA  534


 Score =   193 bits (491),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L LVC ++ +     V +E+  +FY WTV++ TRS LGV ++VI+IN QFPGP L+ 
Sbjct  5    AVLLHLVCGVLAVFSVAVVKAEDPYKFYTWTVTYGTRSPLGVPQQVILINGQFPGPRLDV  64

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNC IPP  N+TY FQ KDQIG
Sbjct  65   VTNDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCAIPPNSNYTYKFQTKDQIG  124

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            SY YFPS  LH+AAG +G I IY  P +  PFP PD D  +L+ DWY
Sbjct  125  SYTYFPSTQLHRAAGAFGAINIYERPRIPIPFPNPDGDFTLLVGDWY  171


 Score = 95.1 bits (235),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH++ LVE EGS+T+++ +D+LD+HVGQS +V+V    
Sbjct  209   GKTYMFRISNVGLSTSLNFRIQGHSLKLVEVEGSHTIQNTYDSLDVHVGQSVAVLVTL--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             ++    YY+ AS RF+ +  +    + Y     N  TP+S
Sbjct  267   NQPPKDYYIVASTRFTKLVLTATSVLHYT----NSHTPVS  302


 Score = 29.3 bits (64),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+++LD    L FP G+LING 
Sbjct  176  KALQQTLDSGKSLPFPAGVLINGQ  199



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   230 bits (587),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L+     + GK RYA+NGVSF+  DTPLKLA
Sbjct  323   RRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPIINGKQRYAVNGVSFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ LG+IP+ P      L      SV+  +   F ++VF NP  ++Q+WH+DG
Sbjct  383   DHFNIQGVFSLGSIPDNPTGGGGYLQ----TSVMAADFRGFVEVVFENPEDTLQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G WSA    +YNL+D + RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  439   HSFFVVGMDGGQWSAASRLNYNLRDTIARSTVQVYPKSWTALYMPLDNVGMWNVRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLG + Y++V       S  S RDE PIP+N ++CGKA
Sbjct  499   RQYLGHQFYLRVYS-----STNSLRDEYPIPSNALQCGKA  533


 Score =   176 bits (446),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +1

Query  82   VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
             C + E+  RFY+W V++     LGV+++ I+IN QFPGP +   TND L +N+ N+LDE
Sbjct  18   ACANGEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDE  77

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL+SWNGV  R +SWQDGV GTNCPI PG+N+TY  Q+KDQIGSYFYFPSL  HKAAGG
Sbjct  78   PFLISWNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGG  137

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YG   I +  V+  PF  P  D  IL  DWY  +
Sbjct  138  YGGFTIASRSVIPVPFDPPSGDYTILAGDWYKRN  171


 Score = 93.6 bits (231),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH + LVE EGS+T+++ +D+LDIH+GQ+YSV+V A +
Sbjct  208   GKTYRFRISNVGITTSINFRIQGHKIKLVEVEGSHTLQNTYDSLDIHLGQTYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               +   YY+  + RF+    +    + Y+   G+   PL   P
Sbjct  268   PPH--DYYIVVTTRFTSQVLNASSILHYSNSAGSVSGPLPGGP  308


 Score = 28.9 bits (63),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP G++ING G    +     GK+
Sbjct  175  LRAILDSGSDLPFPDGLVINGRGSNAYTFAVDQGKT  210



>ref|XP_002893186.1| hypothetical protein ARALYDRAFT_313077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69445.1| hypothetical protein ARALYDRAFT_313077 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   224 bits (570),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             + ++     RPNPQGS+HYG+IN+TRTI L      + GK RYA+N  SF   DTPLKLA
Sbjct  323   KTNLTASGPRPNPQGSYHYGKINITRTIRLANSAGNIKGKQRYAVNSASFYPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I+GVY  G+IP+    TY  +   P  SV+QT+   F +IVF N    VQTWHLDG
Sbjct  383   DYFKIAGVYNPGSIPDQS--TYGAIF--PVTSVMQTDYKTFVEIVFENWEDIVQTWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WSA   + YNL DAV R TVQVYP SWTA+YV++DN GMWNLRS   +
Sbjct  439   YSFYVVGMELGKWSAASRKVYNLNDAVSRCTVQVYPKSWTAIYVSLDNVGMWNLRSELWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE  IP N + CG+A 
Sbjct  499   RQYLGQQFYMRVY-----TTSTSLRDEYLIPKNALLCGRAT  534


 Score =   176 bits (446),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            +K+VN T    ++  L+ L  FV      RF++W V++   S L V ++ I+IN +FPGP
Sbjct  3    VKSVNTTA---MILGLLFLISFVAAEDPYRFFEWHVTYGNISPLNVAQQGILINGKFPGP  59

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             +   TND L +N+ N+LDE FL+SW+G++   +S+QDGV GT CPIPPGKN+TY  Q+K
Sbjct  60   DIVSVTNDNLIINVFNHLDESFLISWSGIRNWRNSYQDGVYGTTCPIPPGKNYTYVLQVK  119

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            DQIGS++YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  120  DQIGSFYYFPSLGFHKAAGGFGAIRISSRPKIPVPFPAPADDYTVLIGDWYKTN  173


 Score = 90.1 bits (222),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNF+IQ H M LVE EG++T++  F  LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQNSLNFQIQNHMMKLVEVEGTHTIQTPFSTLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
              +    YY+  S RF+       G + Y+   G    P+   P + 
Sbjct  267   DQPAKDYYIVVSSRFTSKILITTGVLHYSNSAGPVSGPIPDGPTQL  312


 Score = 38.9 bits (89),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 24/38 (63%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L  P GILING G   A+L+ +PGK+
Sbjct  175  KDLRAQLDNGGKLPLPDGILINGRG-SGATLNIEPGKT  211



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   220 bits (561),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQG++HYG+IN TRTI L     +V GK RYA+N +SF+  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGTYHYGKINTTRTIRLASSAGQVNGKLRYAVNSISFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++ I GV+ +G+I + P        A    SV+Q +   F +IVF NP   VQ+WHL+G
Sbjct  383   DYYKIDGVFRVGSISDHPTGGEIYQDA----SVMQADYRAFVEIVFENPEDIVQSWHLNG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL DAV R TVQVY  SWTA+YVA+DN GMWN+RS + +
Sbjct  439   YSFFVVGMDGGEWTPESRNEYNLHDAVSRCTVQVYRKSWTAIYVALDNVGMWNVRSEDWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  SPRDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVH-----TNSTSPRDEYPIPKNSLLCGRAS  534


 Score =   182 bits (462),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 5/174 (3%)
 Frame = +1

Query  22   TVNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
             VN ++A  L+  +   SL   V++E+  RF+ W V++     LGV ++ I+IN QFPGP
Sbjct  2    AVNASLAAALIAGI---SLVFAVTAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGP  58

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             +   TND L +N+ N+LDEPFL+SW+G+Q R +S+ DGV GT CPIPPGKN+TY+ Q+K
Sbjct  59   DVRSVTNDNLIINVFNSLDEPFLISWSGIQQRRNSFVDGVYGTTCPIPPGKNYTYALQVK  118

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            DQIGS++YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  119  DQIGSFYYFPSLGFHKAAGGFGGIRILSRPKIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 96.3 bits (238),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKT+ LRISNVG++TSLNF+IQGH M +VE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  208   GKTFRLRISNVGLQTSLNFQIQGHTMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S +F+    +  G +RYN   G    P+   P
Sbjct  266   DQPARDYYIVVSSQFTSENLTTTGVLRYNNSAGPVSGPIPGGP  308


 Score = 29.6 bits (65),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+++ + GK+
Sbjct  176  LKAQLDNGKKLPLPDGILINGRG-SGATINVEQGKT  210



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   220 bits (560),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYA+N VSF+ PDTPLKLA
Sbjct  324   RRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAPIIDGKQRYAVNSVSFIQPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I + P      L      SV+  +   F ++VF NP  +VQ+WH+DG
Sbjct  384   DYFKISGVFSIGSIQDNPTGGGAYLQT----SVMNADFRGFAELVFENPEDTVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G W       YNL+D + R TVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  440   HSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQVYPNSWTAIYMPLDNVGMWNVRSENWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A
Sbjct  500   RQYLGQQFYLRVYSPAN-----SWRDEYPIPRNALLCGRA  534


 Score =   192 bits (488),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = +1

Query  52   VCSLIVLSLFV--CVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            VC +I+++L    C S E+  RFY+W V++     LG++++ I+IN QFPGP +   TND
Sbjct  7    VCCVILVALLTVTCTSGEDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTND  66

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +N+ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSYFY
Sbjct  67   NLIINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFY  126

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL  HKAAGG+G I+I +  V+  PFP P  D  IL  DW++++
Sbjct  127  FPSLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKN  172


 Score = 92.4 bits (228),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+ TS+NFRIQGH M LVE EG++++++ + +LDIH+GQSYSV+V A  
Sbjct  209   GKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYSSLDIHLGQSYSVLVTA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
              +    YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  267   DQPAQDYYIVVSTRFTSQVLSTTSILHYSNAAGSVSGPPPGGPTTQ  312


 Score = 23.9 bits (50),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L    G+LING G    +     GK+
Sbjct  176  LKAILDSGNNLPLSDGLLINGRGSNGFTFTVDQGKT  211



>ref|XP_001777221.1| predicted protein [Physcomitrella patens]
 gb|EDQ58001.1| predicted protein [Physcomitrella patens]
Length=545

 Score =   205 bits (522),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 143/225 (64%), Gaps = 9/225 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++  GAAR NPQGS+HYGR+ + ++ V      ++  K RY +NGVSFV   TP+KLA
Sbjct  323   RLNLTAGAARLNPQGSYHYGRLKIAKSYVFANSALKLKEKQRYMVNGVSFVRSRTPIKLA  382

Query  1367  DHFNISGVYELGTIPEMP--HFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHL  1540
             D+  + GV+++G+IP+ P  H T          SVI  +   F +IVF NP  ++Q+WH+
Sbjct  383   DYLKLEGVFQIGSIPDHPIDHATPSF-----ASSVISGDFRAFVEIVFQNPENTLQSWHI  437

Query  1541  DGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGN  1720
             DGY FFVVGMG G W+    +SYNL DAV RST QVY  SWTAV + +DN G+WN+RS +
Sbjct  438   DGYAFFVVGMGWGEWNPDARQSYNLLDAVARSTTQVYENSWTAVMLELDNPGLWNIRSQD  497

Query  1721  ADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
               +++LGQELY+ V     + S    R E P P N++ CG A  L
Sbjct  498   LQRQWLGQELYLHVA--NSNTSDDVRRREEPPPHNLVLCGSALDL  540


 Score =   189 bits (481),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 0/169 (0%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            L  + + ++  + VC     ++ DWTVS+ + S LGV +KVI IN+QFPGP L  +TN  
Sbjct  5    LAFILTSVLSGILVCAEDPYQYEDWTVSYISASPLGVSQKVIAINNQFPGPQLETTTNYN  64

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +N+HN LDEP L++W+G+QLR +SWQDGV  TNCPI PG +WTY+F+ KDQIGSY+Y+
Sbjct  65   LIINVHNELDEPLLITWDGIQLRKNSWQDGVAETNCPIQPGSSWTYTFKAKDQIGSYYYY  124

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PSL   KAAGG+G IR+    ++  PF  P  D  +LI DWY  D Q +
Sbjct  125  PSLKFQKAAGGFGSIRVNPRRIISSPFVPPADDYAVLIGDWYKTDHQTL  173


 Score = 91.7 bits (226),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+  +LNFRIQGH + LVETEGSY  +  +  LD+HVGQSYSV+V  ++
Sbjct  206   GKTYRLRISNVGLTHTLNFRIQGHRLLLVETEGSYVTQTYYSTLDVHVGQSYSVLV-TMD  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQF--RGNPGTPLSKSP  1127
                 A + + AS RF   + +G   + YN    RG     L ++P
Sbjct  265   QSIPADFQIIASTRFVWPELNGSAILHYNTTSNRGPVSGDLPRAP  309


 Score = 42.0 bits (97),  Expect(4) = 3e-127, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            + LR  LD   +L  P GILING GP QAS    PGK+
Sbjct  171  QTLRNILDNGHLLGSPDGILINGLGPHQASFSVNPGKT  208



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   214 bits (545),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN++RTI LE   A V  K RYA+N VSF+  DTPLKLA
Sbjct  328   RTNLTASGPRPNPQGSYHYGLINISRTIKLESSAALVSRKQRYAVNSVSFIPADTPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G++P++P      L      SV+  +   F +IVF N    VQ+WH+DG
Sbjct  388   DYFGIDGVFSVGSVPDVPSRKPMYL----DTSVMGADYRAFIEIVFQNHENIVQSWHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G+W+      YNL+DAV R T QVYP SWTA+Y+++DN GMWN+RS    
Sbjct  444   YSFWVVGMDGGVWTPASREQYNLRDAVSRCTTQVYPKSWTAIYMSLDNVGMWNIRSEFWA  503

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE  +P N + CGKA
Sbjct  504   RQYLGQQFYLRVYTPVK-----SFRDEYNVPDNALLCGKA  538


 Score =   191 bits (484),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVS---SEERFYDWTVSFSTRSILGVEKKVIVINDQF  186
            M   + T   P     +V S F+ ++   S  RF+DW V++     LGV ++ I+IN QF
Sbjct  1    MAQTSSTNLWPAFTVALVFSSFINIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQF  60

Query  187  PGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSF  366
            PGP +   TND + +N+HN+L EPFL+SWNGVQ R +S+QDGV GT CPIPPG+N+TY  
Sbjct  61   PGPDIYAVTNDNIYINVHNSLPEPFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRI  120

Query  367  QLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            Q+KDQIGSYFYFPSL  HKAAGG+G IR+ + P++  PFP P  D  +LI DWYT +
Sbjct  121  QVKDQIGSYFYFPSLAFHKAAGGFGSIRVLSRPLIPVPFPEPAADYTLLIGDWYTAN  177


 Score = 85.9 bits (211),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRI+NVG++ SLNFR+Q H M LVE EG++T+++ + +LD+HVGQSYSV++ A  
Sbjct  214   GKTYRLRITNVGLQHSLNFRVQDHEMKLVEVEGTHTMQNTYSSLDVHVGQSYSVLITA--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLK  1133
              +    +Y+  S RF+         + Y+    + G P+   P +
Sbjct  272   DQPSRDFYIVVSTRFAPKVLISTAILHYSDSTTSVGGPIPGGPTE  316


 Score = 37.4 bits (85),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP+GI+ING GP   +   + GK+
Sbjct  180  TLKTILDRGHKLPFPNGIVINGRGPNATTFTVEKGKT  216



>emb|CDP07321.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   226 bits (576),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     RV GK RYA+N VSFV  DTPLKLA
Sbjct  325   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGRVNGKQRYAVNSVSFVPADTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNI GVY + +I   P      L      SV+Q +   F +IVF N    +Q+WHLDG
Sbjct  385   DFFNIPGVYRVNSISSAPTGGGIYL----DTSVLQADYRAFIEIVFENNEDIIQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y FFVVGM  G W+A     YNL+DAV+RST QVYP SWTA+YVA+DN GMWNLR+    
Sbjct  441   YAFFVVGMDGGQWTAASRNGYNLRDAVFRSTTQVYPKSWTAIYVALDNVGMWNLRTEFWA  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       S  S RDE PIP N + CG+A+
Sbjct  501   RQYLGQQFYLRVY-----TSSTSLRDEFPIPKNALLCGRAS  536


 Score =   171 bits (433),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 120/177 (68%), Gaps = 8/177 (5%)
 Frame = +1

Query  43   LPLVCSLIVLS-----LFVCVSSEER---FYDWTVSFSTRSILGVEKKVIVINDQFPGPL  198
            +PL  + ++ +     LF  ++  E    F++W V++ T   LGV ++ I+IN QFPGP 
Sbjct  1    MPLKSAAVLFTATCAVLFAAIAKAEDPYLFFNWNVTYGTIYPLGVPQQGILINGQFPGPD  60

Query  199  LNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKD  378
            ++  TN+ L +N+ N+L EPFL+SW+G+Q R +S+ DGV GT CPIPPGKN+TY  Q+KD
Sbjct  61   IHSVTNNNLVINVFNSLTEPFLLSWSGIQNRRNSYVDGVYGTTCPIPPGKNYTYILQVKD  120

Query  379  QIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            QIGS++YFPSL  HKAAGG+G  RI +  V+  PF  P  D  +LI DWY+++  V+
Sbjct  121  QIGSFYYFPSLAFHKAAGGFGGFRILSRSVIPVPFAEPAGDFTVLIGDWYSKNHTVL  177


 Score = 90.1 bits (222),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQGH + LVE EG++T+++ + ++D+HVGQS SV+V A +
Sbjct  210   GKTYRLRISNVGLQHSLNFRIQGHKLKLVEVEGTHTLQNTYSSIDVHVGQSMSVLVTADQ  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   Y++  + RF+    +  GF+RY         P+   P
Sbjct  270   PPQ--DYFIVVNTRFTTPIITTTGFLRYANSNSRASGPIPGGP  310


 Score = 41.2 bits (95),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VL+  LD    L FP GILING GP   SL F+ GK+
Sbjct  176  VLKRILDGGHKLPFPDGILINGRGPNGTSLTFEQGKT  212



>ref|XP_004499321.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=544

 Score =   230 bits (587),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI+L    A+V GK RYAIN VS++ PDTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGMINTTRTIILSSSPAQVNGKQRYAINSVSYIAPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY  G+IP+ P      L      SV+QT+   F +IVF N    +Q++HLDG
Sbjct  386   DFFKISGVYRPGSIPDRPTGGGIYL----DTSVLQTDYRTFVEIVFQNDEDILQSYHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS      YNL+DAV RST QVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  442   YSFFVVGMDGGQWSPASRNQYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRSEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  502   RQYLGQQFYMRVY-----TTSTSLRDEYPIPKNALLCGRAS  537


 Score =   175 bits (444),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = +1

Query  73   SLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLD  252
            ++ V      RF+DW +++     LG+ ++ I+IN QFPGP ++  TND L +N+ N+LD
Sbjct  20   TILVLAEDPYRFFDWNITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLD  79

Query  253  EPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAG  432
             PFL+SWNGVQ R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  HKAAG
Sbjct  80   VPFLISWNGVQQRRNSYEDGVSGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAG  139

Query  433  GYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            G+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  140  GFGGIRILSRPRIPVPFDDPAGDYTLLIGDWYKSN  174


 Score = 88.2 bits (217),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H   LVE EG++T++  + +LD+HVGQSYSV++ A  
Sbjct  211   GKTYRLRISNVGLENSLNFRIQNHKFKLVEVEGTHTLQTTYSSLDVHVGQSYSVLLTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+    +  G +RY+
Sbjct  269   DQPAQDYYIVVSSRFTNPVLTTTGILRYS  297


 Score = 33.9 bits (76),  Expect(4) = 4e-127, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L F  GILING G   ASL+ + GK+
Sbjct  178  LKAQLDNGKKLPFADGILINGRGSGGASLNVEQGKT  213



>gb|KHG07318.1| L-ascorbate oxidase [Gossypium arboreum]
Length=536

 Score =   228 bits (581),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 153/220 (70%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+TIVL   ++ + GK RYA+NGVS+V  DTPLKLA
Sbjct  321   RWNLTSNAARPNPQGSFHYGKITPTKTIVLANSVSYINGKLRYAVNGVSYVNADTPLKLA  380

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G++ +  +  +P      + A    SV+ TNLHDF ++VF N   ++Q+WHLDG
Sbjct  381   DYFNIPGIFSMNAVQGVP----SGVAATVATSVMPTNLHDFLEVVFQNNENTMQSWHLDG  436

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS + +
Sbjct  437   YDFWVVGFGSGQWTPKKRRTYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSASWE  496

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+NV+ CGKA
Sbjct  497   RQYLGQQFYLRVWNPVR-----SLANEYDIPSNVLLCGKA  531


 Score =   173 bits (438),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 1/164 (1%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            + L L+  ++ +SL V       +Y WTV++ TRSILG  ++VI+IN+QFPGP L+  TN
Sbjct  6    MKLHLIIGVLAVSL-VNAEDPYLYYTWTVTYGTRSILGFPQQVILINNQFPGPKLDVVTN  64

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            + + +N+ N LD+PFL++WNGV+ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGSY 
Sbjct  65   NNIILNLINKLDQPFLLTWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSYT  124

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            YFPS  +H+AAGG+G + IY+  V+  P+  PD D  +LI DWY
Sbjct  125  YFPSTLMHRAAGGFGALNIYHRSVIPIPYANPDGDFTLLIGDWY  168


 Score = 93.6 bits (231),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH+M LVE EGS+ +++ +D+LD+HVGQS +V+V    
Sbjct  206   GKTYMFRISNVGLSTSLNFRIQGHSMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVTL--  263

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y   +     PL  +P
Sbjct  264   NQPPKDYYIVASTRFTRTVLTATAVLHYANSQTPVSGPLPAAP  306


 Score = 32.7 bits (73),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+++LD    L FPHG+LING 
Sbjct  173  KALQQTLDSGKSLPFPHGVLINGQ  196



>ref|XP_006416404.1| hypothetical protein EUTSA_v10007361mg [Eutrema salsugineum]
 gb|ESQ34757.1| hypothetical protein EUTSA_v10007361mg [Eutrema salsugineum]
Length=524

 Score =   226 bits (576),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 147/222 (66%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG + VTRTI L     ++ GK RY +N  SF   DTPLKLA
Sbjct  311   RTNLTASGPRPNPQGSYHYGMVKVTRTIKLVNSAGQIKGKQRYGVNSASFYPADTPLKLA  370

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I+GVY+LG+I E P  T + +   P  SV+Q +  DF +IVF N    VQ+WH +G
Sbjct  371   DYFKINGVYKLGSISEQP--TNKPIF--PATSVLQADYRDFVEIVFENRESIVQSWHFNG  426

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS    + YNL DAV R TVQVYP SWTA+YVA+DN GMWNLRS + +
Sbjct  427   YSFFVVGMELGKWSPASRKVYNLNDAVSRCTVQVYPRSWTAIYVALDNVGMWNLRSESWE  486

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             ++YLGQ+LY++V       +  S RDE  IP N + CG+A +
Sbjct  487   RQYLGQQLYMRVY-----TTSTSLRDEYQIPTNALLCGRAIK  523


 Score =   164 bits (416),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 117/163 (72%), Gaps = 2/163 (1%)
 Frame = +1

Query  67   VLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIH  240
            +LS  + +++E+  +F++W V++ T S +GV+++ I+IN  FPGP +   TND L +N+ 
Sbjct  3    LLSHIIAIAAEDPYKFFEWHVTYGTISPMGVQQQGILINKMFPGPEIRSVTNDNLIINVF  62

Query  241  NNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLH  420
            N LDEPFL+SW G+Q R +S+QDG+  T CPIPPGKN+TY+ Q+KDQIGS++YFPSL  H
Sbjct  63   NKLDEPFLISWGGIQNRKNSYQDGMYATTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFH  122

Query  421  KAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            KAAGG+G IRI   P+   PFP P  D  +LI DW+  + + +
Sbjct  123  KAAGGFGGIRISTRPLTPVPFPPPADDYTLLIGDWFKSNHKAL  165


 Score = 94.0 bits (232),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++TV++ F +LD+HVGQSYSV++ A  
Sbjct  197   GKTYRLRISNVGLQNSLNFRIQNHVMKLVEVEGTHTVQNVFSSLDVHVGQSYSVLITA--  254

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +  G + Y+   G    P+  +P
Sbjct  255   NQPAKDYYIVVSCRFTPKVLTTTGVLHYSNSAGPVSGPIPGAP  297


 Score = 43.5 bits (101),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L FP GILING G   A+L+ QPGK+
Sbjct  163  KALRTQLDNGGKLPFPDGILINGRG-SGATLNIQPGKT  199



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   224 bits (570),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RY IN VS+V PDTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGINSVSYVVPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I E P      L      SV+Q +   F +IVF N    VQ++HLDG
Sbjct  386   DYFKISGVFRVGSISERPTGGGLYL----DTSVMQADYRSFVEIVFQNNENIVQSYHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R T QVYPYSWTA+YVA+DN GMWNLR+    
Sbjct  442   YSFFVVGMDGGQWTTSSRNGYNLRDAVARCTTQVYPYSWTAIYVALDNVGMWNLRTEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N   CG+A+
Sbjct  502   RQYLGQQFYLRVY-----TASTSIRDEFPIPKNARLCGRAS  537


 Score =   178 bits (451),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
              V   L+C  +  SLF   S+E+  +F++W V++     LGV ++ I+IN QFPGP ++
Sbjct  6    AAVGALLLC--VSTSLFHITSAEDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIH  63

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N+ N+L+EPFL+SWNG+Q R +S++DGV GT CPIPPG+N+TY  Q+KDQI
Sbjct  64   SVTNDNLIINVFNSLNEPFLISWNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQI  123

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GS++YFPSL   KAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  124  GSFYYFPSLAFQKAAGGFGGIRILSRPRIPVPFPEPAGDYTVLIGDWYKSN  174


 Score = 90.9 bits (224),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H + LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  211   GKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+ AS RFS    +    +RY+   G    P    P
Sbjct  269   DQPSQDYYVVASTRFSSKILTTTAVLRYSNSAGAVSGPPPGGP  311


 Score = 35.0 bits (79),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LD+   L  P G+LING GP   S + + GK+
Sbjct  177  TLKAHLDKGKKLPIPDGVLINGRGPNGLSFNVEQGKT  213



>gb|KHF99853.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   223 bits (568),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLINTTRTIRLANSAGQVNGKQRYAVNSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GVY +G+I + P      L      SV+ ++   F +IVF N    VQ+WHLDG
Sbjct  383   DFFKIDGVYRIGSISDNPTGGGMYL----DTSVMNSDYRSFIEIVFQNDEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+A     YNL+DAV R T QVYP SWTA+YVA+DN GMWNLRS    
Sbjct  439   YSFFVVGMDGGQWTAASRNGYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNLRSEYWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVF-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   185 bits (470),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 121/168 (72%), Gaps = 4/168 (2%)
 Frame = +1

Query  40   ALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            A+ L+C+ +  SLFV   +E+  RF++W V++     LGV +  I+IN QFPGP ++  T
Sbjct  6    AVALICATV--SLFVIAGAEDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVT  63

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND L +N+ N+L+EPFL+SWNGVQ R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS+
Sbjct  64   NDNLIINVFNSLNEPFLLSWNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSF  123

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            +YFPSL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  124  YYFPSLGFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKAN  171


 Score = 79.7 bits (195),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H + LVE EG++T++  + ++D+H+GQS SV+  A  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIQNHKLKLVEVEGTHTLQTTYSSIDLHLGQSMSVLFTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
              +    YY+  S RF+    +    +RY
Sbjct  266   DQPAQDYYIVVSSRFTNPVLTSTATLRY  293


 Score = 39.3 bits (90),  Expect(4) = 5e-127, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP GILING GP  AS + + GK+
Sbjct  175  LRAQLDSGRKLPFPDGILINGRGPGGASFNVEQGKT  210



>ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN41233.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   223 bits (569),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L+     + GK RYA+N VSF+  DTPLKLA
Sbjct  323   RRNLTASGPRPNPQGSYHYGLINTTRTIRLQNSGPVINGKQRYAVNSVSFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++ I GV+ LG+IP+ P  +   L      SV++ +   F ++VF N   +V++WH+DG
Sbjct  383   DYYKIQGVFSLGSIPDYPTGSGGYLQT----SVMEADFRGFIEVVFENTEDTVESWHVDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G WS+    +YNL+D V RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  439   HSFFVVGMDGGQWSSASRLNYNLRDTVSRSTVQVYPKSWTAIYMPLDNVGMWNVRSENWV  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
              +YLGQ+ Y++V  P +     S RDE PIP+N I+CGKA
Sbjct  499   HQYLGQQFYLRVYSPAN-----SWRDEYPIPSNAIRCGKA  533


 Score =   186 bits (471),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = +1

Query  40   ALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            ++ + C L ++ L  CV  E+  RFY W V++     LGV+++ I+IN QFPGP +   T
Sbjct  4    SVRVCCVLFLVLLVACVRGEDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVT  63

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND L +N++N+LDEPFL+SWNGV  R +SWQDGV GTNCPI PG N+TY  Q+KDQIGSY
Sbjct  64   NDNLIINVYNSLDEPFLLSWNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSY  123

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FY+PSL  HKAAGGYG  +I + P +  PFP P  D  IL  DWY  +
Sbjct  124  FYYPSLAFHKAAGGYGGFKIASRPGIPVPFPTPAGDFTILAGDWYKRN  171


 Score = 87.8 bits (216),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH MT+VE EG++T+++ +D+LD+H+GQ+YSV+V A +
Sbjct  208   GKTYRFRISNVGLTTSINFRIQGHKMTIVEVEGTHTLQNVYDSLDVHLGQTYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRG  1097
                   Y +  + RF+    +     RY+   G
Sbjct  268   PPQ--DYLIVVTTRFTSQVLNATSIFRYSNSGG  298


 Score = 30.0 bits (66),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP GI+ING G    +     GK+
Sbjct  175  LRAILDGGSDLPFPDGIIINGRGSNAYTFTVDQGKT  210



>ref|XP_009777142.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=538

 Score =   221 bits (562),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQG+FHYG+I ++R+ VL      + GK RYA+N VS+V PDTPLKLA
Sbjct  323   RWNLTANAARPNPQGTFHYGKITISRSFVLANSAPLINGKLRYAVNRVSYVNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ L +I   P      L      +V   + HDF +IVF N   ++Q+WHLDG
Sbjct  383   DHFNIPGVFSLNSIQTFPSDGSPYL----ATAVFPASHHDFIEIVFQNNEATMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA  R T QVYP SWTA+ V++DN+GMWNLRS   D
Sbjct  439   YDFWVVGFGSGTWTQASRNKYNLVDAPTRHTTQVYPKSWTAILVSLDNQGMWNLRSAMWD  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ++Y++V  P       S  +E  IP N + CGKAA
Sbjct  499   RQYLGQQVYLRVYNPTQ-----SLANEYYIPTNALLCGKAA  534


 Score =   183 bits (465),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = +1

Query  31   GTVAL-PLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLL  201
            G VAL  L+C ++V      V +E+  R++ WT ++ T S LGV +++I+IN QFPGP L
Sbjct  2    GKVALFYLICGILVFGSVSVVKAEDAYRYFTWTATYGTASPLGVPQQIILINGQFPGPKL  61

Query  202  NGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQ  381
            +  TN+ + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ+KDQ
Sbjct  62   DLITNENVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQMKDQ  121

Query  382  IGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            IGSY YFPS  LH+A GG+G + IY   V+  P+  P  D  +LI DWY    +V+
Sbjct  122  IGSYTYFPSTQLHRAVGGFGALNIYARSVIPVPYAKPAGDFSLLIGDWYKSSHKVL  177


 Score = 90.1 bits (222),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+K + NFRIQGH M +VE EGS+ ++  +D+LD+HVGQS SV+V   +
Sbjct  208   GKTYMFRISNVGLKNTFNFRIQGHKMRVVEVEGSHVIQSLYDSLDVHVGQSMSVLVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+    +    + Y+  + +   P+  +P
Sbjct  268   PPK--DYYIVASTRFTRTVLTATAVLHYSNSQTSVSGPMPSAP  308


 Score = 33.5 bits (75),  Expect(4) = 6e-127, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVLR+ LD    L FP G+LING   +Q+S     GK+
Sbjct  175  KVLRQILDSGKSLPFPSGLLINGQ--KQSSFTGDQGKT  210



>emb|CDY55201.1| BnaCnng28410D, partial [Brassica napus]
Length=549

 Score =   223 bits (569),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  331   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFKPADTPLKLA  390

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY +G++   P      L      SV+Q +   F +IVF NP   VQTWHLDG
Sbjct  391   DYFKIDGVYRVGSVQSQPTGGGIYL----DTSVLQADYRTFVEIVFENPENIVQTWHLDG  446

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DA+ R TVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  447   YSFWVVGMDGGKWSPDSRNEYNLRDALARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  506

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N + CG+A+
Sbjct  507   RQYLGQQLYLRVY-----TTSTSLRDEFPIPKNALLCGRAS  542


 Score =   184 bits (467),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   IVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNI  237
            I+ SL   V++E+  RF++W V++     LGV ++ I+I+ +FPGP ++  TND L +NI
Sbjct  21   ILFSLLFAVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINI  80

Query  238  HNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHL  417
             NNLDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  
Sbjct  81   FNNLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAF  140

Query  418  HKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  141  HKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  180


 Score = 90.1 bits (222),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F + D+HVGQSYSV+V A  
Sbjct  216   GKTYRLRISNVGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSFDVHVGQSYSVLVTA--  273

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  274   DQPAHDYYVVVSSRFTSTVLTTTGVLRYSGSSGGVSGPIPGGP  316


 Score = 29.6 bits (65),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  184  LKAKLDSGRKLPLPDGILINGRG-TGATLNVEQGKT  218



>ref|XP_004292333.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Fragaria 
vesca subsp. vesca]
Length=588

 Score =   196 bits (498),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 140/227 (62%), Gaps = 18/227 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMAR-VYGKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG I VT   V+  + A  + GK R  +NG+S++ P TPLKL
Sbjct  340   RWNVSAGAARPNPQGSFKYGEITVTDLYVILNRPAELINGKWRTTLNGISYLTPSTPLKL  399

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPG---VSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             A  FNISGVY+L    + P+     L+ RP     S+I      F +I+F N   +VQ +
Sbjct  400   AQQFNISGVYKL----DFPN----KLMNRPAKLDTSLINGTFKGFMEIIFQNNDTTVQNY  451

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             HLDGY FFVVGM  G+W+     +YN  D V R T QV+P +WTA+ V++D+ G+WNLR+
Sbjct  452   HLDGYAFFVVGMDIGVWTENSRGTYNKWDGVARCTTQVFPGAWTAILVSLDSAGIWNLRA  511

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              N D  YLGQELY+ V  PE+D S      EA +P N I CG  + L
Sbjct  512   QNLDSWYLGQELYVSVVNPENDGS------EAALPDNAIYCGVLSSL  552


 Score =   189 bits (481),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            FYDWTVS+ T S LGV++KVI IN +FPGP+LN +TN  + +N+ N+LDEP L++WNG+Q
Sbjct  27   FYDWTVSYITASPLGVKQKVIGINGEFPGPVLNVTTNWNIVINVKNDLDEPLLLTWNGIQ  86

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
             R +SWQDGV GTNCPI  G NWTY FQ+KDQIGS+FYFPSL+  +AAGGYG I I N  
Sbjct  87   HRKNSWQDGVSGTNCPIQAGWNWTYDFQVKDQIGSFFYFPSLNFQRAAGGYGGITINNRA  146

Query  466  VVHPPFPCPDYDLDILISDWYTE  534
            ++  PF  PD D+ + I+DWYT+
Sbjct  147  IIPLPFALPDADVTLFITDWYTK  169


 Score =   113 bits (283),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +3

Query  816   AGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKAL  995
             AGKTY  R+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQS+S +V  +
Sbjct  218   AGKTYRFRVHNVGISTSLNFRIQNHNLLLVETEGSYTVQQNYANMDIHVGQSFSFLV-TM  276

Query  996   EHKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
             +    + YY+ ASPRF    S  +A+G+  + Y+  +G    PL   P  F
Sbjct  277   DQNASSDYYVVASPRFVNSSSWAKATGVAILHYSNSQGPASGPLPDPPNDF  327


 Score = 28.1 bits (61),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ ++    L  P GILING GP
Sbjct  172  KELRKDIESGTNLGIPDGILINGVGP  197



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   220 bits (560),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYA+N VSF+ PDTPLKLA
Sbjct  324   RRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSAPIIDGKQRYAVNSVSFIQPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I + P      L      SV+  +   F ++VF NP  +VQ+WH+DG
Sbjct  384   DYFKISGVFSIGSIQDNPTGGGAYLQT----SVMNADFRGFAELVFENPEDTVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G W       YNL+D + R TVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  440   HSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQVYPNSWTAIYMPLDNVGMWNVRSENWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A
Sbjct  500   RQYLGQQFYLRVYSPAN-----SWRDEYPIPRNALLCGRA  534


 Score =   189 bits (481),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = +1

Query  52   VCSLIVLSLFV--CVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            +C +I+++L    C + E+  RFY+W V++     LG++++ I+IN QFPGP +   TND
Sbjct  7    LCCVILVALLTVTCTNGEDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTND  66

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +N+ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSYFY
Sbjct  67   NLIINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFY  126

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL  HKAAGG+G I+I +  V+  PFP P  D  IL  DW++++
Sbjct  127  FPSLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKN  172


 Score = 92.0 bits (227),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+ TS+NFRIQGH M LVE EG++++++ + +LDIH+GQSYSV+V A  
Sbjct  209   GKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYSSLDIHLGQSYSVLVTA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
              +    YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  267   DQPAQDYYIVVSTRFTSQVLSTTSILHYSNSAGSVSGPPPGGPTTQ  312


 Score = 25.8 bits (55),  Expect(4) = 7e-127, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P G+LING G    +     GK+
Sbjct  176  LKAILDSGNNLPSPDGLLINGRGSNGFTFTVDQGKT  211



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   223 bits (567),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RY IN VS+V PDTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGINSVSYVVPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I E P      L      SV+Q +   F +IVF N    VQ++HLDG
Sbjct  386   DYFKISGVFRVGSISERPTGGGLYL----DTSVMQADYRSFVEIVFQNNENIVQSYHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R  +QVYPYSWTA+YVA+DN GMWNLR+    
Sbjct  442   YSFFVVGMDGGQWTTSSRNGYNLRDAVARCAIQVYPYSWTAIYVALDNVGMWNLRTEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N   CG+A+
Sbjct  502   RQYLGQQFYLRVY-----TASTSIRDEFPIPKNARLCGRAS  537


 Score =   178 bits (451),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
              V   L+C  +  SLF   S+E+  +F++W V++     LGV ++ I+IN QFPGP ++
Sbjct  6    AAVGALLLC--VSTSLFHITSAEDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIH  63

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N+ N+L+EPFL+SWNG+Q R +S++DGV GT CPIPPG+N+TY  Q+KDQI
Sbjct  64   SVTNDNLIINVFNSLNEPFLISWNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQI  123

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GS++YFPSL   KAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  124  GSFYYFPSLAFQKAAGGFGGIRILSRPRIPVPFPEPAGDYTVLIGDWYKSN  174


 Score = 91.3 bits (225),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H + LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  211   GKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+ AS RFS    +    +RY+   G    P    P
Sbjct  269   DQPSQDYYVVASTRFSSKIPTTTAVLRYSNSAGAVSGPPPGGP  311


 Score = 34.7 bits (78),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LD+   L  P G+LING GP   S + + GK+
Sbjct  177  TLKAHLDKGKKLPIPDGVLINGRGPNGLSFNVEQGKT  213



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   214 bits (544),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN  +T VLE    +V GK RY +N VSFV  DTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGLINXNKTYVLENSAGQVNGKQRYGVNSVSFVPADTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+  +   F +IVF N    +Q+WHLDG
Sbjct  386   DYFKIGGVFRVGSISDKPTGGGLYL----DTSVLGADYRTFVEIVFQNNEDIIQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+     +YNL+DAV R T QVYP SWTA+++A+DN GMWNLR+    
Sbjct  442   YSFFVVGMDGGQWTTASRDAYNLRDAVSRCTTQVYPKSWTAIHIALDNVGMWNLRTEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       S  S RDE PIP N   CG+A+
Sbjct  502   RQYLGQQLYLRVY-----TSSTSLRDEFPIPRNARLCGRAS  537


 Score =   183 bits (465),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 121/174 (70%), Gaps = 5/174 (3%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            VNG  A   + +L+ L+    ++  E   RF++W V++     LGV +K I+IN QFPGP
Sbjct  3    VNG--AGGAISALLCLAALFSIAVAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGP  60

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             ++  TND L +N+ N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPG+N+TY  Q+K
Sbjct  61   DIHSVTNDNLIINVFNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVK  120

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            DQIGS++YFPSL  HKAAGG+G IRI + P +  PFP PD D  +LI DWY  +
Sbjct  121  DQIGSFYYFPSLDFHKAAGGFGGIRILSRPRIPVPFPDPDGDYTVLIGDWYKSN  174


 Score = 93.6 bits (231),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  211   GKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              + G  YY+ AS RF+    +  G V Y    G    P    P
Sbjct  269   DQPGQDYYVVASSRFTSPILTTTGTVHYANSAGAVSGPPPGGP  311


 Score = 36.6 bits (83),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LD    L  P GILING GP   SL+F+ GK+
Sbjct  177  TLKAHLDSGKKLPSPDGILINGRGPGGFSLNFEQGKT  213



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   224 bits (570),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN+TRTIVL     +V GK RYAIN VS+V PDTPLKLA
Sbjct  325   RTNLTASGPRPNPQGSYHYGMINLTRTIVLSSSAGQVNGKQRYAINSVSYVAPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I+GVY  G+I + P      L      SV+QT+   F +IVF N    +Q++HLDG
Sbjct  385   DFFKIAGVYRPGSISDRPSGGGIYL----DTSVMQTDYRTFVEIVFQNDEDILQSYHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W++     YNL+DAV RST QVYP SWTA+YV +DN GMWNLRS    
Sbjct  441   YSFFVVGMDGGQWTSDKRNQYNLRDAVSRSTTQVYPKSWTAIYVPLDNVGMWNLRSEFWA  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A 
Sbjct  501   RQYLGQQFYMRVY-----TTSTSLRDEYPIPKNALLCGRAT  536


 Score =   176 bits (446),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 4/169 (2%)
 Frame = +1

Query  43   LPLVCSLIVL----SLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            L L+C  + L    +  +      RF++W V++     LGV ++ I+IN QFPGP ++  
Sbjct  5    LVLLCVSVYLFAITTTIIVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSV  64

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TND L +N+ N+LDEPFL+SWNGVQ R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS
Sbjct  65   TNDNLIINVFNSLDEPFLISWNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGS  124

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            ++YFPSL  HKAAGG+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  125  FYYFPSLAFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTVLIGDWYKSN  173


 Score = 91.3 bits (225),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  210   GKTYRLRISNVGLENSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
              +    YY+  S RF+    +  G +RY
Sbjct  268   DQPSQDYYIVVSSRFTNPVLTSTGILRY  295


 Score = 35.8 bits (81),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING G   +SL+ + GK+
Sbjct  177  LKAQLDNGKKLPFPDGILINGRGSGGSSLNVEQGKT  212



>ref|XP_010529443.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   224 bits (571),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 144/220 (65%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I   RTI++      + GK RYA NGVSFV PDTPLKLA
Sbjct  322   RRNLTASGPRPNPQGSYHYGMIKPGRTIIVSNSAPYINGKQRYAANGVSFVAPDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ LG+IP  P       L     SV+  N  +F +IVF N   +VQ+WH+DG
Sbjct  382   DYFKISGVFNLGSIPTSPSGGNGGSLQ---TSVMAANFREFIEIVFQNWENTVQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+A     YNL DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS    
Sbjct  439   YSFFVVGMEGGQWTAGSRAKYNLHDAVARSTVQVYPRAWTAIYIALDNVGMWNIRSEEWG  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V       S  S RDE PIP N + CG+A
Sbjct  499   RQYLGQQFYLRVW-----TSSTSYRDEYPIPKNALLCGRA  533


 Score =   178 bits (452),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            V ++++L L   V  E   RF+ W V++     LGV+++ I+IN QFPGP ++  TND L
Sbjct  7    VSAILLLVLVNGVFGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNL  66

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             ++++N L+EPFL+SWNG+Q R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGSYFYFP
Sbjct  67   IISVYNYLNEPFLISWNGLQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSYFYFP  126

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            SL  HKAAG +G IR+++ P +  PF  PD D  +L  DWY  +  V+
Sbjct  127  SLAFHKAAGAFGAIRVWSRPQIPVPFSPPDGDFWLLAGDWYKTNHYVL  174


 Score = 89.7 bits (221),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 67/104 (64%), Gaps = 4/104 (4%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EGS+TV++ + +LDIH+GQSYSV+V    
Sbjct  207   GKTYRFRISNVGLATSINFRIQGHTMKLVEVEGSHTVQNVYSSLDIHLGQSYSVLVTT--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y N  RG  G P+   P
Sbjct  265   NQAPQDYYIVVSSRFTRKVLTTTAVLHYSNSGRGVSG-PVPSGP  307


 Score = 34.7 bits (78),  Expect(4) = 8e-127, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L FP GILING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNLPFPDGILINGRGWGGNTFTVQPGKT  209



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score =   220 bits (560),  Expect(4) = 9e-127, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 148/220 (67%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG I  T+TIVL    + + GK RY +N VS+V PDTPLKLA
Sbjct  325   RWNLTANAARPNPQGSYHYGEITPTKTIVLSNSASLINGKLRYTVNKVSYVNPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G+Y + ++  +P       +A    SV+ T+LHDF ++VF N   + Q+WHLDG
Sbjct  385   DYFNIPGIYSVDSLQSLPSDNTPSSVA---TSVVPTDLHDFIEVVFQNNENTTQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP +WT + V++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGFGEWTPAKRRTYNLVDALTRHTAQVYPNAWTGILVSLDNQGMWNLRSAMWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V   E      S  +E  IP NV+ CGKA
Sbjct  502   RQYLGQQLYLRVWTSER-----SLANEYDIPDNVLLCGKA  536


 Score =   180 bits (456),  Expect(4) = 9e-127, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            ++Y WTV++ T S LG  ++VI+IN QFPGP L+  TND + +N+ N LDEPFL++WNG+
Sbjct  31   KYYTWTVTYGTLSPLGTPQQVILINGQFPGPQLDLVTNDNVVLNLVNKLDEPFLLTWNGI  90

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCP+PP  N+TY FQ KDQIG+Y YFPS  LHKAAGG+G + +Y+ 
Sbjct  91   KQRKNSWQDGVLGTNCPVPPNANYTYKFQAKDQIGTYTYFPSTSLHKAAGGFGGLNVYHR  150

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
             V+  P+P PD D  +LI DWY  +
Sbjct  151  SVIPVPYPYPDGDFTLLIGDWYKTN  175


 Score = 93.6 bits (231),  Expect(4) = 9e-127, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH + LVE EGS+T+++ +D LD+HVGQS +V+V    
Sbjct  210   GKTYMFRISNVGMSTSINFRIQGHTLKLVEIEGSHTLQNVYDTLDVHVGQSATVLVTL--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
             ++    YY+ AS RFS    +    + Y+        PL   P+
Sbjct  268   NQPPKDYYIVASTRFSRKMFTATAVLHYSNSNSPASGPLPSPPI  311


 Score = 33.5 bits (75),  Expect(4) = 9e-127, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            K LRESLD    L FP G+LING  
Sbjct  177  KSLRESLDSGNSLAFPDGLLINGQA  201



>ref|XP_002310162.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE90612.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=538

 Score =   214 bits (544),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 145/218 (67%), Gaps = 9/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++   AARPNPQGS+HYG+I  T+TI L      + GK RYA+N VS++  DTPLKLAD+
Sbjct  325   NLTASAARPNPQGSYHYGKITPTKTIELANSAPLINGKQRYAVNRVSYINSDTPLKLADY  384

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ + +I   P      L      SV+  NLHDF ++VF N  +++Q+WHLDGY+
Sbjct  385   FGIPGVFSVDSIESSPSGGAAFL----STSVMSANLHDFLEVVFQNDEKTMQSWHLDGYD  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             F+V+G G G W++     YNL DA+ R TVQVYP SWTA+YV++DN+GMWN+RS   +++
Sbjct  441   FWVIGYGNGQWTSAKRSMYNLVDALTRHTVQVYPKSWTAIYVSLDNQGMWNMRSALWERQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V          S  +E  IP+N ++CGKA
Sbjct  501   YLGQQFYLRVWTQVH-----SLANEYDIPSNALRCGKA  533


 Score =   190 bits (482),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L L+C ++ +     V++++  R+Y WTV++ T  +L V ++VI+IN QFPGP L+ 
Sbjct  4    AVLLHLLCGVLAVLSASLVNADDPYRYYTWTVTYGTVKLLDVPQQVILINGQFPGPRLDV  63

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  64   VTNDNIILNLFNKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  123

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            S+ YFPS  LH+AAGGYG I IY  P +  PFP PD D  +LI DWY
Sbjct  124  SFTYFPSTLLHRAAGGYGAINIYERPRIPIPFPVPDGDFTLLIGDWY  170


 Score = 95.9 bits (237),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISN+G+ TSLNFRIQGH+M LVE EGS+TV++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNMGMSTSLNFRIQGHSMKLVEVEGSHTVQNIYDSLDVHVGQSVAVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y+  R     PL  +P
Sbjct  266   NQAPKDYYIIASTRFNRKILTTTAVLHYSNSRTPASGPLPAAP  308


 Score = 27.3 bits (59),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+  LD    L FP G+LING 
Sbjct  175  KTLQAYLDSGKTLPFPDGVLINGQ  198



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   219 bits (559),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY +G+I   P      L      SV+Q +   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRVGSIQSQPTGGGIYL----DTSVLQVDYRSFVEIVFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+Y+A+DN GMWN+RS    
Sbjct  439   YSFWVVGMDGGQWSPDSRNGYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNIRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQLYLRVY-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   184 bits (467),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            +I  SL   V++E+  RF++W V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   IIGFSLLFAVTAEDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 92.4 bits (228),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG +T++  F +LD+HVGQSYSV++ A +
Sbjct  208   GKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGIHTLQTTFSSLDVHVGQSYSVLITADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  268   PPR--DYYVVVSSRFTSAVLTTTGVLRYSNSAGGVSGPIPGGP  308


 Score = 30.0 bits (66),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  176  LKAQLDSGRKLPLPDGILINGRG-SGATLNVEQGKT  210



>ref|XP_007047153.1| SKU5 similar 17 isoform 2 [Theobroma cacao]
 gb|EOX91310.1| SKU5 similar 17 isoform 2 [Theobroma cacao]
Length=539

 Score =   226 bits (576),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 152/221 (69%), Gaps = 10/221 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+TIVL    + + GK RY +NGVSFV PDTPLKLA
Sbjct  323   RWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I ++P        A    SV+ T+LHDF ++VF N   ++Q+WHLDG
Sbjct  383   DYFNIPGVFSMSSIQDLPSGG----AATVATSVVPTSLHDFIEVVFQNNENTMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQ-VYPYSWTAVYVAMDNEGMWNLRSGNA  1723
             Y+F+VVG G G W+    R+YNL DA+ R T Q VYP SWTA+ V++DN+GMWN+RS   
Sbjct  439   YDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQVVYPNSWTAILVSLDNQGMWNMRSAMW  498

Query  1724  DQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             +++YLGQ+ Y++V  P       S  +E  IP+NV+ CGKA
Sbjct  499   ERQYLGQQFYLRVWTPVR-----SFANEYDIPSNVLLCGKA  534


 Score =   174 bits (442),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            V L L+  ++ +     V++E+   +Y WTV++ TRS+LGV ++VI+INDQFPGP L   
Sbjct  5    VMLRLLFGVLAVLSVSLVNAEDPYLYYTWTVTYGTRSLLGVPQQVILINDQFPGPKLEVV  64

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TN+ + +N+ N LD+PFL++WNGV+ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS
Sbjct  65   TNNNIILNLINKLDQPFLLTWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGS  124

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            Y YFPS  +H+AAGG+G + IY+  V+  P+  PD D  +LI DWY
Sbjct  125  YTYFPSTLMHRAAGGFGALNIYHRSVIPIPYANPDGDFTLLIGDWY  170


 Score = 94.0 bits (232),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH M LVE EGS+ +++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y   +     PL  +P
Sbjct  266   NQPPKDYYIVASTRFTKTVLTATAVLHYTNSQTPVSGPLPAAP  308


 Score = 31.2 bits (69),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+++LD    L FP G+LING    Q +   + GK+
Sbjct  175  KTLQQTLDSGKSLPFPDGVLINGQ--TQTTFSGEQGKT  210



>gb|ABK25324.1| unknown [Picea sitchensis]
Length=538

 Score =   208 bits (529),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 140/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN +RTI+L      + GK RYA+N VS++  DTPLKLA
Sbjct  327   RWNLTASGPRPNPQGSYHYGMINTSRTIILANSAPVINGKQRYAVNSVSYIPSDTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+  I+GV+ +G++P+ P      L      +V+  +   F +IVF N   +VQ+WHLDG
Sbjct  387   DNLKITGVFVVGSMPDKPTNGGGYLQT----AVMGADFRAFVEIVFQNNEDTVQSWHLDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFV+GM  G W+   ++ YNL D V R T QVYP SWTA+ V +DN GMWNLRS N  
Sbjct  443   YSFFVLGMDGGQWTQASIKEYNLFDTVSRCTTQVYPQSWTAIRVPLDNVGMWNLRSENWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE  IP N +KCG+  
Sbjct  503   RQYLGQQFYLRVYSPVG-----SFRDEYSIPNNALKCGRVG  538


 Score =   170 bits (431),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = +1

Query  49   LVCSLIVLSLF-VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            L+ S+  L LF   V+ E+  +F+ W +++     LGV ++ I+IN QFPGP ++  TND
Sbjct  11   LLLSIFALVLFGSSVNGEDPYKFFTWNITYGIIYPLGVPQQGILINGQFPGPPIDSVTND  70

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             + +N++NNL EPFL+SWNG+Q R +SWQDG+  TNCPIPPG+N+TY FQ+KDQIGSY+Y
Sbjct  71   NIIINVYNNLPEPFLLSWNGIQQRRNSWQDGMPETNCPIPPGRNYTYKFQMKDQIGSYYY  130

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            FPS++LHKAAGG+G I+I + P++  PFP P  D  +LI DWY  +  ++
Sbjct  131  FPSMYLHKAAGGFGGIKIVSRPLIPVPFPPPAGDYTVLIGDWYKTNHSIL  180


 Score =   111 bits (278),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ +SLNFRIQGH M LVE EGS+TV++ +D+LDIH+GQSYSV+V A +
Sbjct  213   GKTYRFRISNVGLASSLNFRIQGHKMKLVEVEGSHTVQNTYDSLDIHLGQSYSVLVTADQ  272

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YYM AS RFS    +GI F+RY+  + +   PL  +P
Sbjct  273   PPQ--DYYMVASTRFSTPILTGISFLRYSNSQKSASGPLPPAP  313


 Score = 36.2 bits (82),  Expect(4) = 1e-126, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             +LR++LD   +L  P G+LING  P   S     GK+
Sbjct  178  SILRQTLDSGSILGVPDGVLINGRAPNATSFTVDQGKT  215



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   226 bits (577),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 148/223 (66%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRT+ L+     + GK R+A+N VSF+  DTPLKLA
Sbjct  329   RRNLSASGPRPNPQGSYHYGLINTTRTVRLQNSAPIINGKQRFAVNSVSFISADTPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DH+NI GV+ L +IP+ P      L      SV+  +   + +IVF NP  +VQ+WH+DG
Sbjct  389   DHYNIPGVFSLVSIPDSPTGGGAYL----PTSVMAADFRGYAEIVFENPEDNVQSWHIDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G WS     SYNL+D + R TVQVYP SWTAVY+ +DN GMWN+RS N  
Sbjct  445   HNFFVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPESWTAVYMPLDNVGMWNVRSENWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+AA L
Sbjct  505   RQYLGQQFYLRVYSPAN-----SWRDEYPIPTNALLCGRAAGL  542


 Score =   181 bits (460),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 116/165 (70%), Gaps = 4/165 (2%)
 Frame = +1

Query  55   CS--LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            CS  L VL L  C + E+  RF+ W V++     LGV+++ I+IN  FPGP +   TND 
Sbjct  13   CSFMLAVLLLVTCTAGEDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDN  72

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L +++ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSYFYF
Sbjct  73   LIISVFNSLDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYF  132

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PSL +HKAAGG+G  +I +  V+  PFP P  D   L  DW+ ++
Sbjct  133  PSLGMHKAAGGFGGFKIASRSVIPVPFPPPSGDFTFLAGDWFKKN  177


 Score = 89.7 bits (221),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++++++ +D+LDIH+GQSYSV+V A +
Sbjct  214   GKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYDSLDIHLGQSYSVLVTADQ  273

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
               +   Y++  S RF+    +    + Y+   G+    +S +PL
Sbjct  274   AAH--DYFIVVSTRFTSQVLTTTSILHYSNSAGS----VSDAPL  311


 Score = 28.1 bits (61),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +     GK+
Sbjct  181  LKAILDGGSDLPFPDGLLINGRGSNGYTFTVDQGKT  216



>ref|XP_009128157.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   221 bits (563),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 144/222 (65%), Gaps = 10/222 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQI-VFHNPLRSVQTWHLD  1543
             D+F I GVY +G+I   P      L      SV+QT+   F +I VF NP   VQTWHLD
Sbjct  383   DYFKIDGVYRVGSIQSQPTGGGIYL----DTSVMQTDYRTFIEIIVFENPENIVQTWHLD  438

Query  1544  GYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNA  1723
             GY+F+VVGM  G WS      YNL+DA+ R TVQVYP SWTA+Y+A+DN GMWNLRS   
Sbjct  439   GYSFWVVGMDGGKWSPDSRNEYNLRDALARCTVQVYPSSWTAIYIALDNVGMWNLRSEFW  498

Query  1724  DQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
              ++YLGQ+LY++V       +  S RDE PIP N + CG+A+
Sbjct  499   ARQYLGQQLYLRVY-----TTSTSLRDEFPIPKNALLCGRAS  535


 Score =   184 bits (466),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = +1

Query  64   IVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNI  237
            IV S+   V++E+  RF++W V++     LGV ++ I+I+ +FPGP ++  TND L +NI
Sbjct  13   IVFSILFTVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINI  72

Query  238  HNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHL  417
             NNLDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  
Sbjct  73   FNNLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAF  132

Query  418  HKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  133  HKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 91.7 bits (226),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A +
Sbjct  208   GKTYRLRISNVGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               +   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  268   PAH--DYYVVVSSRFTSTVLTTTGVLRYSGSSGGVSGPIPGGP  308


 Score = 29.6 bits (65),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  176  LKAKLDSGRKLPLPDGILINGRG-TGATLNVEQGKT  210



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   223 bits (568),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 145/221 (66%), Gaps = 8/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG +NV+RTI L    A+V GK RY +NGVSF+  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLVNVSRTIRLSSSAAQVNGKQRYGVNGVSFIPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+++G+I + P     L L     +V+  +   F +IVF NP   VQ+WHLDG
Sbjct  383   DYFKIDGVFKVGSIQDNPTGQKSLYLD---TAVMGADFRTFVEIVFENPENIVQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y F+VVGM  G W+    + YNL DAV R T QVYP SWTAVYVA+DN GMWN+RS    
Sbjct  440   YYFWVVGMDGGKWTPDSRKEYNLVDAVSRHTTQVYPKSWTAVYVALDNVGMWNVRSQFWT  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE PIP N + CG+AA
Sbjct  500   RQYLGQQFYLRVYSPVG-----SVRDEYPIPKNALLCGRAA  535


 Score =   181 bits (458),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF++W V++     LG++++ I+IN QFPGP +   TND L +N+HN+L EPFL++WNGV
Sbjct  27   RFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLITWNGV  86

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS++YFPSL  HKAAGG+G I+I + 
Sbjct  87   QQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKILSR  146

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
            P +  PFP P  D  +LI DWY  D
Sbjct  147  PRIPVPFPEPAADYSLLIGDWYNLD  171


 Score = 94.7 bits (234),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ +LNFRIQGH M LVE EG++TV+  +D+LD+HVGQSYSV++ A +
Sbjct  208   GKTYRLRISNVGMQNTLNFRIQGHQMKLVEVEGTHTVQTTYDSLDVHVGQSYSVLITADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +    + Y+  R     P+   P
Sbjct  268   APQ--DYYIVTSTRFTSKVLTSTAVLHYSNSRRQVSGPIPGGP  308


 Score = 27.3 bits (59),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 21/45 (47%), Gaps = 0/45 (0%)
 Frame = +2

Query  608  DYMVL*LKVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            D+  L  K L+  LD    L  P G+LING G        + GK+
Sbjct  166  DWYNLDHKRLQAILDNGHRLPNPQGLLINGRGGNDTWFTVEQGKT  210



>gb|KDP31876.1| hypothetical protein JCGZ_12337 [Jatropha curcas]
Length=538

 Score =   218 bits (555),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 149/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG+I  T+TIVL      + GK RYA+N VS+V  DTPLKLA
Sbjct  323   RWNLTASAARPNPQGSYHYGKIIPTKTIVLANSAPLINGKKRYAVNRVSYVNADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I  +P        A    SVI  +LHDF +++F N   ++Q+WHLDG
Sbjct  383   DYFNIPGVFSVDSIQTLPSGG----PAYIATSVIPNSLHDFVEVIFQNNEYAMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  439   YDFWVVGYGNGQWTQNKRRMYNLVDALTRHTAQVYPNSWTAILVSLDNQGMWNMRSAIWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  PE      S  +E  IP NV+ CGKAA
Sbjct  499   RQYLGQQLYLRVWTPEH-----SLANEYDIPNNVLLCGKAA  534


 Score =   181 bits (459),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 115/168 (68%), Gaps = 1/168 (1%)
 Frame = +1

Query  49   LVCSLIVL-SLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
             V  L+VL +  V      R+Y WTV++ T S LG  ++VI+IN QFPGP L+  TND +
Sbjct  10   FVGLLVVLGASLVNADDPYRYYTWTVTYGTISPLGKPQQVILINGQFPGPRLDVVTNDNI  69

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG++ YFP
Sbjct  70   ILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTFTYFP  129

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            S   H+AAGGYG + +Y  P +  PF  PD D  +LI DWYT D + +
Sbjct  130  STLFHRAAGGYGGLNVYERPKIPIPFANPDGDFTLLIGDWYTTDHKTL  177


 Score = 95.1 bits (235),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH + LVE EGS+T+++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNVGLSTSLNFRIQGHTLKLVEVEGSHTLQNIYDSLDVHVGQSVAVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
             ++    YY+ AS RF+    +    + Y   +     PL  +P+
Sbjct  266   NQPPKDYYIVASTRFTKQVLTATAVLHYKNSQTPASGPLPAAPI  309


 Score = 31.6 bits (70),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+ESLD    L FP G+LING 
Sbjct  175  KTLQESLDSGKSLPFPDGVLINGQ  198



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   217 bits (552),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 140/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +I+F N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRTGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWSPASRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  P       S RDE P+P N + CG+A+
Sbjct  499   RQYLGQQLYLRVYTPS-----TSLRDEYPVPRNALLCGRAS  534


 Score =   186 bits (471),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            LI LSL   V++E+  RF++W +++     LGV ++ I+IN QFPGP ++  TND + +N
Sbjct  12   LIGLSLLFAVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSN  172


 Score = 93.6 bits (231),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A +
Sbjct  208   GKTYRLRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  268   PPK--DYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGP  308


 Score = 29.3 bits (64),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L  P GILING     A+L+ + GK+
Sbjct  176  LRAQLDNGKKLPLPDGILINGRS-SGATLNVEQGKT  210



>ref|XP_006411628.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
 gb|ESQ53081.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
Length=551

 Score =   226 bits (577),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 151/223 (68%), Gaps = 7/223 (3%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYGRI ++RT++LE   A V  K RYAINGVSFV+ DTPLKLA
Sbjct  328   RTNLTASGPRPNPQGSYHYGRIKISRTLILESSAALVKRKQRYAINGVSFVHADTPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+++G+IP+ P      +  +   SV+  +   F +IVF N  + VQ++HLDG
Sbjct  388   DYFKIGGVFKVGSIPDKPRRIGGGV--KLDTSVMGAHHRAFLEIVFQNREKIVQSYHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS    R YNL+DAV RST QVYP SWTAVYVA+DN GMWNLRS    
Sbjct  446   YSFWVVGMDRGTWSHASRREYNLRDAVSRSTTQVYPESWTAVYVALDNVGMWNLRSEFWA  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+ Y++V  P       S RDE  +P N + CG+A+ +
Sbjct  506   RQYLGQQFYLRVYSPVH-----SIRDEYLLPKNALLCGRASNI  543


 Score =   196 bits (497),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 122/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            VC ++++++   V +E+  RF+DW V++     LG+ ++ I+IN QFPGP +   TN+ L
Sbjct  9    VCMVMMMTIISFVHAEDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNNNL  68

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+HN+LDEPFL+SWNGVQLR +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS+FYFP
Sbjct  69   IINVHNDLDEPFLLSWNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFP  128

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            SL LHKAAGG+G  RI + P +  PFP P  D   LI DWYT+
Sbjct  129  SLALHKAAGGFGGHRILSRPRIPVPFPDPAGDFTFLIGDWYTK  171


 Score = 76.3 bits (186),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNF+I  H M LVE EG++TV+  + +LDIHVGQSYSV+V   +
Sbjct  211   GKTYRFRISNVGLQHSLNFKILDHEMKLVEVEGTHTVQSMYTSLDIHVGQSYSVLVTMDQ  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
              +    Y +  + RF+  +      + Y+  R N    LS +P+
Sbjct  271   PEK--DYSIVVATRFTAKKLLVSSTLHYSNSRQN----LSSAPI  308


 Score = 27.3 bits (59),  Expect(4) = 2e-126, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPE-QASLDFQPGKS  742
            K L+  LDR   L  P  +LING G    +SL    GK+
Sbjct  175  KTLKALLDRGHKLPLPDEVLINGRGVSFSSSLTVHRGKT  213



>emb|CBI18560.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   225 bits (573),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  +RTI+L     R+ GK RYA+NGVS++  DTPLKLA
Sbjct  320   RWNLTASAARPNPQGSFHYGKITPSRTIMLVNSAPRLNGKQRYAVNGVSYINADTPLKLA  379

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I ++P      L      SV+  N HDF ++VF N   ++Q+WHLDG
Sbjct  380   DYFNIPGVFSVNSIQDLPSGGSSFL----STSVMAANHHDFIEVVFQNNENTIQSWHLDG  435

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    +SYNL DA+ R T QVYP SWT ++V++DN+GMWN+RS   +
Sbjct  436   YDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQVYPRSWTTIWVSLDNQGMWNMRSAVWE  495

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       SP +E  IP N + CGKA
Sbjct  496   RQYLGQQFYLRVFNPVH-----SPANEYDIPKNALLCGKA  530


 Score =   179 bits (453),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 119/167 (71%), Gaps = 5/167 (3%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L L+C  ++L +F+ V+ E+  ++Y WTV++ T S LGV ++VI+IN QFPGP L  
Sbjct  4    AVLLHLIC--VLLGVFL-VNGEDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEV  60

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +++ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  61   VTNDNIILDLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  120

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            ++ YFPS   HKAAGG+G I +Y  P +  PFP P  D  +L+ DWY
Sbjct  121  TFTYFPSTLFHKAAGGFGAINVYERPRIPIPFPDPAGDFTLLVGDWY  167


 Score = 92.0 bits (227),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH M LVE EGS+T+++ +D+LD+HVGQS +V+V   +
Sbjct  205   GKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSLDVHVGQSIAVLVTLDQ  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
                   YY+ AS RF+    +    + Y     N  TP+S
Sbjct  265   LPK--DYYIVASTRFTKQILTATAVLHYT----NSHTPVS  298


 Score = 29.6 bits (65),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L+++LD    L FP G+LING      S D
Sbjct  172  KTLQQTLDSGKPLPFPDGVLINGQTSSSFSGD  203



>ref|XP_002270831.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=536

 Score =   225 bits (573),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  +RTI+L     R+ GK RYA+NGVS++  DTPLKLA
Sbjct  321   RWNLTASAARPNPQGSFHYGKITPSRTIMLVNSAPRLNGKQRYAVNGVSYINADTPLKLA  380

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I ++P      L      SV+  N HDF ++VF N   ++Q+WHLDG
Sbjct  381   DYFNIPGVFSVNSIQDLPSGGSSFL----STSVMAANHHDFIEVVFQNNENTIQSWHLDG  436

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    +SYNL DA+ R T QVYP SWT ++V++DN+GMWN+RS   +
Sbjct  437   YDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQVYPRSWTTIWVSLDNQGMWNMRSAVWE  496

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       SP +E  IP N + CGKA
Sbjct  497   RQYLGQQFYLRVFNPVH-----SPANEYDIPKNALLCGKA  531


 Score =   179 bits (453),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 119/167 (71%), Gaps = 5/167 (3%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
             V L L+C  ++L +F+ V+ E+  ++Y WTV++ T S LGV ++VI+IN QFPGP L  
Sbjct  5    AVLLHLIC--VLLGVFL-VNGEDPYKYYTWTVTYGTISPLGVPQQVILINGQFPGPALEV  61

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TND + +++ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  62   VTNDNIILDLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIG  121

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            ++ YFPS   HKAAGG+G I +Y  P +  PFP P  D  +L+ DWY
Sbjct  122  TFTYFPSTLFHKAAGGFGAINVYERPRIPIPFPDPAGDFTLLVGDWY  168


 Score = 92.0 bits (227),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH M LVE EGS+T+++ +D+LD+HVGQS +V+V   +
Sbjct  206   GKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSLDVHVGQSIAVLVTLDQ  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
                   YY+ AS RF+    +    + Y     N  TP+S
Sbjct  266   LPK--DYYIVASTRFTKQILTATAVLHYT----NSHTPVS  299


 Score = 29.6 bits (65),  Expect(4) = 3e-126, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L+++LD    L FP G+LING      S D
Sbjct  173  KTLQQTLDSGKPLPFPDGVLINGQTSSSFSGD  204



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   210 bits (534),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 142/225 (63%), Gaps = 19/225 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG I +TRTI L      + GK RYA+NGVS++   TPL+LA
Sbjct  324   RWNLTASAARPNPQGSYHYGNITITRTIKLANSAPFINGKQRYAVNGVSYLPSATPLQLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQT-----NLHDFTQIVFHNPLRSVQT  1531
             D++NISGV+  G IP+ P         R G   +QT         F ++VF N   ++Q+
Sbjct  384   DYYNISGVFTAGGIPDSP---------RGGSGYLQTAALSVEYRAFIEVVFQNYESTIQS  434

Query  1532  WHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLR  1711
             WHLDGY+FFVVGM  G W+  + + YNL DAV R T QVYP SWTAV +  DN G+WNLR
Sbjct  435   WHLDGYSFFVVGMDGGDWTPANRKGYNLFDAVSRCTTQVYPNSWTAVLLTFDNAGLWNLR  494

Query  1712  SGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             S   ++++LGQ+ Y++VK P       S RDE  IP N + CGKA
Sbjct  495   SQTWERQFLGQQTYVRVKSPVK-----SLRDEYDIPHNALLCGKA  534


 Score =   188 bits (478),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 127/169 (75%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            ++C  +V++ F    +E+  +F+ W V++ T   LG+ ++ I+IN QFPGP ++  TND 
Sbjct  8    VICVFLVIAFFGYSLAEDPYKFFTWNVTWGTIWPLGIPQQGILINGQFPGPRIDSVTNDN  67

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + VN+ N+LD+PFL+SW+G+Q R +SWQDGV GTNCPIPPG+N+TY FQ+KDQIGSY+YF
Sbjct  68   IIVNVFNSLDQPFLISWSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKDQIGSYYYF  127

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS+++HKAAGG+G + + + P++  PFP P+ D+ +LI DWY  +  ++
Sbjct  128  PSMYMHKAAGGFGGLSVVSRPLIPVPFPAPNGDITLLIGDWYKANHTIL  176


 Score = 99.0 bits (245),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+ +SLNFRIQGH + LVE EGS+TV++ +D+LDIHVGQ+YSV+V    
Sbjct  210   GKTYRLRISNVGLSSSLNFRIQGHKLKLVEVEGSHTVQNVYDSLDIHVGQTYSVLVTT--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLK  1133
              +    YYM AS RF+    +G+    Y+  +     P+  +P +
Sbjct  268   DQPSQDYYMVASTRFTSPVLTGLATFHYSNSQKKVSGPIPGAPTE  312


 Score = 27.3 bits (59),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 21/38 (55%), Gaps = 1/38 (3%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQ-ASLDFQPGKS  742
            +LR +LD    L  P  ++ING GP   A++    GK+
Sbjct  175  ILRRTLDMGRSLGKPDAVVINGRGPASGATITVDQGKT  212



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   220 bits (560),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY +G+I   P      L      SV+QT+   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRVGSIQSQPTGGGIYL----DTSVMQTDYRTFIEIVFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV R TVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVY-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   181 bits (460),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
             N ++A  L+    +L   V   S  RF++W V++     LGV ++ I+IN QFPGP ++
Sbjct  3    ANASLAAALIVGFALL-FAVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIH  61

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N++N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQI
Sbjct  62   SVTNDNLIINVYNSLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQI  121

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GS++YFPSL  HKAAGG+G +RI + P +  PF  P  D  +LI DWY  +
Sbjct  122  GSFYYFPSLAFHKAAGGFGGLRILSRPGIPVPFADPAGDYTVLIGDWYKAN  172


 Score = 92.8 bits (229),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISN+G++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  266   DQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGP  308


 Score = 30.0 bits (66),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  176  LKAQLDSGRKLPLPDGILINGRG-SGATLNVEQGKT  210



>ref|XP_008241558.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=537

 Score =   221 bits (564),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 146/222 (66%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I + R +VL    A++ GK RYA+N +S+V P+TPLKLA
Sbjct  325   RLNLTANAARPNPQGSFHYGTIPIVRRLVLANTAAKIGGKLRYAVNKISYVDPETPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D  NI GV+ LGTI + P     +     G SV+ T LHDF +IVF N   ++Q+WHLDG
Sbjct  385   DWLNIPGVFNLGTIKDTPTPGPAVF----GASVVGTTLHDFVEIVFQNTEPTLQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R YNL DAV R TVQVYP  W+AV V++DN+GMWNLRS    
Sbjct  441   YSFYVVGYGSGNWTPDMRRRYNLVDAVSRHTVQVYPTGWSAVLVSLDNKGMWNLRSAIWS  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQ+LY++V   E      S   E  +P N + CGKA  
Sbjct  501   RRYLGQQLYVRVWNNEH-----SLFTETDMPLNALLCGKAKH  537


 Score =   181 bits (459),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            LV  L+ LS F  +++E+   +Y WTV++   S LG+ +K I+IN QFPGP +   TND 
Sbjct  10   LVGILVSLSAFCIINAEDPYLYYTWTVTYGLVSPLGIPQKGILINGQFPGPTIEAVTNDN  69

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + VN+ N LDEPFL++WNG++ R ++WQDGV GTNCPIPP  NWTY FQ KDQIG++ YF
Sbjct  70   IIVNVINKLDEPFLITWNGIKQRKTTWQDGVLGTNCPIPPNTNWTYKFQAKDQIGTFNYF  129

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS  LH+A GG+G   I    V+  P+P P  +  +L+SDWY    +V+
Sbjct  130  PSTKLHRAVGGFGGFNIAQRSVIAVPYPIPAGEFTLLVSDWYKNSHKVL  178


 Score = 90.9 bits (224),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVGI TS+NFRIQGH MTLVE EG++T++  +++LD+H GQS +V+V    
Sbjct  210   GKTYKFRVSNVGIATSINFRIQGHTMTLVEVEGAHTLQEVYESLDVHPGQSVAVLVTL--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             H +   Y++ AS RF+    +  G++RY         PL   P
Sbjct  268   HGSLKDYFIIASSRFTKPILATTGYLRYAGSNTPASGPLPIGP  310


 Score = 31.2 bits (69),  Expect(4) = 4e-126, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            KVL+++LD    L  P G+LINGH
Sbjct  176  KVLQQTLDSGKTLPLPDGLLINGH  199



>ref|XP_010558427.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=539

 Score =   223 bits (569),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+  V       + GK RYA+NGVS++  DTPLKLA
Sbjct  324   RWNLTANAARPNPQGSFHYGKITPTKMFVFSNSAPLINGKQRYAVNGVSYLNSDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI+GV+    I  +P  +     A    SV+QTNLHDF ++VF N  R+VQ+WHLDG
Sbjct  384   DYFNIAGVFSTNAIQRVPSNS----PATVATSVVQTNLHDFIEVVFQNNERTVQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNLKDA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  440   YDFWVVGFGSGQWTPAKRSLYNLKDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWE  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  500   RQYLGQQFYLKVWNPIQ-----SLANEYNPPDNLLLCGKA  534


 Score =   177 bits (449),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 112/165 (68%), Gaps = 2/165 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            L+  + V    V V  ++  ++Y WTV++   S LGV ++VI IN QFPGP L+  TND 
Sbjct  10   LLGVMAVFGSVVKVKGDDPYKYYTWTVTYGIISPLGVPQQVIFINGQFPGPRLDVVTNDN  69

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YF
Sbjct  70   IILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYTYF  129

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            PS   HKAAGGYG I +Y  P +  P+P P  D  +LI DW+  +
Sbjct  130  PSTAFHKAAGGYGAINVYARPRIPIPYPLPASDFTLLIGDWFKTN  174


 Score = 98.2 bits (243),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS N RIQGH M +VE EGS+ ++ D+D+LDIHVGQS S++V    
Sbjct  209   GKTYMFRISNVGLSTSFNLRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLSILVTL--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YY+ AS RF+    S  G +RY+  R      L   P
Sbjct  267   NQSPKDYYIMASTRFTRRVLSVTGLLRYSNSRAPASGSLPDPP  309


 Score = 25.8 bits (55),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 20/38 (53%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
              L++ LD    L +P G+LING    QA+     GK+
Sbjct  176  NTLQQRLDSGTPLLYPDGLLINGQ--TQATFTGDQGKT  211



>ref|XP_009594576.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   217 bits (552),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQG+FHYG+I ++RT VL      + GK RYA+N VS+V PDTPLKLA
Sbjct  323   RWNLTENAARPNPQGTFHYGKITISRTFVLANSAPLINGKLRYAVNRVSYVNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ L +I   P      L      +V   + HDF +IVF N   ++Q+WHLDG
Sbjct  383   DHFNIPGVFSLNSIQTFPSDGSPYL----ATAVFPASHHDFIEIVFQNNEATMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G   W+      YNL DA  R T QVYP SWTA+ V++DN+GMWNLRS   D
Sbjct  439   YDFWVVGFGSRTWTQASRNKYNLVDAPTRHTTQVYPKSWTAILVSLDNQGMWNLRSAMWD  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ++Y++V  P       S  +E  IP N + CGKA
Sbjct  499   RQYLGQQVYLRVYNPTQ-----SLANEYDIPTNALLCGKA  533


 Score =   183 bits (465),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 120/176 (68%), Gaps = 3/176 (2%)
 Frame = +1

Query  31   GTVAL-PLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLL  201
            G VAL  L+C ++V      V +E+  R++ WT ++ T S LGV +++I+IN QFPGP L
Sbjct  2    GKVALFYLICGILVFGSVSVVKAEDAYRYFTWTATYGTASPLGVPQQIILINGQFPGPKL  61

Query  202  NGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQ  381
            +  TN+ + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ+KDQ
Sbjct  62   DLVTNENVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQMKDQ  121

Query  382  IGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            IGSY YFPS  LH+A GG+G + IY   V+  P+  P  D  +LI DWY    +V+
Sbjct  122  IGSYTYFPSTQLHRAVGGFGALNIYARSVIPVPYAKPAGDFSLLIGDWYKSSHKVL  177


 Score = 91.7 bits (226),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+K + NFRIQGH M +VE EGS+ ++  +D+LD+HVGQS SV+V   +
Sbjct  208   GKTYMFRISNVGLKNTFNFRIQGHKMRVVEVEGSHVIQSLYDSLDVHVGQSMSVLVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+    +    + Y+  + +   P+  +P
Sbjct  268   PPK--DYYIVASTRFTRTVLTATAVLHYSNSKASVSGPMPSAP  308


 Score = 32.3 bits (72),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVLR+ LD    L FP G+LING   +Q++     GK+
Sbjct  175  KVLRQILDSGKSLPFPSGLLINGQ--KQSTFTGDQGKT  210



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   216 bits (549),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN +RTI+      +V GK RYA+N VS++ PDTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGMINTSRTIIFASSAGQVNGKQRYAVNSVSYIQPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV++  +I + P+     L      SV+  +   F +IVF N    VQ+WHLDG
Sbjct  384   DFFKIQGVFKENSISDRPYGGGIYL----DTSVLTVDYRAFVEIVFQNDEDIVQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DA+ R T QVYP SWTA+YV +DN GMWNLR+    
Sbjct  440   YSFFVVGMDGGQWTTASRNQYNLRDAIARCTTQVYPKSWTAIYVPLDNVGMWNLRTEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N + CG+A+
Sbjct  500   RQYLGQQLYLRVY-----TTSTSLRDEFPIPKNALLCGRAS  535


 Score =   186 bits (471),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            VC+L   +LF  V +E+  RF++W V++     LGV ++ I+IN QFPGP ++  TND L
Sbjct  11   VCTLF-FALFAIVGAEDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNL  69

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFP
Sbjct  70   IINVFNSLDEPFLLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFP  129

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SL  HKAAGG+G IRI + P +  PF  PD D  +LI DWY  +
Sbjct  130  SLAFHKAAGGFGGIRILSRPRIPVPFADPDGDYTVLIGDWYKAN  173


 Score = 93.6 bits (231),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = +3

Query  801   VLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSV  980
              L    GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV
Sbjct  203   ALTVEQGKTYRLRISNVGLEHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSV  262

Query  981   MVKALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++ A   + G  YY+  S RF+    +  G + Y+    N   P+S SP
Sbjct  263   LITA--DQPGQDYYIVVSSRFTSQILTTTGVLHYS----NSAGPVSGSP  305


 Score = 29.3 bits (64),  Expect(4) = 5e-126, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING G   A L  + GK+
Sbjct  177  LKAHLDNGKKLPFPDGILINGRGSGYA-LTVEQGKT  211



>ref|XP_003550083.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN12128.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   218 bits (556),  Expect(4) = 7e-126, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 149/220 (68%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG+I  T+TIVL      + GK RYA+N VS+V  DTPLKLA
Sbjct  324   RWNLTANAARPNPQGSYHYGKITPTKTIVLSNSAPLINGKLRYAVNKVSYVNSDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G+Y + +I  +P  +    +A    SV+ T+LHDF ++VF N   ++Q+WHLDG
Sbjct  384   DYFNIPGIYSVDSIQTLPSESTPASIA---TSVVPTSLHDFIEVVFQNNENAMQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP +WT + V++DN+GMWNLRS   +
Sbjct  441   YDFWVVGYGFGQWTPAKRRTYNLVDALTRHTTQVYPNAWTTILVSLDNQGMWNLRSAIWE  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V   E      S  +E  IP N + CGKA
Sbjct  501   RQYLGQQLYLRVWTSER-----SLANEYDIPNNALLCGKA  535


 Score =   177 bits (449),  Expect(4) = 7e-126, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            ++Y WTV++   S LG  ++V++I+ QFPGP L+  TN+ + +N+ N LDEPFL++WNG+
Sbjct  30   KYYTWTVTYGILSPLGSPQQVVLIDGQFPGPQLDLVTNENVVLNLVNKLDEPFLLTWNGI  89

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCPIPP  N+TY FQ+KDQIG+Y YFPS  LHKAAGG+G + +Y+ 
Sbjct  90   KQRKNSWQDGVLGTNCPIPPNSNYTYKFQVKDQIGTYTYFPSTSLHKAAGGFGGLNVYHR  149

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             V+  P+P PD D  +LI DWY  + +V+
Sbjct  150  SVIPVPYPYPDGDFTLLIGDWYKTNHKVL  178


 Score = 93.2 bits (230),  Expect(4) = 7e-126, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH + LVE EGS+ V++ +D LD+HVGQS +V+V    
Sbjct  209   GKTYMFRISNVGMSTSINFRIQGHPLKLVEIEGSHIVQNTYDTLDVHVGQSAAVLVTL--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
             ++    YY+ AS RFS    +    + Y+        PL   P+
Sbjct  267   NQPPKDYYIVASTRFSRKVLTATAVLHYSNSNSPASGPLPSPPI  310


 Score = 35.0 bits (79),  Expect(4) = 7e-126, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            KVLRESLD    L FP G+LING  
Sbjct  176  KVLRESLDSGKSLAFPDGLLINGQA  200



>ref|XP_006338228.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=538

 Score =   223 bits (569),  Expect(4) = 9e-126, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I ++RT V+      + GK RYA+N VS+V PDTPLKLA
Sbjct  323   RWNLTSNAARPNPQGSFHYGKITISRTFVMANSAPLINGKLRYAVNSVSYVNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ L +I   P      L    G +V  T+ HDF +IVF N   ++Q+WHLDG
Sbjct  383   DHFNIPGVFNLNSIQAYPSGGSPYL----GTAVFPTSHHDFIEIVFQNDEATMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G   W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWNLRS   D
Sbjct  439   YDFWVVGFGSDKWTQASRNKYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNLRSAMWD  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ++Y++V  P       S  +E  IP N + CGKAA
Sbjct  499   RQYLGQQVYLRVYDPTP-----SLANEYDIPTNALLCGKAA  534


 Score =   176 bits (447),  Expect(4) = 9e-126, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = +1

Query  31   GTVAL-PLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLL  201
            G VAL  L+C + +      V +E+  +++ WT ++ T S LGV ++VI+IN QFPGP L
Sbjct  2    GNVALFHLICGIFIFWSVSVVKAEDTYKYFTWTATYGTLSPLGVPQQVILINGQFPGPRL  61

Query  202  NGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQ  381
            +  TND + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIP   N+TY FQ KDQ
Sbjct  62   DLVTNDNVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPINSNYTYKFQTKDQ  121

Query  382  IGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            IGSY YFPS  LH+A GG+G + +Y   V+  P+  P  D  +LI DWY    +V+
Sbjct  122  IGSYTYFPSTQLHRAVGGFGALNVYARSVISVPYAKPAGDFSLLIGDWYKSSHKVL  177


 Score = 92.4 bits (228),  Expect(4) = 9e-126, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+K S+NFRIQGH M +VE EGS+ +++ +D+LD+HVGQS SV+V   +
Sbjct  208   GKTYMFRISNVGLKNSINFRIQGHKMRVVEVEGSHVLQNFYDSLDVHVGQSMSVLVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RFS +  +    + Y   +     P+  +P
Sbjct  268   PPK--DYYIVASTRFSRINFTATSVLHYTNSQTPVSGPMPPAP  308


 Score = 31.2 bits (69),  Expect(4) = 9e-126, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVLR+ LD    L +P+G+LING   +Q++     GK+
Sbjct  175  KVLRQILDSGRSLPYPNGLLINGQ--KQSTFSGDQGKT  210



>ref|XP_004141928.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004157172.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=537

 Score =   214 bits (545),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+TIVL    A + GK RYAIN VS+V  DTPLKLA
Sbjct  323   RWNLTANAARPNPQGSFHYGKIIPTKTIVLATSAALINGKQRYAINRVSYVNSDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + ++  +P      +      SV+ T LHDF +IVF N   +VQ++HLDG
Sbjct  383   DYFNIPGVFSVDSLQSLPSDGPAFI----ATSVLPTALHDFVEIVFQNNENTVQSFHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G WS     SYNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  439   YDFWVVGYGSGQWSQDSRNSYNLVDALTRHTAQVYPNSWTTILVSLDNQGMWNLRSSIWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V          S  +E  IP+N + CGKA
Sbjct  499   RQYLGQQFYLRVWTQTQ-----SLANEYNIPSNALLCGKA  533


 Score =   182 bits (462),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +1

Query  1    ERQTTMKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVIND  180
            E+Q  ++ + G  AL L  SL      V   +  RFY WTV++ T S LGV ++VI+IN 
Sbjct  2    EKQGLLRLIFGAFAL-LSVSL------VNAENPYRFYTWTVTYGTISPLGVPQQVILING  54

Query  181  QFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTY  360
            QFPGP L   TND + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIP   N+TY
Sbjct  55   QFPGPKLEVVTNDNIILNLFNKLDEPLLLTWNGIKQRKNSWQDGVVGTNCPIPLNSNYTY  114

Query  361  SFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SFQ KDQIGS+ YFPS   HKAAGG+G + +Y  P +  P+P  D D  +LI DWY  +
Sbjct  115  SFQTKDQIGSFAYFPSTQFHKAAGGFGALNVYQRPRIPIPYPIQDGDFTLLIGDWYKTN  173


 Score = 95.1 bits (235),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRIQGH M LVE EGS+T+++ +D+LD+HVGQS SV+V   +
Sbjct  208   GKTYMFRISNVGLSTSLNFRIQGHKMKLVEVEGSHTLQNLYDSLDVHVGQSLSVLVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+    +    + Y+        PL   P
Sbjct  268   APK--DYYIVASTRFTKTVLTATAVLHYSNSNSPVSGPLPAGP  308


 Score = 31.6 bits (70),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+ESLD  G L  P G+LING 
Sbjct  175  KSLQESLDSGGSLPLPDGVLINGQ  198



>ref|XP_009366415.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   213 bits (542),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG +  T+TIVL      + GK RYA N VS+V PDTPLKLA
Sbjct  326   RWNLTANAARPNPQGSFHYGHVTPTKTIVLANSAPLINGKQRYAFNRVSYVNPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I  +P      +    G  V+  + HDF +IVF N   SVQ+ HLDG
Sbjct  386   DYFNIPGVFSLNSIQTVPSDGSAFV----GAPVMPVSHHDFVEIVFQNNENSVQSMHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGSGPWTPAKRRTYNLVDALTRHTAQVYPNSWTTILVSLDNQGMWNLRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+N + CGKA
Sbjct  502   RQYLGQQFYLRVWDPVQ-----SLYNEYNIPSNALLCGKA  536


 Score =   186 bits (472),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            L LVC ++ + L   V   E   +FY WTV++ T S LGV ++VI+IN QFPGP L+  T
Sbjct  9    LHLVCGVLAVFLNSSVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPTLDVVT  68

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS+
Sbjct  69   NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  128

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             YFPS   HKAAGG+G I +Y  P +  P+P PD D  +L  DWY    + +
Sbjct  129  TYFPSTQFHKAAGGFGGINVYARPRIPVPYPIPDGDFTLLAGDWYNTSHKAL  180


 Score = 90.9 bits (224),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRI+GH + LVE EGS+ +++ +D+LDIHVGQS SV+V    
Sbjct  211   GKTYMFRISNVGLSTSLNFRIEGHKLKLVECEGSHPIQNLYDSLDIHVGQSVSVLVTF--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y     +   P+   P
Sbjct  269   NQAPKDYYIVASTRFTRHVLTATSVIHYTNSHASVSGPVPAGP  311


 Score = 33.1 bits (74),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L++SLD    L FP G+LINGH     S D
Sbjct  178  KALQQSLDFGKSLPFPSGVLINGHTSNTFSGD  209



>ref|XP_009347241.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   208 bits (529),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG++  T+TIVL      + GK RYA N VS+V PDTP+KLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKVTPTKTIVLANSAPLINGKQRYAFNRVSYVNPDTPVKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I   P       LA P   V+  + HDF +IVF N  +SVQ+ HLDG
Sbjct  386   DYFNIPGVFSLNSIQTAPS-DGSASLATP---VMPVSHHDFIEIVFQNNEKSVQSMHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+     +YNL D + R T QVYP SWT +  ++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQVYPNSWTTILASLDNQGMWNLRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P  + +     +E  IP+N + CGKA
Sbjct  502   RQYLGQQFYLRVWNPVQNLA-----NEYTIPSNALLCGKA  536


 Score =   188 bits (478),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            L LVC ++ + L   V   E   +FY WTV++ T S LGV ++VI+IN QFPGP L+  T
Sbjct  9    LHLVCGVLAVLLSTSVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDVVT  68

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS+
Sbjct  69   NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  128

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             YFPS   HKAAGG+G I +Y  P +  P+P PD D  +L  DWY    + +
Sbjct  129  TYFPSTQFHKAAGGFGGINVYARPRIPVPYPTPDGDFTLLAGDWYKSSHKAL  180


 Score = 95.1 bits (235),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRI+GH + LVE EGS+T+++ +D+LDIHVGQS SV+V    
Sbjct  211   GKTYMFRISNVGLSTSLNFRIEGHKLKLVECEGSHTIQNSYDSLDIHVGQSVSVLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+ +  +    + Y     +   P+   P
Sbjct  269   NQAPKDYYIVASTRFTRLVLTATSVLHYTNSHTSVSGPVPAGP  311


 Score = 31.6 bits (70),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L++SLD    L FP G+LING      S D
Sbjct  178  KALQQSLDSGKSLPFPAGVLINGQTSNTVSGD  209



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   210 bits (534),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  TRTIV+      V GK RYA+N VSF+  DTPLK+A
Sbjct  321   RTNLTASGPRPNPQGSYHYGMITTTRTIVVANSAGIVDGKQRYAVNSVSFIPADTPLKVA  380

Query  1367  DHFNISGVYELGTIPEMPHF--TYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHL  1540
             D F I GV+ +G+I + P+    Y+        SV+  +   F +IVF N    +Q+WHL
Sbjct  381   DFFKIGGVFRVGSISDWPNGGGIYQ------DTSVMGADYRAFVEIVFQNNEDLIQSWHL  434

Query  1541  DGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGN  1720
             DGY+FFVVGM  G W++     YNL+DA+ R TVQVYP SW+A+YVA+DN GMWN+R+  
Sbjct  435   DGYSFFVVGMDGGQWTSNSRNQYNLRDAIARCTVQVYPKSWSAIYVALDNVGMWNIRTEF  494

Query  1721  ADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
               ++YLGQ+ Y++V  P       S RDE PIP N + CG+A 
Sbjct  495   WARQYLGQQFYLRVYTPS-----TSLRDEYPIPKNALLCGRAT  532


 Score =   179 bits (455),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = +1

Query  82   VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
              V +E+  RF+DW V++ T   LG+ ++ I+IN QFPGP ++  TND + +N+ N+LDE
Sbjct  15   AIVRAEDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDE  74

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  HKAAGG
Sbjct  75   PFLLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGG  134

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            +G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  135  FGGIRILSRPRIPVPFPDPAGDYTVLIGDWYQAN  168


 Score = 95.1 bits (235),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+++SLNFRIQGH M +VE EG++T++ +F +LDIHVGQSYSV+V A  
Sbjct  206   GKTYRLRISNVGLQSSLNFRIQGHRMKVVEVEGTHTLQTEFSSLDIHVGQSYSVLVTA--  263

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTP  1112
              +    +Y+  S RF+    S    +RY    G+     PG P
Sbjct  264   DQPAQDFYIVVSSRFTTPILSTTAILRYANSAGSVQGPPPGGP  306


 Score = 38.5 bits (88),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (3%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQ-ASLDFQPGKS  742
             LR  LD   ML  P GILING GP + AS++ + GK+
Sbjct  171  TLRAQLDNGSMLPLPDGILINGRGPNRTASINVEQGKT  208



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   223 bits (568),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 148/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG +NVTRTI +      + GK RYA+N +SF+  DTPLKLA
Sbjct  324   RWNLTASGPRPNPQGSYHYGYVNVTRTIRIANSAPVINGKQRYAVNSLSFIPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D +NISGV+ELG+I ++P      L      SV+  +   + +IVF N   SVQ+WH+DG
Sbjct  384   DFYNISGVFELGSISDIPTSGPASLR----TSVMAADFRAYVEIVFENSETSVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNF++VGM  G W+     SYNL+DAV R TVQVYP SW+A+Y+ +DN GMWN+RS N  
Sbjct  440   YNFWIVGMDGGQWTPASRDSYNLRDAVSRCTVQVYPNSWSAIYMPLDNVGMWNIRSENWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ YI+V  P +     S RDE PIP N + CG+A+
Sbjct  500   RQYLGQQFYIRVYSPAN-----SWRDENPIPRNALLCGRAS  535


 Score =   182 bits (463),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +1

Query  94   SEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSW  273
            S  RF+ W V++     LGV+++ I+IN QFPGP +   TND L VN+ N+L EPFL SW
Sbjct  25   SPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLFSW  84

Query  274  NGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRI  453
            NG+Q R SSWQDGV GTNCPIPPG N+TY+ Q+KDQIGSYFYFPSL  HKAAGGYG IR+
Sbjct  85   NGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGSYFYFPSLAFHKAAGGYGGIRV  144

Query  454  YNTPVVHPPFPCPDYDLDILISDWYTED  537
             + P++  PF  P  D  +L+ DWY  +
Sbjct  145  LSRPLIPVPFAPPAADYTVLVGDWYKAN  172


 Score = 86.7 bits (213),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVG+ TSLN RIQGH + LVE EGS+T+++ + +LDIH+GQSYS +V A +
Sbjct  209   GKTYRFRVSNVGVATSLNIRIQGHALLLVEVEGSHTLQNTYSSLDIHLGQSYSFLVTADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                   YY+  S RF+    S    + Y+   G      PG P + 
Sbjct  269   PP--MDYYIVVSTRFTTTVLSTTAILHYSNSDGKRVEPPPGGPTTD  312


 Score = 31.2 bits (69),  Expect(4) = 1e-125, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP G+LING G   ++     GK+
Sbjct  176  LRNILDGGKDLPFPDGLLINGQGSNGSAFTVDQGKT  211



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   211 bits (536),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 141/223 (63%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQG++ YG IN TRTI L+     + GK RYAIN VSF+  DTPLKL 
Sbjct  323   RGNLTASGPRPNPQGTYKYGMINTTRTITLQNSAPIINGKQRYAINSVSFIPSDTPLKLG  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I G++ LG+I + P      L      SV+  +   + +IVFHNP  ++Q+WH+DG
Sbjct  383   DYFKIQGLFSLGSISDNPTGGDGYLQT----SVMAADYRAYVEIVFHNPEDTLQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             + FFVVGM  G WS     SYNL DA+ R TVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  439   HFFFVVGMDIGQWSPASRLSYNLIDAISRCTVQVYPKSWTALYMPLDNVGMWNVRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+ Y++V       S  S RDE PIP N + CGK   L
Sbjct  499   RQYLGQQFYLRVYS-----SANSWRDEYPIPLNALHCGKVVGL  536


 Score =   185 bits (469),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +1

Query  55   CSLIVLSLF--VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            CS+ +L +F   CVS E+  RFY W V++      G++++ I+IN QFPGP +   TND 
Sbjct  7    CSVFLLLVFFVACVSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N+LDEPFL+SWNGV  R +SWQDGV GTNCPIPPG+N+TY+ Q+K+QIGSYFYF
Sbjct  67   VIINVFNSLDEPFLISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            PSL LHKAAGGYG + + + P++  PF  P  D  IL  DWY +
Sbjct  127  PSLALHKAAGGYGGLSVASRPMIPVPFDPPSGDFTILAGDWYQK  170


 Score = 92.8 bits (229),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++T+++ +D++DIH+GQSYSV+V A +
Sbjct  208   GKTYQFRISNVGLTTSINFRIQGHKMKLVEVEGTHTLQNIYDSIDIHLGQSYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    + +  + Y    G    P    P
Sbjct  268   PPQ--DYYIVVSTRFTSKVLTVVSILHYRNSEGTVSGPFPLGP  308


 Score = 33.9 bits (76),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP GI+INGHG    +     GK+
Sbjct  175  LRAILDNGNNLPFPDGIIINGHGSNPITFTVDQGKT  210



>gb|EYU46107.1| hypothetical protein MIMGU_mgv1a003243mg [Erythranthe guttata]
Length=597

 Score =   190 bits (482),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 137/226 (61%), Gaps = 16/226 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRT-IVLEGKMARVYGKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG+I VT   ++L      V GK R  +NG+S++ P TPL+L
Sbjct  347   RWNVSAGAARPNPQGSFRYGQITVTDVYVILNRPPELVDGKWRNTLNGISYIAPSTPLRL  406

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLL--ARPGVSVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             A  F + GV++L        F  R +   A+   SVI      F +I+F N   SVQ++H
Sbjct  407   AQQFKVDGVFKL-------DFPNRFMNRPAKMDTSVINGTFKGFMEIIFQNNDTSVQSYH  459

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             LDG+ FFVVGM  G+W+     +YN  D V RST QV+P +WTA+ V++DN G+WNLR+ 
Sbjct  460   LDGHAFFVVGMDYGVWTENSRSTYNKWDGVARSTTQVFPGAWTAILVSLDNAGIWNLRTQ  519

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             N D  YLGQE YI V  PE+D       DE  +P NVI CG  + L
Sbjct  520   NLDSWYLGQESYISVVNPEND------NDEVQLPDNVIYCGVLSPL  559


 Score =   189 bits (480),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            FYDWTVS+ T S LG++++VI ++  FPGP+LN +TN  + +N+ NNLDEPFL++WNG+Q
Sbjct  33   FYDWTVSYITASPLGLKQQVIGVDGIFPGPILNVTTNWNVVINVKNNLDEPFLLTWNGIQ  92

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
             R +SWQDGV GTNCPIP G NWTY FQ+KDQIGS+FYFPSL L +AAGGYG I I N  
Sbjct  93   QRKNSWQDGVSGTNCPIPAGWNWTYQFQVKDQIGSFFYFPSLGLQRAAGGYGGIVINNRE  152

Query  466  VVHPPFPCPDYDLDILISDWYTE  534
            V+  PF  PD D+ + ISDWY +
Sbjct  153  VIAVPFGAPDGDITLFISDWYIK  175


 Score =   116 bits (291),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY +R+ NVGI TSLNFRIQ HNM LVETEGSYTV+ ++ N+DIHVGQSYS +V  ++
Sbjct  226   GKTYRIRVHNVGISTSLNFRIQNHNMVLVETEGSYTVQQNYSNMDIHVGQSYSFLV-TMD  284

Query  999   HKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
                   YY+ ASPRF    +  +ASG+  + Y+  RG    PL   P ++
Sbjct  285   QDASTDYYIVASPRFVNASTWTKASGVAILHYSNSRGPASGPLPDPPHEY  334


 Score = 26.6 bits (57),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  608  DYMVL*LKVLRESLD-RTGMLKFPHGILINGHGPEQ  712
            D+ +   K LR  L+ + G L  P G+L NG GP Q
Sbjct  171  DWYIKSHKSLRNDLESKNGGLGPPDGVLFNGLGPYQ  206



>ref|XP_009358973.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=589

 Score =   196 bits (497),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 138/227 (61%), Gaps = 18/227 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMAR-VYGKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG I VT   V+  + A  + GK R  +NG+S++ P TPLKL
Sbjct  340   RWNVSAGAARPNPQGSFKYGEITVTDVYVILNRPAELINGKWRTTLNGISYIPPSTPLKL  399

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPG---VSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             A  FNISGVY+L    + P+     L+ RP     S+I      F +++F N   +VQ +
Sbjct  400   AQQFNISGVYKL----DFPN----KLMNRPAKVDTSLINGTFKGFMEVIFQNNDTTVQNY  451

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             HLDGY FF+VGM  G+W+     +YN  D V RST QV+P SWTA+ V +DN G+WNLR+
Sbjct  452   HLDGYAFFIVGMDVGVWTENSRSTYNKWDGVARSTTQVFPGSWTAILVVLDNAGIWNLRA  511

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              N D  YLGQE+Y+ V  PE D       DE  +P N I CG  + L
Sbjct  512   QNLDSWYLGQEVYVSVVNPEFD------GDEKSLPDNTIYCGLLSSL  552


 Score =   190 bits (482),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 121/170 (71%), Gaps = 7/170 (4%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCV------SSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
            +P  C L  L +F+C       +    FYDWTVS+ T S LGV+++VI IN QFPGP+LN
Sbjct  1    MPSSC-LFKLVIFLCSLGFGLGADPYVFYDWTVSYITASPLGVKQQVIGINGQFPGPILN  59

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
             +TN  + +N+ NNLDEP L++WNG+Q R +SWQDGV GTNCPI  G NWTY FQ+KDQI
Sbjct  60   VTTNWNVVINVKNNLDEPLLLTWNGIQNRKNSWQDGVSGTNCPIHAGWNWTYEFQVKDQI  119

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            GS+FYFPSL+  +A+GGYG I I N  V+  PF  PD D+ + I+DWYT+
Sbjct  120  GSFFYFPSLNFQRASGGYGGITINNRNVIPLPFTVPDGDITLFITDWYTK  169


 Score =   108 bits (269),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQS+S +V  ++
Sbjct  219   GKTYRFRVHNVGIATSLNFRIQNHNLLLVETEGSYTVQQNYANMDIHVGQSFSFLV-TMD  277

Query  999   HKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                 + YY+ ASPRF    S  +A G+  + Y+  +G    PL   P
Sbjct  278   QNATSDYYIVASPRFVNSSSWAKAIGVAILHYSNSQGPASGPLPDPP  324


 Score = 28.9 bits (63),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ +D    L  P G+LING GP
Sbjct  172  KDLRKDVDSGTSLGIPDGVLINGIGP  197



>ref|XP_006466655.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
Length=541

 Score =   233 bits (594),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 150/222 (68%), Gaps = 8/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I V RTIVL     ++  K RYA+NG+S+V P TPLKLA
Sbjct  326   RTNLTANAARPNPQGSFHYGTIKVVRTIVLANSATKINNKLRYAVNGISYVNPITPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNI GV++L TI + P        A+ G SVI T LHD+ +IVF N   SVQ+WHLDG
Sbjct  386   DWFNIPGVFDLNTIKDTPTPGAP---AKLGASVIPTTLHDYVEIVFQNNEASVQSWHLDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VVG G G W+A   + YNL DA+ R TVQVYP SW+A+Y+++DN+GMWNLRS   +
Sbjct  443   SSFYVVGYGSGTWTADIRKRYNLNDAITRHTVQVYPQSWSAIYISLDNKGMWNLRSAIWE  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQELY++V   E      S   E  +P N + CGKA +
Sbjct  503   RRYLGQELYLRVSNDER-----SLFTETDVPPNALFCGKAKR  539


 Score =   173 bits (439),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPL  198
            + G + L ++  ++       V++E+  R Y WTV++ T S  GV ++ I+IN QFPGP 
Sbjct  1    MKGAIFLEILIGILACLCVFWVNAEDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPA  60

Query  199  LNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKD  378
            +   TND + VN+ N LDEPFL++WNGV+ R ++WQDGV GTNCPIPP  NWTY FQ+KD
Sbjct  61   IEAVTNDNIIVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIPPNSNWTYKFQMKD  120

Query  379  QIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            QIG++ YFPS  +H+A GG+G + +    V+  P+  PD +  +L+SDW+
Sbjct  121  QIGTFNYFPSTKVHRAFGGFGAVNVAQRSVISVPYHIPDGEFTLLVSDWF  170


 Score = 92.4 bits (228),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVGI TS+NFRIQGH +TLVE EG++ ++  ++++DIHVGQS +V+V    
Sbjct  211   GKTYKFRVSNVGIATSINFRIQGHTLTLVEVEGAHCLQESYESIDIHVGQSIAVIVAM--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             H     YY+ AS RF+    +    + Y+     P  PL  +P
Sbjct  269   HGPPKDYYIVASTRFTKPILTTTAILHYDGSNTPPSLPLPIAP  311


 Score = 23.5 bits (49),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (53%), Gaps = 5/40 (13%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDF--QPGKS  742
            K L++ L+    L  P  +LINGH     SL F  Q GK+
Sbjct  177  KALQKRLEDGYPLPVPDALLINGH---HNSLSFTGQKGKT  213



>ref|XP_006282576.1| hypothetical protein CARUB_v10004445mg, partial [Capsella rubella]
 gb|EOA15474.1| hypothetical protein CARUB_v10004445mg, partial [Capsella rubella]
Length=582

 Score =   218 bits (554),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 142/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  365   NLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRYAVNGASFVAPDTPLKLADY  424

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  ++ +IVF N   S+Q+WH+ GY+
Sbjct  425   FKIPGVFNLGSIPTSPSGGSGGYLQS---SVMAANFREYIEIVFQNWENSIQSWHISGYS  481

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G+W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS +  ++
Sbjct  482   FFVVGMDGGLWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSESWARQ  541

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  542   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  574


 Score =   180 bits (457),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 5/170 (3%)
 Frame = +1

Query  55   CSLIVLSLFVCVS-----SEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            C + V+ L V ++     +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND
Sbjct  46   CKVSVILLLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITND  105

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             + +++ N L EPFLMSWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGS+FY
Sbjct  106  NIIISVFNYLKEPFLMSWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFFY  165

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            FPSL  HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  166  FPSLAFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  215


 Score = 93.2 bits (230),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M LVE EGS+TV++ + +LD+H+GQSYSV+V A  
Sbjct  248   GKTYRFRISNVGVATSLNFRIQGHAMKLVEVEGSHTVQNIYTSLDVHLGQSYSVLVTA--  305

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  306   NQAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPVPNGP  348


 Score = 31.2 bits (69),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L  P G+LING G    +   QPGK+
Sbjct  214  VLRRLLEAGRNLPMPDGVLINGRGWGGNTFTVQPGKT  250



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   205 bits (521),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 141/228 (62%), Gaps = 7/228 (3%)
 Frame = +2

Query  1175  FNLDRVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTP  1354
             F   R ++   AARPNPQGS+HYG+IN+TRTI L    +   GK RY INGVS V P TP
Sbjct  323   FRSFRWNLTASAARPNPQGSYHYGQINITRTIKLVSSASSAGGKLRYGINGVSHVNPPTP  382

Query  1355  LKLADHFNISG-VYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQT  1531
             LKLA+++ ++  V++  TIP+ P    +     P  +V+      F +I+  N  +SVQ+
Sbjct  383   LKLAEYYGVADKVFKYDTIPDEP-LLEKATPVTPAPNVMNITFRTFVEIILENHEKSVQS  441

Query  1532  WHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLR  1711
             WHLDGY+FF V + PG W+    +SYNL DAV R T+QV+P SW A+ +  DN GMWNLR
Sbjct  442   WHLDGYSFFGVAIEPGRWTPEKRKSYNLLDAVSRHTIQVFPKSWAAIMLTFDNAGMWNLR  501

Query  1712  SGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             S  A++RYLGQELYI V  PE      S RDE  +P +   CG    L
Sbjct  502   SELAERRYLGQELYISVLSPER-----SLRDEYNMPDDAELCGAVTSL  544


 Score =   183 bits (465),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
            G V + L+C   +L+  V V  E+   F+ W V++ T S LGV ++ I+IN QFPGP +N
Sbjct  2    GRVTILLLC---LLAGAVAVRGEDPYLFFTWNVTYGTISPLGVPQEGILINGQFPGPNIN  58

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
             +TN+ L +N+ NN+DEP L +WNG+Q R +SWQDGV GTNCPIPPGKN+TY FQ+KDQI
Sbjct  59   STTNNNLVINVFNNIDEPLLFTWNGIQQRKNSWQDGVLGTNCPIPPGKNFTYRFQVKDQI  118

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            GSYFY+P+  +H+AAGG+G +R+ +  ++  P+  P+ D  +LI DWY++   V+
Sbjct  119  GSYFYYPTTAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTVL  173


 Score =   106 bits (264),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 3/104 (3%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RI NVG+K SLNFRIQGH M LVE EGS+TV++ +D+LD+HVGQ +SV++ A  
Sbjct  212   GKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHVGQCFSVLITA--  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTP-LSKSP  1127
              K+   YYM AS RF+    +  G +RY    G P +  L K+P
Sbjct  270   DKDPRDYYMVASTRFTKSVLTATGIIRYTNGNGAPASSILPKAP  313


 Score = 27.7 bits (60),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (53%), Gaps = 0/34 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQP  733
            VLR+ LD    L  P G+LING   +    D +P
Sbjct  172  VLRQKLDAGRPLARPDGVLINGQTGKGKGKDVKP  205



>ref|XP_010539014.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=543

 Score =   224 bits (570),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 7/221 (3%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I   RTI++      + GK +YA+NGVSFV PDTPLKLA
Sbjct  323   RRNLTASGPRPNPQGSYHYGMIKPGRTIMISNSAPYINGKQKYAVNGVSFVAPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ LG+IP  P         +   SV+  N  +F +IVF N   +VQ+WH+DG
Sbjct  383   DYFKISGVFNLGSIPTSPSGGNNAGSLQ--TSVMAANFREFIEIVFQNWENTVQSWHIDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  
Sbjct  441   YSFFVVGMDGGQWTTGSRAKYNLHDAVARSTVQVYPRAWTAIYMALDNVGMWNIRSENWG  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       S  S RDE PIP N + CG+A+
Sbjct  501   RQYLGQQFYLRVW-----TSSTSYRDEYPIPKNALLCGRAS  536


 Score =   174 bits (442),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF+ W V++     LGV+++ I+IN QFPGP ++  TND L ++++N L EPFL+SWNG+
Sbjct  27   RFFTWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLKEPFLLSWNGL  86

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +SW DGV GT CPIPPGKN+TY  Q+KDQIGSYFYFPSL  HKAAG +G IR+++ 
Sbjct  87   QQRKNSWHDGVIGTTCPIPPGKNFTYIIQVKDQIGSYFYFPSLAFHKAAGAFGAIRVWSR  146

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            P +  PF  PD D  IL  DWY  +  V+
Sbjct  147  PRIPVPFSPPDGDFWILSGDWYKTNHYVL  175


 Score = 90.5 bits (223),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EGS+TV++ + +LDIH+GQSYSV+V    
Sbjct  208   GKTYRFRISNVGLATSINFRIQGHAMKLVEVEGSHTVQNVYSSLDIHLGQSYSVLVTT--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  266   NQAPQDYYIVVSSRFTRKVLTTTAILHYSNSRRGVSGPVPSGP  308


 Score = 33.5 bits (75),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L FP G+LING G    +   QPGK+
Sbjct  174  VLRRLLEAGRNLPFPDGLLINGRGWGGNTFTVQPGKT  210



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   218 bits (556),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI+L      V GK RYAIN VS+V PDTPLKLA
Sbjct  329   RTNLTASGPRPNPQGSYHYGLINTTRTIILSSSPGIVNGKQRYAINSVSYVAPDTPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+  + P      L      SV+QT+   F + VF N    +Q++HLDG
Sbjct  389   DYFKIPGVFRVGSFSDRPTGGGIYL----DTSVLQTDYRTFVEFVFQNDEDIIQSYHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+     +YNL+DAV R T QVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  445   YSFFVVGMDGGQWTPASRNTYNLRDAVSRCTTQVYPKSWTAIYIALDNVGMWNLRSEFWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE P+P N + CG+A+
Sbjct  505   RQYLGQQFYMRVY-----TTSTSIRDEYPVPKNALLCGRAS  540


 Score =   180 bits (457),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 120/174 (69%), Gaps = 3/174 (2%)
 Frame = +1

Query  7    QTTMKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQF  186
            + T+KT    VA+ +VC +   S+ V      RF++W V++     LGV ++ I+IN QF
Sbjct  4    KMTLKT--AAVAVAIVC-ISAFSITVVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQF  60

Query  187  PGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSF  366
            PGP ++  TND L +N+ N+LD+PFL+SWNGVQ R +S++DGV GT CPIPPG N+TY  
Sbjct  61   PGPDIHSVTNDNLIINVFNSLDQPFLLSWNGVQQRRNSFEDGVLGTTCPIPPGGNFTYIL  120

Query  367  QLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            Q+KDQIGS++YFPSL  HKAAGG+G IRI + P +  PF  P  D  +LI DWY
Sbjct  121  QVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTVLIGDWY  174


 Score = 91.3 bits (225),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H + LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  214   GKTYRLRISNVGLENSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+    +  G +RY+
Sbjct  272   DQPAQDYYIVVSTRFTSTVLTSTGVLRYS  300


 Score = 32.3 bits (72),  Expect(4) = 2e-125, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L   LD    L FP+GILING G   A  + + GK+
Sbjct  181  LMSLLDSGRKLPFPNGILINGRGSNGAYFNVEQGKT  216



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   214 bits (546),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 140/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLK+A
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKIA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+  G+I   P      L      SV+Q +   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIDGVFRSGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIVFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWSPDSRNVYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  P       S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQLYLRVYTPS-----TSLRDEYPIPKNALLCGRAS  534


 Score =   184 bits (468),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            LI LSL   V +E+  RF++W +++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   LIGLSLLFAVVAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSN  172


 Score = 93.6 bits (231),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M ++E EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLQDSLNFRIQDHKMKVIEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  266   DQTPRDYYVVVSSRFTSNVLTTTGILRYSNSAGAVSGPIPGGP  308


 Score = 29.3 bits (64),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L  P GILING     A+L+ + GK+
Sbjct  176  LRAQLDSGKKLPLPDGILINGRS-SGATLNVEQGKT  210



>gb|KDO79346.1| hypothetical protein CISIN_1g009171mg [Citrus sinensis]
Length=541

 Score =   232 bits (591),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 150/222 (68%), Gaps = 8/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I V RTIVL     ++  K RYA+NG+S+V P TPLKLA
Sbjct  326   RTNLTANAARPNPQGSFHYGTIKVVRTIVLANSATKINNKLRYAVNGISYVNPITPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNI GV++L TI + P        A+ G SVI T LHD+ +IVF N   SVQ+WHLDG
Sbjct  386   DWFNIPGVFDLNTIKDTPTPGAP---AKLGASVIPTTLHDYVEIVFQNNETSVQSWHLDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VVG G G W+A   + YNL DA+ R TVQVYP SW+A+YV++DN+G+WNLRS   +
Sbjct  443   SSFYVVGYGSGTWTADIRKRYNLNDAITRHTVQVYPQSWSAIYVSLDNKGVWNLRSAIWE  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQELY++V   E      S   E  +P N + CGKA +
Sbjct  503   RRYLGQELYLRVSNDER-----SLFTETDVPPNALFCGKAKR  539


 Score =   173 bits (439),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPL  198
            + G + L ++  ++       V++E+  R Y WTV++ T S  GV ++ I+IN QFPGP 
Sbjct  1    MKGAIFLEILIGILACLCVFWVNAEDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPA  60

Query  199  LNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKD  378
            +   TND + VN+ N LDEPFL++WNGV+ R ++WQDGV GTNCPIPP  NWTY FQ+KD
Sbjct  61   IEAVTNDNIIVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIPPNSNWTYKFQMKD  120

Query  379  QIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            QIG++ YFPS  +H+A GG+G + +    V+  P+  PD +  +L+SDW+
Sbjct  121  QIGTFNYFPSTKVHRAFGGFGAVNVAQRSVISVPYHIPDGEFTLLVSDWF  170


 Score = 92.4 bits (228),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVGI TS+NFRIQGH +TLVE EG++ ++  ++++DIHVGQS +V+V    
Sbjct  211   GKTYKFRVSNVGIATSINFRIQGHTLTLVEVEGAHCLQESYESIDIHVGQSVAVVVAM--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             H     YY+ AS RF+    +    + Y+     P  PL  +P
Sbjct  269   HGPPKDYYIVASTRFTKPILTTTAILHYDGSNTPPSLPLPIAP  311


 Score = 24.3 bits (51),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (53%), Gaps = 5/40 (13%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDF--QPGKS  742
            K L++ L+    L  P  +LINGH     SL F  Q GK+
Sbjct  177  KALQKRLEDGYSLPVPDALLINGH---HNSLSFTGQKGKT  213



>ref|XP_009115829.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   224 bits (570),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 151/220 (69%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T++ V       + GK RYA+NGVS+V  +TP+KLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKIKPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPVKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI+GV+    I  +P  + R+ +A    SV+Q +LHDF +IVF N  +SVQ+WHLDG
Sbjct  386   DHFNIAGVFSTNAIQSVPSNS-RVTVA---TSVVQASLHDFLEIVFQNSEKSVQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R YNL DA+ R T QVYP +WT + +++DN+GMWN+RS   D
Sbjct  442   YDFWVVGFGSGQWTPAKRRLYNLGDALTRHTTQVYPNAWTTILLSLDNQGMWNMRSARWD  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV     DP K S  +E   P N+++CGKA
Sbjct  502   RQYLGQQFYLKVW----DPVK-SLANEYNPPDNLLRCGKA  536


 Score =   171 bits (434),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  82   VCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPF  261
            V   S  +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+PF
Sbjct  25   VKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  84

Query  262  LMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYG  441
            L++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG+G
Sbjct  85   LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  144

Query  442  PIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             I +Y  P +  P+  P  D  +LI DW+  + + +
Sbjct  145  AINVYARPRIPIPYLLPVSDFTLLIGDWFKTNHKTL  180


 Score = 94.0 bits (232),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ ++ NFRIQGH M +VE EGS+ +++D+++LD+HVGQS S++V    
Sbjct  211   GKTYMLRISNVGLSSTFNFRIQGHKMKVVEVEGSHVIQNDYESLDVHVGQSLSLLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
             ++    YY+ AS RF   + +  G +RY+  R
Sbjct  269   NQPPKDYYIVASTRFLRRKLNVTGLLRYSNSR  300


 Score = 32.7 bits (73),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q S     GK+
Sbjct  178  KTLQQRLDSGGVLPFPDGMLINGQ--TQTSFTGDQGKT  213



>ref|XP_009348086.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   208 bits (529),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG++  T+TIVL      + GK RYA N VS+V PDTP+KLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKVTPTKTIVLANSAPLINGKQRYAFNRVSYVNPDTPVKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I   P       LA P   V+  + HDF +IVF N  +SVQ+ HLDG
Sbjct  386   DYFNIPGVFSLNSIQTAPS-DGSASLATP---VMPVSHHDFIEIVFQNNEKSVQSMHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+     +YNL D + R T QVYP SWT +  ++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQVYPNSWTTILASLDNQGMWNLRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P  + +     +E  IP+N + CGKA
Sbjct  502   RQYLGQQFYLRVWNPVQNLA-----NEYTIPSNALLCGKA  536


 Score =   188 bits (477),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            L LVC ++ + L   V   E   +FY WTV++ T S LGV ++VI+IN QFPGP L+  T
Sbjct  9    LHLVCGVLAVLLSSSVVKAEDPYKFYTWTVTYGTLSPLGVPQQVILINGQFPGPRLDVVT  68

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS+
Sbjct  69   NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  128

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             YFPS   HKAAGG+G I +Y  P +  P+P PD D  +L  DWY    + +
Sbjct  129  TYFPSTQFHKAAGGFGGINVYARPRIPVPYPTPDGDFTLLAGDWYKSSHKAL  180


 Score = 95.1 bits (235),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TSLNFRI+GH + LVE EGS+T+++ +D+LDIHVGQS SV+V    
Sbjct  211   GKTYMFRISNVGLSTSLNFRIEGHKLKLVECEGSHTIQNSYDSLDIHVGQSVSVLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+ +  +    + Y     +   P+   P
Sbjct  269   NQAPKDYYIVASTRFTRLVLTATSVLHYTNSHTSVSGPVPAGP  311


 Score = 30.8 bits (68),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L++SLD    L FP G+LING      S D
Sbjct  178  KALQQSLDSGKSLPFPAGVLINGQTSNTFSGD  209



>ref|XP_006425822.1| hypothetical protein CICLE_v10027285mg, partial [Citrus clementina]
 gb|ESR39062.1| hypothetical protein CICLE_v10027285mg, partial [Citrus clementina]
Length=554

 Score =   233 bits (593),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 150/222 (68%), Gaps = 8/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I V RTIVL     ++  K RYA+NG+S+V P TPLKLA
Sbjct  339   RTNLTANAARPNPQGSFHYGTIKVVRTIVLANSATKINNKLRYAVNGISYVNPITPLKLA  398

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNI GV++L TI + P        A+ G SVI T LHD+ +IVF N   SVQ+WHLDG
Sbjct  399   DWFNIPGVFDLNTIKDTPTPGAP---AKLGASVIPTTLHDYVEIVFQNNEASVQSWHLDG  455

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VVG G G W+A   + YNL DA+ R TVQVYP SW+A+Y+++DN+GMWNLRS   +
Sbjct  456   SSFYVVGYGSGTWTADIRKRYNLNDAITRHTVQVYPQSWSAIYISLDNKGMWNLRSAIWE  515

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQELY++V   E      S   E  +P N + CGKA +
Sbjct  516   RRYLGQELYLRVSNDER-----SLFTETDVPPNALFCGKAKR  552


 Score =   173 bits (438),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 115/170 (68%), Gaps = 2/170 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPL  198
            + G + L ++  ++       V++E+  R Y WTV++ T S  GV ++ I+IN QFPGP 
Sbjct  14   MKGAIFLEILIGILACLCVFWVNAEDPYRSYTWTVTYGTISPFGVPQQGILINGQFPGPA  73

Query  199  LNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKD  378
            +   TND + VN+ N LDEPFL++WNGV+ R ++WQDGV GTNCPIPP  NWTY FQ+KD
Sbjct  74   IEAVTNDNIIVNLINKLDEPFLITWNGVKQRRTTWQDGVLGTNCPIPPNSNWTYKFQMKD  133

Query  379  QIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            QIG++ YFPS  +H+A GG+G + +    V+  P+  PD +  +L+SDW+
Sbjct  134  QIGTFNYFPSTKVHRAFGGFGAVNVAQRSVISVPYHIPDGEFTLLVSDWF  183


 Score = 92.4 bits (228),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVGI TS+NFRIQGH +TLVE EG++ ++  ++++DIHVGQS +V+V    
Sbjct  224   GKTYKFRVSNVGIATSINFRIQGHTLTLVEVEGAHCLQESYESIDIHVGQSIAVIVAM--  281

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             H     YY+ AS RF+    +    + Y+     P  PL  +P
Sbjct  282   HGPPKDYYIVASTRFTKPILTTTAILHYDGSNTPPSLPLPIAP  324


 Score = 23.5 bits (49),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (53%), Gaps = 5/40 (13%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDF--QPGKS  742
            K L++ L+    L  P  +LINGH     SL F  Q GK+
Sbjct  190  KALQKRLEDGYPLPVPDALLINGH---HNSLSFTGQKGKT  226



>gb|AFK35121.1| unknown [Medicago truncatula]
Length=544

 Score =   223 bits (567),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V GK RY IN VS+V PDTPLKLA
Sbjct  326   RTNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGINSVSYVVPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I E P      L      SV+Q +   F +IVF N    VQ++HLDG
Sbjct  386   DYFKISGVFRVGSISERPTGGGLYL----DTSVMQADYRSFVEIVFQNNENIVQSYHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R  +QVYPYSWTA+YVA+DN GMWNLR+    
Sbjct  442   YSFFVVGMDGGQWTTSSRNGYNLRDAVARCAIQVYPYSWTAIYVALDNVGMWNLRTEFWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N   CG+A+
Sbjct  502   RQYLGQQFYLRVY-----TASTSIRDEFPIPKNARLCGRAS  537


 Score =   178 bits (451),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
              V   L+C  +  SLF   S+E+  +F++W V++     LGV ++ I+IN QFPGP ++
Sbjct  6    AAVGALLLC--VSTSLFHITSAEDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIH  63

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND L +N+ N+L+EPFL+SWNG+Q R +S++DGV GT CPIPPG+N+TY  Q+KDQI
Sbjct  64   SVTNDNLIINVFNSLNEPFLISWNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQI  123

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            GS++YFPSL   KAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  124  GSFYYFPSLAFQKAAGGFGGIRILSRPRIPVPFPEPAGDYTVLIGDWYKSN  174


 Score = 89.4 bits (220),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +3

Query  822   KTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALEH  1001
             KTY LRISNVG++ SLNFRIQ H + LVE EG++T++  + +LD+HVGQSYSV+V A   
Sbjct  212   KTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--D  269

Query  1002  KNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +    YY+ AS RFS    +    +RY+   G    P    P
Sbjct  270   QPSQDYYVVASTRFSSKIPTTTAVLRYSNSAGAVSGPPPGGP  311


 Score = 31.6 bits (70),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LD+   L  P G+LING GP   S + +  K+
Sbjct  177  TLKAHLDKGKKLPIPDGVLINGRGPNGLSFNVEQRKT  213



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   215 bits (548),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +IVF N    VQ+WHLDG
Sbjct  384   DYFKIDGVYRTGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIVFENSEDIVQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  440   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE P+P N + CG+A+
Sbjct  500   RQYLGQQFYLRVYTPS-----TSLRDEYPVPRNALLCGRAS  535


 Score =   184 bits (468),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I LSL   V++E+  RFY+W +++     LGV ++ I+IN QFPGP ++  TND + +N
Sbjct  13   FIGLSLLFAVTAEDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPG+N+TY  Q+KDQIGS++YFPSL 
Sbjct  73   VYNSLDEPFLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLA  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  133  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSN  173


 Score = 93.6 bits (231),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A +
Sbjct  209   GKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  269   PPR--DYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGP  309


 Score = 28.1 bits (61),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING     A+L+ + GK+
Sbjct  177  LKAQLDNGKKLPLPDGILINGRS-SGATLNVEQGKT  211



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score =   214 bits (546),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLK+A
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPLKIA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I   P      L      SV+Q +   F +IVF N    +Q+WHLDG
Sbjct  383   DYFKIDGVFRVGSIQPQPTGGGIYL----DTSVLQVDYRSFVEIVFENTEDIMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SW+A+Y+A+DN GMWN+RS    
Sbjct  439   YSFWVVGMDGGQWSPDSRNGYNLRDAVARCTVQVYPSSWSAIYIALDNVGMWNIRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQLYLRVY-----TASTSLRDEYPIPKNALLCGRAS  534


 Score =   181 bits (458),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I +SL + V++E+  RF++W +++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   FIGISLILAVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFADPAGDYTVLIGDWYKSN  172


 Score = 95.1 bits (235),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG +T+   F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLQDSLNFRIQDHKMQVVEVEGIHTLPTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YYM  S RF+    +  G +RY+   G    P+   P
Sbjct  266   DQPAKDYYMVVSSRFTSAVLTTTGVLRYSNSAGGVSGPIPGGP  308


 Score = 31.2 bits (69),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L  P GILING G   A+L+ + GK+
Sbjct  176  LRAQLDSGRKLPLPDGILINGRG-SGATLNVEQGKT  210



>ref|XP_003537368.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Glycine max]
 ref|XP_006590664.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Glycine max]
Length=537

 Score =   215 bits (547),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+ I L      + GK RYA+N VS+V PDTPLKLA
Sbjct  322   RWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPLINGKLRYAVNSVSYVNPDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G++ +  +   P      +    G SV+QT+LHDF +++F N   ++Q+WHLDG
Sbjct  382   DYFNIPGIFSVNLLQNSPSNGPGYI----GTSVLQTSLHDFIEVIFQNNENTMQSWHLDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+V+G G G W+    ++YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  438   YDFWVIGHGFGQWTDASRKTYNLVDALTRHTTQVYPKSWTTILVSLDNQGMWNLRSAIWE  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V   +      S  +E  IP NV+ CGKA
Sbjct  498   RQYLGQQFYLRVWDAQK-----SLANEYDIPNNVLLCGKA  532


 Score =   184 bits (467),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
            T  L L+C +I L   V V +E+  ++Y WTV++ T S LG  ++VI+IN QFPGP L+ 
Sbjct  4    TGLLHLLCLVIAL---VSVQAEDAYKYYTWTVTYGTISPLGSPQQVILINGQFPGPRLDL  60

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TN+ + +N+ N LDEPFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  61   VTNENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIG  120

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +Y YFPS  LHKAAGG+G + +Y+  V+  P+P PD D  +L+ DWY  + + +
Sbjct  121  TYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTL  174


 Score = 91.3 bits (225),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
             + GKTYM RISNVG  TS+NFRIQGH + LVE EGS+TV++ +D+LD+HVGQS +V+V  
Sbjct  203   NPGKTYMFRISNVGFSTSINFRIQGHTLKLVEVEGSHTVQNLYDSLDVHVGQSVAVLVTL  262

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGN----PGTPLSK  1121
               ++    YY+ AS RF+    +    + Y N F       P  P+ K
Sbjct  263   --NQPPKDYYIVASTRFTETPLTTTAVLHYANSFSSALGPVPAPPVDK  308


 Score = 31.2 bits (69),  Expect(4) = 3e-125, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR++L+    L FP G+LING     ++    PGK+
Sbjct  172  KTLRQTLESGKPLAFPDGLLINGQA--HSTFTGNPGKT  207



>emb|CDY43557.1| BnaC02g16540D [Brassica napus]
Length=541

 Score =   223 bits (567),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 155/235 (66%), Gaps = 10/235 (4%)
 Frame = +2

Query  1142  PGFLICMT*RCFNLDRVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAI  1321
             PG LI    R     R ++   AARPNPQGSFHYG+I  T++ V       + GK RYA+
Sbjct  312   PGELIWSM-RQARTFRWNLTANAARPNPQGSFHYGKIKPTKSFVFSNSAPLINGKQRYAV  370

Query  1322  NGVSFVYPDTPLKLADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIV  1501
             NGVS+V  +TP+KLADHFNI+GV+    I   P  + R+ +A    SV+Q +LHDF +IV
Sbjct  371   NGVSYVNSETPVKLADHFNIAGVFSTNAIQSFPSNS-RVTVA---TSVVQASLHDFLEIV  426

Query  1502  FHNPLRSVQTWHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVA  1681
             F N  +SVQ+WHLDGY+F+VVG G G W+    R YNL DA+ R T QVYP +WT + V+
Sbjct  427   FQNNEKSVQSWHLDGYDFWVVGFGSGQWTPAKRRLYNLADALTRHTTQVYPNAWTTILVS  486

Query  1682  MDNEGMWNLRSGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             +DN+GMW++RS   D++YLGQ+ Y+KV     DP K S  +E   P N+++CGKA
Sbjct  487   LDNQGMWSMRSARWDRQYLGQQFYLKVW----DPVK-SLANEYNPPDNLLRCGKA  536


 Score =   172 bits (435),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  82   VCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPF  261
            V   S  +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+PF
Sbjct  25   VKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQPF  84

Query  262  LMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYG  441
            L++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG+G
Sbjct  85   LLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFG  144

Query  442  PIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             I +Y  P +  P+  P  D  +LI DW+  + + +
Sbjct  145  AINVYARPRIPIPYLLPVSDFTLLIGDWFKTNHKTL  180


 Score = 94.7 bits (234),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ ++ NFRIQGH M +VE EGS+ +++D+++LD+HVGQS S++V    
Sbjct  211   GKTYMLRISNVGLSSTFNFRIQGHKMKVVEVEGSHVIQNDYESLDVHVGQSLSLLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF   + +  G +RY+  R     P S +P
Sbjct  269   NQPPKDYYIVASTRFLRRKLNVTGLLRYSNSR----VPASGAP  307


 Score = 32.7 bits (73),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q S     GK+
Sbjct  178  KTLQQRLDSGGVLPFPDGMLINGQ--TQTSFTGDQGKT  213



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   215 bits (548),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRTGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIVFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE P+P N + CG+A+
Sbjct  499   RQYLGQQFYLRVYTPS-----TSLRDEYPVPRNALLCGRAS  534


 Score =   184 bits (468),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I LSL   V++E+  RFY+W +++     LGV ++ I+IN QFPGP ++  TND + +N
Sbjct  12   FIGLSLLFAVTAEDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPG+N+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYVLQMKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSN  172


 Score = 93.6 bits (231),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A +
Sbjct  208   GKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  268   PPR--DYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGP  308


 Score = 28.1 bits (61),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING     A+L+ + GK+
Sbjct  176  LKAQLDNGKKLPLPDGILINGRS-SGATLNVEQGKT  210



>gb|ABK25092.1| unknown [Picea sitchensis]
 gb|ACN40425.1| unknown [Picea sitchensis]
Length=539

 Score =   210 bits (535),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 138/220 (63%), Gaps = 11/220 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG I   RTI L      + GK RYA+NGVSF+ PDTPLKLA
Sbjct  324   RWNLTANAARPNPQGSYHYGLIKPARTITLANSAPIINGKQRYAVNGVSFMPPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ LGTI + P      L      +V+      F +IVF N   ++Q+WH+DG
Sbjct  384   DYFKIQGVFNLGTISDYPRGGGGYLQ----TAVMSGQFRSFIEIVFQNDENTIQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFV GM  G WS    + YNL DAV RST QVYP SWTAV + +DN GMWN+RS    
Sbjct  440   YSFFVAGMDGGQWSPASRKGYNLFDAVSRSTTQVYPNSWTAVLLMLDNAGMWNVRSEIWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV G        + +DE  +P N + CG+A
Sbjct  500   RQYLGQQFYMKVAG-------FAGQDEYIVPRNALMCGRA  532


 Score =   178 bits (451),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 116/169 (69%), Gaps = 0/169 (0%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            L ++C + + +  V      +++ WTV++ T   +GV ++ I+IN QFPGP LN  TND 
Sbjct  8    LAVICVVWITAAGVRTEDAYKYFTWTVTYGTIYPMGVPQQGILINGQFPGPQLNVVTNDN  67

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N L+EPFL+SWNG+Q R +SWQDGV GT+CPIPP +N+TY FQ KDQIG+YFYF
Sbjct  68   VIINVFNYLNEPFLLSWNGIQQRRNSWQDGVLGTSCPIPPRRNFTYKFQAKDQIGTYFYF  127

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS  LHKAAGG+G + I +  V+  P+P P  +   LI DWY  +  V+
Sbjct  128  PSTLLHKAAGGFGGLAIASRSVISIPYPTPAGEYTALIGDWYKTNHAVL  176


 Score =   102 bits (254),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G+TY LRISNVG+ TSLNFRIQGH M LVE EGS+TV++ +D+LD+HVGQS SV++ A +
Sbjct  209   GRTYRLRISNVGLSTSLNFRIQGHKMKLVEVEGSHTVQNVYDSLDLHVGQSCSVLITADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+     G+  +RY+  R     PL   P
Sbjct  269   APK--DYYIVASTRFTNPVLYGVALLRYSNSRQPASGPLPPGP  309


 Score = 30.4 bits (67),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  LD    L  P+G+ ING G   ++    PG++
Sbjct  175  VLRRWLDSGRALGMPNGVHINGRGKGLSTFKVDPGRT  211



>ref|XP_006413696.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
 gb|ESQ55149.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
Length=541

 Score =   220 bits (561),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 141/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  +F +IVF N   SVQ+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTSPSGGNGGYLQS---SVMAANFREFIEIVFQNWENSVQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  ++
Sbjct  441   FFVVGMDGGQWTTRSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSENWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   177 bits (449),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVFGDNPYRFFTWKITYGNIYPLGVKQQGILINGQFPGPHIDAITNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLKEPFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IRI++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRIWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 91.7 bits (226),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ T+LNFRIQGH M LVE EGS+T+++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGVATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  265   NQAPQDYYIVVSSRFTRKVLTTTSILHYSNSRRRVSGPVPSGP  307


 Score = 32.0 bits (71),  Expect(4) = 4e-125, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L FP G+LING G    +    PGK+
Sbjct  173  VLRRLLEAGRNLPFPDGVLINGRGWGGNTFTVHPGKT  209



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   220 bits (560),  Expect(4) = 5e-125, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY +G+I   P      L      SV+QT+   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRVGSIQSQPTGGGIYL----DTSVMQTDYRTFIEIVFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV R TVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVY-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   179 bits (453),  Expect(4) = 5e-125, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            ++  +L   V++E   RF++W V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   IVGFALLFAVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G +RI + P +  PF  P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGLRILSRPGIPVPFADPAGDYTVLIGDWYKSN  172


 Score = 92.8 bits (229),  Expect(4) = 5e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISN+G++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  266   DQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGP  308


 Score = 30.0 bits (66),  Expect(4) = 5e-125, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  176  LKAQLDSGRKLPLPDGILINGRG-SGATLNVEQGKT  210



>ref|XP_007049589.1| SKU5 similar 3 [Theobroma cacao]
 gb|EOX93746.1| SKU5 similar 3 [Theobroma cacao]
Length=594

 Score =   194 bits (492),  Expect(4) = 6e-125, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 139/226 (62%), Gaps = 16/226 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVY-GKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG+I VT   V+  K A +  GK R  +NG+S++ P TP+KL
Sbjct  345   RWNVSAGAARPNPQGSFKYGQIIVTDVYVILNKPAELIDGKWRTTLNGISYLAPSTPIKL  404

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARP--GVSVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             A  FNI GVY+L        F  RL+   P    S+I      F +I+F N   +VQ++H
Sbjct  405   AQQFNIPGVYKL-------DFPNRLMNRPPKTDTSLINGTFKGFMEIIFQNNDTTVQSYH  457

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             LDGY FFVVGM  G+W+     +YN  D V RST QV+P +WTA+ +++DN G+WNLR+ 
Sbjct  458   LDGYAFFVVGMDFGVWTENSRGTYNKWDGVARSTTQVFPGAWTAILISLDNAGIWNLRAQ  517

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             N D  YLGQE+Y+ V  PE D S      E P+P N I CG  + L
Sbjct  518   NLDSWYLGQEVYVSVLNPEVDQS------EVPLPENAIYCGILSSL  557


 Score =   192 bits (487),  Expect(4) = 6e-125, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEER---FYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            V+G+    L     VL+  V  S       FYDWTVS+ T S LG +++VI IN QFPGP
Sbjct  2    VSGSPYFRLSFFFSVLACLVTASLAGDPFVFYDWTVSYLTTSPLGYKQQVIGINGQFPGP  61

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
            +LN +TN  + VN+ NNLDEP L++WNG+Q R +SWQDGV GTNCPIP G NWTY FQ+K
Sbjct  62   ILNVTTNWNIVVNVKNNLDEPLLLTWNGIQHRKNSWQDGVLGTNCPIPAGWNWTYEFQVK  121

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            DQIGS+FYFPSL+  +AAGGYG I I N  V+  PF  PD D+ I ISDWYT+
Sbjct  122  DQIGSFFYFPSLNFQRAAGGYGGIIINNRDVIPLPFGIPDGDITIFISDWYTK  174


 Score =   107 bits (268),  Expect(4) = 6e-125, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQSYS +V  ++
Sbjct  224   GKTYRFRVHNVGISTSLNFRIQDHNLLLVETEGSYTVQQNYTNMDIHVGQSYSFLV-TMD  282

Query  999   HKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ ASPRF       + +G+  + Y+  +G    PL   P
Sbjct  283   QNASNDYYIVASPRFVNSSDWAKVTGVAILHYSNSQGPASGPLPDPP  329


 Score = 27.3 bits (59),  Expect(4) = 6e-125, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ ++    L+ P GILING GP
Sbjct  177  KGLRKDVENGVDLEVPDGILINGLGP  202



>ref|XP_009353293.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=542

 Score =   227 bits (579),  Expect(4) = 7e-125, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYA+N VSF+ PDTPLKLA
Sbjct  324   RRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAVNSVSFIKPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+ LG+I + P      L      SV+  +   F ++VF NP  +VQ+WH+DG
Sbjct  384   DHFKISGVFSLGSIQDNPTGGGAYLQ----TSVMNADFRGFAELVFENPEDTVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G W+      YNL+D + RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  440   HNFFVVGMDGGQWTPASRLRYNLRDTISRSTVQVYPNSWTAIYMPLDNVGMWNIRSENWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y +V  P +     S RDE PIP N + CG+A
Sbjct  500   RQYLGQQFYFRVYSPAN-----SWRDEYPIPRNALLCGRA  534


 Score =   176 bits (446),  Expect(4) = 7e-125, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +1

Query  52   VCSLIVLSLF--VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
             C +I+++L   +C S E+  RFY+W V++     LG++++ I+IN QFPGP +   TND
Sbjct  7    ACCVILVALLTVICTSGEDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTND  66

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +++ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSYFY
Sbjct  67   NLIISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFY  126

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL LHKAAGG+G I+I + P +  PFP P  D  IL  DW++++
Sbjct  127  FPSLGLHKAAGGFGGIKIDSRPRIPVPFPPPAGDFTILAGDWFSKN  172


 Score = 88.6 bits (218),  Expect(4) = 7e-125, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG  T +NFRIQGH M LVE EG++++++ + +LDIH+GQSYSV+V A +
Sbjct  209   GKTYRLRISNVGRTTHINFRIQGHKMLLVEVEGTHSLQNTYSSLDIHLGQSYSVLVTADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                   YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  269   PP--KDYYIVVSSRFTSQVVSATSILHYSNSAGSVSGPPPGGPTTQ  312


 Score = 28.5 bits (62),  Expect(4) = 7e-125, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +     GK+
Sbjct  176  LKAILDGGNNLPFPDGLLINGRGSNGFTFTVDQGKT  211



>ref|XP_003517277.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=540

 Score =   216 bits (550),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+ I L      + GK RYA+N VS+V PDTPLKLA
Sbjct  325   RWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPLINGKLRYAVNSVSYVNPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ +  +   P      +    G SV+QT+LHDF +++F N   ++Q+WHLDG
Sbjct  385   DYFNIPGVFSVNLLQNSPSNGPGYI----GTSVLQTSLHDFIEVIFQNNENTMQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+V+G G G W+    ++YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  441   YDFWVIGHGFGQWTDASRKTYNLVDALTRHTAQVYPKSWTTILVSLDNQGMWNLRSAIWE  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V   +      S  +E  IP NV+ CGKA
Sbjct  501   RQYLGQQFYLRVWNAQK-----SLANEYDIPNNVLLCGKA  535


 Score =   181 bits (459),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 121/177 (68%), Gaps = 2/177 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPL  198
            +  T  L L+C +I L     V +E+  +++ WTV++ T   L   ++VI+IN QFPGP 
Sbjct  1    MGSTGLLHLICLVIALVSVSLVQAEDAYKYFTWTVTYGTLYPLASPQQVILINGQFPGPR  60

Query  199  LNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKD  378
            L+  TN+ + +N+ N LDEPFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KD
Sbjct  61   LDLVTNENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKD  120

Query  379  QIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            QIG+Y YFPS  LHKAAGG+G + +Y+  V+  P+P PD D  +L+ DWY  + + +
Sbjct  121  QIGTYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTL  177


 Score = 92.0 bits (227),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH + LVE EGS+TV++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSHTVQNLYDSLDVHVGQSVAVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGN----PGTPLSK  1121
             ++    YY+ AS RF+    +    + Y N F       P  P+ K
Sbjct  266   NQPPKDYYIVASTRFTETPLTTTAVLHYANSFSSALGPVPAPPVDK  311


 Score = 31.2 bits (69),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            K LR++LD    L FP G+LING  
Sbjct  175  KTLRQTLDSGKSLAFPDGLLINGQA  199



>ref|XP_008362259.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=542

 Score =   224 bits (571),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYA+N VS++ PDTPLKLA
Sbjct  324   RRNLTASGPRPNPQGSYHYGLINTTRTIRLXSSAPIIDGKQRYAVNSVSYIQPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ LG+I + P      L      SV+  +   F ++VF NP  +VQ+WH+DG
Sbjct  384   DYFKISGVFSLGSIQDNPTGGGAYLQ----TSVMNADFRGFAELVFENPEDTVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G W+      YNL+D + RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  440   HNFFVVGMDGGQWTPASRLRYNLRDTISRSTVQVYPSSWTALYMPLDNVGMWNIRSENXA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y +V  P +     S RDE PIP N + CG+A
Sbjct  500   RQYLGQQFYFRVYSPAN-----SWRDEYPIPKNALLCGRA  534


 Score =   176 bits (446),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +1

Query  52   VCSLIVLSLFV--CVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
             C +++++L    C + E+  RFY+W V++     LGV+++ I+IN QFPGP ++  TND
Sbjct  7    ACCVVLVALLTVTCTNGEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDSVTND  66

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +N+ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY+ Q+KDQIGSYFY
Sbjct  67   NLIINVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYALQVKDQIGSYFY  126

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL  HKAAGG+G I+I + P +  PFP P  D  IL  DW++++
Sbjct  127  FPSLGFHKAAGGFGGIKIDSRPRIPVPFPPPAGDFTILAGDWFSKN  172


 Score = 91.7 bits (226),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+ TS+NFRIQGH M LVE EG++++++ + +LDIH+GQSYSV+V A +
Sbjct  209   GKTYRLRISNVGLTTSINFRIQGHTMMLVEVEGTHSLQNTYSSLDIHLGQSYSVLVTADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                   YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  269   PPQ--DYYIVVSSRFTSQVLSSTSILHYSNSAGSVSGPPPGGPTTQ  312


 Score = 28.5 bits (62),  Expect(4) = 8e-125, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +     GK+
Sbjct  176  LKAILDGGNNLPFPDGLLINGRGSNGFTFTVDQGKT  211



>ref|NP_177743.1| SKU5-like 5 protein [Arabidopsis thaliana]
 gb|AAF17645.1|AC009978_21 T23E18.10 [Arabidopsis thaliana]
 dbj|BAH19558.1| AT1G76160 [Arabidopsis thaliana]
 gb|AEE35804.1| SKU5-like 5 protein [Arabidopsis thaliana]
Length=541

 Score =   216 bits (550),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLK+A
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKIA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +I+F N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRSGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  P       S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQLYLRVYTPS-----TSLRDEYPIPKNALLCGRAS  534


 Score =   182 bits (462),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I LSL   V++E+  RF++W +++     LGV ++ I+IN  FPGP ++  TND L +N
Sbjct  12   FIGLSLLFAVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKAN  172


 Score = 92.4 bits (228),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRFRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G  RY+   G    P+   P
Sbjct  266   DQTPRDYYVVVSSRFTSNVLTTTGIFRYSNSAGGVSGPIPGGP  308


 Score = 29.3 bits (64),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L  P GILING     A+L+ + GK+
Sbjct  176  LRAQLDNGKKLPLPDGILINGRS-SGATLNVEQGKT  210



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   219 bits (559),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY +G+I   P      L      SV+QT+   F +IVF N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRVGSIQSQPTGGGIYL----DTSVMQTDYRTFIEIVFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV R TVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVY-----TTSTSLRDEYPIPKNALLCGRAS  534


 Score =   177 bits (450),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            ++  +L   V++E   RF++W V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   IVGFALLFAVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G +RI + P +  PF  P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGLRILSRPGIPVPFADPAGDNTVLIGDWYKSN  172


 Score = 92.8 bits (229),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISN+G++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  266   DQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGP  308


 Score = 30.0 bits (66),  Expect(4) = 9e-125, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+L+ + GK+
Sbjct  176  LKAQLDSGRKLPLPDGILINGRG-SGATLNVEQGKT  210



>ref|XP_010459724.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
Length=548

 Score =   223 bits (569),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++  G  RPNPQGS+HYG INVTRTI L     ++ GKPRYA+N  SF   DTPLKLA
Sbjct  333   RTNLTAGGPRPNPQGSYHYGMINVTRTIRLVTSAGQIQGKPRYAVNRASFYPSDTPLKLA  392

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY+ G+I + P  T   L   P  SV+Q +   F +IVF N    VQ+WH DG
Sbjct  393   DYFKIDGVYKPGSISDHP--TSGALF--PMTSVLQADHRAFVEIVFQNWDNIVQSWHFDG  448

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS    + YNL DAV R TVQVYP SWTA+YVA+DN GMWNLRS   +
Sbjct  449   YSFFVVGMEFGKWSTASRKIYNLNDAVSRCTVQVYPRSWTAIYVALDNVGMWNLRSELWE  508

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S RDE  IP N + CG+A
Sbjct  509   RQYLGQQLYMRVY-----TTSTSLRDEYQIPKNALLCGRA  543


 Score =   167 bits (423),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            LIVLS+ + V +E+  R++ W +++     +GV+++ I+IN  FPGP +   TND L +N
Sbjct  23   LIVLSILIVVMAEDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIIN  82

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SW G+Q R +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS++YFPSL 
Sbjct  83   VFNHLDEPFLISWAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGSFYYFPSLG  142

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             HKAAGG+G IRI + P++  PFP P  D  +LI DWY  + + +
Sbjct  143  FHKAAGGFGAIRISSRPLIPVPFPPPADDYTVLIGDWYKTNHKAL  187


 Score = 92.8 bits (229),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG +T++  F +LD+HVGQSYSV+V A  
Sbjct  219   GKTYRLRISNVGLRNSLNFRIQNHMMKLVEVEGRHTIQTQFSSLDVHVGQSYSVIVTA--  276

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+       G + Y+   G    PL   P
Sbjct  277   NQPAKDYYIVVSSRFTPQTLITGGVLHYSNSAGAVSGPLPDVP  319


 Score = 36.6 bits (83),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 22/38 (58%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L FP  ILING     A L+ QPGK+
Sbjct  185  KALRAQLDNGGKLPFPDVILINGRA-SGAKLNVQPGKT  221



>ref|XP_002522337.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF40021.1| multicopper oxidase, putative [Ricinus communis]
Length=539

 Score =   213 bits (541),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 147/220 (67%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+TIVL      + GK RYA+N VS+V  DTPLKLA
Sbjct  324   RWNLTASAARPNPQGSFHYGKIIPTKTIVLANSAPLINGKRRYAVNRVSYVNADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I  +P        A    SV+ T+LHDF ++VF N   ++Q+WHLDG
Sbjct  384   DYFNIPGVFSVDSIQSLPSDG----PAYVATSVLPTSLHDFVEVVFQNNEYTMQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP +WTA+ V++DN+GMWN+RS   +
Sbjct  440   YDFWVVGYGAGQWAPNKRRTYNLVDALTRHTAQVYPKAWTAILVSLDNQGMWNMRSAIWE  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V          S  +E  IP N + CGKA
Sbjct  500   RQYLGQQLYLRVWTQVH-----SLANEYDIPCNALLCGKA  534


 Score =   179 bits (455),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            L     VL     V++++  R+Y WTV+  T S LG  ++VI+IN QFPGP L+  TND 
Sbjct  10   LFAVFAVLGTVSLVNADDPYRYYTWTVTDGTISPLGSPQQVILINGQFPGPRLDVVTNDN  69

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY  Q KDQIGS+ YF
Sbjct  70   IILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKLQTKDQIGSFTYF  129

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS  LH+AAGGYG + +Y  P +  PFP PD D  +L+ DWY  D + +
Sbjct  130  PSTLLHRAAGGYGGLNVYERPRIPIPFPNPDGDFTLLVGDWYKTDHKTL  178


 Score = 97.8 bits (242),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ TSLNFRIQGH M LVE EGS+T+++ +D+LD+HVGQS +V+V   +
Sbjct  209   GKTYMLRISNVGLSTSLNFRIQGHKMKLVEVEGSHTIQNIYDSLDVHVGQSVAVLVTLDQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+    +    + Y+  +     PL   P
Sbjct  269   PPK--DYYIVASTRFTRQVLTATAVLHYSNSQTPASGPLPAPP  309


 Score = 29.6 bits (65),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+ SLD    L FP G+LING 
Sbjct  176  KTLQASLDSGNSLPFPDGVLINGQ  199



>emb|CDX81353.1| BnaC09g07640D [Brassica napus]
Length=541

 Score =   222 bits (565),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+IN T++ V       + GK RYA+NGVS+V  DTPLKLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKINTTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+    I  +P  +     A    SV++ +LHDF +IVF N  ++VQ+WHLDG
Sbjct  386   DHFNIPGVFSTSAIQSVPSNS----PATVATSVVKASLHDFLEIVFQNNEKAVQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    + YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  442   YDFWVVGFGSGQWTPAKRQLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  502   RQYLGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  536


 Score =   175 bits (443),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 0/153 (0%)
 Frame = +1

Query  91   SSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMS  270
             S  +FY WTV++     LGV ++VI+IN QFPGP L+  TND + +N+ N LD+PFL++
Sbjct  28   ESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  87

Query  271  WNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIR  450
            WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG+G I 
Sbjct  88   WNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFGAIN  147

Query  451  IYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +Y  P +  P+P P  D  +LISDW+  + + +
Sbjct  148  VYARPRIPIPYPLPVEDFTLLISDWFKTNHKTL  180


 Score = 90.9 bits (224),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG  ++ NFRIQGH M +VE EGS+ ++ D+D+LD+HVGQS S++V    
Sbjct  211   GKTYMFRISNVGSSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDVHVGQSLSLLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             +++   YY+ AS RF     S    +RY+    N G P S
Sbjct  269   NQSPKDYYIVASTRFVRSNLSVTALLRYS----NSGVPAS  304


 Score = 32.3 bits (72),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  178  KTLQQRLDSGGVLPFPDGVLINGQ--TQTTFTGDQGKT  213



>ref|XP_010459725.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=537

 Score =   223 bits (569),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++  G  RPNPQGS+HYG INVTRTI L     ++ GKPRYA+N  SF   DTPLKLA
Sbjct  322   RTNLTAGGPRPNPQGSYHYGMINVTRTIRLVTSAGQIQGKPRYAVNRASFYPSDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY+ G+I + P  T   L   P  SV+Q +   F +IVF N    VQ+WH DG
Sbjct  382   DYFKIDGVYKPGSISDHP--TSGALF--PMTSVLQADHRAFVEIVFQNWDNIVQSWHFDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS    + YNL DAV R TVQVYP SWTA+YVA+DN GMWNLRS   +
Sbjct  438   YSFFVVGMEFGKWSTASRKIYNLNDAVSRCTVQVYPRSWTAIYVALDNVGMWNLRSELWE  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S RDE  IP N + CG+A
Sbjct  498   RQYLGQQLYMRVY-----TTSTSLRDEYQIPKNALLCGRA  532


 Score =   167 bits (422),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            LIVLS+ + V +E+  R++ W +++     +GV+++ I+IN  FPGP +   TND L +N
Sbjct  12   LIVLSILIVVMAEDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SW G+Q R +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS++YFPSL 
Sbjct  72   VFNHLDEPFLISWAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             HKAAGG+G IRI + P++  PFP P  D  +LI DWY  + + +
Sbjct  132  FHKAAGGFGAIRISSRPLIPVPFPPPADDYTVLIGDWYKTNHKAL  176


 Score = 92.8 bits (229),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG +T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLRNSLNFRIQNHMMKLVEVEGRHTIQTQFSSLDVHVGQSYSVIVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+       G + Y+   G    PL   P
Sbjct  266   NQPAKDYYIVVSSRFTPQTLITGGVLHYSNSAGAVSGPLPDVP  308


 Score = 36.6 bits (83),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 22/38 (58%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L FP  ILING     A L+ QPGK+
Sbjct  174  KALRAQLDNGGKLPFPDVILINGRA-SGAKLNVQPGKT  210



>gb|KEH20500.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=541

 Score =   214 bits (545),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 149/221 (67%), Gaps = 8/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG+I  T+TIVL      + GK RYA+N VS+V  +TPLKLA
Sbjct  325   RWNLTANAARPNPQGSYHYGKITPTKTIVLANSAPLINGKLRYAVNKVSYVNSETPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G++ + +I  +P       +A    SV+ T+LHDF ++VF N   ++Q+WHLDG
Sbjct  385   DYFNIPGIFSVDSIQSIPSNGGPAYVA---TSVLPTSLHDFVELVFQNDENTMQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R YNL DA  R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGFGQWTPARRRIYNLVDAPTRHTAQVYPNSWTTILVSLDNQGMWNLRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V   +      S R+E  IP NV+ CGKA+
Sbjct  502   RQYLGQQLYLRVWTDQR-----SLRNEYNIPTNVLLCGKAS  537


 Score =   180 bits (456),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            +++ WTV++ T S LG  ++VI+IN QFPGP L+  TN+ + +N+ N LD+PFL++WNG+
Sbjct  31   KYFTWTVTYGTLSPLGTPQQVILINGQFPGPQLDLVTNENVVLNLVNKLDQPFLLTWNGI  90

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS  LHKAAGG+G I +Y+ 
Sbjct  91   KQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTYTYFPSTQLHKAAGGFGAINVYHR  150

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             V+  P+P PD D  +LI DWY  + + +
Sbjct  151  SVISVPYPYPDGDFTLLIGDWYKTNHKAL  179


 Score = 92.0 bits (227),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH + LVE EGS+ +++ +D+LD+HVGQS +V+V    
Sbjct  210   GKTYMFRISNVGMSTSINFRIQGHALKLVEVEGSHVIQNIYDSLDVHVGQSAAVLVTL--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YY+ AS RFS    +    + Y         PL   P
Sbjct  268   NQSPKDYYIVASTRFSRRILTATAVLHYTNSHSPASGPLPSPP  310


 Score = 33.9 bits (76),  Expect(4) = 1e-124, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LRESLD    L FP G+LING     ++++   GK+
Sbjct  177  KALRESLDSGKSLAFPDGLLINGQA--HSTINGDQGKT  212



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   220 bits (561),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYAIN VSF+ PDTPLK+A
Sbjct  324   RRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAINSVSFLQPDTPLKVA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISGV+ +G+I + P      L      SV+  +   F + VF NP  ++Q+WHLDG
Sbjct  384   DYFKISGVFSVGSISDNPTGGGGYLQT----SVMHADFRAFVEFVFENPENTLQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL D V R TVQVYP SWTA+YV +DN GMWN+RS N  
Sbjct  440   YSFFVVGMDGGQWTPASRLRYNLMDTVSRCTVQVYPNSWTAIYVPLDNVGMWNVRSENWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A+
Sbjct  500   RQYLGQQFYLRVYSPVN-----SWRDEYPIPKNALLCGRAS  535


 Score =   183 bits (465),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 119/166 (72%), Gaps = 3/166 (2%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            + C L+V  L V  ++ E   RFY+W V++     LGV+++ I+IN QFPGP ++  TND
Sbjct  7    VCCVLLVALLTVSFTNGEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDCVTND  66

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +++ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSY+Y
Sbjct  67   NLIISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYYY  126

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL  HKAAGGYG I+I + P +  PF  P  D  IL  DW+ ++
Sbjct  127  FPSLAFHKAAGGYGGIKISSRPRIPVPFDPPAGDFTILAGDWFKQN  172


 Score = 87.8 bits (216),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH M LVE EG +T+++ + +LDIH+GQS SV+V A +
Sbjct  209   GKTYRFRISNVGIATSINFRIQGHKMLLVEVEGIHTLQNTYSSLDIHLGQSLSVLVTADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                   YY+  S RF+    S    + Y+   G+     PG P ++
Sbjct  269   PPQ--DYYIVVSTRFTSQVLSATSILHYSNSGGSVSGPPPGGPTTE  312


 Score = 27.7 bits (60),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G++ING G    +     GK+
Sbjct  176  LKAILDGGNNLPFPDGLIINGRGSNGNTFTVDQGKT  211



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score =   216 bits (551),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V  K RYA+N VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLINTTKTIILANSAGQVNRKQRYAVNSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV+ +G+I + P      L      SV+  +   F +IVF N    VQ+WH+DG
Sbjct  383   DFFKIGGVFRVGSISDRPTGGGIYL----DTSVMGADYRAFVEIVFQNNENIVQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DA+ R T QVYPYSWTA+YVA+DN G+WN+RS    
Sbjct  439   YSFFVVGMDGGQWTQSSRNQYNLRDAIARCTTQVYPYSWTAIYVALDNVGLWNVRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQFYLRVYTPS-----TSLRDEFPIPKNALLCGRAS  534


 Score =   178 bits (452),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF+ W VS++    LGV ++ I+IN QFPGP ++  TND L +N+ N+LDEPFL+SWNG+
Sbjct  28   RFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLISWNGI  87

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  HKAAGG+G IRI + 
Sbjct  88   QQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSR  147

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
            P +  PFP P  D  +LI DWY  +
Sbjct  148  PRIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 94.0 bits (232),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQGH M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+    +  G +RY+
Sbjct  266   DQPAQDYYIVVSTRFTSRVLATTGILRYS  294


 Score = 30.4 bits (67),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (3%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING   +  S   + GK+
Sbjct  175  TLKAHLDRGKKLPFPDGILINGRAND-TSFSVEQGKT  210



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   218 bits (555),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V  K RYA+N VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLINTTKTIILANSAGQVNRKQRYAVNSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV+ +G+I + P      L      SV+  +   F +I+F N    VQ+WH+DG
Sbjct  383   DFFKIGGVFRVGSISDRPTGGGIYL----DTSVMGVDYRAFVEIIFQNNENIVQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DA+ R T QVYPYSWTA+YVA+DN GMWN+RS    
Sbjct  439   YSFFVVGMDGGQWTQSSRNQYNLRDAIARCTTQVYPYSWTAIYVALDNVGMWNVRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE PIP N + CGKA+
Sbjct  499   RQYLGQQFYLRVYTPS-----TSLRDEFPIPKNALLCGKAS  534


 Score =   178 bits (451),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF+ W VS++    LGV ++ I+IN QFPGP ++  TND L +N+ N+LDEPFL+SWNG+
Sbjct  28   RFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISWNGI  87

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  HKAAGG+G IRI + 
Sbjct  88   QQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSR  147

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
            P +  PFP P  D  +LI DWY  +
Sbjct  148  PRIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 93.6 bits (231),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQGH M LVE EG++T++  + +LD+HVGQSYSV++ A  
Sbjct  208   GKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+    +  G +RY+
Sbjct  266   DQPAQDYYIVVSTRFTSRVLATTGILRYS  294


 Score = 30.0 bits (66),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (3%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING   +  S   + GK+
Sbjct  175  TLKAHLDRGKKLPFPDGILINGRAND-TSFGVEQGKT  210



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   218 bits (554),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 140/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI+L     +V  K RYA+N VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLINTTKTIILANSAGQVNRKQRYAVNSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F I GV+ +G+I + P      L      SV+  +   F +I+F N    VQ+WH+DG
Sbjct  383   DFFKIGGVFRVGSISDRPTGGGIYL----DTSVMGVDYRAFVEIIFQNNENIVQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DA+ R T QVYPYSWTA+YVA+DN GMWN+RS    
Sbjct  439   YSFFVVGMDGGQWTQSSRNQYNLRDAIARCTTQVYPYSWTAIYVALDNVGMWNVRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE PIP N + CGKA 
Sbjct  499   RQYLGQQFYLRVYTPS-----TSLRDEFPIPKNALLCGKAT  534


 Score =   178 bits (451),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF+ W VS++    LGV ++ I+IN QFPGP ++  TND L +N+ N+LDEPFL+SWNG+
Sbjct  28   RFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISWNGI  87

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL  HKAAGG+G IRI + 
Sbjct  88   QQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSR  147

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
            P +  PFP P  D  +LI DWY  +
Sbjct  148  PRIPVPFPDPAGDYTVLIGDWYKSN  172


 Score = 93.6 bits (231),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQGH M LVE EG++T++  + +LD+HVGQSYSV++ A  
Sbjct  208   GKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+    +  G +RY+
Sbjct  266   DQPAQDYYIVVSTRFTSRVLATTGILRYS  294


 Score = 30.0 bits (66),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (3%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
             L+  LDR   L FP GILING   +  S   + GK+
Sbjct  175  TLKAHLDRGKKLPFPDGILINGRAND-TSFGVEQGKT  210



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   224 bits (570),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI+L G    V GK RYAIN VS+V PDTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLINTTRTIILSGSPGIVNGKQRYAINSVSYVAPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+I + P      L      SV+QT+   F + VF N    +Q++HLDG
Sbjct  383   DYFKIPGVFRVGSISDRPTGGGIYL----DTSVLQTDYRTFVEFVFQNDEDIIQSYHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+     +YNL+DAV RST QVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  439   YSFFVVGMDGGQWTPASRNTYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE P+P N + CG+A+
Sbjct  499   RQYLGQQFYMRVY-----TTSTSIRDEYPVPKNALLCGRAS  534


 Score =   173 bits (439),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 112/164 (68%), Gaps = 1/164 (1%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
             AL ++C + V  + V      RF+ W V++     LGV ++ I+IN QFPGP ++  TN
Sbjct  6    AALAVLC-ISVFGIAVVAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTN  64

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N+ N+LD+PFL+SWNGVQ R +S++DGV GT CPIP G N+TY  Q+KDQIGS++
Sbjct  65   DNLIINVFNSLDQPFLLSWNGVQQRRNSFEDGVLGTTCPIPAGGNFTYILQVKDQIGSFY  124

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            YFPSL  HKAAGG+G IRI + P +  PF  P  D  +LI DWY
Sbjct  125  YFPSLAFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTVLIGDWY  168


 Score = 88.6 bits (218),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLN RIQ H + LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRLRISNVGLENSLNLRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              +    YY+  S RF+    +  G +RY+
Sbjct  266   DQPAQDYYIVVSSRFTSTVLTTTGILRYS  294


 Score = 33.1 bits (74),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A L+ + GK+
Sbjct  175  LKSQLDSGRKLPLPDGILINGRGSNGAYLNVEQGKT  210



>ref|XP_010448953.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   216 bits (550),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 141/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPARTIILANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  ++ +IVF N   S+Q+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTSPSGGNGGYLQ---TSVMAANFREYIEIVFQNWENSIQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS +  ++
Sbjct  441   FFVVGMDGGQWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNVRSESWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   177 bits (448),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLKEPFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 94.4 bits (233),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M L+E EGS+TV++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTVQNIYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +K    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  265   NKAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPIPNGP  307


 Score = 31.6 bits (70),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L  P G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNLPMPDGVLINGRGWGGNTFTVQPGKT  209



>ref|XP_004232058.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=538

 Score =   225 bits (574),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I ++RT V+      + GK RYA+N VS+V PDTPLKLA
Sbjct  323   RWNLTSNAARPNPQGSFHYGKITISRTFVMANSAPLINGKLRYAVNSVSYVNPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ L +I   P      L    G +V  T+ HDF +IVF N   ++Q+WHLDG
Sbjct  383   DHFNIPGVFNLNSIQAYPSGGSPNL----GTAVFPTSHHDFIEIVFQNDEATMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWNLRS   D
Sbjct  439   YDFWVVGFGSGKWTQASRNKYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNLRSAMWD  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ++Y++V  P       S  +E  IP N + CGKAA
Sbjct  499   RQYLGQQVYLRVYDPTP-----SLANEYDIPTNALLCGKAA  534


 Score =   173 bits (438),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 3/176 (2%)
 Frame = +1

Query  31   GTVAL-PLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLL  201
            G VAL  L+C + +      V +E+  +++ WT ++ T   LGV ++VI+IN QFPGP L
Sbjct  2    GNVALFHLICGIFIFWSVSLVKAEDTYKYFTWTATYGTLYPLGVPQQVILINGQFPGPRL  61

Query  202  NGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQ  381
            +  TND + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIP   N+TY FQ KDQ
Sbjct  62   DLVTNDNVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPINSNYTYKFQTKDQ  121

Query  382  IGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            IGSY YFPS  LH+A GG+G + +Y   V+  P+  P  D  +LI DWY    +V+
Sbjct  122  IGSYTYFPSTQLHRAVGGFGALNVYARSVIPVPYAKPAGDFSLLIGDWYKSSHKVL  177


 Score = 91.7 bits (226),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+K S+NFRIQGH M +VE EGS+ +++ +D+LD+HVGQS SV+V   +
Sbjct  208   GKTYMFRISNVGLKNSINFRIQGHKMRVVEIEGSHVLQNFYDSLDVHVGQSMSVLVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RFS +  +    + Y   +     P+  +P
Sbjct  268   PPK--DYYIVASTRFSRISFTATSVLHYTNSQTPVSGPVPPAP  308


 Score = 28.5 bits (62),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVLR+ LD    L +P+ +LING   +Q++     GK+
Sbjct  175  KVLRQILDSGRSLPYPNDLLINGQ--KQSTFSGDQGKT  210



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   215 bits (548),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN +RTI L     +V  K RYAIN VSFV  DTP+KLA
Sbjct  320   RTNLTASGPRPNPQGSYHYGMINTSRTIRLASSAGQVNRKQRYAINSVSFVPADTPIKLA  379

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY +G+IP+ P+     L      SV+QT+   F +IVF N    VQ++HL+G
Sbjct  380   DFFQISGVYHVGSIPDAPNGRGVYL----DTSVMQTDYRTFIEIVFENYEDIVQSYHLNG  435

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W++     YNL+DAV R TVQVYP SWTA+Y+A+DN GMW LRS    
Sbjct  436   YSFWVVGMDGGQWTSASRNQYNLRDAVSRCTVQVYPKSWTAIYIALDNVGMWQLRSEFWA  495

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V       +  S RDE PIP N + CG+A
Sbjct  496   RQYLGQQFYLRVY-----TTSTSLRDEYPIPKNALLCGRA  530


 Score =   178 bits (451),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  46   PLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            PL+   +V + F   ++E   RFY W V++ T   LGV ++ I+IN QFPGP +   TND
Sbjct  3    PLLKLAVVFACFAIAAAESPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTND  62

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             + VN+ N+LDEPFL+ W+GVQ R +S++DGV GT CPIPPG+N+TY  Q+KDQIGS+FY
Sbjct  63   NIIVNVFNSLDEPFLIHWSGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGSFFY  122

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL  HKAAGG+G I+I + P++  PF  P  D  +LI DWY  +
Sbjct  123  FPSLAFHKAAGGFGGIKILSRPLIPVPFDPPADDYTVLIGDWYKSN  168


 Score = 87.8 bits (216),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK Y LRI NVG++ SLNFRIQGH M +VE EG++T++  + +LDIH+GQ  SV+V A +
Sbjct  205   GKIYRLRICNVGLQNSLNFRIQGHKMKVVEVEGTHTLQVSYSSLDIHLGQCMSVLVTADQ  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  GF+RY         PL   P
Sbjct  265   QPQ--DYYIVVSSRFTSTVLTTTGFLRYANSNRPASGPLPGGP  305


 Score = 37.4 bits (85),  Expect(4) = 2e-124, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 0/35 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGK  739
            L+  LD+   L FP GILING GP   S   Q GK
Sbjct  172  LKAILDKGHKLPFPDGILINGRGPNVTSFTVQQGK  206



>ref|XP_010434093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   216 bits (550),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 141/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPARTIILANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  ++ +IVF N   S+Q+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTSPSGGNGGYLQS---SVMAANFREYIEIVFQNWENSIQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS +  ++
Sbjct  441   FFVVGMDGGQWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSESWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   176 bits (447),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLKEPFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 94.4 bits (233),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M L+E EGS+TV++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTVQNIYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +K    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  265   NKAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPIPNGP  307


 Score = 31.6 bits (70),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L  P G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNLPMPDGVLINGRGWGGNTFTVQPGKT  209



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   219 bits (558),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 149/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN T TI L      + GK RYAIN VSFV  DTPLKLA
Sbjct  327   RRNLSASGPRPNPQGSYHYGLINTTHTIRLANSAPIINGKQRYAINSVSFVPADTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ LG+IP+ P      L      SV+  +   +T+++F N   +VQ++H+DG
Sbjct  387   DHFNIPGVFTLGSIPDSPTGGGAYLQ----TSVMAADFRAYTEVIFENLEDTVQSYHIDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGMG G W+     +YNL+D + RSTVQ+YP SWTA+Y+ +DN GMWN+RS N  
Sbjct  443   HHFFVVGMGGGEWTPASRLTYNLRDTISRSTVQLYPKSWTALYMPLDNVGMWNIRSQNWA  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P +     S RDE PIP++ + CG+A+
Sbjct  503   RQYLGQQFYLRVYSPAN-----SWRDEYPIPSDALLCGRAS  538


 Score =   180 bits (456),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            LPL+  +++      +S E+  RFY W V++     LG++++ I+IN QFPGP +   TN
Sbjct  9    LPLMAVVLMFVHTNLISGEDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTN  68

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N+ NNLDEPFL+SWNGV+ R +SWQDGV GTNCPIPPG N+TY  Q+KDQIGS++
Sbjct  69   DNLIINVFNNLDEPFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFY  128

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YFPSL  HKAAGG+G I I +  V+  PFP P  +  IL  DW+ ++
Sbjct  129  YFPSLAFHKAAGGFGSINIASRSVIPVPFPPPAGEFSILSGDWFKQN  175


 Score = 93.2 bits (230),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M +VE EG++TV++ +D+LDIH+GQSYSV++    
Sbjct  212   GKTYRFRISNVGLTTSINFRIQGHKMMVVEVEGTHTVQNTYDSLDIHLGQSYSVLLTT--  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
              +    YY+  S RF+    +    +RY+   G+     PG P ++
Sbjct  270   DQPAKDYYIVVSTRFTSQVLTATSTLRYSNSAGSVSGPPPGGPTTE  315


 Score = 26.2 bits (56),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LI+G G    +     GK+
Sbjct  179  LKAILDSGHDLPFPDGLLISGRGSNGYTFTVDQGKT  214



>gb|AAL09733.1| At1g76160/T23E18_10 [Arabidopsis thaliana]
Length=541

 Score =   216 bits (551),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLK+A
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKIA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +I+F N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRSGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  P       S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQLYLRVYTPS-----TSLRDEYPIPKNALLCGRAS  534


 Score =   182 bits (462),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I LSL   V++E+  RF++W +++     LGV ++ I+IN  FPGP ++  TND L +N
Sbjct  12   FIGLSLLFAVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKAN  172


 Score = 90.5 bits (223),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFR Q H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRFRISNVGLQDSLNFRFQDHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G  RY+   G    P+   P
Sbjct  266   DQTPRDYYVVVSSRFTSNVLTTTGIFRYSNSAGGVSGPIPGGP  308


 Score = 29.3 bits (64),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L  P GILING     A+L+ + GK+
Sbjct  176  LRAQLDNGKKLPLPDGILINGRS-SGATLNVEQGKT  210



>ref|XP_010680456.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=537

 Score =   214 bits (546),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 150/226 (66%), Gaps = 15/226 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+ YG I +T+T++L   + ++ GK RY +N VS+V P+TPLKLA
Sbjct  324   RWNLTANAARPNPQGSYRYGGIEITKTLILGNSVDQIDGKMRYGVNNVSYVNPETPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARP---GVSVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             D++NISG++ L T  + P        A P   G +V   ++HD+ +I+F N   + Q+WH
Sbjct  384   DYYNISGIFNLNTSRKEP-------AAGPMSYGTTVFGMDVHDYIEIIFQNNEATTQSWH  436

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             LDG+NFFVV  G   WS    R YNL DAV+RSTVQVY  SWTAV V++DN+GMWNLRS 
Sbjct  437   LDGHNFFVVAFGANEWSPDMRRKYNLVDAVWRSTVQVYRDSWTAVLVSLDNKGMWNLRSA  496

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
                ++YLGQ++Y++    E      S R E+ IP N +KCGKAA+L
Sbjct  497   IWHRQYLGQQVYLRAWNNEP-----SLRTESDIPTNALKCGKAAKL  537


 Score =   186 bits (473),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            L  +  ++  S    + +E   R+YDW +++ T S LGV ++ I+IN QFPGP +N  TN
Sbjct  7    LSFLLGILAFSSIFGIQAESPYRYYDWEITYGTISPLGVPQRGILINGQFPGPTINCDTN  66

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L + I+N LDEPFLM+WNGV  R  SWQDGV GTNCPIPP  NWTY+ Q KDQIG+Y 
Sbjct  67   DNLIITIYNRLDEPFLMTWNGVWQRKMSWQDGVLGTNCPIPPNSNWTYTMQSKDQIGTYM  126

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            YFPS  +H+ AGG+G   I+  PV+  P+P P  + ++L+ DWY  D +V+
Sbjct  127  YFPSTAMHRVAGGFGAFNIHRRPVIALPYPEPAGEYNLLVGDWYNTDHKVL  177


 Score = 85.1 bits (209),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 2/109 (2%)
 Frame = +3

Query  801   VLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSV  980
             VL    GKTY++R++NVGI  S+N RIQGH M LVE EGS+ ++  +++LD+H GQS + 
Sbjct  203   VLTGEEGKTYLIRVANVGIMESINIRIQGHVMKLVEVEGSHVLQEIYESLDVHPGQSLAF  262

Query  981   MVKALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +V    + +   YY+ AS RF+         +RYN    +   PL   P
Sbjct  263   LVTL--YGSVKDYYIVASTRFARTSIEATALLRYNGSNTDASLPLPIGP  309


 Score = 32.0 bits (71),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            KVL+E LD+   +  P G+LINGH P    L  + GK+
Sbjct  175  KVLQERLDKGFDMPTPDGLLINGH-PNNTVLTGEEGKT  211



>ref|XP_010439384.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   216 bits (549),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 141/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPARTIILANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  ++ +IVF N   S+Q+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTSPSGGNGGYLQS---SVMAANFREYIEIVFQNWENSIQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS +  ++
Sbjct  441   FFVVGMDGGQWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNVRSESWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   177 bits (448),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLKEPFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 94.4 bits (233),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M L+E EGS+TV++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTVQNIYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +K    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  265   NKAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPIPNGP  307


 Score = 31.6 bits (70),  Expect(4) = 3e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L  P G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNLPMPDGVLINGRGWGGNTFTVQPGKT  209



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score =   213 bits (542),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  +RTI+L      +  K R+A+N VSF+  DTPLKLA
Sbjct  323   RRNLTASGPRPNPQGSYHYGMIKTSRTIMLANSAPFINRKQRFAVNSVSFIPSDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ L +IP  P +    L      SV+  N  +F +IVF N   +VQ+WH+DG
Sbjct  383   DYFKIPGVFNLESIPTSPTWGNPYL----QTSVMSANFREFIEIVFQNWEDTVQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G W+      YNL+DAV R T QVYP SWTAVY+A+DN GMWN+RS N  
Sbjct  439   HSFFVVGMDGGQWTPASRVGYNLRDAVARCTTQVYPRSWTAVYMALDNVGMWNIRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE PIP N + CG+A
Sbjct  499   RQYLGQQFYLRVYTPSN-----SWRDELPIPRNALLCGRA  533


 Score =   179 bits (455),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            RF+ W V++     LGV+++ I+IN QFPGP ++  TND L +N+ N L EPFL+SWNG+
Sbjct  27   RFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLREPFLISWNGI  86

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            Q R +SWQDGV GTNCPI PG+N+TY  Q+KDQIGS+FYFPSL +HKAAGG+G IRI++ 
Sbjct  87   QQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSFFYFPSLGMHKAAGGFGSIRIWSR  146

Query  463  PVVHPPFPCPDYDLDILISDWYTED  537
            P++  PFP P  D  +L  DWY  +
Sbjct  147  PLIPVPFPTPAGDFTVLAGDWYKRN  171


 Score = 93.6 bits (231),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
               GKTY  RISNVG+ TS+NFRIQGH M LVE EGS+T+++ + +LDIH+GQSYSV+V A
Sbjct  206   DPGKTYRFRISNVGLATSINFRIQGHKMKLVEVEGSHTLQNTYSDLDIHLGQSYSVLVTA  265

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +      YY+  S RF+    +    + Y+        P+ + P
Sbjct  266   DQQPK--DYYIVVSTRFTPRVLATTAILHYSNSWSRVAGPIPRGP  308


 Score = 32.0 bits (71),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            +LR  LD    L FP G+LING G    +    PGK+
Sbjct  174  LLRRILDAGHDLPFPDGLLINGRGWNGYTFTVDPGKT  210



>gb|KHN42054.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   215 bits (547),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+ I L      + GK RYA+N VS+V PDTPLKLA
Sbjct  322   RWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPLINGKLRYAVNSVSYVNPDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G++ +  +   P      +    G SV+QT+LHDF +++F N   ++Q+WHLDG
Sbjct  382   DYFNIPGIFSVNLLQNSPSNGPGYI----GTSVLQTSLHDFIEVIFQNNENTMQSWHLDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+V+G G G W+    ++YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  438   YDFWVIGHGFGQWTDASRKTYNLVDALTRHTTQVYPKSWTTILVSLDNQGMWNLRSAIWE  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V   +      S  +E  IP NV+ CGKA
Sbjct  498   RQYLGQQFYLRVWDAQK-----SLANEYDIPNNVLLCGKA  532


 Score =   181 bits (458),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 122/174 (70%), Gaps = 5/174 (3%)
 Frame = +1

Query  34   TVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNG  207
            T  L L+C +I L   V V +E+  ++Y WTV++ T S LG  ++VI+IN QFPGP L+ 
Sbjct  4    TGLLHLLCLVIAL---VSVQAEDAYKYYTWTVTYGTISPLGSPQQVILINGQFPGPRLDL  60

Query  208  STNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIG  387
             TN+ + +N+ N LDEPFL++WNG++   +SWQDGV GTNCPIPP  N+TY FQ KDQIG
Sbjct  61   VTNENVILNLINKLDEPFLLTWNGIKQWKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIG  120

Query  388  SYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +Y YFPS  LHKAAGG+G + +Y+  V+  P+P PD D  +L+ DWY  + + +
Sbjct  121  TYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTL  174


 Score = 91.3 bits (225),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
             + GKTYM RISNVG  TS+NFRIQGH + LVE EGS+TV++ +D+LD+HVGQS +V+V  
Sbjct  203   NPGKTYMFRISNVGFSTSINFRIQGHTLKLVEVEGSHTVQNLYDSLDVHVGQSVAVLVTL  262

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGN----PGTPLSK  1121
               ++    YY+ AS RF+    +    + Y N F       P  P+ K
Sbjct  263   --NQPPKDYYIVASTRFTETPLTTTAVLHYANSFSSALGPVPAPPVDK  308


 Score = 31.2 bits (69),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR++L+    L FP G+LING     ++    PGK+
Sbjct  172  KTLRQTLESGKPLAFPDGLLINGQA--HSTFTGNPGKT  207



>ref|XP_006304367.1| hypothetical protein CARUB_v10010844mg [Capsella rubella]
 gb|EOA37265.1| hypothetical protein CARUB_v10010844mg [Capsella rubella]
Length=543

 Score =   220 bits (561),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             + ++     RPNPQGS+HYG I VTRTI L   +  + GK RYA+N  SF   +TPLKLA
Sbjct  309   KTNLTASGPRPNPQGSYHYGMIKVTRTIRLANSVGNINGKQRYAVNSASFYPAETPLKLA  368

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+IP+ P  TY  +   P  SV+QT+   F +IVF N    +Q+WH DG
Sbjct  369   DYFKIDGVYRPGSIPDQP--TYGAMF--PVTSVMQTDYKAFVEIVFENWEDIIQSWHFDG  424

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WSA   + YNL DAV R TVQVYP SWTA+Y+++DN GMWNLRS + +
Sbjct  425   YSFYVVGMELGKWSADSRKVYNLNDAVSRCTVQVYPKSWTAIYISLDNVGMWNLRSESWE  484

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       +  S RDE  IP N + CGKA+
Sbjct  485   RQYLGQQFYMRVY-----TTSTSLRDEYLIPKNALLCGKAS  520


 Score =   164 bits (414),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 111/171 (65%), Gaps = 17/171 (10%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            +K++N T  +    SL+ L   V      RF++W                I+IN +FPGP
Sbjct  3    VKSMNTTATM---ISLLFLIGVVASEDPYRFFEW--------------HGILINGKFPGP  45

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             +   TND L +N+ N+LDEPFL+SW+G++   +S+QDGV GT CPIPPGKN+TY+ ++K
Sbjct  46   DIVSVTNDNLIINVFNHLDEPFLVSWSGIENMKNSYQDGVYGTTCPIPPGKNYTYALRVK  105

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            DQIGS++YFPSL  HKAAGG+G IRIY+ P +  PFP P  D  +LI DWY
Sbjct  106  DQIGSFYYFPSLGFHKAAGGFGAIRIYSRPKIPVPFPAPADDYTVLIGDWY  156


 Score = 95.5 bits (236),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H MTLVE EG++TV+  F +LD+HVGQSYSV++ A  
Sbjct  195   GKTYRLRISNVGLQNSLNFRIQNHMMTLVEVEGTHTVQTAFSSLDVHVGQSYSVLITA--  252

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G + Y+   G    P+   P
Sbjct  253   DQPAKDYYIVVSSRFTSKILTTTGVLHYSNSAGPVSGPIPDGP  295


 Score = 38.5 bits (88),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L  P GILING G + A+++ +PGK+
Sbjct  161  KDLRTQLDNGGTLPLPDGILINGRGSD-ATVNVEPGKT  197



>ref|XP_009112343.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   220 bits (561),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+IN T++ V       + GK RYA+NGVS+V  DTPLKLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKINTTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+    I  +P  +     A    SV++ +LHDF +IVF N  ++VQ+WHLDG
Sbjct  386   DHFNIPGVFSTSAIQSVPSNS----PATVATSVVKASLHDFLEIVFQNNEKAVQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  442   YDFWVVGFGSGQWTPAKRPLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAVWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  502   RQYLGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  536


 Score =   173 bits (439),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 0/153 (0%)
 Frame = +1

Query  91   SSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMS  270
             S  +FY WTV++     LGV ++VI+IN QFPGP L+  TND + +N+ N LD+PFL++
Sbjct  28   ESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  87

Query  271  WNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIR  450
            WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG+G I 
Sbjct  88   WNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFGAIN  147

Query  451  IYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +Y  P +  P+P P  D  +LI DW+  + + +
Sbjct  148  VYARPRIPIPYPLPVEDFTLLIGDWFKTNHKTL  180


 Score = 92.4 bits (228),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ ++ NFRIQGH M +VE EGS+ ++ D+D+LD+HVGQS S++V    
Sbjct  211   GKTYMFRISNVGLSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDVHVGQSLSLLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             +++   YY+ AS RF     S    +RY+    N G P S
Sbjct  269   NQSPKDYYIVASTRFVRSNLSVTALLRYS----NSGVPAS  304


 Score = 32.0 bits (71),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  178  KTLQQRLDSGGVLPFPDGMLINGQ--TQTTFTGDQGKT  213



>gb|AAM97070.1| pectinesterase, putative [Arabidopsis thaliana]
 gb|AAN15546.1| pectinesterase, putative [Arabidopsis thaliana]
Length=541

 Score =   214 bits (545),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 140/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLK+A
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKIA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +I+F N    VQ+WHLDG
Sbjct  383   DYFKIDGVYRSGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLR     
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRPEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V  P       S RDE PIP N + CG+A+
Sbjct  499   RQYLGQQLYLRVYTPS-----TSLRDEYPIPKNALLCGRAS  534


 Score =   182 bits (462),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I LSL   V++E+  RF++W +++     LGV ++ I+IN  FPGP ++  TND L +N
Sbjct  12   FIGLSLLFAVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            ++N+LDEPFL+SWNG+Q R +S+ DGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VYNSLDEPFLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKAN  172


 Score = 92.4 bits (228),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  208   GKTYRFRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G  RY+   G    P+   P
Sbjct  266   DQTPRDYYVVVSSRFTSNVLTTTGIFRYSNSAGGVSGPIPGGP  308


 Score = 29.3 bits (64),  Expect(4) = 4e-124, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L  P GILING     A+L+ + GK+
Sbjct  176  LRAQLDNGKKLPLPDGILINGRS-SGATLNVEQGKT  210



>emb|CDY18626.1| BnaA09g07690D [Brassica napus]
Length=541

 Score =   220 bits (561),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+IN T++ V       + GK RYA+NGVS+V  DTPLKLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKINTTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+    I  +P  +     A    SV++ +LHDF +IVF N  ++VQ+WHLDG
Sbjct  386   DHFNIPGVFSTSAIQSVPSNS----PATVATSVVRASLHDFLEIVFQNNEKAVQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  442   YDFWVVGFGSGQWTPAKRPLYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAVWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  502   RQYLGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  536


 Score =   173 bits (439),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 0/153 (0%)
 Frame = +1

Query  91   SSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMS  270
             S  +FY WTV++     LGV ++VI+IN QFPGP L+  TND + +N+ N LD+PFL++
Sbjct  28   ESPYKFYTWTVTYGIIYPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQPFLLT  87

Query  271  WNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIR  450
            WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG+G I 
Sbjct  88   WNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGGFGAIN  147

Query  451  IYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +Y  P +  P+P P  D  +LI DW+  + + +
Sbjct  148  VYARPRIPIPYPLPVEDFTLLIGDWFKTNHKTL  180


 Score = 92.4 bits (228),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ ++ NFRIQGH M +VE EGS+ ++ D+D+LD+HVGQS S++V    
Sbjct  211   GKTYMFRISNVGLSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDVHVGQSLSLLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             +++   YY+ AS RF     S    +RY+    N G P S
Sbjct  269   NQSPKDYYIVASTRFVRSNLSVTALLRYS----NSGVPAS  304


 Score = 32.0 bits (71),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  178  KTLQQRLDSGGVLPFPDGMLINGQ--TQTTFTGDQGKT  213



>ref|XP_010263764.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
 ref|XP_010263765.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=539

 Score =   225 bits (573),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 147/219 (67%), Gaps = 9/219 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I   RT+VL    +++ GK RYA+N VS+V P TPLKLA
Sbjct  326   RWNLTANAARPNPQGSFHYGTIPTVRTLVLANSKSQINGKLRYAVNRVSYVNPTTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L TI + P      L    G SV+ T LHDF +I+F N   S+Q+WHLDG
Sbjct  386   DYFNIPGVFNLNTIQDKPTPGPVFL----GTSVVGTALHDFVEIIFQNNETSIQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W  ++ + YNL DA  R TVQVYP SW+A+ V++DN+GMWNLRS   D
Sbjct  442   YDFWVVGYGNGQWIPVNRKRYNLYDATTRHTVQVYPKSWSAILVSLDNKGMWNLRSAIWD  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGK  1843
             +RYLGQELY++V   E      S   E  IP N ++CGK
Sbjct  502   RRYLGQELYVRVWNNER-----SLYTEYDIPPNALRCGK  535


 Score =   172 bits (437),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
             V +L  L +F+ V +E+  +++ WTV + T S LGV ++ I+IN QFPGP ++  TND 
Sbjct  12   FVGALACLRVFLLVEAEDPYKYFTWTVIYGTISPLGVPQQGILINGQFPGPRIDCVTNDN  71

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + VN+ N LD+PFL++WNGV+ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG++ YF
Sbjct  72   IVVNVINKLDQPFLITWNGVKQRKNSWQDGVLGTNCPIPPNSNYTYHFQTKDQIGTFTYF  131

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            PS  + +AAGG+G   IY  P +  P+P P  +  +L+ DWY
Sbjct  132  PSTLMQRAAGGFGGFNIYARPGISIPYPIPTDEFTLLVGDWY  173


 Score = 87.8 bits (216),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK+YM R+SNVG+ TS+NFRIQGH + LVE EGS+TV+  +++LD+HVGQS +V+V    
Sbjct  211   GKSYMFRVSNVGLSTSINFRIQGHRLKLVEVEGSHTVQDFYESLDVHVGQSVAVLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y+        PL  +P
Sbjct  269   NQPPKDYYIVASARFTKPILTTTAILHYSNSHTPASGPLPIAP  311


 Score = 32.3 bits (72),  Expect(4) = 5e-124, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+++LD    L FP G+LINGH    +S     GKS
Sbjct  178  KALQQTLDSGKSLPFPSGLLINGH--TSSSFTGDQGKS  213



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   206 bits (523),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 140/223 (63%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPN QG++ YG IN TRTI L+     + GK RYAIN VSF+  DTPLKLA
Sbjct  323   RGNLTASGPRPNLQGTYKYGMINTTRTITLQNSAPIINGKQRYAINSVSFIPSDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I G++ LG+I + P      L      SV+  +  D+ +IVF NP  ++Q+WH+DG
Sbjct  383   DYFKIQGLFSLGSISDNPTGGDGYLQT----SVMAADYRDYVEIVFQNPEDTLQSWHIDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             + FFVVGM  G WS     SYNL DAV R TVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  439   HFFFVVGMDVGQWSPASRLSYNLIDAVSRCTVQVYPKSWTALYMPLDNVGMWNVRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+ Y++V       S  S RDE  IP N + CGK   L
Sbjct  499   RQYLGQQFYLRVYS-----SANSWRDEYRIPPNALHCGKVVGL  536


 Score =   185 bits (470),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +1

Query  55   CSLIVLSLF--VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            CS+ +L +F   CVS E+  RFY W V++      G++++ I+IN QFPGP +   TND 
Sbjct  7    CSVFLLLVFFVACVSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N+LDEPFL+SWNGV  R +SWQDGV GTNCPIPPG+N+TY+ Q+K+QIGSYFYF
Sbjct  67   VIINVFNSLDEPFLISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            PSL LHKAAGGYG + + + P++  PF  P  D  IL  DWY +
Sbjct  127  PSLALHKAAGGYGGLSVASRPMIPVPFDPPSGDFTILAGDWYQK  170


 Score = 92.8 bits (229),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++T+++ +D++DIH+GQSYSV+V A +
Sbjct  208   GKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGTHTLQNIYDSIDIHLGQSYSVLVTADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    + +  + Y    G    P    P
Sbjct  268   PPQ--DYYIVVSTRFTSKVLTVVSILHYRNSEGTVSGPFPLGP  308


 Score = 33.9 bits (76),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP GI+INGHG    +     GK+
Sbjct  175  LRAILDNGNNLPFPDGIIINGHGSNPITFTVDQGKT  210



>ref|NP_173604.1| SKU5 similar 7 protein [Arabidopsis thaliana]
 gb|AAF16543.1|AC013482_17 T26F17.7 [Arabidopsis thaliana]
 gb|AEE30163.1| SKU5 similar 7 protein [Arabidopsis thaliana]
Length=538

 Score =   212 bits (540),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+ YG IN+TRTI L   +  + GK RYA+N  SF   DTPLKL 
Sbjct  323   RTNLTASGPRPNPQGSYRYGVINITRTIRLANNLGHIEGKQRYAVNSASFYPADTPLKLV  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY+ G+I + P  T   +   P  SV+Q +   F +++F N    VQ+WHLDG
Sbjct  383   DYFKIDGVYKPGSISDQP--TNGAIF--PTTSVMQADFRAFVEVIFENSEDIVQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS    + YNL DA+ R T+QVYP SWTA+Y+A+DN GMWN+RS   +
Sbjct  439   YSFYVVGMELGKWSPASRKVYNLNDAILRCTIQVYPRSWTAIYIALDNVGMWNMRSEIWE  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             ++YLGQ+ Y++V       +  S RDE  IP N + CG+A+ 
Sbjct  499   RQYLGQQFYMRVY-----TTSTSLRDEYLIPKNALLCGRASS  535


 Score =   174 bits (442),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 114/163 (70%), Gaps = 0/163 (0%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLN  228
            ++ +L+ L          RF++W V++   S LGV ++ I+IN +FPGP +   TND L 
Sbjct  11   MITTLLFLISLAFAEDPYRFFEWHVTYGNISPLGVAQQGILINGKFPGPDIISITNDNLI  70

Query  229  VNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPS  408
            +N+ N+LDEPFL+SWNG++   +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS++YFPS
Sbjct  71   INVFNHLDEPFLLSWNGIRNWKNSFQDGVYGTMCPIPPGKNYTYALQVKDQIGSFYYFPS  130

Query  409  LHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            L  HKAAGG+G IRI +  ++  PFP P  D  +L+ DWY  +
Sbjct  131  LGFHKAAGGFGGIRISSRALIPVPFPTPADDYTLLVGDWYKTN  173


 Score = 95.5 bits (236),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG YT+++ F +LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQNSLNFRIQNHTMKLVEVEGRYTIQNLFSSLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
              +    YY+  S RF+    +  G + Y+        P+   P+K 
Sbjct  267   DQPAKDYYVVVSSRFTSKILTTTGVLHYSNSVAPVSGPIPDGPIKL  312


 Score = 35.0 bits (79),  Expect(4) = 6e-124, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LD  G L  P GILING     A+L+ +PGK+
Sbjct  175  KDLKAQLDNGGKLPLPDGILINGRS-SGATLNIEPGKT  211



>gb|KHN36198.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   216 bits (550),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+ I L      + GK RYA+N VS+V PDTPLKLA
Sbjct  325   RWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPLINGKLRYAVNSVSYVNPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ +  +   P      +    G SV+QT+LHDF +++F N   ++Q+WHLDG
Sbjct  385   DYFNIPGVFSVNLLQNSPSNGPGYI----GTSVLQTSLHDFIEVIFQNNENTMQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+V+G G G W+    ++YNL DA+ R T QVYP SWT + V++DN+GMWNLRS   +
Sbjct  441   YDFWVIGHGFGQWTDASRKTYNLVDALTRHTAQVYPKSWTTILVSLDNQGMWNLRSAIWE  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V   +      S  +E  IP NV+ CGKA
Sbjct  501   RQYLGQQFYLRVWNAQK-----SLANEYDIPNNVLLCGKA  535


 Score =   181 bits (459),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 121/177 (68%), Gaps = 2/177 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPL  198
            +  T  L L+C +I L     V +E+  +++ WTV++ T   L   ++VI+IN QFPGP 
Sbjct  1    MGSTGLLHLICLVIALVSVSLVQAEDAYKYFTWTVTYGTLYPLASPQQVILINGQFPGPR  60

Query  199  LNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKD  378
            L+  TN+ + +N+ N LDEPFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KD
Sbjct  61   LDLVTNENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKD  120

Query  379  QIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            QIG+Y YFPS  LHKAAGG+G + +Y+  V+  P+P PD D  +L+ DWY  + + +
Sbjct  121  QIGTYTYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTL  177


 Score = 88.6 bits (218),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH + LVE EGS+TV++ +D+LD+HVGQS +V+V   +
Sbjct  208   GKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSHTVQNLYDSLDVHVGQSVAVLVTLNQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGN----PGTPLSK  1121
                    Y+ AS RF+    +    + Y N F       P  P+ K
Sbjct  268   PPKDC--YIVASTRFTETPLTTTAVLHYANSFSSALGPVPAPPVDK  311


 Score = 31.2 bits (69),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            K LR++LD    L FP G+LING  
Sbjct  175  KTLRQTLDSGKSLAFPDGLLINGQA  199



>gb|KEH29685.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=537

 Score =   223 bits (569),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 147/220 (67%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L+     + GK RYA+N VSF+  DTPLKLA
Sbjct  322   RRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPIIKGKQRYAVNSVSFIPADTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ LG+IP+ P      L      SV+  +   F ++VF NP  ++Q+WH+DG
Sbjct  382   DYFKIQGVFSLGSIPDNPTGGGGNLQ----TSVMAADFRGFLEVVFENPEDTLQSWHIDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G WSA    +YNL+D + RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  438   HSFFVVGMDGGQWSAASRLNYNLRDTIARSTVQVYPKSWTALYMPLDNVGMWNVRSENWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLG + Y++V  P +     S RDE PIP N ++CGKA
Sbjct  498   RQYLGHQFYLRVYSPVN-----SLRDEYPIPNNALRCGKA  532


 Score =   171 bits (434),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 105/154 (68%), Gaps = 3/154 (2%)
 Frame = +1

Query  82   VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
             C + E+  RFY+W V++     LGV+++ I+IN +FPGP +   TND L +N+ N+LDE
Sbjct  18   ACANGEDPYRFYNWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIINVFNSLDE  77

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL+SWNGV  R +SWQDGV GTNCPI PGKN TY  Q+KDQIGSYFYFPSL  HKAAGG
Sbjct  78   PFLISWNGVLQRRNSWQDGVYGTNCPISPGKN-TYILQVKDQIGSYFYFPSLAFHKAAGG  136

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YG   I    V+  PF  P  D  IL  DWY  +
Sbjct  137  YGGFTIATRSVIPVPFDPPSGDFTILAGDWYKRN  170


 Score = 93.6 bits (231),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 4/85 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH M LVE EGS+TV++ +D+LDIH+GQ+YSV+V A +
Sbjct  207   GKTYRFRISNVGITTSINFRIQGHKMKLVEVEGSHTVQNIYDSLDIHLGQTYSVLVTADQ  266

Query  999   HKNGASYYMSASPRFS--LMQASGI  1067
               +   YY+  + RF+  ++ AS I
Sbjct  267   PPH--DYYIVVTTRFTSQVLNASSI  289


 Score = 28.9 bits (63),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD    L FP G++ING G    +     GK+
Sbjct  174  LRAILDSGKNLPFPDGLVINGRGSNAYTFTVDQGKT  209



>ref|XP_006416260.1| hypothetical protein EUTSA_v10007292mg [Eutrema salsugineum]
 gb|ESQ34613.1| hypothetical protein EUTSA_v10007292mg [Eutrema salsugineum]
Length=545

 Score =   226 bits (576),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 146/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGSFHYG IN+TRTI L     ++ GK RYA+N  SF   DTPLKLA
Sbjct  327   RTNLTANGPRPNPQGSFHYGMINITRTIRLANSAGQIEGKQRYAVNSASFYPADTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVYE G+I + P     L    P  SV+Q +   F ++VF N   SVQ+WHLDG
Sbjct  387   DYFKIDGVYEPGSISDTP-IKGGLF---PATSVMQVDYRAFVEVVFENWEASVQSWHLDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G WS    ++YNL DAV R TVQVYP SWTA+Y+++DN GMWNLRS + +
Sbjct  443   YSFFVVGMELGKWSPASRKAYNLNDAVSRCTVQVYPKSWTAIYISLDNVGMWNLRSESWE  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE  IP N + CG+A 
Sbjct  503   RQYLGQQLYMRVY-----TNSTSLRDEYLIPKNALLCGRAT  538


 Score =   162 bits (410),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 118/174 (68%), Gaps = 0/174 (0%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGP  195
            +K++  T    ++  + ++   V      RF++W V++   S LGVE++ I+IN +FPGP
Sbjct  3    VKSMMNTATTLMIGLVFIMISVVAAEDPYRFFEWHVTYGNISPLGVEQQGILINGKFPGP  62

Query  196  LLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLK  375
             +   TND L +N+ N LDEPFL+SW+G++   +S+QDGV GT CPIPPGKN+TY+  +K
Sbjct  63   DIYSVTNDNLIINVFNQLDEPFLISWSGIENLRNSFQDGVYGTTCPIPPGKNYTYALHVK  122

Query  376  DQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            DQIGS++YFPSL  HKAAGG+G IRI   P++  PFP P  D  +LI DWY  +
Sbjct  123  DQIGSFYYFPSLGFHKAAGGFGGIRISTRPLIPVPFPPPADDYTVLIGDWYKTN  176


 Score = 91.3 bits (225),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG +T+++ F +LD+H+GQSYSV+V A  
Sbjct  213   GKTYRLRISNVGLQNSLNFRIQNHAMKLVEVEGRHTLQNVFSSLDVHLGQSYSVLVTA--  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRG  1097
              +    YY+  S RF+    +  G + Y+ + G
Sbjct  271   DQPAKDYYIVVSSRFTPKVLTTTGVLHYSNYSG  303


 Score = 37.7 bits (86),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 0/38 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L  P GILING       + F+PGK+
Sbjct  178  KDLRAKLDNGGKLPLPDGILINGRSSGATIITFEPGKT  215



>ref|XP_011013815.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=537

 Score =   215 bits (547),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 145/222 (65%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I V +T+VL     ++ GK RYA+NG+S+V P TPLKLA
Sbjct  324   RLNLTANAARPNPQGSFHYGTIKVVKTLVLANTAEKINGKLRYAVNGISYVDPSTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D +NI GV+ L ++   P  T  +L    G SV+ T LHDF +IVF N   ++Q+WHL G
Sbjct  384   DWYNIPGVFSLNSMKTTPVNTPAVL----GTSVVGTELHDFVEIVFQNNENTIQSWHLSG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VV  G  +W+    + YNL DAV R TVQVYP +WTA+YV++DN+GMWNLRS    
Sbjct  440   TSFYVVAYGDNVWNPSMRKRYNLLDAVSRYTVQVYPTAWTAIYVSLDNKGMWNLRSAIWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQ+LY++V   E      S   E   P N + CG A +
Sbjct  500   RRYLGQQLYVRVWNDER-----SLYTETDPPPNTLFCGLAKR  536


 Score =   180 bits (457),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            R+Y WTV++ TR++L   + VI+IN +FPGP +   TND + VN+ N L+EPFL++WNG+
Sbjct  29   RYYTWTVTYGTRTVLDRPQTVILINGRFPGPNIECVTNDNIIVNVINKLNEPFLITWNGI  88

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCPIPPG NWTY FQ KDQIG+Y YFPS  +HKA GG+G   I + 
Sbjct  89   KQRRTSWQDGVLGTNCPIPPGSNWTYKFQTKDQIGTYIYFPSTAMHKAGGGFGGFNIASR  148

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             V+  P+P P  +  +LISDWY    Q +
Sbjct  149  SVISIPYPIPVAEFTLLISDWYRAGHQAL  177


 Score = 95.1 bits (235),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH +TLVE EGS+T++  +++LD+HVGQS +V+VK   
Sbjct  209   GKTYRFRISNVGISTSINFRIQGHTLTLVEVEGSHTMQEVYNSLDVHVGQSVTVLVKF--  266

Query  999   HKNGA--SYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               N A   YY+ AS RF+    +    +RY      P  PL   P
Sbjct  267   --NSAVKDYYIVASSRFTKPILTTTALLRYAGSNTPPSLPLPIGP  309


 Score = 26.9 bits (58),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 22/38 (58%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            + L+++LDR   L  P  +LING   + AS   + GK+
Sbjct  175  QALKQNLDRGKALPVPDALLINGLS-KGASFTGEKGKT  211



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   212 bits (540),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI++     +V GK RY +N VSFV PDTP+KLA
Sbjct  330   RTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRYGVNSVSFVAPDTPMKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV++  +I + P+     L      SV+      F +IVF N    VQ+WHLDG
Sbjct  390   DYFKIQGVFKENSISDRPYGGGLYL----DTSVLTLPYRAFVEIVFQNNENIVQSWHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+D V R T+QVYP +WTA+Y+ +DN GMWNLR+    
Sbjct  446   YSFFVVGMDGGQWTTASRNQYNLRDGVSRCTIQVYPKAWTAIYIPLDNVGMWNLRTEFWA  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V          S RDE PIP N + CG+A+
Sbjct  506   RQYLGQQFYLRVY-----TDSTSLRDEYPIPKNALLCGRAS  541


 Score =   183 bits (464),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 121/175 (69%), Gaps = 10/175 (6%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVC--------VSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPG  192
            L L C+  VL  F+C        V +E+  RF+DW V++     LGV ++ I+IN QFPG
Sbjct  3    LNLACNPAVLCTFLCLTVSILSVVKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPG  62

Query  193  PLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQL  372
            P ++  TND L +N++N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+
Sbjct  63   PDIHSVTNDNLIINVYNSLDEPFLLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQV  122

Query  373  KDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            KDQIGS++YFPSL  HKAAGG+G IRI + P +  PF  P  D  ILI DWY  +
Sbjct  123  KDQIGSFYYFPSLGFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTILIGDWYMSN  177


 Score = 89.4 bits (220),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query  804   LLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVM  983
             L    GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV+
Sbjct  209   LTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTFSSLDVHVGQSYSVL  268

Query  984   VKALEHKNGASYYMSASPRFS---LMQASGI  1067
               A   + G  YY+  + RF+   ++  +GI
Sbjct  269   FTA--DQPGQDYYIVVTSRFTAPVVLNTTGI  297


 Score = 32.3 bits (72),  Expect(4) = 7e-124, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING G    SL  + GK+
Sbjct  181  LKALLDSGRRLPFPSGILINGRGRNGYSLTVEQGKT  216



>ref|XP_007153964.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris]
 gb|ESW25958.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris]
Length=545

 Score =   229 bits (584),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 148/221 (67%), Gaps = 8/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  +RTI+L      + GK RYA+NGVS+V PDTPLKLA
Sbjct  326   RWNLTASGPRPNPQGSYHYGLIQPSRTIMLANSAPYINGKQRYAVNGVSYVAPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ +G+IP  P       L     SV+  N H+F +IVF N   SVQ+WH+DG
Sbjct  386   DYFNIQGVFYVGSIPTNPSGGNNGYLQ---TSVMGANFHEFVEIVFQNWEDSVQSWHIDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVG G G W+      YNL+D + R TVQVYP SWTA+Y+A+DN GMWN+RS N +
Sbjct  443   YSFFVVGFGSGQWTQDSRVHYNLRDTIARCTVQVYPKSWTAIYMALDNVGMWNIRSENWE  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE P+P N + CG+A+
Sbjct  503   RQYLGQQFYLRVYTPSG-----SWRDEYPVPKNAVLCGRAS  538


 Score =   169 bits (428),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = +1

Query  58   SLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +L+V  LF  V  E+  R+  W V++     LGV+++ I+IN QFPGP ++  TND L +
Sbjct  13   TLLVTFLFAFVHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLII  72

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            N++N L EPFL+SWNG+Q R +SWQDGV GTNCPIPPG+N TY+ Q+KDQIGSYFYFPSL
Sbjct  73   NVYNYLREPFLISWNGLQHRRNSWQDGVAGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSL  132

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             +HKAAG +G IRI++ P++  PFP P  D  IL  DW+  D
Sbjct  133  GMHKAAGAFGGIRIWSRPLIPVPFPPPAGDFTILAGDWFKLD  174


 Score = 89.0 bits (219),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH++ LVE EGS+T+++ + +LDIH+GQSYSV+V A +
Sbjct  211   GKTYRFRISNVGLTTSINFRIQGHSLKLVEVEGSHTLQNSYSSLDIHLGQSYSVLVTADQ  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +    + Y+  R     P+   P
Sbjct  271   PVK--DYYIVVSTRFTRRILTTTSILHYSYSRIGVSGPVPPGP  311


 Score = 29.6 bits (65),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 22/45 (49%), Gaps = 0/45 (0%)
 Frame = +2

Query  608  DYMVL*LKVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            D+  L  + LR  L+    L FP G+LING G    +     GK+
Sbjct  169  DWFKLDHRRLRRVLENGHNLPFPDGLLINGRGWNGNTFTVDQGKT  213



>ref|XP_008235896.1| PREDICTED: monocopper oxidase-like protein SKU5 [Prunus mume]
Length=588

 Score =   192 bits (488),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 137/227 (60%), Gaps = 18/227 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRT-IVLEGKMARVYGKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG I VT   ++L      + GK R  +NG+S++ P TPL L
Sbjct  340   RWNVSAGAARPNPQGSFKYGEITVTDVYVILNRPPELINGKWRTTLNGISYLPPSTPLNL  399

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPG---VSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             A  FNISGVY+L    + P      L+ RP     S+I      F +I+F N   +VQ +
Sbjct  400   AQKFNISGVYKL----DFP----TKLMNRPAKVDTSLINGTFKGFMEIIFQNDDTTVQNY  451

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             HLDGY FFVVGM  G+W+     +YN  D V RST QV+P +WTA+ V +DN G+WNLR+
Sbjct  452   HLDGYAFFVVGMDIGVWTENSRSTYNKWDGVARSTTQVFPGAWTAILVPLDNSGIWNLRA  511

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              N D  YLGQE+Y+ V   E D S      EAP+P N+I CG  + L
Sbjct  512   QNLDSWYLGQEVYVSVVNTEIDQS------EAPLPDNIIYCGLLSSL  552


 Score =   191 bits (486),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEER-FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNI  237
            +++ SL V +  +   F+DWTVS+ T S LGVE++VI IN +FPGP+LN +TN  + +N+
Sbjct  11   ILLCSLGVALGGDPYVFFDWTVSYITASPLGVEQQVIGINGEFPGPILNVTTNWNVVINV  70

Query  238  HNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHL  417
             N+LDEP L++WNG+Q R +SWQDGV GTNCPIP G NWTY FQ+KDQIGS+FYFPSL+ 
Sbjct  71   KNHLDEPLLLTWNGIQHRKNSWQDGVSGTNCPIPAGWNWTYEFQVKDQIGSFFYFPSLNF  130

Query  418  HKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
             +A+GGYG I I N  V+  PF  PD D+ + I+DWYT+
Sbjct  131  QRASGGYGGITINNRAVIALPFAVPDADITLFITDWYTK  169


 Score =   108 bits (269),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQS+S +V  ++
Sbjct  219   GKTYRFRVHNVGISTSLNFRIQNHNLLLVETEGSYTVQQNYANMDIHVGQSFSFLV-TMD  277

Query  999   HKNGASYYMSASPRFS----LMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                 + YY+ ASPRF       +A+G+  + Y+  +G    PL   P
Sbjct  278   QNASSDYYIVASPRFVNSSLWARATGVAVLHYSNSQGPASGPLPDPP  324


 Score = 25.0 bits (53),  Expect(4) = 9e-124, Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (58%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ ++    L  P G+LING  P
Sbjct  172  KELRKDVESGTSLGIPDGVLINGISP  197



>ref|XP_002522339.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF40023.1| multicopper oxidase, putative [Ricinus communis]
Length=540

 Score =   220 bits (560),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 151/226 (67%), Gaps = 14/226 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I V RTI+L    A++ GK RYA+NG+S+V P TPLKLA
Sbjct  324   RLNLTANAARPNPQGSFHYGTIQVMRTIILANTAAKIGGKLRYAVNGISYVDPSTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F+I GV+ L +I + P     +L    G SVI T LHDF ++VF N   +VQ+WHLDG
Sbjct  384   DWFSIPGVFTLNSIKDAPTNATAVL----GTSVIGTALHDFVELVFQNTESTVQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRS----YNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
              +F+VVG G G+W+  ++R     YNL DAV R TVQVYP SW+AV V++DN+GMWNLRS
Sbjct  440   SSFYVVGYGSGMWTP-EVRKRRKLYNLNDAVPRHTVQVYPNSWSAVLVSLDNKGMWNLRS  498

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
                 +RYLGQ+LYI+V   E      S   E  +P N + CG A +
Sbjct  499   AIWARRYLGQQLYIRVWNNEH-----SLYTETDVPPNALFCGLAKR  539


 Score =   179 bits (454),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L+ L   +CV +E+  RF+ WTV++ T S LGV ++ I+IN QFPGP ++  TND + VN
Sbjct  13   LLALLSGICVKAEDPYRFFTWTVTYGTISPLGVPQRGILINGQFPGPAIDCVTNDNIIVN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N LD PFL++WNG++ R ++WQDGV GTNCPIPP  NWTY FQ KDQIG++ YFPS+ 
Sbjct  73   VINKLDVPFLLTWNGIKQRRTTWQDGVLGTNCPIPPNSNWTYKFQTKDQIGTFNYFPSVG  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            LH+ AGG+G   I    V+  P+P P  +  +LI DW+  D +V+
Sbjct  133  LHRVAGGFGAFNIQPRSVIAIPYPIPVEEFTLLIGDWFKTDYKVL  177


 Score = 92.8 bits (229),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G+TY  R+SNVGI TS+NFRIQGH M LVE EG++T++  +++LD+H GQS +V+V    
Sbjct  209   GQTYKFRVSNVGIATSINFRIQGHPMVLVEVEGAHTMQELYESLDVHPGQSVTVLVTL--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             H +   YY+ AS RF+    +  G +RY      P  PL   P
Sbjct  267   HGSPKDYYIVASTRFTKPILTTTGILRYAGSNTPPSKPLPIGP  309


 Score = 25.0 bits (53),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILING  697
            KVL++ LD+   L  P  +LING
Sbjct  175  KVLQQRLDQGLSLPLPDALLING  197



>ref|XP_006393890.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
 gb|ESQ31176.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
Length=542

 Score =   213 bits (541),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 142/218 (65%), Gaps = 9/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++   AARPNPQGSFHYG+I  T++ V       + GK RYA+NGVS+V  +TPLKLADH
Sbjct  329   NLTANAARPNPQGSFHYGKIITTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPLKLADH  388

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+   +I  +P  +     A    SV+Q +LHDF +IVF N  +S+Q+WHLDGY+
Sbjct  389   FKIEGVFSTNSIQSVPSNS----PATVATSVVQASLHDFLEIVFQNNEKSMQSWHLDGYD  444

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +++
Sbjct  445   FWVVGFGSGQWTPSKRPLYNLADALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWERQ  504

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             Y GQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  505   YSGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  537


 Score =   176 bits (447),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WTV++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+
Sbjct  26   VIVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQ  85

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG
Sbjct  86   PFLLTWNGIKQRKNSWQDGVMGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGG  145

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +LI DW+  + + +
Sbjct  146  FGAINVYARPGIPIPYPLPVADFTLLIGDWFKTNHKTL  183


 Score = 95.5 bits (236),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK YM RISNVG  +S NFRIQGH M +VE EGS+ +++D+D+LD+HVGQS SV+V    
Sbjct  214   GKAYMFRISNVGSSSSFNFRIQGHTMKVVEVEGSHVIQNDYDSLDVHVGQSLSVLVTL--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
             +++   YY+ AS RF   + S  G +RY+  R
Sbjct  272   NQSPKDYYIVASTRFVRSKLSVTGLLRYSNSR  303


 Score = 32.0 bits (71),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q++     GK+
Sbjct  181  KTLQQRLDSGGVLPFPDGMLINGQ--TQSTFTGDQGKA  216



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   207 bits (528),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 143/223 (64%), Gaps = 13/223 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T+TI L     +V GK RYAIN VSF+  DTPLKLA
Sbjct  324   RSNLTASGPRPNPQGSYHYGLINTTKTIRLSSSAGQVNGKQRYAINSVSFIPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHF--TYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHL  1540
             D+F I GV+ +G+I + P     Y+        +V+  +   F +IVF N    +Q++HL
Sbjct  384   DYFKIGGVFRIGSISDNPTGGGIYQ------DTAVMGADYRAFIEIVFQNDEDIIQSYHL  437

Query  1541  DGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGN  1720
             +GY F+VVGM  G W++     YNL+DAV R TVQVYP SW+A+Y+A+DN GMWNLRS +
Sbjct  438   NGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSES  497

Query  1721  ADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
               ++YLGQ+ Y++V       +  S RDE PIP N   CGKAA
Sbjct  498   WARQYLGQQFYLRVY-----TASTSLRDEYPIPKNARLCGKAA  535


 Score =   186 bits (472),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            +CSL   SLF  VS+E+  RF++W V++     LGV ++ I+IN QFPGP ++  TND L
Sbjct  11   ICSLFC-SLFAIVSAEDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNL  69

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGS++YFP
Sbjct  70   IINVFNSLDEPFLLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFP  129

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SL  HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  130  SLAFHKAAGGFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSN  173


 Score = 92.4 bits (228),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+V A  
Sbjct  209   GKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLVTA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G + Y+   G    P+   P
Sbjct  267   DQPARDYYIVVSSRFTSTVLTTTGILHYSNSAGPVSGPIPGGP  309


 Score = 30.8 bits (68),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            LR  LD+   L  P GILING G   A+ + + GK+
Sbjct  177  LRAHLDKGKKLPLPDGILINGRG-SGAAFNVEQGKT  211



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   209 bits (531),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN T TI L      + GK RYA+N VSF+  DTP+KLA
Sbjct  326   RRNLTASGPRPNPQGSYHYGLINTTHTIRLANSAPIINGKQRYAVNSVSFIPADTPVKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +IP+ P      L      SV+ +    + +IVF N   ++Q+WH+DG
Sbjct  386   DYFNIPGVFSLSSIPQNPTGGGGYLQ----TSVMASEYRGYAEIVFENSEDTLQSWHIDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             ++FFVVGM  G W+      YNL+D + RSTVQVYP SWTAVY+ +DN GMWN+RS +  
Sbjct  442   HHFFVVGMDGGEWTPASRFVYNLRDTISRSTVQVYPKSWTAVYMPLDNAGMWNVRSQDWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             +++LGQ+ Y+++  P +     S RDE PIP+N + CG+A
Sbjct  502   RQHLGQQFYLRIFSPAN-----SWRDENPIPSNTLLCGRA  536


 Score =   184 bits (468),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 116/160 (73%), Gaps = 5/160 (3%)
 Frame = +1

Query  85   CVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEP  258
            C+ +E+  RF+ W V++     LGV+++ I+IN QFPGP +   TND L +N+ NNLDEP
Sbjct  22   CIIAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEP  81

Query  259  FLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGY  438
            FL+SWNG++ R +SWQDGV GTNCPIPPGKN+TY+ Q+KDQIGSYFYFPSL  HKAAGGY
Sbjct  82   FLISWNGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGY  141

Query  439  GPIRIYNTPVVHPPFPCPDYDLDILISDWYTE---DIQVI  549
            G I+I +  V+  PF  P  D  IL  DW+ +   D++ I
Sbjct  142  GGIKIASRSVIPVPFAPPAGDYTILAGDWFNQSHNDLKAI  181


 Score = 95.1 bits (235),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TS+NFRIQGH M LVE EG++T+++ +D+LDIH+GQSYSV+V A +
Sbjct  211   GKTYRFRISNVGLATSINFRIQGHKMVLVEVEGTHTLQNTYDSLDIHLGQSYSVLVTADQ  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
                   YY+ AS RF+    +    +RY
Sbjct  271   PIQ--DYYLVASMRFTPQVLTATSVLRY  296


 Score = 28.1 bits (61),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP+G+LING G        + GK+
Sbjct  178  LKAILDSGHNLPFPNGLLINGRGTNGYVFTVEHGKT  213



>ref|XP_006393891.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
 gb|ESQ31177.1| hypothetical protein EUTSA_v10003952mg [Eutrema salsugineum]
Length=544

 Score =   213 bits (541),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 142/218 (65%), Gaps = 9/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++   AARPNPQGSFHYG+I  T++ V       + GK RYA+NGVS+V  +TPLKLADH
Sbjct  331   NLTANAARPNPQGSFHYGKIITTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPLKLADH  390

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+   +I  +P  +     A    SV+Q +LHDF +IVF N  +S+Q+WHLDGY+
Sbjct  391   FKIEGVFSTNSIQSVPSNS----PATVATSVVQASLHDFLEIVFQNNEKSMQSWHLDGYD  446

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +++
Sbjct  447   FWVVGFGSGQWTPSKRPLYNLADALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWERQ  506

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             Y GQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  507   YSGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  539


 Score =   176 bits (447),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WTV++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+
Sbjct  26   VIVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQ  85

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG
Sbjct  86   PFLLTWNGIKQRKNSWQDGVMGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGG  145

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +LI DW+  + + +
Sbjct  146  FGAINVYARPGIPIPYPLPVADFTLLIGDWFKTNHKTL  183


 Score = 95.5 bits (236),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK YM RISNVG  +S NFRIQGH M +VE EGS+ +++D+D+LD+HVGQS SV+V    
Sbjct  214   GKAYMFRISNVGSSSSFNFRIQGHTMKVVEVEGSHVIQNDYDSLDVHVGQSLSVLVTL--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
             +++   YY+ AS RF   + S  G +RY+  R
Sbjct  272   NQSPKDYYIVASTRFVRSKLSVTGLLRYSNSR  303


 Score = 32.0 bits (71),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q++     GK+
Sbjct  181  KTLQQRLDSGGVLPFPDGMLINGQ--TQSTFTGDQGKA  216



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   215 bits (548),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 147/223 (66%), Gaps = 15/223 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+ I L      + GK RYA+N VS+V PDTPLKLA
Sbjct  325   RWNLTANAARPNPQGSFHYGKITPTKVIKLANSAPSINGKLRYAVNSVSYVNPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPG---VSVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             D+FNI G++ +  +   P        + PG    SV+ T+LHDF +++F N   ++Q+WH
Sbjct  385   DYFNIPGIFSVNLLQNTPS-------SGPGYIATSVLPTSLHDFIEVIFQNNENTMQSWH  437

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             LDGY+F+V+G G G WS    ++YNL DA+ R T QVYP SWTA+ V++DN+GMWNLRS 
Sbjct  438   LDGYDFWVIGYGFGQWSDASRKTYNLVDALTRHTAQVYPKSWTAILVSLDNQGMWNLRSA  497

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
               +++YLGQ+ Y++V   +      S  +E  IP NV+ CGKA
Sbjct  498   IWERQYLGQQFYLRVWNAQR-----SLANEYDIPNNVLLCGKA  535


 Score =   181 bits (458),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            L L+C +I       V +E+  +FY WTV++   S LG  ++VI+IN QFPGP L+  TN
Sbjct  7    LHLLCFVIASVSVSLVQAEDAYKFYTWTVTYGNLSPLGSPQQVILINGQFPGPKLDLVTN  66

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D + +N+ N LDEPFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y 
Sbjct  67   DNVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGTYS  126

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            YFPS  LHKAAGG+G + +Y+  V+  P+  PD D  +LI DWY  + + +
Sbjct  127  YFPSTQLHKAAGGFGGLNVYHRSVIPIPYQNPDGDFTLLIGDWYKTNHKTL  177


 Score = 92.8 bits (229),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH + LVE EGS+T+++ +D+LD+HVGQS S++V    
Sbjct  208   GKTYMFRISNVGLSTSINFRIQGHTLKLVEVEGSHTIQNIYDSLDVHVGQSVSLLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGNPGTPLSKSPLK  1133
             ++    YY+ AS RF+    +    + Y N F    G P+  SP+ 
Sbjct  266   NQPPKDYYIVASTRFTETPLTTTAVLHYSNSFSSALG-PVPPSPVD  310


 Score = 27.7 bits (60),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K LR++LD    +  P G+LING 
Sbjct  175  KTLRQTLDSGKSIGLPDGLLINGQ  198



>ref|NP_193932.1| protein SKU5 similar 4 [Arabidopsis thaliana]
 emb|CAA18104.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB79156.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AAL91224.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAP68338.1| At4g22010 [Arabidopsis thaliana]
 gb|AEE84542.1| protein SKU5 similar 4 [Arabidopsis thaliana]
Length=541

 Score =   219 bits (558),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 142/220 (65%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLA
Sbjct  322   RRNLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRYAVNGASFVAPDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ LG+IP  P       L     SV+  N  +F ++VF N   SVQ+WH+ G
Sbjct  382   DYFKIPGVFNLGSIPTSPSGGNGGYLQS---SVMAANFREFIEVVFQNWENSVQSWHVSG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  
Sbjct  439   YSFFVVGMDGGQWTPGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  499   RQYLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   173 bits (438),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVLGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLKEPFLISWNGVQQRKNSWQDGVVGTTCPIPPGKNFTYVIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PF  PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFSPPDGDFWLLAGDWYKTNHYVL  174


 Score = 93.6 bits (231),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M LVE EGS+TV++ + +LDIH+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGVATSLNFRIQGHTMKLVEVEGSHTVQNIYTSLDIHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  265   NQAPQDYYIVISSRFTRKVLTTTSILHYSNSRKGVSGPVPNGP  307


 Score = 30.4 bits (67),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L  P G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNLPNPDGVLINGRGWGGNTFTVQPGKT  209



>gb|KFK44156.1| hypothetical protein AALP_AA1G222300 [Arabis alpina]
Length=538

 Score =   214 bits (544),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 139/224 (62%), Gaps = 17/224 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG INVTRTI L      + GK RYA+N  SF   DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGMINVTRTIQLVNSAGHIKGKQRYAMNSASFYPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPE----MPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             D+F I GVY+ G+IP+    +P F        P  SV+  +   F +IVF N    VQ+W
Sbjct  383   DYFKIDGVYKPGSIPDQQPSVPIF--------PVTSVLHADHKAFVEIVFENGEDIVQSW  434

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             H DGY+FFVVGM  G WS      YNL DAV R TVQVYP SWTA+YVA+DN GMWNLRS
Sbjct  435   HFDGYSFFVVGMEVGKWSPDSRNVYNLNDAVSRCTVQVYPRSWTAIYVALDNVGMWNLRS  494

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
                +++YLGQ+ YI+V          S RDE  IP N + CGKA
Sbjct  495   ELWERQYLGQQFYIRVY-----TKSASLRDEYLIPKNALLCGKA  533


 Score =   169 bits (429),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            +I LSL + V++E+  R ++W V++     +GV+++ I+IN+QFPGP +   TND L +N
Sbjct  12   VIGLSLLIAVAAEDPYRNFEWHVTYGDIYPMGVKQQGILINNQFPGPEIRSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N LDEPFL+SW G+Q R +S+QDGV GT CPIPPGKN+TY+ Q+KDQIGS++YFPSL 
Sbjct  72   VFNELDEPFLISWAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLG  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             HKAAGG+G IRI + P++  PFP P  D  +LI DWY  + + +
Sbjct  132  FHKAAGGFGAIRILSRPLIPVPFPPPADDFTVLIGDWYKTNHKAL  176


 Score = 94.0 bits (232),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+  SLNFRIQ H+M LVE EG++T+++   +LD+HVGQSYSV++ A  
Sbjct  208   GKTYRLRISNVGLHGSLNFRIQNHSMKLVEVEGTHTIQNVLSSLDVHVGQSYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             HK    YY+  S RF+    +  G + Y+   G    P+   P
Sbjct  266   HKPAKYYYIVVSSRFTSKVLTTTGVLHYSNSAGPVSGPIPAVP  308


 Score = 38.9 bits (89),  Expect(4) = 1e-123, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 23/38 (61%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR  LD  G L  P GILING     A+L+ QPGK+
Sbjct  174  KALRAQLDNGGKLPLPDGILINGQS-SGATLNIQPGKT  210



>gb|EYU44358.1| hypothetical protein MIMGU_mgv1a004238mg [Erythranthe guttata]
Length=538

 Score =   236 bits (602),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 153/223 (69%), Gaps = 10/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG I V RTIVLE   A + GK RYAIN VS+V PDTPLKLA
Sbjct  325   RWNLTANAARPNPQGSYHYGTIKVARTIVLENTAAVIDGKLRYAINNVSYVNPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GVY L T  + P     +L    G  V+ T LHDF +IVF N   S+Q+WHLDG
Sbjct  385   DYFNIPGVYTLNTTKDTPPVGPAVL----GTGVVGTTLHDFVEIVFQNRESSLQSWHLDG  440

Query  1547  YNFFVVGMGPGIW-SALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNA  1723
              +F+ VG G G W SAL  R YNL DA  R T+QVYP+SW+A+ V++DN+G+WNLRS N 
Sbjct  441   NDFWSVGFGSGKWNSALRRRFYNLNDATTRHTIQVYPFSWSAILVSLDNKGIWNLRSANW  500

Query  1724  DQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
              +RYLGQELY++V    D+P   SP  E  IP NV+ CGKA +
Sbjct  501   PRRYLGQELYVRVW--NDEP---SPFTEYGIPDNVLLCGKAKK  538


 Score =   167 bits (424),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            F +W V +   S L ++++ I+IN QFPGP +N  TND + VN+ N LDEP L +WNG++
Sbjct  31   FLNWVVEYGDISPLDIKQRGILINGQFPGPTINVITNDNVIVNVENKLDEPLLFTWNGIK  90

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
             R ++WQDGV GTNCPIPP  NWTY  Q+KDQIG+Y YFPS  LH+AAGG+G + I    
Sbjct  91   QRKAAWQDGVLGTNCPIPPNSNWTYRMQMKDQIGTYNYFPSTLLHRAAGGFGGLNILARS  150

Query  466  VVHPPFPCPDYDLDILISDWYTED  537
            V+  P+P P  +L +L+SDW+ +D
Sbjct  151  VISVPYPKPYEELTVLVSDWWKKD  174


 Score = 85.5 bits (210),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 6/106 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G+TY+ R+SNVG+ TS+NFRIQ H + LVE EGS+T++  +D+LDIHVGQS S +V    
Sbjct  210   GQTYLFRVSNVGLTTSINFRIQNHKLLLVEVEGSHTMQEVYDSLDIHVGQSSSFLVTL--  267

Query  999   HKNGASYYMSASPRF--SLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
             + +   Y++ AS RF   ++ AS I  + Y   +     PL  +P+
Sbjct  268   YSDPKDYFIVASSRFIKPVLTASAI--LNYQGSKNAASGPLPNAPI  311


 Score = 26.6 bits (57),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD       P GILING  P   S    PG++
Sbjct  176  KDLQKILDSGSPFPLPDGILINGK-PHSTSFPVVPGQT  212



>ref|XP_007201183.1| hypothetical protein PRUPE_ppa003275mg [Prunus persica]
 gb|EMJ02382.1| hypothetical protein PRUPE_ppa003275mg [Prunus persica]
Length=588

 Score =   192 bits (489),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 137/227 (60%), Gaps = 18/227 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRT-IVLEGKMARVYGKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG I VT   ++L      + GK R  +NG+S++ P TPLKL
Sbjct  340   RWNVSAGAARPNPQGSFKYGEITVTDVYVILNRPPELINGKWRTTLNGISYLPPSTPLKL  399

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPG---VSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             A  FNISGVY+L    + P      L+ RP     S+I      F +I+F N   +VQ +
Sbjct  400   AQQFNISGVYKL----DFP----TKLMNRPAKVDTSLINGTFKGFMEIIFQNNDTTVQNY  451

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             HLDGY FFVVGM  G+W+     +YN  D V R T QV+P +WTA+ V +DN G+WNLR+
Sbjct  452   HLDGYAFFVVGMDIGVWTENSRSTYNKWDGVARCTTQVFPGAWTAILVPLDNSGIWNLRA  511

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              N D  YLGQE+Y+ V   E D S      EAP+P N+I CG  + L
Sbjct  512   QNLDSWYLGQEVYVSVVNTEIDQS------EAPLPDNIIYCGLLSSL  552


 Score =   186 bits (472),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEER-FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNI  237
            +++ SL V +  +   F+DWTVS+ T S LGV+++VI IN +FPGP+LN +TN  + +N+
Sbjct  11   ILLCSLGVALGGDPYVFFDWTVSYITASPLGVKQQVIGINGEFPGPILNVTTNWNVVINV  70

Query  238  HNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHL  417
             N+LDEP L++WNG+Q R +SWQDGV GTNCPI  G NWTY FQ+KDQIGS+FYFPSL+ 
Sbjct  71   KNHLDEPLLLTWNGIQHRKNSWQDGVSGTNCPIQAGWNWTYEFQVKDQIGSFFYFPSLNF  130

Query  418  HKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
             +A+GGYG I I N  V+  PF  PD D+ + I+DWYT+
Sbjct  131  QRASGGYGGITINNRAVIPLPFAVPDADITLFITDWYTK  169


 Score =   110 bits (274),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQS+S +V  ++
Sbjct  219   GKTYRFRVHNVGISTSLNFRIQNHNLLLVETEGSYTVQQNYANMDIHVGQSFSFLV-TMD  277

Query  999   HKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                 + YY+ ASPRF    S  +A+G+  + Y+  +G    PL   P
Sbjct  278   QNASSDYYIVASPRFVNSSSWARATGVAILHYSNSQGPASGPLPDPP  324


 Score = 26.9 bits (58),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ ++    L  P G+LING GP
Sbjct  172  KELRKDVESGTGLGIPDGVLINGIGP  197



>ref|XP_010028303.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55016.1| hypothetical protein EUGRSUZ_I00990 [Eucalyptus grandis]
Length=538

 Score =   224 bits (572),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 146/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG I V RT++L     ++ G  RY +N VS+V PDTPLKLA
Sbjct  325   RTNLTANAARPNPQGSYHYGTIQVNRTLILANAPTKINGTLRYTVNNVSYVDPDTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I + P      L    G SV+ T LHDF +I+F N  +++Q+WHLDG
Sbjct  385   DYFNIPGVFTLNSIKDTPPSGPDAL----GTSVVGTTLHDFVEIIFQNTEKAIQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+ VG G G W+    + YN+ DAV R TVQVYP SW+A+ V++DN+GMWNLRS    
Sbjct  441   YSFYTVGYGSGQWTPDMRKRYNMADAVSRDTVQVYPLSWSAILVSLDNKGMWNLRSAIWS  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LYI+V   E      SP  E   P NV+ CGKA
Sbjct  501   KQYLGQQLYIRVWNNEK-----SPYTEYDAPQNVLLCGKA  535


 Score =   177 bits (448),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 113/168 (67%), Gaps = 1/168 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE-RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            LV SL  L  F   + +  R+++W V++ T S LGV ++ I+IN QFPGP +   TND +
Sbjct  11   LVVSLAWLGAFFANAEDPYRYFNWEVTYGTISPLGVSQQGILINGQFPGPPIEAITNDNI  70

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N LDEPFL++W GVQ R +SWQDGV GT CPIPPG NWTY FQLKDQIG++ YFP
Sbjct  71   VLNVVNKLDEPFLLTWKGVQQRKNSWQDGVLGTQCPIPPGTNWTYKFQLKDQIGTFMYFP  130

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            S+ L +A GG+G + I    V+  P+P P  +  +L+ DWY  D + +
Sbjct  131  SIGLQRADGGFGALNIAQRSVIPIPYPTPFGEFTLLVGDWYKSDHKAL  178


 Score = 84.7 bits (208),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G+TY  R+SNVGI TS+NFRIQGHN+TLVE EG +T++  +++LD+HVGQS +V+V    
Sbjct  210   GQTYKFRVSNVGIATSINFRIQGHNITLVEVEGCHTLQEVYESLDVHVGQSVTVLVTL--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               +   Y++  S RF+    +    + Y+        PL   P
Sbjct  268   QWSPKDYFVVCSSRFTKPILNATALLHYDGSNTPASLPLPIGP  310


 Score = 30.0 bits (66),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 23/38 (61%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+++LD+  +L  P GI+ING  P   +   Q G++
Sbjct  176  KALQQTLDKGNLLHLPDGIIINGR-PNGFTFTGQRGQT  212



>ref|XP_010416484.1| PREDICTED: monocopper oxidase-like protein SKS1 [Camelina sativa]
Length=485

 Score =   212 bits (540),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +1

Query  109  YDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQL  288
            Y W VS+S RSILG  K++IVIND FPGPLLN + ND++ VNI NNL+EPFLM+WNG++L
Sbjct  29   YQWVVSYSQRSILGGNKQIIVINDMFPGPLLNATANDIIIVNIFNNLNEPFLMTWNGLRL  88

Query  289  RGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPV  468
            R +SWQDGV+GTNCPI PG NWTY FQ+KDQIGSYFYFP+L L KAAGGYG IRI NTP 
Sbjct  89   RKNSWQDGVRGTNCPILPGTNWTYRFQVKDQIGSYFYFPTLLLQKAAGGYGAIRI-NTPE  147

Query  469  VHP-PFPCPDYDLDILISDWYTED  537
            + P PFP PDY+ DIL+ DW+  D
Sbjct  148  LVPVPFPKPDYEYDILVGDWFYAD  171


 Score =   165 bits (418),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+DV VGAAR NPQGS+HYGRI V RTI+L   +    G+ RY INGVSFVYP+TPLKL 
Sbjct  328   RMDVNVGAARTNPQGSYHYGRIKVARTILLHNDVMLSSGRLRYTINGVSFVYPETPLKLV  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ++        P  P      L      SV+     DF  IVF NPL  +Q++H+DG
Sbjct  388   DHFQLNDTIIPNMFPNYPTNKTPSLCT----SVVDIRYRDFVHIVFQNPLFELQSYHIDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSW  1663
             YNFFVVG G G W       YNL DAV RSTVQVYPYSW
Sbjct  444   YNFFVVGYGFGAWPESKRAGYNLVDAVSRSTVQVYPYSW  482


 Score = 97.8 bits (242),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK Y LRISNVG+KT +NFRIQ H+M LVETEG+Y  K  + +LDIH GQSYSV+V A  
Sbjct  208   GKMYRLRISNVGLKTCVNFRIQDHDMLLVETEGTYVQKRVYSSLDIHAGQSYSVLVTAKT  267

Query  999   HKNG--ASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPL  1130
                G   +YY+ A+ RF+     GI  +RY     +P  P+   PL
Sbjct  268   DPVGINRAYYILATARFTDYYLGGIALIRYPN---SPLDPVGSVPL  310


 Score = 40.4 bits (93),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +2

Query  638  RESLDRTGMLKFPHGILINGHGPEQASLDFQPGK  739
            R SLD    L  P GILING GPE+    F+PGK
Sbjct  176  RASLDTGHSLPTPDGILINGRGPEETFFVFEPGK  209



>ref|XP_010667350.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   222 bits (566),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQG++HYG+IN+TR I L+    +V GK RYA+N VSF+  DTPLKLA
Sbjct  320   RTNLSASGPRPNPQGAYHYGKINITRIIRLQNSAGQVNGKQRYAVNSVSFIPADTPLKLA  379

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ +G+IP  P  +   L      SV+  +  +F +IVF N    VQ+WHLDG
Sbjct  380   DYFKIGGVFSVGSIPSNPSSSGIYL----ATSVMGADFRNFIEIVFENTEDIVQSWHLDG  435

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             YNFFVVGM  G WS  +   YNL+DA +R T QVYP +WTAVYV +DN GMWNLRS +  
Sbjct  436   YNFFVVGMDGGTWSPANRNQYNLRDAAFRCTTQVYPKAWTAVYVPLDNVGMWNLRSESWA  495

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S + E  IP N + CG+AA
Sbjct  496   RQYLGQQFYLRVYTPSR-----SLKYEFHIPINALTCGRAA  531


 Score =   177 bits (448),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +1

Query  49   LVC-SLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
            L C S+  + LF  V +E+  R+++W +++     LGV ++ I+IN QFPGP ++  TND
Sbjct  4    LSCFSIATMFLFTIVVAEDPYRYFNWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTND  63

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             + +N+ NNL+ PFL+SW+GVQ R +S+QDGV GT CPIPPG+N+TY  Q KDQIGS++Y
Sbjct  64   NIIINVFNNLNVPFLLSWSGVQNRRNSYQDGVYGTTCPIPPGRNFTYKLQFKDQIGSFYY  123

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE---DIQVI  549
            FPSL  HKAAG +G IRI + P +  PFP P  D  +LI DWY     D+Q I
Sbjct  124  FPSLAFHKAAGAFGGIRILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLQAI  176


 Score = 92.8 bits (229),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQGH M LVE EG++T++  F +LD+HVGQ+YSV++ A +
Sbjct  205   GKTYRLRISNVGLENSLNFRIQGHKMKLVEVEGTHTLQTTFSSLDVHVGQTYSVLITADQ  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTP  1112
                  +YY+ AS RF+    +  G + Y    G+     PG P
Sbjct  265   PPR--NYYVVASSRFTSPVLTTTGILSYANSGGSVQGKIPGGP  305


 Score = 23.9 bits (50),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L  P GILING G   A+++   GK+
Sbjct  173  LQAILDDGHKLPPPDGILINGRG-SGATINVVQGKT  207



>ref|XP_010547509.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   212 bits (539),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 143/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+  V       + GK RYA+NGVS+V  DTP KLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKITPTKMFVFSNSAPLINGKQRYAVNGVSYVNSDTPPKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I+GV+   +I  +P  +     A    SV+QT+LHDF ++VF N   ++Q+WHLDG
Sbjct  386   DYFGIAGVFSTNSIQSVPSNS----PATVATSVVQTSLHDFIEVVFQNNENAMQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+ VG G G W+      YNL+DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  442   YDFWAVGFGSGQWTPAKRSLYNLEDALTRHTTQVYPNSWTAILVSLDNQGMWNMRSAVWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  502   RQYLGQQFYLKVWNPVQ-----SLANEYNPPDNLLLCGKA  536


 Score =   174 bits (440),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            ++Y WT ++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+PFL++WNG+
Sbjct  32   KYYTWTATYGIISPLGVPQQVILINGQFPGPRLDLLTNDNIVLNLINKLDQPFLLTWNGI  91

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCP+PP  N+TY FQ KDQIG+Y YFPS  +HKAAGGYG I IY  
Sbjct  92   KQRKNSWQDGVLGTNCPVPPNSNFTYKFQTKDQIGTYSYFPSTAMHKAAGGYGAINIYAR  151

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            P +  P+  P  D  +LI DW+  + + +
Sbjct  152  PRIPIPYTLPTADFTLLIGDWFKSNHKTL  180


 Score =   100 bits (250),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G TYMLRISNVG+ TS NFRIQGH M LVE EGS+ ++ D+D+LDIHVGQS SV+V    
Sbjct  211   GNTYMLRISNVGLSTSFNFRIQGHTMKLVEVEGSHVIQTDYDSLDIHVGQSLSVLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YY+ AS RF+    S  G +RY+  R      L  SP
Sbjct  269   NQSPKDYYIVASTRFTRSVFSVTGLLRYSNSRVPASGSLPASP  311


 Score = 29.3 bits (64),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L++ LD    L FP GILING 
Sbjct  178  KTLQQRLDSGSPLPFPDGILINGQ  201



>gb|KFK28370.1| hypothetical protein AALP_AA8G506600 [Arabis alpina]
Length=544

 Score =   214 bits (545),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I  T++ V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  329   RWNLTANAARPNPQGSFHYGTITPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI+GV+    I  +P  +   +      SV+Q NLH+F +IVF N  +S+Q+WHLDG
Sbjct  389   DHFNIAGVFSTSAIQSVPSNSPTTV----ATSVVQANLHEFLEIVFQNNEKSMQSWHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWT + V++DN+GMWN+RS   +
Sbjct  445   YDFWVVGFGSGQWTPAKRPLYNLVDALTRHTTQVYPNSWTTILVSLDNQGMWNMRSAIWE  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++Y GQ+ Y+KV  P    S     +E   P N++ CGKA
Sbjct  505   RQYAGQQFYLKVWNPVQSLS-----NEYNPPDNLLLCGKA  539


 Score =   172 bits (436),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = +1

Query  82   VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            V V  E   ++Y WTV++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+
Sbjct  26   VTVKGESPYKYYTWTVTYGIISPLGVPQQVILINGQFPGPTLDVVTNDNIILNLINKLDQ  85

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPI P  N+TY FQ KDQIG+Y YFPS   HKAAGG
Sbjct  86   PFLLTWNGIKQRKNSWQDGVLGTNCPIQPNTNFTYKFQTKDQIGTYNYFPSTAFHKAAGG  145

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y+ P +  P+P P  D  +LI DW+  + + +
Sbjct  146  FGAINVYSRPGIPIPYPLPVSDFTLLIGDWFKTNHKTL  183


 Score = 96.3 bits (238),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ +S N RIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  214   GKTYMLRISNVGLASSFNLRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLAVLVTL--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+ AS RF     S +G +RY+  R     P S  P
Sbjct  272   SQTPKDYYIVASTRFVRSNLSVMGLLRYSNSR----VPASGDP  310


 Score = 32.7 bits (73),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  181  KTLQQKLDSGGILPFPDGLLINGQ--TQTTFTGDQGKT  216



>ref|XP_008338225.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=541

 Score =   207 bits (527),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG++  T+TIVL      + GK RYA N VS+V PDTP+KLA
Sbjct  326   RWNLTANAARPNPQGSFHYGKVTPTKTIVLANSAPLINGKQRYAFNRVSYVNPDTPVKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I   P       LA P   V+  + HDF +IVF N   SVQ+ HLDG
Sbjct  386   DYFNIPGVFSLNSIQTTPS-DGSASLATP---VMPVSHHDFIEIVFQNNENSVQSMHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+     +YNL D + R T QVYP SWT +  ++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQVYPNSWTTILASLDNQGMWNLRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P  + +     +E  IP+N + CGKA
Sbjct  502   RQYLGQQFYLRVWNPVQNLA-----NEYTIPSNALLCGKA  536


 Score =   188 bits (477),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 115/165 (70%), Gaps = 3/165 (2%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            L LVC ++ + L   V   E   +FY WTV++ T S LGV ++VI+IN QFPGP L+  T
Sbjct  9    LHLVCGVLAVLLSSSVVKAEDPYKFYTWTVTYGTLSPLGVSQQVILINGQFPGPRLDVVT  68

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS+
Sbjct  69   NDNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKDQIGSF  128

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
             YFPS   HKAAGG+G I +Y  P +  P+P PD D  +L  DWY
Sbjct  129  TYFPSTQFHKAAGGFGGINVYARPRIPVPYPTPDGDFTLLAGDWY  173


 Score = 89.7 bits (221),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+  SLNFRI+GH + LVE EGS+T+++ +D+LDIHVGQS SV+V    
Sbjct  211   GKTYMFRISNVGLSASLNFRIEGHKLKLVECEGSHTIQNMYDSLDIHVGQSVSVLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    Y++ AS RF+ +  +    + Y     +   P+   P
Sbjct  269   NQAPKDYHIVASTRFTRLVLTATSVLHYTNSHTSVSGPVPAGP  311


 Score = 30.8 bits (68),  Expect(4) = 2e-123, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L++SLD    L FP G+LING      S D
Sbjct  178  KXLQQSLDSGKSLPFPXGVLINGQTSNTFSGD  209



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   211 bits (537),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI++     +V GK RY +N VSF+ PDTP+KLA
Sbjct  330   RTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRYGVNSVSFIAPDTPMKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV++  +I + P+     L      SV+      F +IVF N    VQ+WHLDG
Sbjct  390   DYFKIQGVFKENSISDRPYGGGLYL----DTSVLTLPYRAFVEIVFQNNEDIVQSWHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+D V R T+QVYP +WTA+Y+ +DN GMWNLR+    
Sbjct  446   YSFFVVGMDGGQWTTASRNQYNLRDGVSRCTIQVYPKAWTAIYIPLDNVGMWNLRTEFWA  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V          S RDE PIP N + CG+A+
Sbjct  506   RQYLGQQFYLRVY-----TDSTSLRDEYPIPKNALLCGRAS  541


 Score =   183 bits (464),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 120/175 (69%), Gaps = 10/175 (6%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVC--------VSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPG  192
            L L C   VL  F+C        V +E+  RF+DW V++     LGV ++ I+IN QFPG
Sbjct  3    LNLACKPAVLCTFLCLTVSILSVVKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPG  62

Query  193  PLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQL  372
            P ++  TND L +N++N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+
Sbjct  63   PDIHSVTNDNLIINVYNSLDEPFLLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQV  122

Query  373  KDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            KDQIGS++YFPSL  HKAAGG+G IRI + P +  PF  P  D  ILI DWY  +
Sbjct  123  KDQIGSFYYFPSLGFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTILIGDWYMSN  177


 Score = 88.2 bits (217),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query  804   LLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVM  983
             L    GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+
Sbjct  209   LTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVL  268

Query  984   VKALEHKNGASYYMSASPRFS---LMQASGI  1067
               A   + G  YY+  + RF+   ++  +GI
Sbjct  269   FTA--DQPGQDYYIVVTSRFTAPVVLNTTGI  297


 Score = 33.1 bits (74),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP+GILING G    SL  + GK+
Sbjct  181  LKAILDSGRKLPFPNGILINGRGRNGYSLTVEQGKT  216



>gb|ACN40384.1| unknown [Picea sitchensis]
Length=591

 Score =   194 bits (493),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 143/227 (63%), Gaps = 17/227 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMAR-VYGKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG+INVT+  VL+ K    + GK R  +NG+S+  P TPLKL
Sbjct  341   RWNVSAGAARPNPQGSFKYGQINVTQVFVLKNKPPELINGKRRCTLNGISYQAPATPLKL  400

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARP---GVSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             AD +N++GV++L   P  P       + RP     S+I      F +I+  N   +VQ++
Sbjct  401   ADRYNLTGVFKL-DFPNAP-------MNRPPKLDTSIINGTYRGFMEIILQNNDTTVQSY  452

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             H+DGY FFVVGM  G W+     +YN  D V RST QV+P +WTA+ V++DN GMWNLR+
Sbjct  453   HMDGYAFFVVGMDYGDWTENSRGTYNKWDGVARSTAQVFPNAWTAILVSLDNVGMWNLRA  512

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              N D  YLGQE Y++V  PE     I+ + E P+P+N + CG  +++
Sbjct  513   ENLDAWYLGQETYVRVVNPE-----INNKTELPLPSNALYCGALSRM  554


 Score =   187 bits (475),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            FYDW VS+   + LGV+++VI IN QFPGPL+N +TN    VN+ NNLDEP L++WNG+Q
Sbjct  28   FYDWNVSYIEAAPLGVKQQVIAINGQFPGPLVNLTTNWNAAVNVMNNLDEPLLITWNGLQ  87

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
             R +SWQDGV GTNCPIP G NWTY+FQ KDQIGS+FYFPSLH  +AAGG+G + + N  
Sbjct  88   NRRNSWQDGVSGTNCPIPVGWNWTYNFQAKDQIGSFFYFPSLHFQRAAGGFGGVIVNNRA  147

Query  466  VVHPPFPCPDYDLDILISDWYTE  534
            V+  PF  PD DL I I DWYT 
Sbjct  148  VIPVPFGTPDGDLTIFIGDWYTR  170


 Score =   102 bits (253),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 5/110 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY +R+ NVGI TSLNFRIQ HN+ LVETEGSY  + ++ NLDIHVGQSYS +V  ++
Sbjct  219   GKTYRIRVHNVGISTSLNFRIQNHNILLVETEGSYASQQNYTNLDIHVGQSYSFLV-TMD  277

Query  999   HKNGASYYMSASPRFS----LMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
                 + YYM AS RF         +G+  + Y+  +G    PL   P  +
Sbjct  278   QNASSDYYMVASARFVNTTIWSNVTGVAILHYSNSKGKAKGPLPDGPDDY  327


 Score = 31.6 bits (70),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 23/49 (47%), Gaps = 11/49 (22%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP-----------EQASLDFQPGKS  742
            K LR +LD    L  P G+L NG GP           E  + + QPGK+
Sbjct  173  KDLRAALDAGKDLGMPDGVLFNGKGPYRYNNSVPSGIEYETFNVQPGKT  221



>ref|XP_010680450.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680451.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   218 bits (556),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 147/220 (67%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I +++T VL      + GK R+A+N VSF+ PDTPLKLA
Sbjct  323   RWNLTANAARPNPQGSFHYGTIPISKTFVLANSAPLINGKQRFAVNQVSFINPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I   P        AR G SV+  + HDF ++VF N   ++Q+WHLDG
Sbjct  383   DYFNIPGVFSLNSIQSSPSGG----AARLGTSVLAASHHDFIEVVFQNDENAMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    + YNLKDA+ R T QVYP SWTA+ V++DN+GMWN+RS    
Sbjct  439   YDFWVVGFGAGKWTQASRKGYNLKDALTRHTTQVYPNSWTAILVSLDNQGMWNVRSAMWP  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S  +E   P+N++ CGKA
Sbjct  499   RQYLGQQLYLRVWN-----TAQSLANEYNPPSNLLLCGKA  533


 Score =   181 bits (459),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            L+  ++ L     V +++  RF+ WTV++   + LGV ++VI+IN QFPGP L+  TND 
Sbjct  9    LIFGIVALLSITIVKADDPYRFFTWTVTYGNIAPLGVSQQVILINGQFPGPKLDCVTNDN  68

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N L+EPFL++WNG++ R +SWQDGV GTNCPIPP KN+TY FQ KDQIGS+ YF
Sbjct  69   IVLNVINKLNEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNKNFTYIFQPKDQIGSFTYF  128

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            P++ LH+AAGG+G + +Y+ P +  P+P PD D  +LI DW+  + + +
Sbjct  129  PTIGLHRAAGGFGALNVYSRPRIPVPYPNPDGDFTLLIGDWHKPNFKTL  177


 Score = 89.4 bits (220),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVG+ TS NFRIQGH + +VE EGS+ +++ +D++D+HVGQS S++V   +
Sbjct  208   GKTYKFRVSNVGLSTSFNFRIQGHKLKVVEVEGSHVLQNLYDSIDVHVGQSLSILVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+ AS RF+ +  S  G + Y+        PL  +P
Sbjct  268   PPK--DYYIVASTRFTKIVLSATGVLHYSNSGAQVSGPLPPAP  308


 Score = 26.9 bits (58),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 0/25 (0%)
 Frame = +2

Query  626  LKVLRESLDRTGMLKFPHGILINGH  700
             K L   LD    L FP G+LING 
Sbjct  174  FKTLERVLDAGKALPFPDGLLINGQ  198



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   212 bits (539),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSF   DTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GVY  G+I   P      L      SV+Q +   F +IVF N    +Q++HLDG
Sbjct  384   DYFKIDGVYRTGSIQYQPTGGGIYL----DTSVMQVDYRTFVEIVFENTEDIIQSYHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G WS      YNL+DAV R TVQVYP SWTA+ +A+DN GMWNLRS    
Sbjct  440   YSFWVVGMDGGQWSPNSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P       S RDE P+P N + CG+A+
Sbjct  500   RQYLGQQFYLRVYTPS-----TSLRDEYPVPRNALLCGRAS  535


 Score =   184 bits (467),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
             I LSL   V++E+  RFY+W V++     LGV ++ I+IN QFPGP ++  TND + +N
Sbjct  13   FIGLSLLFAVTAEDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            + N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPG+N+TY  Q+KDQIGS++YFPSL 
Sbjct  73   VFNSLDEPFLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLA  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PFP P  D  +LI DWY  +
Sbjct  133  FHKAAGGFGGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSN  173


 Score = 91.7 bits (226),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK Y LRISNVG++ SLNFRIQ H M +VE EG++T++  F +LD+HVGQSYSV+V A +
Sbjct  209   GKVYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLVTADQ  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  G +RY+   G    P+   P
Sbjct  269   PPR--DYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGP  309


 Score = 27.7 bits (60),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 19/35 (54%), Gaps = 1/35 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGK  739
            L+  LD    L  P GILING     A+L+ + GK
Sbjct  177  LKAQLDNGKKLPLPDGILINGRS-SGATLNVEQGK  210



>ref|XP_007203632.1| hypothetical protein PRUPE_ppa003976mg [Prunus persica]
 gb|EMJ04831.1| hypothetical protein PRUPE_ppa003976mg [Prunus persica]
Length=537

 Score =   212 bits (539),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I + R +VL    A++ GK RYA+N +S+V P TPLKLA
Sbjct  325   RLNLTANAARPNPQGSFHYGTIPIVRRLVLANTAAKIGGKLRYAVNKISYVDPATPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D  NI GV+ L TI + P     +     G SV+ T LHDF +IVF N   ++Q+WHLDG
Sbjct  385   DWLNIPGVFNLDTIKDTPTPGPAVF----GASVVGTTLHDFVEIVFQNTEPTLQSWHLDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VVG G G W+    R YNL D V R TVQVYP  W+AV V++DN+GMWNLRS    
Sbjct  441   NSFYVVGYGSGNWTPDMRRRYNLVDGVSRHTVQVYPTGWSAVLVSLDNKGMWNLRSAIWS  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQ+LY++V   E      S   E  +P N + CGKA  
Sbjct  501   RRYLGQQLYVRVWNNEH-----SLFTENDMPLNALLCGKAKH  537


 Score =   181 bits (459),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            LV  L+ LS F  +++E+   +Y WTV++   S LG+ +K I+IN QFPGP +   TND 
Sbjct  10   LVGILVSLSAFCIINAEDPYLYYTWTVTYGLVSPLGIPQKGILINGQFPGPTIEAVTNDN  69

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + VN+ N LDEPFL++WNG++ R ++WQDGV GTNCPIPP  NWTY FQ KDQIG++ YF
Sbjct  70   IIVNVINKLDEPFLITWNGIKQRKTTWQDGVLGTNCPIPPNTNWTYKFQAKDQIGTFNYF  129

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS  LH+A GG+G   I +  V+  P+P P  +  +L+SDWY    +V+
Sbjct  130  PSTKLHRAVGGFGGFNIAHRSVIAVPYPIPAGEFTLLVSDWYKNSHKVL  178


 Score = 90.9 bits (224),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVGI TS+NFRIQGH MTLVE EG++T++  +++LD+H GQS +V+V    
Sbjct  210   GKTYKFRVSNVGIATSINFRIQGHTMTLVEVEGAHTLQEVYESLDVHPGQSVAVLVTL--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             H +   Y++ AS RF+    +  G++RY         PL   P
Sbjct  268   HGSLKDYFIIASSRFTKPILATTGYLRYAGSNTPASGPLPIGP  310


 Score = 31.2 bits (69),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            KVL+++LD    L  P G+LINGH
Sbjct  176  KVLQQTLDSGKTLPLPDGLLINGH  199



>ref|XP_010088984.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37211.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=537

 Score =   217 bits (552),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 144/222 (65%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I + RTIVL    A++ GK RYA+N +S+V P TPLKLA
Sbjct  324   RLNLTANAARPNPQGSFHYGTIKILRTIVLANSQAKIGGKLRYAVNRISYVDPSTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+  I GV++L TI + P     +L    G SVI T LHDF +IVF N   +VQ+WHL G
Sbjct  384   DYLKIPGVFKLNTIKDTPTPGPAIL----GTSVINTTLHDFIEIVFQNNEAAVQSWHLAG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+ VG G   W     R YNL DAV R TVQVYP SW+A+ V++DN+GMWNLRS    
Sbjct  440   NSFYAVGYGARQWKPRRRRGYNLADAVSRHTVQVYPNSWSAILVSLDNKGMWNLRSAIWG  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             ++YLGQ+LY++V   E      S   E  +P N + CGKA +
Sbjct  500   RQYLGQQLYVRVWNTEH-----SLFTETDVPPNALYCGKAKR  536


 Score =   182 bits (461),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 113/161 (70%), Gaps = 1/161 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE-RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
             + +L  LS F   + +  R+Y WTV++ T S LGV++K I+IN QFPGP +   TND +
Sbjct  10   FLGTLACLSAFYANAEDPYRYYTWTVTYGTISPLGVQQKGILINGQFPGPTIECVTNDNI  69

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             VN+ N LDEPFL++WNG++ R ++WQDGV GTNCPIPP  NWTY FQ KDQIG++FYFP
Sbjct  70   IVNVINKLDEPFLITWNGIKQRKTAWQDGVLGTNCPIPPNSNWTYKFQTKDQIGTFFYFP  129

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            S  +H+A+GG+G   + +  V+  P+P P  +  +L+ DWY
Sbjct  130  STQMHRASGGFGGFNVNHRSVIAVPYPIPAEEFTVLVGDWY  170


 Score = 85.9 bits (211),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GK+Y  RISNVGI TS+N RIQGH M LVE EGS+T++  ++++D+H GQS +V+V    
Sbjct  209   GKSYKFRISNVGIATSINVRIQGHTMVLVEVEGSHTIQEAYESIDVHPGQSLAVLVTC--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
             H +   Y++ AS RF+    +    +RY
Sbjct  267   HNHIKDYFIVASTRFTKPVLTATAILRY  294


 Score = 30.8 bits (68),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 21/38 (55%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD    L  P G+LING  P  A+   Q GKS
Sbjct  175  KELQKKLDSGSSLPLPDGLLINGL-PHHATFTGQKGKS  211



>emb|CDX82897.1| BnaC01g13470D [Brassica napus]
Length=541

 Score =   219 bits (557),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 141/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPARTIMLANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  +F +IVF N   SVQ+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTNPPGGNGGYLT---TSVMAANFREFIEIVFQNWENSVQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  ++
Sbjct  441   FFVVGMDGGQWTQGSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSENWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   174 bits (440),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVLGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +S+QDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLREPFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 89.4 bits (220),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG  T+LNFRIQGH M LVE EGS+T+++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGTATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P    P
Sbjct  265   NQAPQDYYIVVSSRFTRKVLTTTSILHYSNSRRGVSGPAPSGP  307


 Score = 33.1 bits (74),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    + FP G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNIPFPDGVLINGRGWGGNTFTVQPGKT  209



>ref|XP_002866726.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42985.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   211 bits (537),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I  T++ V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  328   RWNLTANAARPNPQGSFHYGMITPTKSFVFSNSAPLINGKQRYAVNGVSYVNSETPLKLA  387

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+    I  +P  +   +      SV+QT+LHDF +IVF N  +S+Q+WHLDG
Sbjct  388   DHFGISGVFSTNAIQSVPSNSPPTV----ATSVVQTSLHDFLEIVFQNNEKSMQSWHLDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWT + V++DN+GMWN+RS   +
Sbjct  444   YDFWVVGFGSGQWTPAKRSLYNLVDALTRHTTQVYPKSWTTILVSLDNQGMWNMRSAIWE  503

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++Y GQ+ Y+KV  P       S  +E   P N+  CGKA
Sbjct  504   RQYSGQQFYLKVWNPVQ-----SLANEYNPPDNLQFCGKA  538


 Score =   172 bits (437),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WTV++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+
Sbjct  25   VIVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQ  84

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPI P  N+TY FQ KDQIG++ YFPS   HKAAGG
Sbjct  85   PFLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFHYFPSTAFHKAAGG  144

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +L+ DW+  + + +
Sbjct  145  FGAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTL  182


 Score = 98.6 bits (244),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ +S NFRIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  213   GKTYMFRISNVGLSSSFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLAVLVTL--  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFR  1094
             +++   YY+ AS RF   + S +G +RY+  R
Sbjct  271   NQSPRDYYIVASTRFVRSKVSVMGLLRYSNSR  302


 Score = 32.7 bits (73),  Expect(4) = 3e-123, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q++     GK+
Sbjct  180  KTLQQRLDSGGVLPFPDGMLINGQ--TQSTFSGDQGKT  215



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   212 bits (540),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG +++ RTI       ++ GK RYA+N VSFV  DTPLKLA
Sbjct  322   RTNLTASGPRPNPQGSYHYGLVSLARTIRFGSSAGQINGKQRYALNSVSFVPADTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P      L      SV+Q +   F +IVF N    VQ++HLDG
Sbjct  382   DFFQISGVYKVNSISDRPTGGGMYL----DTSVLQADYRTFVEIVFENNEDIVQSYHLDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y F+VVGM  G W+      YNL+DA+ RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  438   YAFWVVGMDGGQWTVASRNGYNLRDAISRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S RDE PIP N + CG+A
Sbjct  498   RQYLGQQLYLRVF-----TTSTSLRDEFPIPKNALLCGRA  532


 Score =   182 bits (462),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 3/167 (2%)
 Frame = +1

Query  46   PLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            P    ++ LS+FV   + E   RF++W V++     LGV ++ I+IN QFPGP ++  TN
Sbjct  5    PRAAVILCLSIFVAAVTGESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTN  64

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N+ N+LDEPFL+SWNGVQ R +S+ DGV GT CPIPPG+N+TY  Q+KDQIGS++
Sbjct  65   DNLIINVFNSLDEPFLISWNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGSFY  124

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YFPSL  HKAAGG+G IRI + P++  PF  P  D  +LI DWY  +
Sbjct  125  YFPSLAFHKAAGGFGGIRILSRPLIPVPFDQPAGDYTVLIGDWYKSN  171


 Score = 92.8 bits (229),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV+V A  
Sbjct  207   GKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTFSSLDVHVGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +  G +RY+        P+   P
Sbjct  265   DQPARDYYVVVSSRFTDKINTTTGILRYSGSSTPASGPIPGGP  307


 Score = 27.3 bits (59),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+ + + GK+
Sbjct  175  LKARLDRGKKLPNPDGILINGRS-SGATFNVEQGKT  209



>gb|KHG02352.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   217 bits (552),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I  +RTI+L      + GK RYA+NGVS+V  DTPLK+A
Sbjct  323   RWNLTASGPRPNPQGSYHYGLITPSRTIMLSNSAPYINGKQRYAVNGVSYVPADTPLKIA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ LG+IP  P             SV+  N  ++ +IVF N   +VQ+WH+DG
Sbjct  383   DYFKIPGVFNLGSIPTWPPSGNNAYFQ---TSVMAANFREYVEIVFQNWEDTVQSWHIDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+     SYNL+D V R T QVYP SWTA+Y+A+DN GMWN+RS N  
Sbjct  440   YSFFVVGMNGGQWTPASRSSYNLRDTVARCTTQVYPRSWTAIYMALDNVGMWNIRSENWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P +     S RDE PIP N + C +A
Sbjct  500   RQYLGQQFYLRVYSPAN-----SWRDELPIPKNALLCDRA  534


 Score =   186 bits (471),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            ++C  I   LF+ V+ E   R+  W V++     LGV+++ I+IN QFPGP ++  TND 
Sbjct  7    ILCCFIACILFLGVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            L ++++N L+EPFL+SWNGVQ R +SWQDGV GTNCPI PGKN+TY  Q+KDQIGS++YF
Sbjct  67   LIISVYNYLNEPFLISWNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PSL  HKAAGGYG IRI++ P +  PFP P  D  +L  DWY  +  V+
Sbjct  127  PSLLFHKAAGGYGAIRIWSRPKIPVPFPSPAGDFTVLAGDWYKRNHYVL  175


 Score = 81.6 bits (200),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +3

Query  813   SAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKA  992
               G+TY  R+SNVG+ TS+NFRIQGH + L+E EGS+T+++ + + DIH+GQS S +V A
Sbjct  206   DPGRTYRFRVSNVGLTTSINFRIQGHKLKLIEVEGSHTLQNTYTSFDIHLGQSCSFLVTA  265

Query  993   LEHKNGASYYMSASPRFSLMQASGIGFVRY-NQFRGNPGTPLSKSP  1127
              +      YY+ AS RF+    +    + Y N  RG  G P+  +P
Sbjct  266   DQIPQ--DYYVVASTRFTRRVLTTTAVLHYSNSKRGVSG-PVPGAP  308


 Score = 29.6 bits (65),  Expect(4) = 4e-123, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 19/37 (51%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  LD    L FP  +LING G    +    PG++
Sbjct  174  VLRRLLDSGHNLPFPDRLLINGRGWNGYTFTVDPGRT  210



>ref|XP_009407426.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   227 bits (579),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 153/223 (69%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG+I  +R+I+L    A + GK RYAINGVSFV P TPLKLA
Sbjct  319   RWNLTASAARPNPQGSYHYGKITRSRSIMLANSAAVIGGKQRYAINGVSFVVPGTPLKLA  378

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNI+GV+   ++P +P      +L+ P   V++ NLHDF +I+F N   ++QTWHLDG
Sbjct  379   DDFNIAGVFTWDSLP-IPPAGGSPVLSTP---VVRFNLHDFVEIIFQNTENTMQTWHLDG  434

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R YNL DAV R TVQVYP  W+A+ V++DN+GMWNLRS    
Sbjct  435   YDFWVVGYGSGKWTERLRRRYNLVDAVTRHTVQVYPNGWSAILVSLDNQGMWNLRSAMWA  494

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQ+ YI+V  PE      S  +E  +PAN ++CGKA  L
Sbjct  495   RQYLGQQFYIRVWTPEK-----SYANEYDMPANALRCGKAVAL  532


 Score =   166 bits (419),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGST  213
            + LVC ++V      V+  +   RF+ WTV++     LGV+++ I+IN QFPGP L+  T
Sbjct  2    MRLVCGVLVFLAAAFVAGADDPYRFFTWTVTYGPIYPLGVQQQGILINGQFPGPRLDCVT  61

Query  214  NDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSY  393
            ND + +++ N LDEP L++WNG++ R +SWQDGV GTNCPI P  N+TY FQ KDQIG +
Sbjct  62   NDNIVIDVINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPILPSGNFTYKFQTKDQIGGF  121

Query  394  FYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             YFPS  + +AAGG+G + +Y  P +  P+  P  D  +L+ DWY    +V+
Sbjct  122  TYFPSTGMQRAAGGFGSLNVYQRPQIPVPYAKPADDFSLLVGDWYRASHKVL  173


 Score = 93.6 bits (231),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY+ RISNVG+ TS+NFRIQGH M LVE EGS+T+++ +D+LDIHVGQS SV+V   +
Sbjct  204   GKTYLFRISNVGMTTSINFRIQGHKMKLVEVEGSHTLQNIYDSLDIHVGQSLSVLVTLDQ  263

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
                   YY+ AS RF+    +    + Y    GN  +P+S
Sbjct  264   APK--DYYIVASTRFTRKVLTATAVLHY----GNSNSPVS  297


 Score = 27.7 bits (60),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            KVL+++LD    L FP  +LING 
Sbjct  171  KVLQKALDSGSSLPFPDDLLINGQ  194



>ref|XP_010263761.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=538

 Score =   215 bits (548),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 144/223 (65%), Gaps = 9/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG+I  +RTI L      V GK RYAIN VS++  DTPLKLA
Sbjct  323   RWNLTASAARPNPQGSYHYGKITTSRTIFLANSAPLVNGKQRYAINRVSYINSDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ L +I   P      L      +V+   LH+F ++VF N   ++Q+WHLDG
Sbjct  383   DYFNIPGVFSLNSIQTAPGGGPAYL----ATAVMPAFLHEFIEVVFQNNENTIQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    + YNL DA+ R T QVYPYSWT + +++DN+GMWNLRS    
Sbjct  439   YDFWVVGYGRGQWTPASRKHYNLVDALTRHTAQVYPYSWTTILISLDNQGMWNLRSAIWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++YLGQE Y++V  P+  P+     +E  IP N + CG+A  L
Sbjct  499   RQYLGQEFYLRVWSPDKTPA-----NEYDIPPNALLCGRARGL  536


 Score =   182 bits (463),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = +1

Query  64   IVLSLFVCVS-----SEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            ++L +  C+S     +E+  ++Y WTV++ T + LGV ++ I+IN QFPGP+L+  TND 
Sbjct  9    LILGVLACLSVSLVNAEDPYKYYTWTVTYGTIAPLGVPQQAILINGQFPGPILDVVTNDN  68

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YF
Sbjct  69   IILNLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTYTYF  128

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS  LHKAAGGYG + +Y  P +  PFP P  D  +L+ DWY  + + +
Sbjct  129  PSTQLHKAAGGYGGLNVYERPQIPIPFPNPAGDFTLLVGDWYKTNHKTL  177


 Score = 89.7 bits (221),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISN+G+ TS+NFRIQGH + LVE EGS+T+++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYMFRISNMGLSTSINFRIQGHTIMLVEVEGSHTIQNIYDSLDVHVGQSVAVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRY  1082
             ++    YY+ AS RF+    +    + Y
Sbjct  266   NQAPKDYYIVASTRFTRTVLTATAVLHY  293


 Score = 26.9 bits (58),  Expect(4) = 5e-123, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+  LD    L FP G+LING     AS     GK+
Sbjct  175  KTLQHYLDLGRPLPFPDGLLINGQA--HASFSGDQGKT  210



>ref|XP_002869849.1| hypothetical protein ARALYDRAFT_914433 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46108.1| hypothetical protein ARALYDRAFT_914433 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   217 bits (553),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 142/220 (65%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I   RTI+L      + GK R+A+NG SFV PDTPLKLA
Sbjct  322   RRNLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRFAVNGASFVAPDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV+ LG+IP  P       L     SV+  N  +F ++VF N   SVQ+WH+ G
Sbjct  382   DYFKIPGVFNLGSIPTSPPGGNGGYLQS---SVMAANFREFIEVVFQNWESSVQSWHVSG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  
Sbjct  439   YSFFVVGMDGGEWTPGSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSENWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  499   RQYLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   173 bits (438),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 119/175 (68%), Gaps = 1/175 (1%)
 Frame = +1

Query  25   VNGTVALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
            + G+  + +V  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++
Sbjct  1    MRGSCKISIVL-LLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHID  59

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
              TND + +++ N L EPFL+SWNGVQ R +SWQDGV GT CPIPPGKN+TY  Q+KDQI
Sbjct  60   AITNDNIIISVFNYLKEPFLISWNGVQQRKNSWQDGVVGTTCPIPPGKNFTYVIQVKDQI  119

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            GS++YFPSL  HKAAG +G IR+++ P +  PF  PD D  +L  DWY  +  V+
Sbjct  120  GSFYYFPSLAFHKAAGAFGAIRVWSRPRIPVPFSPPDGDFWLLAGDWYKTNHYVL  174


 Score = 93.6 bits (231),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M LVE EGS+TV++ + +LDIH+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGVATSLNFRIQGHTMKLVEVEGSHTVQNIYTSLDIHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P+   P
Sbjct  265   NQAPQDYYIVISSRFTRKVLTTTSILHYSNSRKGVSGPVPNGP  307


 Score = 30.0 bits (66),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    L  P G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNLPNPDGVLINGRGWGGNTFTVQPGKT  209



>ref|XP_009347125.1| PREDICTED: L-ascorbate oxidase homolog, partial [Pyrus x bretschneideri]
Length=544

 Score =   221 bits (564),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 144/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI L      + GK RYA+N VSF+ PDTPLKLA
Sbjct  326   RRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAVNSVSFIQPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F ISG++ LG+I + P      L     +SV+  +   F ++VF N   +VQ+WH+DG
Sbjct  386   DYFKISGLFSLGSIQDNPTGGGAYLQ----ISVMNADFRGFAELVFENLEDTVQSWHIDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             +NFFVVGM  G W+      YNL+D + RSTVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  442   HNFFVVGMDGGQWTPASRLRYNLRDTISRSTVQVYPNSWTAIYMPLDNVGMWNIRSENWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y +V  P +     S RDE PIP N + CG+A
Sbjct  502   RQYLGQQFYFRVYSPAN-----SWRDEYPIPRNALLCGRA  536


 Score =   175 bits (443),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 123/166 (74%), Gaps = 4/166 (2%)
 Frame = +1

Query  52   VCSLIVLSLF--VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTND  219
             C +I+++L   +C S E+  RFY+W V++     LG++++ I+IN QFPGP +   TND
Sbjct  9    ACCVILVALLTVICTSGEDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPHIESVTND  68

Query  220  VLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFY  399
             L +++ N+LDEPFL+SWNGVQ R +SWQDGV GTNCPIPPG+N+TY  Q+KDQIGSYFY
Sbjct  69   NLIISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFY  128

Query  400  FPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            FPSL LHKAAGG+G I+I + P +  PFP P  D  +L  DW++++
Sbjct  129  FPSLGLHKAAGGFGGIKIDSRPRIPVPFPPPAGDFTMLAGDWFSKN  174


 Score = 89.0 bits (219),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 7/106 (7%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG+ T +NFRIQGH M LVE EG++++++ + +LDIH+GQSYSV+V A +
Sbjct  211   GKTYRLRISNVGLTTHINFRIQGHKMLLVEVEGTHSLQNTYSSLDIHLGQSYSVLVTADQ  270

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGN-----PGTPLSK  1121
                   YY   S RF+    S    + Y+   G+     PG P ++
Sbjct  271   PP--KDYYTVVSSRFTSQVLSATSILHYSNSAGSVSGPPPGGPTTQ  314


 Score = 28.5 bits (62),  Expect(4) = 6e-123, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 18/36 (50%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +     GK+
Sbjct  178  LKAILDGGNNLPFPDGLLINGRGSNGFTFTVDQGKT  213



>ref|XP_006280268.1| hypothetical protein CARUB_v10026189mg [Capsella rubella]
 gb|EOA13166.1| hypothetical protein CARUB_v10026189mg [Capsella rubella]
Length=545

 Score =   209 bits (532),  Expect(4) = 7e-123, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 10/220 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T+T V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  331   RWNLTANAARPNPQGSFHYGKITPTKTFVFSNSAPLINGKQRYAVNGVSYVNSETPLKLA  390

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+    I  +P  +   +      SV+QT+LHDF +IVF N  +SVQ+WHLDG
Sbjct  391   DHFGISGVFT-NAIQSVPSNSPPTV----ATSVVQTSLHDFLEIVFQNNEKSVQSWHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL D + R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  446   YDFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWE  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++Y GQ+ Y++V  P       S  +E   P N+  CGKA
Sbjct  506   RQYSGQQFYMRVWNPVQ-----SLANEYNPPDNLQLCGKA  540


 Score =   174 bits (441),  Expect(4) = 7e-123, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+
Sbjct  28   VIVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQ  87

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG++ YFPS   HKAAGG
Sbjct  88   PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGG  147

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +L+ DW+  + + +
Sbjct  148  FGAINVYARPGIPIPYPVPTADFTLLVGDWFKTNHKTL  185


 Score = 98.6 bits (244),  Expect(4) = 7e-123, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+  + NFRIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  216   GKTYMLRISNVGLSNTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLAVLVTL--  273

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YYM AS RF   + S +G +RY+    N   P S  P
Sbjct  274   NQSPKDYYMVASSRFVRNKLSVMGLLRYS----NSHVPASGDP  312


 Score = 32.3 bits (72),  Expect(4) = 7e-123, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  183  KTLQQRLDSGGVLPFPDGMLINGQ--TQTTFSGDQGKT  218



>ref|XP_011039229.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=537

 Score =   215 bits (548),  Expect(4) = 8e-123, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 145/222 (65%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I V +T+VL     ++ GK RYA+NG+S+V P TPLKLA
Sbjct  324   RLNLTANAARPNPQGSFHYGTIKVVKTLVLANTAEKINGKLRYAVNGISYVDPSTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D +NI GV+ L ++   P  T  +L    G SV+ T LHDF +IVF N   ++Q+WHL G
Sbjct  384   DWYNIPGVFSLNSMKTTPVNTPAVL----GTSVVGTELHDFVEIVFQNNENTIQSWHLSG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VV  G  +W+    + YNL DAV R TVQVYP +WTA+YV++DN+GMWNLRS    
Sbjct  440   TSFYVVAYGDNVWNPSMRKRYNLLDAVSRYTVQVYPTAWTAIYVSLDNKGMWNLRSAIWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQ+LY++V   E      S   E   P N + CG A +
Sbjct  500   RRYLGQQLYVRVWNDER-----SLYTETDPPPNTLFCGLAKR  536


 Score =   176 bits (447),  Expect(4) = 8e-123, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  103  RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGV  282
            R+Y WTV++ TR++L   + VI+IN +FPGP +   TND + VN+ N L+EPFL++WNG+
Sbjct  29   RYYTWTVTYGTRTVLDRPQTVILINGRFPGPNIECVTNDNIIVNVINKLNEPFLITWNGI  88

Query  283  QLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNT  462
            + R +SWQDGV GTNCPIPPG  WTY FQ KDQIG+Y YFPS  +H+A GG+G   I + 
Sbjct  89   KQRRTSWQDGVLGTNCPIPPGSTWTYKFQTKDQIGTYSYFPSTAMHRAGGGFGGFNIASR  148

Query  463  PVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             V+  P+P P  +  +LISDWY    Q +
Sbjct  149  SVISIPYPIPVAEFTLLISDWYRAGHQAL  177


 Score = 95.1 bits (235),  Expect(4) = 8e-123, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVGI TS+NFRIQGH +TLVE EGS+T++  +++LD+HVGQS +V+VK   
Sbjct  209   GKTYRFRISNVGISTSINFRIQGHTLTLVEVEGSHTMQEVYNSLDVHVGQSVTVLVKF--  266

Query  999   HKNGA--SYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               N A   YY+ AS RF+    +    +RY      P  PL   P
Sbjct  267   --NSAVKDYYIVASSRFTKPILTTTALLRYAGSNTPPSLPLPIGP  309


 Score = 26.9 bits (58),  Expect(4) = 8e-123, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 22/38 (58%), Gaps = 1/38 (3%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            + L+++LDR   L  P  +LING   + AS   + GK+
Sbjct  175  QALKQNLDRGKALPVPDALLINGLS-KGASFTGEKGKT  211



>emb|CDX79120.1| BnaA01g11870D [Brassica napus]
Length=541

 Score =   218 bits (556),  Expect(4) = 9e-123, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 141/218 (65%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPARTIMLANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  +F +IVF N   SVQ+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTNPPGGNGGYLT---TSVMGANFREFIEIVFQNWENSVQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVGM  G W+      YNL+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  ++
Sbjct  441   FFVVGMDGGQWTQGSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSENWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   173 bits (438),  Expect(4) = 9e-123, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +S+QDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLREPFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 89.4 bits (220),  Expect(4) = 9e-123, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG  T+LNFRIQGH M LVE EGS+T+++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGTATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P    P
Sbjct  265   NQAPQDYYIVVSSRFTRKVLTTTSILHYSNSRRGVSGPAPSGP  307


 Score = 32.7 bits (73),  Expect(4) = 9e-123, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    + FP G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNVPFPDGVLINGRGWGGNTFTVQPGKT  209



>gb|KDP45242.1| hypothetical protein JCGZ_15107 [Jatropha curcas]
Length=596

 Score =   193 bits (491),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 140/226 (62%), Gaps = 16/226 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVY-GKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG I VT   V+  K A +  GK R  +NG+S++ P TPLKL
Sbjct  347   RWNVSAGAARPNPQGSFKYGDITVTDVYVILNKPAELIDGKLRSTLNGISYLPPSTPLKL  406

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPGV--SVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             A  +NISGVY+L        F  RL+   P V  S+I      F +I+F N   +VQ++H
Sbjct  407   AQQYNISGVYKL-------DFPNRLMNRPPKVDTSLINGTFKGFMEIIFQNDDTTVQSYH  459

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             +DGY FFVVGM  G+W+     +YN  D V R T QV+P +WTA+ V++DN G+WNLR+ 
Sbjct  460   MDGYAFFVVGMDFGVWTENSRGTYNKWDGVARCTTQVFPGAWTAILVSLDNAGIWNLRTQ  519

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             N +  YLGQE+Y+ V  PE D S+I      P+P N I CG  + L
Sbjct  520   NLNTWYLGQEVYVSVVNPEIDSSEI------PLPDNCIYCGLLSSL  559


 Score =   183 bits (465),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            ++DWTVS+ T   LGV+++VI IN  FPGP+LN +TN  + VN+ N LDEP L++WNG+Q
Sbjct  34   YFDWTVSYLTGYPLGVKQQVIGINGMFPGPILNVTTNWNVIVNVKNELDEPLLLTWNGLQ  93

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
             R +SWQDGV GTNCPIP G NWTY FQ+KDQIGS+FYFPSL+  +AAGGYG I I N  
Sbjct  94   HRKNSWQDGVLGTNCPIPAGWNWTYQFQVKDQIGSFFYFPSLNFQRAAGGYGGIIINNRN  153

Query  466  VVHPPFPCPDYDLDILISDWYTE  534
            V+  PF  PD D  I ISDWYT+
Sbjct  154  VIPVPFAMPDGDFTIFISDWYTK  176


 Score =   106 bits (264),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ +++N+DIHVGQSYS +V  ++
Sbjct  226   GKTYRFRVHNVGISTSLNFRIQNHNLLLVETEGSYTVQQNYENMDIHVGQSYSFLV-TMD  284

Query  999   HKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
                 + YY+ AS R+    +  +A+G+  + Y+  +G    PL   P ++
Sbjct  285   QNATSDYYIVASSRYVNSSTWTKATGVAILHYSNSQGPASGPLPDLPNEY  334


 Score = 30.0 bits (66),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ L++   L  P GILING GP
Sbjct  179  KELRKHLEKGDDLGVPDGILINGFGP  204



>ref|XP_010482094.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X1 [Camelina 
sativa]
Length=592

 Score =   192 bits (487),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 138/224 (62%), Gaps = 10/224 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMAR-VYGKPRYAINGVSFVYPDTPLKL  1363
             R++++ GAARPNPQGSF YG+I VT   V+  +    + G+ R  +NG+S++ P TPLKL
Sbjct  340   RLNLSAGAARPNPQGSFKYGQITVTDVYVIVNRPPEMIEGRLRATLNGISYIPPSTPLKL  399

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLD  1543
             A  +NISGVY+L   P+ P   +     R   SVI      F +I+F N   +V+++HLD
Sbjct  400   AQQYNISGVYKL-DFPKRPMNRH----PRVDTSVINGTFKGFVEIIFQNSDTTVKSYHLD  454

Query  1544  GYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNA  1723
             GY FFVVGM  G+W+     +YN  DAV RST QVYP +WTA+ V++DN GMWNLR  N 
Sbjct  455   GYAFFVVGMDFGLWTENSRSTYNKGDAVARSTTQVYPGAWTAILVSLDNAGMWNLRIDNL  514

Query  1724  DQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
                YLGQE+Y+ V  PE D        E  +P N I CG+ + L
Sbjct  515   ASWYLGQEVYLSVVNPEIDMDS----SENSVPGNSIYCGRLSPL  554


 Score =   185 bits (470),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            F+DWTVS+ T S LG  ++VI IN QFPGP+LN +TN  + +N+ NNLDEP L++WNG+Q
Sbjct  30   FFDWTVSYLTASPLGTRQQVIGINGQFPGPILNVTTNWNVVMNVKNNLDEPLLLTWNGIQ  89

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
             R +SWQDGV GTNCPIP G NWTY FQ+KDQIGS+FYFPS +  +A+GGYG I + N  
Sbjct  90   QRKNSWQDGVLGTNCPIPAGWNWTYEFQVKDQIGSFFYFPSTNFQRASGGYGRIIVNNRD  149

Query  466  VVHPPFPCPDYDLDILISDWYTE  534
            ++  PF  PD D+ + ISDWYT+
Sbjct  150  IIPVPFARPDGDVTLFISDWYTK  172


 Score =   110 bits (274),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ N GI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQS+S +V  ++
Sbjct  222   GKTYRFRVHNSGIATSLNFRIQNHNLLLVETEGSYTVQQNYTNMDIHVGQSFSFLV-TMD  280

Query  999   HKNGASYYMSASPRF-SLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
                   YY+ ASPRF + ++ASG+  +RY+  +G    PL   P++ 
Sbjct  281   QSGSNDYYIVASPRFVTSVKASGVAILRYSSSQGPALGPLPDPPVEL  327


 Score = 25.4 bits (54),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGP  706
            K LR+ ++    L  P GI+ING GP
Sbjct  175  KKLRKDVEGKNGLGPPDGIVINGFGP  200



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   205 bits (521),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 139/221 (63%), Gaps = 10/221 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSFV  DTPLKL 
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFVPLDTPLKLL  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F + G + +G+I + P      L      SV+  +   F +IVF N    VQ+WHL+G
Sbjct  383   DYFKVGG-FRVGSISDAPSGGGIFL----DTSVLGADYRQFIEIVFENNEDIVQSWHLNG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV R T QVYP SWTA+Y+A+DN GMWNLR+    
Sbjct  438   YSFWVVGMDGGQWTQASRNGYNLRDAVARCTTQVYPKSWTAIYIALDNVGMWNLRTEFWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N   CGK A
Sbjct  498   RQYLGQQLYMRVY-----TTSTSLRDEYPIPRNARLCGKVA  533


 Score =   184 bits (467),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            + + +V+ L V   +E+  RF++W V++ T   LGV ++ I+IN QFPGP +   TND L
Sbjct  8    IAAFLVVGLVVNTVAEDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNL  67

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+KDQIGSY+YFP
Sbjct  68   IINVFNSLDEPFLLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQMKDQIGSYYYFP  127

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SL  HKAAGG+G I+I + P +  PFP P  D  +LI DWY ++
Sbjct  128  SLAFHKAAGGFGGIKILSRPRIPVPFPDPADDYTVLIGDWYKKN  171


 Score = 89.0 bits (219),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRI+GH M LVE EG++T++  + +LD+HVGQ+YSV++ A  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIEGHKMKLVEVEGTHTLQTTYSSLDVHVGQTYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
              +    +Y+  S RF+    +  G + Y+    N  TP+S
Sbjct  266   DQEAKDHYIVVSSRFTSPVLTTTGVLHYS----NSNTPVS  301


 Score = 35.0 bits (79),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING GP   S   + GK+
Sbjct  175  LKAILDGGKKLPFPDGILINGRGPNGVSFTVEQGKT  210



>emb|CAN72538.1| hypothetical protein VITISV_028749 [Vitis vinifera]
Length=592

 Score =   225 bits (573),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  +RTI+L     R+ GK RYA+NGVS++  DTPLKLA
Sbjct  377   RWNLTASAARPNPQGSFHYGKITPSRTIMLXNSAPRLNGKQRYAVNGVSYINXDTPLKLA  436

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I ++P      L      SV+  N HDF ++VF N   ++Q+WHLDG
Sbjct  437   DYFNIPGVFSVNSIQDLPSGGSSFL----STSVMAANHHDFIEVVFQNNENTIQSWHLDG  492

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    +SYNL DA+ R T QVYP SWT ++V++DN+GMWN+RS   +
Sbjct  493   YDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQVYPRSWTTIWVSLDNQGMWNMRSAVWE  552

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       SP +E  IP N + CGKA
Sbjct  553   RQYLGQQFYLRVFNPVH-----SPANEYDIPKNALLCGKA  587


 Score =   166 bits (421),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 122/195 (63%), Gaps = 22/195 (11%)
 Frame = +1

Query  1    ERQTTMKTVNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVI  174
            +R    + +   V L L+C  ++L +F+ V+ E+  ++Y WTV++ T S LGV ++VI+I
Sbjct  33   QRLAVYRXMRKAVLLHLIC--VLLGVFL-VNGEDPYKYYTWTVTYGTISPLGVPQQVILI  89

Query  175  NDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMS-----------------WNGVQLRGSSW  303
            N QFPGP L   TND + +++ N LD+PFL++                  NG++ R +SW
Sbjct  90   NGQFPGPALEVVTNDNIILDLINKLDQPFLLTCILEKCHGLTRACLFTTRNGIKQRKNSW  149

Query  304  QDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPF  483
            QDGV GTNCPIPP  N+TY FQ KDQIG++ YFPS   HKAAGG+G I +Y  P +  PF
Sbjct  150  QDGVLGTNCPIPPNSNYTYKFQTKDQIGTFTYFPSTLFHKAAGGFGAINVYERPRIPIPF  209

Query  484  PCPDYDLDILISDWY  528
            P P  D  +L+ DWY
Sbjct  210  PDPAGDFTLLVGDWY  224


 Score = 92.0 bits (227),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+ TS+NFRIQGH M LVE EGS+T+++ +D+LD+HVGQS +V+V   +
Sbjct  262   GKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSLDVHVGQSIAVLVTLDQ  321

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
                   YY+ AS RF+    +    + Y     N  TP+S
Sbjct  322   LPK--DYYIVASTRFTKQILTATAVLHYT----NSHTPVS  355


 Score = 29.6 bits (65),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 18/32 (56%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L+++LD    L FP G+LING      S D
Sbjct  229  KTLQQTLDSGKPLPFPDGVLINGQTSSSFSGD  260



>gb|KHG25743.1| L-ascorbate oxidase [Gossypium arboreum]
Length=538

 Score =   225 bits (574),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 149/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I  T+TIVL      + GK RYA+NGVS++ PDTPLKLA
Sbjct  323   RWNLTSNAARPNPQGSFHYGTITPTKTIVLANSAPLINGKLRYAVNGVSYINPDTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+   ++ E+P      L      SV+ T+LHDF ++VF N   ++Q WHLDG
Sbjct  383   DYFNIPGVFSTNSLSELPSGRAATL----ATSVMATSLHDFIEVVFQNNENTMQAWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    +SYNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   D
Sbjct  439   YDFWVVGFGSGQWTPDKRKSYNLVDALTRHTTQVYPNSWTAILVSLDNQGMWNVRSTLWD  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP+NV+ CG+A
Sbjct  499   RQYLGQQFYLRVWNPVR-----SLANEYDIPSNVLLCGQA  533


 Score =   166 bits (421),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            LV  ++ +     V++E+   ++ WTV++ TRSILGV ++VI+IN QFPGP L+  TN+ 
Sbjct  9    LVFGVLAVLGVSLVNAEDPYLYFTWTVTYGTRSILGVPQQVILINGQFPGPKLDVVTNNN  68

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ N LD+PFLM+WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGSY YF
Sbjct  69   IILNLINKLDQPFLMTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGSYTYF  128

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            PS  +H+AAGG+G + I +  V+  P+  PD D  +L+ DW+  + + +
Sbjct  129  PSTLMHRAAGGFGALNIIHRSVIPIPYANPDGDFTLLVGDWFKANHKTL  177


 Score = 89.4 bits (220),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM R SNVG+ TSLNFRIQGH M LVE EGS+ +++ +D+LD+HVGQS +++V   +
Sbjct  208   GKTYMFRFSNVGLSTSLNFRIQGHKMKLVEVEGSHVIQNLYDSLDVHVGQSITILVTLDQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                  +YY+ AS RF+    +    + Y         P+  +P
Sbjct  268   PPK--NYYIVASTRFTKTVLTATAALHYANSNAPVSGPVPAAP  308


 Score = 31.6 bits (70),  Expect(4) = 1e-122, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++SLD    + FP G+LING    QA+     GK+
Sbjct  175  KTLQQSLDSGKSMPFPDGVLINGQ--TQATFTGDQGKT  210



>ref|XP_006402152.1| hypothetical protein EUTSA_v10013200mg [Eutrema salsugineum]
 gb|ESQ43605.1| hypothetical protein EUTSA_v10013200mg [Eutrema salsugineum]
Length=539

 Score =   232 bits (592),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 152/225 (68%), Gaps = 17/225 (8%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             + ++     RPNPQGS+HY RI ++RT++LE     V  K RYAING+SFV  DTPLKLA
Sbjct  319   KTNLTASGPRPNPQGSYHYSRIKISRTLILESSADFVNKKQRYAINGISFVPADTPLKLA  378

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGV----SVIQTNLHDFTQIVFHNPLRSVQTW  1534
             D+F I GV+ +G+IP+MP        +R G+    +V+  +   F ++VF NP  +VQ++
Sbjct  379   DYFKIKGVFNVGSIPDMP--------SRGGMRLDTAVMGAHHKAFLEVVFQNPENTVQSY  430

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             HLDGYNF+VVGM  G WS    R+YNL+DA+ RST QVYP +WTAVYVA+DN GMWNLRS
Sbjct  431   HLDGYNFWVVGMDKGTWSQASRRAYNLRDAISRSTTQVYPKTWTAVYVALDNVGMWNLRS  490

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
                 +RYLGQ+ Y++V  P       S RDE PIP N + CG+A+
Sbjct  491   EVWTRRYLGQQFYLRVYSPVK-----SQRDEYPIPKNALLCGRAS  530


 Score =   178 bits (451),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 116/163 (71%), Gaps = 7/163 (4%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLN  228
            ++ ++  +S FV     +RF+DW V++   S LG  ++VI+IN QFPGP ++  TND L 
Sbjct  11   MIMTITTIS-FVQAEDPKRFFDWRVTYGKISPLGHSQRVILINGQFPGPEIHSVTNDNLI  69

Query  229  VNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPS  408
            +N+HN+LDEPFL+SW       +S+QDGV GT CPIPPG+N+TY+  +K+QIGS+FYFPS
Sbjct  70   INVHNDLDEPFLLSWK------NSYQDGVYGTTCPIPPGRNYTYALHVKNQIGSFFYFPS  123

Query  409  LHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            L + KAAGG+G +RI++ P +  PFP P  D   LI DWY++D
Sbjct  124  LAVQKAAGGFGALRIFSRPHIPVPFPQPAGDFTFLIGDWYSQD  166


 Score = 76.3 bits (186),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 3/103 (3%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG++ SLNF I GH + LVE EG++TV+  + ++DIHVGQSYSV+V   +
Sbjct  205   GKTYRFRISNVGLQHSLNFEILGHMLKLVEVEGTHTVQSMYTSIDIHVGQSYSVLVTMDQ  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                  +Y +  S RF+  Q +    + Y+  +G+   P S+ P
Sbjct  265   PPQ--NYSIVISTRFTETQYNVGSTLHYSNSKGSTFVP-SRQP  304


 Score = 26.6 bits (57),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHG  703
            K L+  LDR   +  P  +L+NGHG
Sbjct  169  KTLKALLDRGRKIPLPDVVLLNGHG  193



>ref|XP_011085509.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011085510.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011085511.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   221 bits (563),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 145/220 (66%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  +RTIVL      + GK RYAING SF+  DTPLKLA
Sbjct  322   RWNLTSNAARPNPQGSFHYGKITTSRTIVLANSAPIINGKQRYAINGNSFINSDTPLKLA  381

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI GV+ + +I   P  +   L      SV+  +LH+F ++VF N   ++Q+WHLDG
Sbjct  382   DYFNIPGVFSINSIQTAPSDSSNKL----ATSVMGASLHEFIEVVFQNNEDTIQSWHLDG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    ++YNL DA+ R T QVYP SWTA+ V++DN+GMWNLRS    
Sbjct  438   YDFWVVGFGTGQWTQASRKAYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNLRSAMWG  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S  +E  IP N + CGKA
Sbjct  498   RQYLGQQFYLRVYNPTP-----SLANEYDIPNNALLCGKA  532


 Score =   171 bits (434),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  82   VCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPF  261
            V      ++Y WTV++ T S LG  ++VI+IN QFPGP L+  TND + +N+ N LD+PF
Sbjct  21   VKAEDAYKYYTWTVTYGTASPLGPSQQVILINGQFPGPRLDTVTNDNIILNLINKLDQPF  80

Query  262  LMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYG  441
            L++WNG++ R +SWQDG+ GTNC IPP  N+TY FQ KDQIGSY YFPS  +H+AAGG+G
Sbjct  81   LLTWNGIKQRKNSWQDGMLGTNCAIPPNSNYTYKFQTKDQIGSYTYFPSTLMHRAAGGFG  140

Query  442  PIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
             + IY   V+  P+  P  D  +LI DWY  + + +
Sbjct  141  VLNIYARSVIPVPYAKPAGDFSLLIGDWYKSNHKAL  176


 Score = 91.3 bits (225),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM R+SN+G+ TS NFRIQGH + LVE EGS+ +++ +D+LD+HVGQS +V+V    
Sbjct  207   GKTYMFRVSNLGLSTSFNFRIQGHKLKLVEVEGSHVLQNMYDSLDVHVGQSVTVLVTL--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+ AS RF+    + I  + Y   R     P+   P
Sbjct  265   DQSPKDYYIVASTRFTKTVLTAIAVLHYTNSRAAISGPVPSGP  307


 Score = 28.9 bits (63),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 17/32 (53%), Gaps = 0/32 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLD  724
            K L++ LD    L FP GILING      S D
Sbjct  174  KALQQVLDSGKPLPFPDGILINGQSRSSFSGD  205



>ref|XP_010923873.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=543

 Score =   224 bits (572),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG +N+TRTI L      + GK RYAIN VSF+  DTPLKLA
Sbjct  325   RWNLTASGPRPNPQGSYHYGSVNITRTIRLANSAPIINGKQRYAINSVSFIPADTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNISGV+ LG+IP+ P F    L      SV+  +   F +IVF N   +VQ+WH+DG
Sbjct  385   DFFNISGVFSLGSIPDNPTFKDGYLQ----TSVMAADFRGFAEIVFENYEDTVQSWHIDG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F++VGM  G W+    +SYNL DAV R T+QVYP  WTA+Y+ +DN GMWN+RS +  
Sbjct  441   YSFWIVGMDEGTWTEDSRKSYNLVDAVNRCTLQVYPKGWTAIYMPLDNVGMWNVRSEDWA  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V  P +     S RDE  IP N ++CG+AA
Sbjct  501   RQYLGQQFYLRVYSPAN-----SLRDEYAIPKNALRCGRAA  536


 Score =   168 bits (426),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = +1

Query  34   TVALPLVCSLIVL-SLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            T+ +  VC L VL SL V      RF+ W +++     LGV+++ I+IN QFPGP +   
Sbjct  5    TLLVSFVCLLSVLPSLPVRGEDPYRFFTWNIAYGDIWPLGVKQQGILINGQFPGPQIEAV  64

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TND + +N+ NNL EPFL+SWNGV  R + WQDGV GTNCPIPPG+N+TY+ Q+KDQIGS
Sbjct  65   TNDNIIINVFNNLPEPFLLSWNGVLQRKNCWQDGVYGTNCPIPPGQNFTYALQVKDQIGS  124

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YFYFPSL  HKAAGG+G  RI + P++  PFP P  D  +LI DWY  +
Sbjct  125  YFYFPSLAFHKAAGGFGGFRILSRPLIPVPFPPPAADYTLLIGDWYKTN  173


 Score = 91.7 bits (226),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLN R QGH M LVE EGS+T+++ + +LD+H+GQSYSV+VKA +
Sbjct  210   GKTYRFRISNVGLATSLNIRFQGHTMQLVEVEGSHTLQNTYSSLDVHLGQSYSVLVKADQ  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +    + YN     P  P    P
Sbjct  270   LP--GDYYIVVSTRFTRTVLTTTSILHYNNSFKKPVDPPPAGP  310


 Score = 28.1 bits (61),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 19/36 (53%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP G+LING G    +   + GK+
Sbjct  177  LKGVLDGGKNLPFPDGVLINGRGWNGNNFTVEQGKT  212



>ref|XP_006847483.1| hypothetical protein AMTR_s00163p00059030 [Amborella trichopoda]
 gb|ERN09064.1| hypothetical protein AMTR_s00163p00059030 [Amborella trichopoda]
Length=592

 Score =   190 bits (482),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 141/227 (62%), Gaps = 17/227 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMAR-VYGKPRYAINGVSFVYPDTPLKL  1363
             + +V+ GAARPNPQGSF YG+I VT   VL  +    + GKPR A+NG+S++ P TPL+L
Sbjct  344   KWNVSAGAARPNPQGSFKYGQIPVTDVYVLLNRAPEMINGKPRTALNGLSYIAPTTPLRL  403

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARP---GVSVIQTNLHDFTQIVFHNPLRSVQTW  1534
             A  FN+ GV++L    + P+     ++ RP     S+I      F +I+F N   SVQ++
Sbjct  404   AQQFNVPGVFKL----DFPN----QMMDRPPKLDTSIINATYRGFFEIIFQNNDTSVQSY  455

Query  1535  HLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRS  1714
             HLDGY FFVVGM  G W+     +YN  D V R T QV+P +WTA+ V++DN+GMWNLR+
Sbjct  456   HLDGYAFFVVGMDYGEWTENSRGTYNKWDGVARCTTQVFPGAWTAILVSLDNDGMWNLRT  515

Query  1715  GNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              N D  YLGQE Y+ +  PE     I+ + E P+P N + CG  + +
Sbjct  516   QNLDSWYLGQETYMSIVNPE-----INGKTEMPLPDNALYCGVLSSM  557


 Score =   187 bits (476),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            F++W VS+ T S LGV+++VI IN  FPGP +N +TN  L +N+ NNLDEP L++WNG+Q
Sbjct  29   FFNWEVSYLTASPLGVKQQVIGINGNFPGPTVNATTNWNLVINVQNNLDEPLLLTWNGIQ  88

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTP  465
            +R +SWQDGV GTNCPIP G NWTY FQ+KDQIGS+FYFPS+H  +AAGGYG I + N  
Sbjct  89   VRRNSWQDGVLGTNCPIPSGWNWTYQFQVKDQIGSFFYFPSIHFQRAAGGYGGIIVNNRE  148

Query  466  VVHPPFPCPDYDLDILISDWYTE  534
            V+  PF  PD D+ + ISDWYT 
Sbjct  149  VIPVPFGTPDGDITLFISDWYTR  171


 Score =   104 bits (259),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY +R+ NVG++TSLNFRIQ HN+ LVETEGSYT++ ++ N+DIHVGQSYS +V  ++
Sbjct  221   GKTYRIRVHNVGMRTSLNFRIQNHNLLLVETEGSYTIQQNYTNMDIHVGQSYSFLV-TMD  279

Query  999   HKNGASYYMSASPRFSLMQAS-----GIGFVRYNQFRGNPGTPLSKSP  1127
                 + YY+ ASPR     AS     G+  + Y+  +G    PL   P
Sbjct  280   QNASSDYYIVASPRLFNPAASWTGLIGVAILHYSNSQGPASGPLPDPP  327


 Score = 30.4 bits (67),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 12/50 (24%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQ------------ASLDFQPGKS  742
            K LR++L+    L  P GIL NG GP +            A +D +PGK+
Sbjct  174  KDLRKALEDGNDLGIPDGILFNGLGPYRYNETIVPAGISYAKIDVEPGKT  223



>ref|XP_010444713.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=545

 Score =   207 bits (527),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 143/223 (64%), Gaps = 10/223 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T++ V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  331   RWNLTANAARPNPQGSFHYGKITPTKSFVFANSAPLINGKQRYAVNGVSYVNSETPLKLA  390

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+    I  +P  +   +      SV+QT+LHDF +IVF N  +S+Q+WHLDG
Sbjct  391   DHFGISGVFT-NAIQNVPSNSPPTV----ATSVVQTSLHDFLEIVFQNNEKSMQSWHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL D + R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  446   YDFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPNSWTAILVSLDNQGMWNMRSAIWE  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             ++Y GQ+ Y++V  P       S  +E   P N+  CGKA  L
Sbjct  506   RQYSGQQFYLRVWNPVQ-----SLANEYNPPDNLQLCGKAVGL  543


 Score =   173 bits (439),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WT ++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+
Sbjct  28   VIVKGESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQ  87

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG++ YFPS   HKAAGG
Sbjct  88   PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGG  147

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +L+ DW+  + + +
Sbjct  148  FGAINVYARPGIPIPYPVPTADFTLLVGDWFKTNHKTL  185


 Score = 99.4 bits (246),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ ++ NFRIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  216   GKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLAVLVTL--  273

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YYM AS RF   + S +G +RY+    N   P S  P
Sbjct  274   NQSPKDYYMVASSRFVRSKLSVMGLLRYS----NSHVPASGDP  312


 Score = 32.0 bits (71),  Expect(4) = 2e-122, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  183  KTLQQRLDSGGVLPFPDGMLINGQ--TQTTFSGDQGKT  218



>ref|XP_004253203.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=543

 Score =   205 bits (521),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 144/224 (64%), Gaps = 11/224 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFV-YPDTPLKL  1363
             R ++     RPNPQG++HYG I+ TRTI L     +V G+ RYA+N VSFV   DTPLKL
Sbjct  323   RTNLTANGPRPNPQGAYHYGMIDTTRTIRLATSAGQVNGEQRYAVNSVSFVPTDDTPLKL  382

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLD  1543
             AD+F I G Y  G I ++P    R+ L     SV+QT+   F +IVF N  R VQ+WH+ 
Sbjct  383   ADYFKIGGFYP-GNIHDVP-IGGRIHL---NTSVLQTDYRTFIEIVFENKERIVQSWHIA  437

Query  1544  GYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNA  1723
             GY F+VVGM  G W+      YNL+DAVYRST QVYP SWTA+Y+A+DN G+WN+RS   
Sbjct  438   GYAFWVVGMDGGHWTPASRNQYNLRDAVYRSTTQVYPRSWTAIYIALDNVGIWNIRSEFW  497

Query  1724  DQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              +RYLGQ+LY++V       +  S +DE  IP N I CGK ++ 
Sbjct  498   ARRYLGQQLYMRVY-----TTSTSLQDEYLIPTNAILCGKVSEF  536


 Score =   178 bits (451),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  49   LVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDV  222
            LV  L+   L   + +E   RFY+W V++ T S LGV ++ I+IN QFPGP +   TND 
Sbjct  7    LVVFLVSFLLVNSIVAENPYRFYEWNVTYGTISPLGVPQQGILINGQFPGPDIISVTNDN  66

Query  223  LNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYF  402
            + +N+ NNLD+ FL+SW+GVQ R +S+QDGV GT CPIPPGKN+TY  Q+KDQIGS++YF
Sbjct  67   VIINVINNLDDDFLLSWHGVQNRRNSYQDGVWGTTCPIPPGKNFTYRLQMKDQIGSFYYF  126

Query  403  PSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            P+   HKAAGG+G IRI++ P VH P P    D  +LI DWY  +
Sbjct  127  PTTAFHKAAGGFGSIRIFSGPFVHVPLPPYAGDFTVLIGDWYKRN  171


 Score = 92.8 bits (229),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             G+TY LRISNVG++ SLNFRI+GHN+TLVE EG++T++  + +LD+HVGQSYSV++ A +
Sbjct  208   GQTYRLRISNVGLENSLNFRIEGHNLTLVEVEGTHTMQETYTSLDVHVGQSYSVLITADQ  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
                   YY+  S RF+    +  G + Y+        P+   P
Sbjct  268   APK--DYYIVVSSRFTSKVLTTTGVLHYSTSNSTVSGPIPSGP  308


 Score = 35.8 bits (81),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L FP GILING GP  A+     G++
Sbjct  175  LKAILDRGHKLPFPDGILINGRGPNGATYTVDQGQT  210



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   204 bits (520),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 139/221 (63%), Gaps = 10/221 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSFV  DTPLKL 
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFVPLDTPLKLL  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F + G + +G+I + P      L      SV+  +   F +IVF N    VQ+WHL+G
Sbjct  383   DYFKVGG-FRVGSISDAPSGGGIFL----DTSVLGADYRQFIEIVFENTEDIVQSWHLNG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV R T QVYP SWTA+Y+A+DN GMWNLR+    
Sbjct  438   YSFWVVGMDGGQWTQASRNGYNLRDAVARYTTQVYPKSWTAIYIALDNVGMWNLRTEFWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N   CGK A
Sbjct  498   RQYLGQQLYMRVY-----TTSTSLRDEYPIPRNARLCGKVA  533


 Score =   182 bits (462),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            V + +V+ L     +E+  RF++W V++ T   LGV ++ I+IN QFPGP +   TND L
Sbjct  8    VAAFLVVGLIANTLAEDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNL  67

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPG+N+TY  Q+KDQIGSY+YFP
Sbjct  68   IINVFNSLDEPFLLSWNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFP  127

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SL  HKAAGG+G I+I + P +  PFP P  D  +LI DWY ++
Sbjct  128  SLAFHKAAGGFGGIKILSRPRIPVPFPDPADDYTLLIGDWYKKN  171


 Score = 89.7 bits (221),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRI+GH M LVE EG++T++  + +LD+HVGQ+YSV++ A  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIEGHRMKLVEVEGTHTLQTTYSSLDVHVGQTYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
              +    +Y+  S RF+    +  G + Y+    N  TP+S
Sbjct  266   DQEAKDHYIVVSSRFTSQVLTTTGVLHYS----NSNTPVS  301


 Score = 35.0 bits (79),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING GP   S   + GK+
Sbjct  175  LKAILDGGKKLPFPDGILINGRGPNGVSFTVEQGKT  210



>ref|XP_002984579.1| hypothetical protein SELMODRAFT_445960 [Selaginella moellendorffii]
 gb|EFJ14224.1| hypothetical protein SELMODRAFT_445960 [Selaginella moellendorffii]
Length=588

 Score =   211 bits (538),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 146/226 (65%), Gaps = 13/226 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++  GAARPNPQGSFHYG+INVT+T VL      + GK R+A+NG SF  P TPL LA
Sbjct  336   RRNLTTGAARPNPQGSFHYGQINVTQTFVLTSTAVSIAGKRRFAVNGFSFEVPSTPLLLA  395

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGV--SVIQTNLHDFTQIVFHNP-LRSVQTWH  1537
             D +NI+G+Y+L + PE      ++    PG+  SV+      F +I+F NP   SVQ+WH
Sbjct  396   DEYNITGLYKLNSFPE------KVGSVVPGLQTSVVNATYAGFLEIIFQNPDNNSVQSWH  449

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             +DGY  FVVG GPG W+  D   YN  DAV RSTVQV+P SWTA+ +++DN G+WN+RS 
Sbjct  450   VDGYAAFVVGYGPGQWTENDRGQYNKWDAVSRSTVQVFPGSWTAIQISLDNVGLWNIRSE  509

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             +  + YLGQE+Y+ V  P D+    +     P P NV+ CG+ A L
Sbjct  510   DLVRHYLGQEIYMFVNDPSDNIKNTA----FPKPDNVLYCGRLANL  551


 Score =   170 bits (430),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            F+DW VS+ TR+ LGV+++VIVIN  FPGP+LN +TN +  VN+ NNLDEPFL++W+G+Q
Sbjct  28   FFDWVVSYETRAPLGVKQQVIVINGMFPGPVLNTTTNRINIVNVQNNLDEPFLLTWDGIQ  87

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRI--YN  459
             R ++W DGV  TNCPIP G+N+TY+   KDQIGS+FY+P+    +AAGG G +R+    
Sbjct  88   NRRNAWMDGVAATNCPIPAGQNFTYNITAKDQIGSFFYWPTTMFQRAAGGVGSVRVNPRA  147

Query  460  TPVVHPPFPCPDYDLDILISDWYTE  534
               V  PF  PD D+ ++I DWYT 
Sbjct  148  ASGVRVPFAPPDGDIVVMIGDWYTR  172


 Score = 94.7 bits (234),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +3

Query  828   YMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALEHKN  1007
             Y  R++NVG+ T+LNFRIQGH + LVETEGSYTV+  +D++DI VGQSYS ++      N
Sbjct  218   YRFRVTNVGVSTTLNFRIQGHQLNLVETEGSYTVQQPYDSIDIFVGQSYSFLLNCT--AN  275

Query  1008  GASYYMSASPRF-----SLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              + YY+ ASPRF          +G+G + Y   +     PL + P
Sbjct  276   ASDYYIVASPRFVGNETEWANITGVGVLHYLDSKALVNGPLPEGP  320


 Score = 35.8 bits (81),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQ  730
            K LR SLDR  +L  P G+LING G    + D++
Sbjct  175  KELRASLDRGVLLGMPDGVLINGKGAYNRTTDYE  208



>ref|XP_010070498.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW59310.1| hypothetical protein EUGRSUZ_H01991 [Eucalyptus grandis]
Length=538

 Score =   216 bits (549),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 145/222 (65%), Gaps = 13/222 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  +RTIVL      + GK RYA+NG SF+  DTPLKLA
Sbjct  323   RWNLTANAARPNPQGSFHYGKITPSRTIVLANSAPLINGKQRYAVNGASFINADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGV--SVIQTNLHDFTQIVFHNPLRSVQTWHL  1540
             D+FNI GV+   ++   P          P +  SVI  +LHDF +IVF N   +VQ+WHL
Sbjct  383   DYFNIPGVFRTDSLQTSPSG------GSPSIATSVIPASLHDFIEIVFQNNENTVQSWHL  436

Query  1541  DGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGN  1720
             DGY+F+VVG G G W+     SYNL D + R T QVYP SWT++Y+++DN+GMWN+RS  
Sbjct  437   DGYDFWVVGYGNGQWTPASRSSYNLVDTLTRHTAQVYPNSWTSIYMSLDNQGMWNVRSAI  496

Query  1721  ADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
              +++YLGQ+ Y++V  P       S  +E  IP+N + CG+A
Sbjct  497   WERQYLGQQFYLRVWNPVQ-----SLANEYNIPSNALLCGQA  533


 Score =   175 bits (443),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  52   VCSLIVL--SLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            +C+++ L  +         RFY WTV++ T S LGV ++VI+IN QFPGP L+  TND L
Sbjct  10   ICAVLALLGASLAMADDPYRFYTWTVTYGTISPLGVPQQVILINGQFPGPRLDVVTNDNL  69

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N LDEPFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGSY YFP
Sbjct  70   VLNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYIFQPKDQIGSYTYFP  129

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            S  LHKAAGGYG + +Y    +  P+P PD D  +LI DW+
Sbjct  130  STALHKAAGGYGALNVYQRAPIPIPYPPPDGDFTLLIGDWF  170


 Score = 89.7 bits (221),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQ H + L+E EGS+TV++ +D+LD+HVGQS +V+V    
Sbjct  208   GKTYKFRISNVGLSTSLNFRIQSHTLKLIEVEGSHTVQNIYDSLDVHVGQSVTVLVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RF+    +    + Y+    +   PL   P
Sbjct  266   NQPPKDYYVVASTRFTKTVLTATAILHYSNSHSSVSGPLPAGP  308


 Score = 31.6 bits (70),  Expect(4) = 3e-122, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K LR++LD    L FP G++ING    QA+     GK+
Sbjct  175  KTLRQTLDSGKSLPFPDGVIINGQ--PQATFAGDQGKT  210



>ref|XP_004293304.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   221 bits (564),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 143/220 (65%), Gaps = 8/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NGVS++ P+TPLKLA
Sbjct  325   RWNLTASGPRPNPQGSYHYGMIKPARTIMLANSAPWINGKQRYAVNGVSYIPPNTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ LG+I   P       L     SV+  N  +F +IVF N   SVQ+WH+DG
Sbjct  385   DHFNIPGVFNLGSISTNPPGGNGGYLQ---TSVMHANFREFVEIVFQNWEDSVQSWHIDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFV+GM  G W+      YNL+D V RSTVQVYP SWTA+ VA+DN GMWN+RS N  
Sbjct  442   YSFFVLGMDGGQWTQASRARYNLRDTVARSTVQVYPKSWTAISVALDNVGMWNVRSQNWA  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y++V  P       S RDE PIP N I CG+A
Sbjct  502   RQYLGQQFYLRVYSPAH-----SWRDELPIPRNAILCGRA  536


 Score =   164 bits (415),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 114/167 (68%), Gaps = 2/167 (1%)
 Frame = +1

Query  55   CSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLN  228
            C  +VL L    + E+  +   W +++     LGV+++ I+IN+QFPGP ++  TN  L 
Sbjct  10   CIALVLVLVHGANGEDPYKLLTWKITYGDIYPLGVKQQGILINNQFPGPQIDAVTNMNLV  69

Query  229  VNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPS  408
            +++ N L EPFL+SW+G+Q R +SWQDG+ GTNCPI PG+N+TY+ Q+KDQIGS+FYFPS
Sbjct  70   ISVFNYLSEPFLLSWDGIQQRRNSWQDGMPGTNCPILPGRNFTYNIQVKDQIGSFFYFPS  129

Query  409  LHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
               HKAAGG+G IRI++ P +  PFP P  D  +L  DW+  +  ++
Sbjct  130  FLFHKAAGGFGGIRIWSRPKIPVPFPNPAGDHTVLAGDWFKTNHYIL  176


 Score = 95.9 bits (237),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG+ TSLNFRIQGH M LVE EGS+T+++ +D LDIH+GQSYSV+V A  
Sbjct  210   GKTYRFRISNVGLTTSLNFRIQGHKMKLVEVEGSHTLQNTYDALDIHLGQSYSVLVTA--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              +    YY+  S RF+    +    + Y   R     P+   P
Sbjct  268   DQPAKDYYVVVSSRFTTKILTTTAILHYTNSRQGVSGPIPWGP  310


 Score = 30.0 bits (66),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 0/35 (0%)
 Frame = +2

Query  638  RESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            R  L+R   L  P G+LING G    + + +PGK+
Sbjct  178  RYFLERGQNLPLPDGLLINGRGWNGYTFNVEPGKT  212



>emb|CDY01453.1| BnaA07g12260D [Brassica napus]
Length=545

 Score =   214 bits (546),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 142/220 (65%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I  T++ V       + GK RYA+NGVS+V  DTPLKLA
Sbjct  330   RWNLTANAARPNPQGSFHYGTITPTKSFVFSNSAPLINGKQRYAVNGVSYVNSDTPLKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+    I  +P  +   +      SV+Q +LHDF ++VF N   S+Q+WHLDG
Sbjct  390   DHFNIPGVFSTNAIQRVPSSSPVTV----ATSVVQASLHDFLEVVFQNNEESMQSWHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  446   YDFWVVGFGSGQWTPEQRPLYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNMRSAIWE  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  506   RQYLGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  540


 Score =   176 bits (447),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = +1

Query  82   VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            V V  E   +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+
Sbjct  27   VSVKGESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQ  86

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG
Sbjct  87   PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGG  146

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I IY  P +  P+P P  D  +LI DW+  + + +
Sbjct  147  FGAINIYARPRIPIPYPLPVADFTLLIGDWFKTNHKTL  184


 Score = 90.5 bits (223),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG  ++ NFRIQGH M +VE EGS+ +++ +++LD+HVGQS SV+V    
Sbjct  215   GKTYMLRISNVGSSSTFNFRIQGHTMQVVEVEGSHVLQNVYESLDVHVGQSLSVLVTL--  272

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             ++    YY+ A+ R++  + S  G +RY+    N G P S
Sbjct  273   NQPSKDYYIVATSRYTTSKLSVTGLLRYS----NSGVPAS  308


 Score = 29.6 bits (65),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L+E LD  G+L  P G+LING    Q +     GK+
Sbjct  182  KTLQERLDSGGVLPSPDGMLINGQ--TQTTFTGDQGKT  217



>ref|XP_009619786.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   230 bits (586),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 149/221 (67%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  +RTIVL      + GK RYA+N VS+V  DTPLKLA
Sbjct  323   RWNLTSNAARPNPQGSFHYGKITPSRTIVLANSAPLISGKQRYAVNSVSYVNADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+ L +I  +P+     L      SV+  +LH+F +IVF N   ++Q+WHLDG
Sbjct  383   DHFNIPGVFSLNSIQTVPNAASPSL----ATSVLPASLHEFLEIVFQNNEDTMQSWHLDG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+V+G G G WS    + YNL DA+ R T QVYP SWTA+YV++DN+GMWNLRS   D
Sbjct  439   YDFWVIGFGSGTWSQDSRKEYNLVDALTRHTTQVYPKSWTAIYVSLDNQGMWNLRSSMWD  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ++Y++V  P       S  +E  IP N + CGKAA
Sbjct  499   RQYLGQQVYLRVYNPTP-----SLANEYDIPTNALLCGKAA  534


 Score =   169 bits (428),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            V L L+C ++V      V++E+  +++ WT ++   S LGV ++VI+IN QFPGP L+  
Sbjct  5    VLLHLLCGILVFWSVSVVNAEDDYKYFTWTATYGMASPLGVPQQVILINGQFPGPRLDLV  64

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TN+ + +N+ N LDEP L++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIGS
Sbjct  65   TNNNVILNLINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGS  124

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            Y YFPS  LH+A GG+G + +Y   V+  P+  PD D  +LI DWY
Sbjct  125  YTYFPSTQLHRAVGGFGALNVYARSVIPVPYANPDGDFSLLIGDWY  170


 Score = 84.7 bits (208),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYM RISNVG+K ++NFRIQGH M LVE EGS+ +++ +D+ D+HVGQS S++V    
Sbjct  208   GKTYMFRISNVGLKNTINFRIQGHKMKLVEVEGSHVIQNLYDSFDVHVGQSLSILVTL--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+ AS RF+    +    + Y   +     PL   P
Sbjct  266   DQSPKDYYIVASTRFTTTVLTTTAVLHYTNSQTPTSGPLPAGP  308


 Score = 27.3 bits (59),  Expect(4) = 4e-122, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD    L FP  +LING   +Q++ +   GK+
Sbjct  175  KALQQILDSGKSLPFPDSLLINGQ--KQSTFNGDQGKT  210



>ref|XP_002978641.1| hypothetical protein SELMODRAFT_418427 [Selaginella moellendorffii]
 gb|EFJ20088.1| hypothetical protein SELMODRAFT_418427 [Selaginella moellendorffii]
Length=588

 Score =   211 bits (537),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 145/226 (64%), Gaps = 13/226 (6%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++  GAARPNPQGSFHYG+INVT+T VL      + GK R+A+NG SF  P TPL LA
Sbjct  336   RRNLTTGAARPNPQGSFHYGQINVTQTFVLTSTAVSIAGKRRFAVNGFSFEVPSTPLLLA  395

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGV--SVIQTNLHDFTQIVFHNP-LRSVQTWH  1537
             D +NI+G+Y+L + PE      +     PG+  SV+      F +IVF NP   SVQ+WH
Sbjct  396   DEYNITGLYKLNSFPE------KAGSVVPGLQTSVVNATYAGFLEIVFQNPDNNSVQSWH  449

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             +DGY  FVVG GPG W+  D   YN  DAV RSTVQV+P SWTA+ +++DN G+WN+RS 
Sbjct  450   VDGYAAFVVGYGPGQWTENDRGQYNKWDAVSRSTVQVFPGSWTAIQISLDNVGLWNIRSE  509

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             +  + YLGQE+Y+ V  P D+    +     P P NV+ CG+ A L
Sbjct  510   DLVRHYLGQEIYMFVNDPSDNIKNTA----FPKPDNVLYCGRLANL  551


 Score =   170 bits (430),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = +1

Query  106  FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQ  285
            F+DW VS+ TR+ LGV+++VIVIN  FPGP+LN +TN +  VN+ NNLDEPFL++W+G+Q
Sbjct  28   FFDWVVSYETRAPLGVKQQVIVINGMFPGPVLNTTTNRINIVNVQNNLDEPFLLTWDGIQ  87

Query  286  LRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGGYGPIRI--YN  459
             R ++W DGV  TNCPIP G+N+TY+   KDQIGS+FY+P+    +AAGG G +R+    
Sbjct  88   NRRNAWMDGVAATNCPIPAGQNFTYNITAKDQIGSFFYWPTTMFQRAAGGVGSVRVNPRA  147

Query  460  TPVVHPPFPCPDYDLDILISDWYTE  534
               V  PF  PD D+ ++I DWYT 
Sbjct  148  ASGVRVPFAPPDGDIVVMIGDWYTR  172


 Score = 94.4 bits (233),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +3

Query  828   YMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALEHKN  1007
             Y  R++NVG+ T+LNFRIQGH + LVETEGSYTV+  +D++DI VGQSYS ++      N
Sbjct  218   YRFRVTNVGVSTTLNFRIQGHQLNLVETEGSYTVQQPYDSIDIFVGQSYSFLLNCT--AN  275

Query  1008  GASYYMSASPRF-----SLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              + YY+ ASPRF          +G+G + Y   +     PL + P
Sbjct  276   ASDYYIVASPRFVGNETEWANITGVGVLHYLDSKALVNGPLPEGP  320


 Score = 35.8 bits (81),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQ  730
            K LR SLDR  +L  P G+LING G    + D++
Sbjct  175  KELRASLDRGVLLGMPDGVLINGKGAYNRTTDYE  208



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   204 bits (519),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 139/221 (63%), Gaps = 10/221 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R +++    RPNPQGS+HYG IN TRTI L     +V GK RYA+N VSFV  DTPLKL 
Sbjct  323   RTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFVPLDTPLKLL  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F + G + +G+I + P      L      SV+  +   F +IVF N    VQ+WHL+G
Sbjct  383   DYFKVGG-FRVGSISDAPSGGGIFL----DTSVLGADYRQFIEIVFENTEDIVQSWHLNG  437

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV R T QVYP SWTA+Y+A+DN GMWNLR+    
Sbjct  438   YSFWVVGMDGGHWTQASRNGYNLRDAVARYTTQVYPKSWTAIYIALDNVGMWNLRTEFWA  497

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+LY++V       +  S RDE PIP N   CGK A
Sbjct  498   RQYLGQQLYMRVY-----TTSTSLRDEYPIPRNARLCGKVA  533


 Score =   182 bits (461),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 118/164 (72%), Gaps = 2/164 (1%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVL  225
            V + +V+ L     +E+  RF++W V++ T   LGV ++ I+IN QFPGP +   TND L
Sbjct  8    VAAFLVVGLIANTLAEDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNL  67

Query  226  NVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFP  405
             +N+ N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPG+N+TY  Q+KDQIGSY+YFP
Sbjct  68   IINVFNSLDEPFLLSWNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFP  127

Query  406  SLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            SL  HKAAGG+G I+I + P +  PFP P  D  +LI DWY ++
Sbjct  128  SLAFHKAAGGFGGIKILSRPRIPVPFPDPADDYTLLIGDWYKKN  171


 Score = 89.7 bits (221),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRI+GH M LVE EG++T++  + +LD+HVGQ+YSV++ A  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIEGHRMKLVEVEGTHTLQTTYSSLDVHVGQTYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
              +    +Y+  S RF+    +  G + Y+    N  TP+S
Sbjct  266   DQEAKDHYIVVSSRFTSQVLTTTGVLHYS----NSNTPVS  301


 Score = 35.0 bits (79),  Expect(4) = 5e-122, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LD    L FP GILING GP   S   + GK+
Sbjct  175  LKAILDGGKKLPFPDGILINGRGPNGVSFTVEQGKT  210



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   203 bits (517),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 140/228 (61%), Gaps = 7/228 (3%)
 Frame = +2

Query  1175  FNLDRVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTP  1354
             F   R ++   AARPNPQGS+HYG IN+TRTI L     +V GK RYAINGVS V P+TP
Sbjct  324   FRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETP  383

Query  1355  LKLADHFNISG-VYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQT  1531
             LKLA++F I+  V++  TI +       +       +V+ T   +F +I+F N  +S+Q+
Sbjct  384   LKLAEYFEITDKVFKYDTISD-EGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSLQS  442

Query  1532  WHLDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLR  1711
             WHLDGY+FF V + PG WS     +YNL DAV R T+QV+P SW A+ +  DN GMWNLR
Sbjct  443   WHLDGYSFFAVAIEPGRWSPEKRSNYNLLDAVSRHTIQVFPKSWAAILLTFDNAGMWNLR  502

Query  1712  SGNADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             S   + RYLGQ+LY+ V+ P       S RDE  IP   + CG    L
Sbjct  503   SELTENRYLGQQLYMSVQSPAR-----SLRDEYNIPDKTLLCGLVKDL  545


 Score =   178 bits (452),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 120/170 (71%), Gaps = 3/170 (2%)
 Frame = +1

Query  31   GTVALPLVCSLIVLSLFVCVSSEER--FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLN  204
            G +   L+C L    +   V  E+   F+ W V++ T S LGV ++ I+IN QFPGP +N
Sbjct  3    GMMFTMLLC-LSAAGMMATVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNVN  61

Query  205  GSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQI  384
             +TN+ L +N+ NNLDEPFL+ W+G+Q R +SWQDG+ GTNCPIPPG N+TY FQ+KDQI
Sbjct  62   STTNNNLVINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQI  121

Query  385  GSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            GS+FY+PS  +H+AAGG+G IR+ +  ++  P+  P+ D  +LI DWYT+
Sbjct  122  GSFFYYPSTAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTK  171


 Score =   103 bits (257),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+ NVG+KTSLNFR QGH M LVE EGS+TV++D+ +LD+HVGQ +SV+V A +
Sbjct  214   GKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVTADQ  273

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
                   YYM AS RF      G G VRY   +G     +  +P+ +
Sbjct  274   EPK--DYYMVASTRFIKSALVGKGIVRYTNGKGPASPEIPNAPMGW  317


 Score = 25.4 bits (54),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (49%), Gaps = 5/45 (11%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLD-----FQPGKS*NY  751
             L++ LD    +  P G+LING   +   +D      +PGK+  Y
Sbjct  175  TLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKY  219



>ref|XP_004509178.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=543

 Score =   224 bits (572),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 147/223 (66%), Gaps = 7/223 (3%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I V R + L    + V GK RYA+NG+S + P TPLKLA
Sbjct  324   RLNLTANAARPNPQGSFHYGTIPVLRILQLANSKSIVKGKLRYAVNGISHINPSTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D FNI GV++L TI + P  +   +  + G SVI   LHDF +I+F N   ++Q+WH+DG
Sbjct  384   DWFNIPGVFDLNTIKDFPSSSNNPI--KLGTSVIGLTLHDFAEIIFQNNENTIQSWHMDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              +F+VVG G GIW++    +YNL D V R TVQVYP SW+A+ V++DN+GMWNLRS   +
Sbjct  442   SSFYVVGYGNGIWTSKVRETYNLVDGVSRHTVQVYPKSWSAIMVSLDNKGMWNLRSAIWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
              RYLGQELY++V   E      S   E  +P N + CGKA  L
Sbjct  502   NRYLGQELYLRVWNNEQ-----SLYTETNVPLNALFCGKAKHL  539


 Score =   171 bits (433),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 7/173 (4%)
 Frame = +1

Query  52   VCSLIVLSLFVC-----VSSEER--FYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            + + I L +  C     V +E+R  F+ W ++  T   LGV ++ I+IN QFPGP ++  
Sbjct  5    ILTPIFLGILACWSALSVIAEDRYLFFTWEITNGTIFPLGVPQEGILINGQFPGPTIDAI  64

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TND + +N+ N LD+ FL++WNG++ R +SWQDGV GTNC IPP  NWTY FQLKDQIG+
Sbjct  65   TNDNIVINVINKLDDKFLITWNGIKQRKTSWQDGVLGTNCAIPPNTNWTYKFQLKDQIGT  124

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            Y YFP+  +HKAAGG+G   I    V+  P+P PD +  +L+ DWY  + +V+
Sbjct  125  YTYFPTTKIHKAAGGFGGFNIQQRSVISIPYPAPDGEFTLLVGDWYKTNHRVL  177


 Score = 89.4 bits (220),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +3

Query  801   VLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSV  980
             V    AGKTY  R+SNVGI TS+NFRIQGH++ L+E EG++T++  + +LD+HVGQS +V
Sbjct  203   VFTGEAGKTYKFRVSNVGIATSINFRIQGHSLKLIEVEGAHTLQETYKSLDVHVGQSVTV  262

Query  981   MVKALEHKNGASYYMSASPRFSLMQASGIGFVRY  1082
             +V     K+   YY+ AS RF+    +    +RY
Sbjct  263   LVTL--DKSIGDYYIVASSRFTDPVLTTTSTLRY  294


 Score = 26.2 bits (56),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            +VLR  LD    L FP  +LING 
Sbjct  175  RVLRRLLDLGKSLPFPDALLINGQ  198



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   209 bits (533),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY IN VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P      L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  383   DFFKISGVYKINSISDKPTGGGLYL----DTSVLQVDYRTFIEIVFENKENIVQSYHLNG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S RDE PIP N   CG+A
Sbjct  499   RQYLGQQLYLRVF-----TTSTSLRDEYPIPKNSRLCGRA  533


 Score =   179 bits (454),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L+  S F  V++E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   LLCFSFFALVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+LDEPFL+SWNGVQ R +S+ DG+ GT CPIPP  N+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  132  FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSN  172


 Score = 93.2 bits (230),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  208   GKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSLDVHVGQSYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+ AS RF+    +  G +RY+    +   P+   P
Sbjct  266   DQSPRDYYVVASSRFTDKIITTTGILRYSGSSTSASGPIPGGP  308


 Score = 28.5 bits (62),  Expect(4) = 6e-122, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  176  LKARLDRGRKLPSPDGILINGRS-NGATLNVEQGKT  210



>ref|XP_011080540.1| PREDICTED: monocopper oxidase-like protein SKU5 [Sesamum indicum]
Length=595

 Score =   194 bits (492),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 138/226 (61%), Gaps = 16/226 (7%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVY-GKPRYAINGVSFVYPDTPLKL  1363
             R +V+ GAARPNPQGSF YG I VT   V+  + A +  GK R  +NG+S++ P TP+KL
Sbjct  345   RWNVSAGAARPNPQGSFKYGDITVTDVYVIINRPAELIDGKRRTTLNGISYIVPSTPVKL  404

Query  1364  ADHFNISGVYELGTIPEMPHFTYRLLL--ARPGVSVIQTNLHDFTQIVFHNPLRSVQTWH  1537
             A  FN+SGV++L        F  R +   A+   S+I      F +I+F N   SVQ++H
Sbjct  405   AQQFNVSGVFKL-------DFPNRFMNRPAKVDTSLINGTFKGFMEIIFQNNDTSVQSYH  457

Query  1538  LDGYNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSG  1717
             LDGY FFVVGM  G+W+     +YN  D V R T QV+P +WTA+ V++DN GMWNLR+ 
Sbjct  458   LDGYAFFVVGMDYGVWTENSRSTYNKWDGVARCTTQVFPGAWTAILVSLDNAGMWNLRTQ  517

Query  1718  NADQRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQL  1855
             N D  YLGQE+Y+ V  PE+D       +E  +P N I CG  + L
Sbjct  518   NLDSWYLGQEVYVSVVNPEND------NNEVQLPENAIYCGVLSNL  557


 Score =   177 bits (448),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 117/166 (70%), Gaps = 6/166 (4%)
 Frame = +1

Query  55   CSLIVLSLFVCV------SSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            C+     L +C+           FYDWTVS+ T S LGV+++VI I  QFPGP+LN +TN
Sbjct  9    CNFFCFGLLLCLIRVGLAGDPFVFYDWTVSYITASPLGVKQQVIGIEGQFPGPILNVTTN  68

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
              + VN+ NNLDEPFL++WNG+Q R +SWQDGV GTNCPIP G NWTY FQ+KDQIGS+F
Sbjct  69   WNVVVNVKNNLDEPFLLTWNGIQQRKNSWQDGVSGTNCPIPAGWNWTYQFQVKDQIGSFF  128

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTE  534
            YFPSL L +AAGGYG I + N  V+  PF  PD D+ + ISDWY +
Sbjct  129  YFPSLGLQRAAGGYGGIIVNNREVIPVPFGKPDGDITLFISDWYIK  174


 Score =   112 bits (281),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = +3

Query  789   LLCLVLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQ  968
             +L  ++    GKTY LR+ NVGI TSLNFRIQ HN+ LVETEGSYTV+ ++ N+DIHVGQ
Sbjct  214   ILYQIINVEPGKTYRLRVHNVGISTSLNFRIQNHNLVLVETEGSYTVQQNYSNMDIHVGQ  273

Query  969   SYSVMVKALEHKNGASYYMSASPRF----SLMQASGIGFVRYNQFRGNPGTPLSKSPLKF  1136
             SYS +V  ++    + YY+ ASPRF    +  +A G+  + Y+  +G    PL   P ++
Sbjct  274   SYSFLV-TMDQNASSDYYIVASPRFVNASAWTKAPGVAILHYSNSQGPASGPLPDPPNEY  332


 Score = 26.9 bits (58),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 19/40 (48%), Gaps = 0/40 (0%)
 Frame = +2

Query  608  DYMVL*LKVLRESLDRTGMLKFPHGILINGHGPEQASLDF  727
            D+ +   K LR  L+    L  P G+L NG GP Q    F
Sbjct  170  DWYIKSHKELRNDLESGNDLGAPDGVLFNGLGPYQFDRAF  209



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   211 bits (537),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY +N VSFV  DTPLKLA
Sbjct  325   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTPLKLA  384

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P +    L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  385   DFFKISGVYKINSISDKPTYGGLYL----DTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  440

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W       YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  441   YSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  500

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       S  S RDE PIP N   CG+A
Sbjct  501   RQYLGQQLYLRVF-----TSSTSLRDEYPIPKNSRLCGRA  535


 Score =   180 bits (456),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +1

Query  13   TMKTVNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQF  186
            T+    GTV L     L  LS F  V++E   RF+DW V++     LGV ++ I+IN +F
Sbjct  3    TVGRSGGTVVL-----LFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGKF  57

Query  187  PGPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSF  366
            PGP ++  TND L +N+HN+LDEPFL+SWNG+Q R +S+ DG+ GT CPIPP  N+TY  
Sbjct  58   PGPDIHSVTNDNLIINVHNSLDEPFLISWNGIQNRRNSYVDGMYGTTCPIPPRSNYTYIL  117

Query  367  QLKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            Q+KDQIGS++YFPSL  HKAAGG+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  118  QVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSN  174


 Score = 91.7 bits (226),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  210   GKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQSYSVLITA--  267

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
              ++  +YY+  S RF+    +  G +RY+
Sbjct  268   DQSPRAYYVVVSSRFTDKIITSTGVLRYS  296


 Score = 27.7 bits (60),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  178  LKSRLDRGRKLPPPDGILINGRS-NGATLNVEQGKT  212



>ref|NP_195433.1| protein SKU5 similar 15 [Arabidopsis thaliana]
 emb|CAB16759.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB80382.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AEE86760.1| protein SKU5 similar 15 [Arabidopsis thaliana]
Length=541

 Score =   218 bits (556),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R+++   AARPNPQGSFHYG I + RT+VL      +YGK RY +N +S++ P TPLKLA
Sbjct  327   RMNLTANAARPNPQGSFHYGTIPINRTLVLANAATLIYGKLRYTVNRISYINPTTPLKLA  386

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D +NISGV++  TI   P        A  G SVI   LH+F +IVF N  RS+Q+WH+DG
Sbjct  387   DWYNISGVFDFKTIISTPTTG----PAHIGTSVIDVELHEFVEIVFQNDERSIQSWHMDG  442

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
              + + VG G G W+    + YNL DAV R T QVYP SWT + V++DN+GMWNLRS    
Sbjct  443   TSAYAVGYGSGTWNVTMRKRYNLVDAVPRHTFQVYPLSWTTILVSLDNKGMWNLRSQIWS  502

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAAQ  1852
             +RYLGQELY++V   E      S   EA  P NV+ CGKA +
Sbjct  503   RRYLGQELYVRVWNDEK-----SLYTEAEPPLNVLYCGKAKR  539


 Score =   180 bits (457),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 119/167 (71%), Gaps = 6/167 (4%)
 Frame = +1

Query  49   LVCSLIVLSLF----VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGS  210
            LVC L + +LF    V V++E+   FY WTV++ TRS LGV ++VI+IN QFPGP +   
Sbjct  7    LVCKLFIGALFWLGSVLVNAEDPYMFYTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAV  66

Query  211  TNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGS  390
            TN+ + VN+ N LDEPFL++WNGV+ R +SWQDGV GTNCPI P  NWTY FQLKDQIG+
Sbjct  67   TNNNIVVNLINKLDEPFLITWNGVKQRRTSWQDGVLGTNCPIQPNSNWTYQFQLKDQIGT  126

Query  391  YFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYT  531
            Y YF S  LH+A+G +G + I    V+  P+P PD D  +L+SDW++
Sbjct  127  YTYFASTSLHRASGAFGALNINQRSVITTPYPTPDGDFTLLVSDWFS  173


 Score = 85.9 bits (211),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  798   LVLLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYS  977
             L+     GKTY  R+SNVGI TS+NFRIQ H M+L+E EG++T++  +++LD+HVGQS +
Sbjct  205   LIFTGQQGKTYKFRVSNVGIATSINFRIQNHTMSLIEVEGAHTLQESYESLDVHVGQSMT  264

Query  978   VMVKALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             V+V      +   Y++ AS RF+    +    +RY   +     PL   P
Sbjct  265   VLVTL--KASVRDYFIVASTRFTKPVLTTTASLRYQGSKNAAYGPLPIGP  312


 Score = 25.8 bits (55),  Expect(4) = 7e-122, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILING  697
            K LR+SLD    L  P  +LING
Sbjct  178  KDLRKSLDAGSALPLPDALLING  200



>ref|XP_010109886.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXC24855.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   226 bits (577),  Expect(4) = 8e-122, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 150/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG++ +T+ IVL    A + GK RYA+N VS++ PDTPLKLA
Sbjct  326   RWNLTANAARPNPQGSYHYGKVPITKRIVLASSPAWINGKQRYAVNRVSYINPDTPLKLA  385

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+   TI   P      +      SVI T+LHDF +IVF N   ++Q+WHLDG
Sbjct  386   DHFNIPGVFSESTIQIQPSDGPAFV----ATSVILTSLHDFIEIVFQNTENTMQSWHLDG  441

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R+YNL DA+ R T QVYP SWTA+ V++DN+GMWNLRS   +
Sbjct  442   YDFWVVGYGSGQWTEAKRRTYNLVDALTRHTAQVYPKSWTAILVSLDNQGMWNLRSALWE  501

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ++Y+KV  P       S  +E  IP+NV+ CGKA
Sbjct  502   RQYLGQQVYLKVWNPVH-----SLANEYDIPSNVLLCGKA  536


 Score =   166 bits (421),  Expect(4) = 8e-122, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = +1

Query  16   MKTVNGTVALPLVCSLIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFP  189
            M   +  V   L+C ++ +     V +++  R+Y WTV++ T S LGV ++VI+IN QFP
Sbjct  1    MDKKDNKVLGHLICGILAVFSVCDVKADDPYRYYTWTVTYGTISPLGVPQQVILINGQFP  60

Query  190  GPLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQ  369
            GP L   TN+ + +N+ N LD+PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ
Sbjct  61   GPSLEVVTNNNIILNLINKLDQPFLLTWNGIKQRKNSWQDGVSGTNCPIPPNSNYTYKFQ  120

Query  370  LKDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
             KDQIG++ YFPS   HKAAGG+G   IY  P +  P+  PD D  +LI DWY
Sbjct  121  AKDQIGTFTYFPSTLFHKAAGGFGAFNIYQRPRIPIPYSWPDGDFTLLIGDWY  173


 Score = 87.8 bits (216),  Expect(4) = 8e-122, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 62/103 (60%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  R+SNVG  TS NFRIQ H M LVE EGS+T+++ +D+LD+HVGQS +V+V    
Sbjct  211   GKTYKFRVSNVGFSTSFNFRIQNHTMKLVEVEGSHTIQNVYDSLDVHVGQSVAVLVTL--  268

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+ AS RFS    +    + Y+        PL   P
Sbjct  269   NQAPKDYYIVASTRFSRSVLTAEAILHYSNSHTPASGPLPAPP  311


 Score = 29.6 bits (65),  Expect(4) = 8e-122, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L+ SLD    L FP GILING 
Sbjct  178  KALQGSLDSGKSLPFPDGILINGQ  201



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   211 bits (537),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY +N VSFV  DTPLKLA
Sbjct  323   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTPLKLA  382

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P +    L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  383   DFFKISGVYKINSISDKPTYGGLYL----DTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  438

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W       YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  439   YSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  498

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       S  S RDE PIP N   CG+A
Sbjct  499   RQYLGQQLYLRVF-----TSSTSLRDEYPIPKNSRLCGRA  533


 Score =   180 bits (456),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L  LS F  V++E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  12   LFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  71

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+LDEPFL+SWNGVQ R +S+ DG+ GT CPIPP  N+TY  Q+KDQIGS++YFPSL 
Sbjct  72   VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLA  131

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY
Sbjct  132  FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWY  169


 Score = 90.5 bits (223),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  208   GKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQSYSVLITA--  265

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+  S RF+    +  G +RY+        P+   P
Sbjct  266   DQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGGP  308


 Score = 28.5 bits (62),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  176  LKSRLDRGRKLPSPDGILINGRS-NGATLNVEQGKT  210



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   211 bits (537),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY +N VSFV  DTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P +    L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  384   DFFKISGVYKINSISDKPTYGGLYL----DTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W       YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  440   YSFWVVGMDGGQWETGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       S  S RDE PIP N   CG+A
Sbjct  500   RQYLGQQLYLRVF-----TSSTSLRDEYPIPKNSRLCGRA  534


 Score =   180 bits (456),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L  LS F  V++E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  13   LFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+LDEPFL+SWNGVQ R +S+ DG+ GT CPIPP  N+TY  Q+KDQIGS++YFPSL 
Sbjct  73   VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLA  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY
Sbjct  133  FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWY  170


 Score = 90.5 bits (223),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+  S RF+    +  G +RY+        P+   P
Sbjct  267   DQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGGP  309


 Score = 28.5 bits (62),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  177  LKSRLDRGRKLPSPDGILINGRS-NGATLNVEQGKT  211



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   209 bits (533),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY IN VSFV  DTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVSFVPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P      L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  384   DFFKISGVYKINSISDKPTGGGLYL----DTSVLQVDYRTFIEIVFENKENIVQSYHLNG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  440   YSFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S RDE PIP N   CG+A
Sbjct  500   RQYLGQQLYLRVF-----TTSTSLRDEYPIPKNSRLCGRA  534


 Score =   179 bits (453),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L+  S F  V++E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  13   LLCYSFFALVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+LDEPFL+SWNGVQ R +S+ DG+ GT CPIPP  N+TY  Q+KDQIGS++YFPSL 
Sbjct  73   VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLA  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  133  FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSN  173


 Score = 93.6 bits (231),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+ AS RF+    +  G +RY+    +   P+   P
Sbjct  267   DQSPRDYYVVASSRFTDKIITTTGILRYSGSSTSASGPIPGGP  309


 Score = 28.5 bits (62),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  177  LKARLDRGRKLPSPDGILINGRS-NGATLNVEQGKT  211



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   211 bits (537),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY +N VSFV  DTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P +    L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  384   DFFKISGVYKINSISDKPTYGGLYL----DTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W       YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  440   YSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       S  S RDE PIP N   CG+A
Sbjct  500   RQYLGQQLYLRVF-----TSSTSLRDEYPIPKNSRLCGRA  534


 Score =   180 bits (456),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L  LS F  V++E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  13   LFCLSFFAAVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+LDEPFL+SWNGVQ R +S+ DG+ GT CPIPP  N+TY  Q+KDQIGS++YFPSL 
Sbjct  73   VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLA  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY
Sbjct  133  FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWY  170


 Score = 90.5 bits (223),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+  S RF+    +  G +RY+        P+   P
Sbjct  267   DQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGGP  309


 Score = 28.5 bits (62),  Expect(4) = 9e-122, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  177  LKSRLDRGRKLPSPDGILINGRS-NGATLNVEQGKT  211



>ref|XP_010484570.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=543

 Score =   206 bits (523),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 142/220 (65%), Gaps = 10/220 (5%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG+I  T++ V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  329   RWNLTANAARPNPQGSFHYGKIAPTKSFVFANSAPLINGKQRYAVNGVSYVNSETPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+    I  +P  +   +      SV+QT+LHDF +IVF N  +S+Q+WHLDG
Sbjct  389   DHFGISGVFT-NAIQNVPSNSPPTV----ATSVVQTSLHDFLEIVFQNNEKSMQSWHLDG  443

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL D + R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  444   YDFWVVGFGSGQWTPAKRSLYNLVDGLTRHTTQVYPKSWTAILVSLDNQGMWNMRSAIWE  503

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++Y GQ+ Y++V  P       S  +E   P N+  CGKA
Sbjct  504   RQYSGQQFYLRVWNPVQ-----SLANEYNPPDNLQLCGKA  538


 Score =   173 bits (439),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (69%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WT ++   S LGV ++VI+IN QFPGP L+  TND + +N+ N LD+
Sbjct  26   VIVKGESPYKFYTWTATYGIISPLGVPQQVILINGQFPGPKLDVVTNDNIILNLINKLDQ  85

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG++ YFPS   HKAAGG
Sbjct  86   PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGG  145

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +L+ DW+  + + +
Sbjct  146  FGAINVYARPGIPIPYPVPTADFTLLVGDWFKTNHKTL  183


 Score = 98.6 bits (244),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ ++ NFRIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  214   GKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVMQTDYDSLDIHVGQSLAVLVTL--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YYM AS RF   + S +G +RY+    N   P S  P
Sbjct  272   NQSPKDYYMVASTRFVRSKLSVMGLLRYS----NSHVPASGDP  310


 Score = 32.0 bits (71),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q +     GK+
Sbjct  181  KTLQQRLDSGGVLPFPDGMLINGQ--TQTTFSGDQGKT  216



>ref|XP_009135529.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   214 bits (545),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 140/218 (64%), Gaps = 8/218 (4%)
 Frame = +2

Query  1193  DVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLADH  1372
             ++     RPNPQGS+HYG I   RTI+L      + GK RYA+NG SFV PDTPLKLAD+
Sbjct  324   NLTASGPRPNPQGSYHYGLIKPARTIMLANSAPWINGKQRYAVNGASFVAPDTPLKLADY  383

Query  1373  FNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDGYN  1552
             F I GV+ LG+IP  P       L     SV+  N  +F +IVF N   SVQ+WH+ GY+
Sbjct  384   FKIPGVFNLGSIPTNPPGGNGGYLT---TSVMGANFREFIEIVFQNWENSVQSWHISGYS  440

Query  1553  FFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNADQR  1732
             FFVVG+  G W+      Y L+DAV RSTVQVYP +WTA+Y+A+DN GMWN+RS N  ++
Sbjct  441   FFVVGVDGGKWTQGSRSKYTLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSENWARQ  500

Query  1733  YLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             YLGQ+ Y++V       S  S RDE P P N + CG+A
Sbjct  501   YLGQQFYLRVY-----TSSTSYRDEYPPPKNALMCGRA  533


 Score =   173 bits (439),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 115/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  52   VCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNV  231
            +  L+VL   V   +  RF+ W +++     LGV+++ I+IN QFPGP ++  TND + +
Sbjct  9    IVLLLVLINGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIII  68

Query  232  NIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSL  411
            ++ N L EPFL+SWNGVQ R +S+QDGV GT CPIPPGKN+TY  Q+KDQIGS++YFPSL
Sbjct  69   SVFNYLREPFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSL  128

Query  412  HLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
              HKAAG +G IR+++ P +  PFP PD D  +L  DWY  +  V+
Sbjct  129  AFHKAAGAFGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVL  174


 Score = 89.4 bits (220),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY  RISNVG  T+LNFRIQGH M LVE EGS+T+++ + +LD+H+GQSYSV+V A  
Sbjct  207   GKTYRFRISNVGTATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQSYSVLVTA--  264

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             ++    YY+  S RF+    +    + Y+  R     P    P
Sbjct  265   NQAPQDYYIVVSSRFTRRVLTTTSILHYSNSRRGVSGPAPSGP  307


 Score = 32.7 bits (73),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (57%), Gaps = 0/37 (0%)
 Frame = +2

Query  632  VLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            VLR  L+    + FP G+LING G    +   QPGK+
Sbjct  173  VLRRLLEAGRNVPFPDGVLINGRGWGGNTFTVQPGKT  209



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   207 bits (527),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 138/221 (62%), Gaps = 9/221 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG IN TRTI++     +V GK RY +N VSFV PDTP+KLA
Sbjct  329   RTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRYGVNSVSFVAPDTPMKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+F I GV++   I + P+     L      +V+      + +IVF N    +Q+WHLDG
Sbjct  389   DYFKIQGVFKENGITDRPYGGGLYL----DTAVLTVPYRAYVEIVFQNDEDILQSWHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+FFVVGM  G W+      YNL+DAV R T QVYP +WTA+Y+ +DN GMWNLR+    
Sbjct  445   YSFFVVGMDGGQWTTASRDQYNLRDAVARCTAQVYPKAWTAIYIPLDNVGMWNLRTEFWA  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V          S RDE PIP N + CG+A+
Sbjct  505   RQYLGQQFYLRVY-----TDSTSLRDEFPIPKNALLCGRAS  540


 Score =   181 bits (458),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 10/172 (6%)
 Frame = +1

Query  43   LPLVCSLIVLSLFVCVS--------SEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPG  192
            L L     VL  F+CVS        +E+  RF+DW V++     LGV ++ I+IN QFPG
Sbjct  3    LNLAGKTAVLCTFLCVSVSIISIVKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPG  62

Query  193  PLLNGSTNDVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQL  372
            P ++  TND L +N++N+LDEPFL+SWNG+Q R +S++DGV GT CPIPPGKN+TY  Q+
Sbjct  63   PDIHSVTNDNLIINVYNSLDEPFLLSWNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQV  122

Query  373  KDQIGSYFYFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            KDQIGS++YFPSL  HKAAGG+G IRI + P +  PF  P  D  +LI DWY
Sbjct  123  KDQIGSFYYFPSLGFHKAAGGFGGIRILSRPRIPVPFDDPAGDYTVLIGDWY  174


 Score = 90.9 bits (224),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = +3

Query  804   LLKSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVM  983
             L    GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  + +LD+HVGQSYSV+
Sbjct  209   LTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVL  268

Query  984   VKALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
               A   + G  YY+  + RF+    +  G + Y+   G    P    P
Sbjct  269   FTA--DQPGQDYYIVVTSRFTSTVLNTTGVLHYSNSAGAVSGPFPGGP  314


 Score = 30.8 bits (68),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 0/36 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+ +LD    L FP GILING G     L  + GK+
Sbjct  181  LKAALDGGRKLPFPDGILINGRGRNGYYLTVEQGKT  216



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   209 bits (533),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG I + RTIV      ++ GK RY IN VSFV  DTPLKLA
Sbjct  324   RTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVSFVPADTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D F ISGVY++ +I + P      L      SV+Q +   F +IVF N    VQ++HL+G
Sbjct  384   DFFKISGVYKINSISDKPTGGGLYL----DTSVLQVDYRTFIEIVFENKENIVQSYHLNG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVGM  G W+      YNL+DAV RSTVQVYP SWTA+Y+A+DN GMWNLRS    
Sbjct  440   YSFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+LY++V       +  S RDE PIP N   CG+A
Sbjct  500   RQYLGQQLYLRVF-----TTSTSLRDEYPIPKNSRLCGRA  534


 Score =   179 bits (453),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  61   LIVLSLFVCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVN  234
            L+  S F  V++E   RF+DW V++     LGV ++ I+IN QFPGP ++  TND L +N
Sbjct  13   LLCYSFFALVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIIN  72

Query  235  IHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLH  414
            +HN+LDEPFL+SWNGVQ R +S+ DG+ GT CPIPP  N+TY  Q+KDQIGS++YFPSL 
Sbjct  73   VHNSLDEPFLISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLA  132

Query  415  LHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
             HKAAGG+G IRI + P +  PF  P  D  +LI DWY  +
Sbjct  133  FHKAAGGFGGIRILSRPGIPVPFADPAGDYTVLIGDWYKSN  173


 Score = 93.2 bits (230),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY LRISNVG++ SLNFRIQ H M LVE EG++T++  F +LD+HVGQSYSV++ A  
Sbjct  209   GKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSLDVHVGQSYSVLITA--  266

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
              ++   YY+ AS RF+    +  G +RY+    +   P+   P
Sbjct  267   DQSPRDYYVVASSRFTGKIITTTGILRYSGSSTSASGPIPGGP  309


 Score = 28.1 bits (61),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (3%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            L+  LDR   L  P GILING     A+L+ + GK+
Sbjct  177  LKARLDRGRKLPSPDGILINGRS-NGATLNVEQGKT  211



>ref|XP_009103469.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=545

 Score =   213 bits (543),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I  T++ V         GK RYA+NGVS+V  DTPLKLA
Sbjct  330   RWNLTANAARPNPQGSFHYGTITPTKSFVFSNSAPLFNGKQRYAVNGVSYVNSDTPLKLA  389

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHFNI GV+    I  +P  +   +      SV+Q +LHDF ++VF N   S+Q+WHLDG
Sbjct  390   DHFNIPGVFSTNAIQSVPSSSPVTV----ATSVVQASLHDFLEVVFQNNEESMQSWHLDG  445

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      YNL DA+ R T QVYP SWTA+ V++DN+GMWN+RS   +
Sbjct  446   YDFWVVGFGSGQWTPEQRPLYNLVDALTRHTTQVYPKSWTAILVSLDNQGMWNMRSAIWE  505

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y+KV  P       S  +E   P N++ CGKA
Sbjct  506   RQYLGQQFYLKVWDPVQ-----SLANEYNPPDNLLLCGKA  540


 Score =   176 bits (447),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = +1

Query  82   VCVSSEE--RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            V V  E   +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+
Sbjct  27   VSVKGESPYKFYTWTVTYGVISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQ  86

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPIPP  N+TY FQ KDQIG+Y YFPS   HKAAGG
Sbjct  87   PFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYNYFPSTAFHKAAGG  146

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I IY  P +  P+P P  D  +LI DW+  + + +
Sbjct  147  FGAINIYARPRIPIPYPLPVADFTLLIGDWFKTNHKTL  184


 Score = 90.9 bits (224),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG  ++ NFRIQGH M +VE EGS+ +++ +++LD+HVGQS SV+V    
Sbjct  215   GKTYMLRISNVGSSSTFNFRIQGHAMQVVEVEGSHVLQNVYESLDVHVGQSLSVLVTL--  272

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLS  1118
             ++   +YY+ AS R++  + S  G +RY+    N G P S
Sbjct  273   NQPSKNYYIVASTRYTTSKLSVTGLLRYS----NSGVPAS  308


 Score = 28.5 bits (62),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGH  700
            K L++ LD  G+L  P G+LING 
Sbjct  182  KTLQQRLDSGGVLPSPDGMLINGQ  205



>ref|NP_569041.1| protein SKU5 similar 17 [Arabidopsis thaliana]
 gb|AAM19780.1| AT5g66920/MUD21_18 [Arabidopsis thaliana]
 gb|AAN38699.1| At5g66920/MUD21_18 [Arabidopsis thaliana]
 gb|AED98278.1| protein SKU5 similar 17 [Arabidopsis thaliana]
Length=546

 Score =   206 bits (525),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I+ T+T V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  331   RWNLTANAARPNPQGSFHYGMISPTKTFVFSNSAPLINGKQRYAVNGVSYVKSETPLKLA  390

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+    I  +P  +   +      SV+QT+ HDF +IVF N  +S+Q+WHLDG
Sbjct  391   DHFGISGVFSTNAIQSVPSNSPPTV----ATSVVQTSHHDFLEIVFQNNEKSMQSWHLDG  446

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      +NL DA+ R T QVYP SWT + V++DN+GMWN+RS   +
Sbjct  447   YDFWVVGFGSGQWTPAKRSLHNLVDALTRHTTQVYPESWTTILVSLDNQGMWNMRSAIWE  506

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++Y GQ+ Y+KV       S  S  +E   P N+  CGKA
Sbjct  507   RQYSGQQFYLKVWN-----SVQSLANEYNPPDNLQLCGKA  541


 Score =   171 bits (434),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+
Sbjct  28   VIVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQ  87

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPI P  N+TY FQ KDQIG++ YFPS   HKAAGG
Sbjct  88   PFLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGG  147

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +L+ DW+  + + +
Sbjct  148  FGAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTL  185


 Score = 98.6 bits (244),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ ++ NFRIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  216   GKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLAVLVTL--  273

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YY+ AS RF   + S +G +RY+  R     P S  P
Sbjct  274   NQSPKDYYIVASTRFIRSKLSVMGLLRYSNSR----VPASGDP  312


 Score = 32.3 bits (72),  Expect(4) = 1e-121, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q++     GK+
Sbjct  183  KTLQQRLDSGGVLPFPDGMLINGQ--TQSTFSGDQGKT  218



>dbj|BAB08634.1| pectinesterase like protein [Arabidopsis thaliana]
Length=544

 Score =   207 bits (526),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 141/220 (64%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGSFHYG I+ T+T V       + GK RYA+NGVS+V  +TPLKLA
Sbjct  329   RWNLTANAARPNPQGSFHYGMISPTKTFVFSNSAPLINGKQRYAVNGVSYVKSETPLKLA  388

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             DHF ISGV+    I  +P  +   +      SV+QT+ HDF +IVF N  +S+Q+WHLDG
Sbjct  389   DHFGISGVFSTNAIQSVPSNSPPTV----ATSVVQTSHHDFLEIVFQNNEKSMQSWHLDG  444

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+      +NL DA+ R T QVYP SWT + V++DN+GMWN+RS   +
Sbjct  445   YDFWVVGFGSGQWTPAKRSLHNLVDALTRHTTQVYPESWTTILVSLDNQGMWNMRSAIWE  504

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++Y GQ+ Y+KV       S  S  +E   P N+  CGKA
Sbjct  505   RQYSGQQFYLKVWN-----SVQSLANEYNPPDNLQLCGKA  539


 Score =   171 bits (434),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = +1

Query  76   LFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTNDVLNVNIHNNLDE  255
            + V   S  +FY WTV++   S LGV ++VI+IN QFPGP L   TND + +N+ N LD+
Sbjct  26   VIVKGESPYKFYTWTVTYGIISPLGVPQQVILINGQFPGPKLEVVTNDNIILNLINKLDQ  85

Query  256  PFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYFYFPSLHLHKAAGG  435
            PFL++WNG++ R +SWQDGV GTNCPI P  N+TY FQ KDQIG++ YFPS   HKAAGG
Sbjct  86   PFLLTWNGIKQRKNSWQDGVLGTNCPIQPNSNFTYKFQTKDQIGTFNYFPSTAFHKAAGG  145

Query  436  YGPIRIYNTPVVHPPFPCPDYDLDILISDWYTEDIQVI  549
            +G I +Y  P +  P+P P  D  +L+ DW+  + + +
Sbjct  146  FGAINVYARPGIPIPYPLPTADFTLLVGDWFKTNHKTL  183


 Score = 98.6 bits (244),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTYMLRISNVG+ ++ NFRIQGH M +VE EGS+ ++ D+D+LDIHVGQS +V+V    
Sbjct  214   GKTYMLRISNVGLSSTFNFRIQGHTMKVVEVEGSHVIQTDYDSLDIHVGQSLAVLVTL--  271

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             +++   YY+ AS RF   + S +G +RY+  R     P S  P
Sbjct  272   NQSPKDYYIVASTRFIRSKLSVMGLLRYSNSR----VPASGDP  310


 Score = 32.7 bits (73),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 2/38 (5%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILINGHGPEQASLDFQPGKS  742
            K L++ LD  G+L FP G+LING    Q++     GK+
Sbjct  181  KTLQQRLDSGGVLPFPDGMLINGQ--TQSTFSGDQGKT  216



>ref|XP_008792598.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=538

 Score =   222 bits (566),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 150/220 (68%), Gaps = 9/220 (4%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++   AARPNPQGS+HYG I  TR++VL+     + GK RYA+NGVSFV PDTPLKLA
Sbjct  324   RWNLTASAARPNPQGSYHYGTITRTRSLVLKNSAPLINGKQRYAVNGVSFVVPDTPLKLA  383

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D+FNI G++   +IP +P      +L  P   V++ NLHDF +IVF N   S+Q+WHLDG
Sbjct  384   DNFNIPGIFTWDSIP-IPAPEGSAVLGTP---VMRFNLHDFIEIVFQNTEDSMQSWHLDG  439

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y+F+VVG G G W+    R YNL DAV R TVQVYP  W+A++V++DN+GMWNLRS    
Sbjct  440   YDFWVVGYGAGNWTEKFRRRYNLIDAVTRHTVQVYPKGWSAIFVSLDNQGMWNLRSAMWG  499

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKA  1846
             ++YLGQ+ Y +V   E   S     +E  IP+N ++CGKA
Sbjct  500   RQYLGQQFYNRVWTLEKSFS-----NEYDIPSNALRCGKA  534


 Score =   169 bits (428),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 3/164 (2%)
 Frame = +1

Query  46   PLVCSLIVLSLFVCVSSEE---RFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            PLV   +       V++ E   R++ WTV+    S LGV+++ I+IN QFPGP ++  TN
Sbjct  8    PLVLGAMAFLALAFVATAEDPYRYFTWTVTHGPISPLGVQQQGILINGQFPGPRIDCVTN  67

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D + V++ N +DEP L++WNG++ R +SWQDGV GTNCPIPPG N+TY FQ KDQIGS+ 
Sbjct  68   DNMIVDVINKIDEPILITWNGIKQRKNSWQDGVLGTNCPIPPGSNYTYKFQTKDQIGSFT  127

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWY  528
            YF S  + +AAGG+G + +Y  P +  P+  PD D  +L+ DWY
Sbjct  128  YFLSTGMQRAAGGFGALNVYQRPQIPVPYAKPDGDFSLLVGDWY  171


 Score = 89.7 bits (221),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  819   GKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVKALE  998
             GKTY+ R+SNVG+ TS+NFRIQGH M LVE EGS+T+++ +D+LDIHVGQS +V+V   +
Sbjct  210   GKTYLFRVSNVGLMTSINFRIQGHQMKLVEVEGSHTLQNIYDSLDIHVGQSLAVLVTLDQ  269

Query  999   HKNGASYYMSASPRFSLMQASGIGFVRYN  1085
                   YY+  S RF+    +  G + Y+
Sbjct  270   PPK--DYYIVTSTRFTRRVLTATGVLHYS  296


 Score = 28.5 bits (62),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  629  KVLRESLDRTGMLKFPHGILING  697
            K L+++LD    L FP G+LING
Sbjct  176  KALQQTLDSGRSLPFPDGLLING  198



>dbj|BAC83966.1| putative PS60 [Oryza sativa Japonica Group]
Length=563

 Score =   222 bits (566),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 146/221 (66%), Gaps = 6/221 (3%)
 Frame = +2

Query  1187  RVDVAVGAARPNPQGSFHYGRINVTRTIVLEGKMARVYGKPRYAINGVSFVYPDTPLKLA  1366
             R ++     RPNPQGS+HYG +  TRTI L    A V GK RY++NGVS V PDTPLK+A
Sbjct  342   RWNLTASGPRPNPQGSYHYGMVTTTRTIRLASSSATVNGKQRYSVNGVSHVNPDTPLKVA  401

Query  1367  DHFNISGVYELGTIPEMPHFTYRLLLARPGVSVIQTNLHDFTQIVFHNPLRSVQTWHLDG  1546
             D++ I+GV+ +GTI + P        A    +V+  +  D+ +IVF NP   VQ+WH+DG
Sbjct  402   DYYKIAGVFSVGTISDSPS-GGGGGGAYLQTAVMGASYRDYVEIVFENPENEVQSWHIDG  460

Query  1547  YNFFVVGMGPGIWSALDMRSYNLKDAVYRSTVQVYPYSWTAVYVAMDNEGMWNLRSGNAD  1726
             Y F+VVGM  G WS+   + YNL+DAV R TVQVYP SWTA+Y+ +DN GMWN+RS N  
Sbjct  461   YAFWVVGMDGGKWSSASRQGYNLRDAVSRYTVQVYPNSWTAIYMPLDNVGMWNVRSENWA  520

Query  1727  QRYLGQELYIKVKGPEDDPSKISPRDEAPIPANVIKCGKAA  1849
             ++YLGQ+ Y++V       S  S RDE PIP N + CG+AA
Sbjct  521   RQYLGQQFYLRVW-----TSSTSWRDEYPIPKNALLCGRAA  556


 Score =   168 bits (426),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  37   VALPLVCSLIVLSLFVCVSSEERFYDWTVSFSTRSILGVEKKVIVINDQFPGPLLNGSTN  216
            VA  L   L   +L V      RF+ WTV++   + LGV+++ I+IN QFPGP +   TN
Sbjct  7    VAAALFLFLATSALLVAGDDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTN  66

Query  217  DVLNVNIHNNLDEPFLMSWNGVQLRGSSWQDGVQGTNCPIPPGKNWTYSFQLKDQIGSYF  396
            D L +N+ N L++PFL+SWNG+Q R +S++DGV GT CPIPPG N+TY  Q+KDQIG+YF
Sbjct  67   DNLIINVFNKLNDPFLISWNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYF  126

Query  397  YFPSLHLHKAAGGYGPIRIYNTPVVHPPFPCPDYDLDILISDWYTED  537
            YFPSL  HKAAGG+G IR+ + P++  PFP P  D  +LI DWY  +
Sbjct  127  YFPSLAFHKAAGGFGAIRVLSRPMIPVPFPPPAADYPLLIGDWYKAN  173


 Score = 89.0 bits (219),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  810   KSAGKTYMLRISNVGIKTSLNFRIQGHNMTLVETEGSYTVKHDFDNLDIHVGQSYSVMVK  989
             K+AG+TY  RISNVG+ TSLN R QGH MTLVE EGS+T++  + +LD+H+GQSYSV++ 
Sbjct  224   KNAGRTYRFRISNVGLSTSLNIRFQGHTMTLVEVEGSHTMQTTYSSLDVHLGQSYSVLLT  283

Query  990   ALEHKNGASYYMSASPRFSLMQASGIGFVRYNQFRGNPGTPLSKSP  1127
             A   +    Y +  S RF+    S    +RY+   G     L   P
Sbjct  284   A--DQPAYDYAVVVSTRFTSKIISTTAVLRYSGSGGKSPAALPGGP  327


 Score = 29.6 bits (65),  Expect(4) = 2e-121, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 0/35 (0%)
 Frame = +2

Query  635  LRESLDRTGMLKFPHGILINGHGPEQASLDFQPGK  739
            L+  LD    L FP G+LING   +  + + Q GK
Sbjct  177  LKYMLDSGKALGFPDGLLINGRSWDGYTFNVQQGK  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5763899892528