BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20773_g1_i3 len=905 path=[10101:0-226 10327:227-311 9102:312-734
15446:735-740 8749:741-904]

Length=905
                                                                      Score     E

gb|EYU29183.1|  hypothetical protein MIMGU_mgv1a0133061mg               177   3e-51   
ref|XP_011082035.1|  PREDICTED: putative UDP-sugar transporter DD...    180   3e-50   
ref|XP_009770578.1|  PREDICTED: putative UDP-sugar transporter DD...    179   4e-50   
ref|XP_006342467.1|  PREDICTED: putative UDP-sugar transporter DD...    179   7e-50   
ref|XP_004253066.1|  PREDICTED: putative UDP-sugar transporter DD...    177   3e-49   
ref|XP_009625558.1|  PREDICTED: putative UDP-sugar transporter DD...    176   9e-49   
ref|XP_002271869.1|  PREDICTED: putative UDP-sugar transporter DD...    176   1e-48   Vitis vinifera
ref|XP_008445072.1|  PREDICTED: putative UDP-sugar transporter DD...    175   2e-48   
ref|XP_002308729.2|  hypothetical protein POPTR_0006s28550g             174   6e-48   Populus trichocarpa [western balsam poplar]
ref|XP_004138772.1|  PREDICTED: putative UDP-sugar transporter DD...    174   6e-48   
ref|XP_002324378.2|  hypothetical protein POPTR_0018s03360g             173   1e-47   Populus trichocarpa [western balsam poplar]
emb|CDP12468.1|  unnamed protein product                                173   1e-47   
ref|XP_011031390.1|  PREDICTED: putative UDP-sugar transporter DD...    172   2e-47   
ref|XP_011077971.1|  PREDICTED: putative UDP-sugar transporter DD...    171   3e-47   
ref|XP_011077820.1|  PREDICTED: putative UDP-sugar transporter DD...    171   7e-47   
ref|XP_010268352.1|  PREDICTED: putative UDP-sugar transporter DD...    171   1e-46   
ref|XP_011078047.1|  PREDICTED: putative UDP-sugar transporter DD...    169   1e-46   
ref|XP_010278061.1|  PREDICTED: putative UDP-sugar transporter DD...    170   2e-46   
ref|XP_010525916.1|  PREDICTED: putative UDP-sugar transporter DD...    169   3e-46   
gb|KCW82632.1|  hypothetical protein EUGRSUZ_C04017                     165   3e-46   
ref|XP_004253065.1|  PREDICTED: putative UDP-sugar transporter DD...    169   4e-46   
ref|XP_011044974.1|  PREDICTED: putative UDP-sugar transporter DD...    169   5e-46   
ref|XP_011044973.1|  PREDICTED: putative UDP-sugar transporter DD...    169   5e-46   
gb|KFK29748.1|  hypothetical protein AALP_AA7G173700                    168   1e-45   
ref|XP_010914083.1|  PREDICTED: putative UDP-sugar transporter DD...    167   2e-45   
gb|KDO67335.1|  hypothetical protein CISIN_1g020772mg                   164   2e-45   
gb|KHG10574.1|  Putative UDP-sugar transporter                          167   4e-45   
ref|XP_010049832.1|  PREDICTED: putative UDP-sugar transporter DD...    166   6e-45   
ref|XP_002515367.1|  UDP-sugar transporter, putative                    166   9e-45   Ricinus communis
ref|XP_008779598.1|  PREDICTED: putative UDP-sugar transporter DD...    166   1e-44   
ref|XP_010432843.1|  PREDICTED: putative UDP-sugar transporter DD...    166   1e-44   
ref|XP_010692995.1|  PREDICTED: putative UDP-sugar transporter DD...    165   1e-44   
ref|XP_006284104.1|  hypothetical protein CARUB_v10005245mg             165   1e-44   
ref|XP_009363633.1|  PREDICTED: putative UDP-sugar transporter DD...    165   2e-44   
ref|XP_006450206.1|  hypothetical protein CICLE_v10008929mg             165   2e-44   
gb|KEH35961.1|  GDP-mannose transporter GONST3                          162   2e-44   
gb|KEH35962.1|  GDP-mannose transporter GONST3                          163   3e-44   
ref|XP_002867292.1|  hypothetical protein ARALYDRAFT_491578             164   3e-44   
ref|XP_006412577.1|  hypothetical protein EUTSA_v10025721mg             164   5e-44   
ref|XP_004291270.1|  PREDICTED: putative UDP-sugar transporter DD...    163   8e-44   
ref|XP_008393929.1|  PREDICTED: putative UDP-sugar transporter DD...    163   9e-44   
ref|XP_009403327.1|  PREDICTED: putative UDP-sugar transporter DD...    163   1e-43   
ref|XP_004501225.1|  PREDICTED: putative UDP-sugar transporter DD...    163   1e-43   
ref|XP_003603557.1|  UDP-sugar transporter sqv-7                        162   1e-43   
ref|NP_567879.1|  UDP-galactose transporter 7                           162   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447521.1|  PREDICTED: putative UDP-sugar transporter DD...    162   3e-43   
ref|NP_001031765.1|  UDP-galactose transporter 7                        161   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011628.1|  UDP-N-acetylglucosamine (UAA) transporter fa...    161   6e-43   
ref|NP_001241044.1|  uncharacterized protein LOC100777622               160   1e-42   
gb|EPS72338.1|  hypothetical protein M569_02420                         159   1e-42   
ref|XP_010112122.1|  Putative UDP-sugar transporter                     159   2e-42   
ref|XP_006845526.1|  hypothetical protein AMTR_s00019p00170070          159   4e-42   
ref|XP_009108919.1|  PREDICTED: putative UDP-sugar transporter DD...    158   6e-42   
ref|XP_009108920.1|  PREDICTED: putative UDP-sugar transporter DD...    157   7e-42   
gb|KDP33466.1|  hypothetical protein JCGZ_07037                         158   8e-42   
ref|XP_010438019.1|  PREDICTED: putative UDP-sugar transporter DD...    157   8e-42   
ref|XP_010438017.1|  PREDICTED: putative UDP-sugar transporter DD...    158   9e-42   
ref|XP_007137131.1|  hypothetical protein PHAVU_009G102300g             157   1e-41   
ref|XP_008219958.1|  PREDICTED: putative UDP-sugar transporter DD...    157   2e-41   
ref|XP_007224372.1|  hypothetical protein PRUPE_ppa021028mg             157   2e-41   
emb|CDY57885.1|  BnaC03g77290D                                          156   4e-41   
ref|XP_009770581.1|  PREDICTED: putative UDP-sugar transporter DD...    154   1e-40   
ref|XP_008346553.1|  PREDICTED: putative UDP-sugar transporter DD...    153   5e-40   
emb|CAN81588.1|  hypothetical protein VITISV_041431                     151   1e-39   Vitis vinifera
ref|XP_002437988.1|  hypothetical protein SORBIDRAFT_10g005990          151   3e-39   Sorghum bicolor [broomcorn]
ref|XP_006655866.1|  PREDICTED: putative UDP-sugar transporter DD...    151   3e-39   
gb|ACF87479.1|  unknown                                                 147   6e-39   Zea mays [maize]
ref|XP_004964633.1|  PREDICTED: putative UDP-sugar transporter DD...    149   1e-38   
ref|XP_010438018.1|  PREDICTED: putative UDP-sugar transporter DD...    149   2e-38   
ref|XP_003564172.1|  PREDICTED: putative UDP-sugar transporter DD...    149   2e-38   
ref|NP_001057020.1|  Os06g0188100                                       149   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008346555.1|  PREDICTED: putative UDP-sugar transporter DD...    147   3e-38   
ref|NP_001140325.1|  hypothetical protein                               147   3e-38   Zea mays [maize]
gb|EMT27185.1|  hypothetical protein F775_18741                         150   4e-38   
ref|XP_010268354.1|  PREDICTED: putative UDP-sugar transporter DD...    147   5e-38   
ref|XP_008658221.1|  PREDICTED: hypothetical protein isoform X1         147   5e-38   
dbj|BAJ97855.1|  predicted protein                                      146   2e-37   
dbj|BAJ89468.1|  predicted protein                                      146   2e-37   
ref|XP_010227926.1|  PREDICTED: putative UDP-sugar transporter DD...    144   9e-37   
gb|KDO67333.1|  hypothetical protein CISIN_1g020772mg                   141   9e-36   
ref|XP_009130089.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    140   8e-35   
gb|EMS45587.1|  hypothetical protein TRIUR3_12824                       136   7e-34   
emb|CAA19763.1|  putative protein                                       135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982976.1|  hypothetical protein SELMODRAFT_179881             130   3e-31   
ref|XP_011082037.1|  PREDICTED: putative UDP-sugar transporter DD...    127   6e-31   
ref|XP_011078127.1|  PREDICTED: putative UDP-sugar transporter DD...    124   1e-29   
ref|XP_002965499.1|  hypothetical protein SELMODRAFT_84207              111   9e-25   
ref|XP_008659941.1|  PREDICTED: putative UDP-sugar transporter DD...  85.9    4e-16   
ref|XP_001762906.1|  predicted protein                                81.3    2e-14   
ref|XP_001691747.1|  predicted protein                                68.6    2e-10   Chlamydomonas reinhardtii
ref|XP_001784945.1|  predicted protein                                64.7    2e-08   
ref|XP_002955833.1|  hypothetical protein VOLCADRAFT_66339            64.7    2e-08   
ref|XP_001758197.1|  predicted protein                                61.6    2e-07   
emb|CBY32423.1|  unnamed protein product                              61.2    3e-07   
emb|CBY09669.1|  unnamed protein product                              61.2    3e-07   
ref|XP_002499609.1|  Drug/Metabolite transporter superfamily          60.8    3e-07   Micromonas commoda
ref|XP_643057.1|  hypothetical protein DDB_G0276625                   60.5    5e-07   Dictyostelium discoideum AX4
ref|XP_006815022.1|  PREDICTED: solute carrier family 35 member D...  58.2    8e-07   
ref|XP_003728942.1|  PREDICTED: UDP-N-acetylglucosamine/UDP-gluco...  57.0    1e-06   
ref|XP_003728944.1|  PREDICTED: UDP-N-acetylglucosamine/UDP-gluco...  56.6    2e-06   
gb|ELU16612.1|  hypothetical protein CAPTEDRAFT_101209                58.5    2e-06   
ref|XP_003058215.1|  Drug/Metabolite transporter superfamily          57.4    4e-06   
ref|XP_009029556.1|  hypothetical protein HELRODRAFT_122800           57.4    4e-06   
gb|ETN65003.1|  UDP-sugar transporter UST74c                          57.4    6e-06   
emb|CBY32879.1|  unnamed protein product                              55.5    2e-05   
emb|CBY18652.1|  unnamed protein product                              55.5    2e-05   
ref|XP_001599500.1|  PREDICTED: UDP-sugar transporter UST74c          55.1    3e-05   Nasonia vitripennis
emb|CDX91779.1|  BnaC08g06980D                                        52.8    6e-05   
gb|KFB50841.1|  AGAP005200-PA-like protein                            53.5    1e-04   
ref|XP_002160727.2|  PREDICTED: solute carrier family 35 member D...  52.0    3e-04   
gb|KFM25567.1|  Putative UDP-sugar transporter                        50.8    6e-04   
ref|XP_001230977.2|  AGAP005200-PA                                    51.2    6e-04   Anopheles gambiae str. PEST
ref|XP_005829506.1|  hypothetical protein GUITHDRAFT_141195           50.8    7e-04   
ref|XP_005646100.1|  hypothetical protein COCSUDRAFT_37348            50.4    8e-04   



>gb|EYU29183.1| hypothetical protein MIMGU_mgv1a0133061mg, partial [Erythranthe 
guttata]
Length=136

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + +PY SL AAVSYGV+SMAMVFINKAVLMQYS SMTLLT QQL +TLLI F RV GYTK
Sbjct  6    DSAPYLSLFAAVSYGVSSMAMVFINKAVLMQYSNSMTLLTFQQLMTTLLIRFGRVTGYTK  65

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+GF+IETAK+L LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF GK +
Sbjct  66   ARGFNIETAKKLLLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFYGKGK  125

Query  728  PTTQV  742
            PTTQV
Sbjct  126  PTTQV  130



>ref|XP_011082035.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Sesamum indicum]
 ref|XP_011082036.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Sesamum indicum]
Length=322

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  377  PYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKG  556
            PY SL AA+SYGVASMAMVFINKAVLMQY+QSMTLLTLQQL + LLI+F RV+GYTKA+G
Sbjct  9    PYLSLFAALSYGVASMAMVFINKAVLMQYAQSMTLLTLQQLVTALLIHFGRVMGYTKARG  68

Query  557  FSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTT  736
            F++ TAK+L LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF GK RPTT
Sbjct  69   FNMATAKKLLLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFTGKGRPTT  128

Query  737  QVC  745
            QV 
Sbjct  129  QVT  131



>ref|XP_009770578.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770579.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770580.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Nicotiana sylvestris]
Length=317

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVL  535
            M  M+ SPY SL +A+SYG+ASMAMVFINKAV+MQY+ SMTLLT+QQLA+ LLI+F RV+
Sbjct  1    MEIMDTSPYLSLFSALSYGIASMAMVFINKAVIMQYAHSMTLLTVQQLATALLIHFGRVM  60

Query  536  GYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFA  715
            GYT+A+G + ETAK+LF VSLFYNANV FALASLKGVNIPMYIAIKRLTPLAVLVAGFF 
Sbjct  61   GYTRARGLNAETAKKLFPVSLFYNANVGFALASLKGVNIPMYIAIKRLTPLAVLVAGFFT  120

Query  716  GKARPTTQVC  745
            GKA+PTTQV 
Sbjct  121  GKAKPTTQVT  130



>ref|XP_006342467.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Solanum 
tuberosum]
Length=320

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVL  535
            M  M+ SPY SL+AA SYG+ASMAMVFINKAV+MQY+ SMTLLT+QQ+A+ LLI+  RV+
Sbjct  1    MEIMDSSPYLSLIAAFSYGIASMAMVFINKAVIMQYAHSMTLLTVQQIATALLIHLGRVM  60

Query  536  GYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFA  715
            GYTKAK  + ETAKRLF VSLFYNANV FALASLKGVNIPMYIAIKRLTPLAVLVAGFF 
Sbjct  61   GYTKAKELNAETAKRLFPVSLFYNANVGFALASLKGVNIPMYIAIKRLTPLAVLVAGFFT  120

Query  716  GKARPTTQVC  745
            GK RPTTQV 
Sbjct  121  GKGRPTTQVT  130



>ref|XP_004253066.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010314802.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Solanum lycopersicum]
Length=317

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  365  MEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYT  544
            M+ SPY SL AA SYG+ASMAMVFINKAV+MQY+ SMTLL +QQ+ + LLI+  RV+GYT
Sbjct  1    MDSSPYLSLTAAFSYGIASMAMVFINKAVIMQYAHSMTLLAVQQVTTALLIHLGRVMGYT  60

Query  545  KAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKA  724
            KAK  + ETAKRLF VSLFYNANV FALASLKGVNIPMYIAIKRLTPLAVLVAGFF GK 
Sbjct  61   KAKDLNAETAKRLFPVSLFYNANVGFALASLKGVNIPMYIAIKRLTPLAVLVAGFFTGKG  120

Query  725  RPTTQVC  745
            RPTTQV 
Sbjct  121  RPTTQVT  127



>ref|XP_009625558.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Nicotiana 
tomentosiformis]
 ref|XP_009625559.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Nicotiana 
tomentosiformis]
 ref|XP_009625560.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Nicotiana 
tomentosiformis]
Length=320

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVL  535
            M  M+ SPY SL AA+SYG+ SMAMVFINKAV+MQY+ SMTLLT+QQLA+ LLI+F RV+
Sbjct  1    MEIMDTSPYLSLFAALSYGITSMAMVFINKAVIMQYAHSMTLLTVQQLATALLIHFGRVM  60

Query  536  GYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFA  715
            GYT+ +G + ETAK+LF VSLFYNANV FALASLKGVNIPMYIAIKRLTPLAVLVAGFF 
Sbjct  61   GYTRDRGLNAETAKKLFPVSLFYNANVGFALASLKGVNIPMYIAIKRLTPLAVLVAGFFT  120

Query  716  GKARPTTQVC  745
            GK +PTTQV 
Sbjct  121  GKGKPTTQVT  130



>ref|XP_002271869.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Vitis 
vinifera]
 ref|XP_010648836.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Vitis 
vinifera]
 emb|CBI24000.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E SP+ SL +A SYGVASMAMVFINKAVLMQYS SMTLLT+QQLA+ LLI+F RV+GYT+
Sbjct  9    EPSPFLSLTSAFSYGVASMAMVFINKAVLMQYSSSMTLLTVQQLATALLIHFGRVMGYTR  68

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+G ++ +AKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+ GFF+GK R
Sbjct  69   ARGINMASAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLITGFFSGKGR  128

Query  728  PTTQVC  745
            P+TQV 
Sbjct  129  PSTQVS  134



>ref|XP_008445072.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Cucumis 
melo]
Length=317

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + + Y SLVAAVSYG+ASMAMVF+NKAVLMQYS SMTLLTLQQLA+TLLI+F R +GYTK
Sbjct  8    DKNSYRSLVAAVSYGIASMAMVFLNKAVLMQYSHSMTLLTLQQLATTLLIHFGRKMGYTK  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            AKG  ++TAKR+F VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF+GK R
Sbjct  68   AKGLDMQTAKRIFPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFSGKGR  127

Query  728  PTTQV-CT  748
            PT QV C+
Sbjct  128  PTAQVICS  135



>ref|XP_002308729.2| hypothetical protein POPTR_0006s28550g [Populus trichocarpa]
 gb|EEE92252.2| hypothetical protein POPTR_0006s28550g [Populus trichocarpa]
Length=323

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E SPY SLVAAVSYG+ASMAMVFINKA+LMQY  SMTLLTLQQLA+ LLI+F R  GYT+
Sbjct  8    EASPYKSLVAAVSYGIASMAMVFINKAILMQYGHSMTLLTLQQLATALLIHFGRRTGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+G  ++TAKRL  VSLFYNANVAFALASL+GVNIPMYIAIKRLTPLAVL+AG F+GK +
Sbjct  68   ARGVDMQTAKRLLPVSLFYNANVAFALASLRGVNIPMYIAIKRLTPLAVLIAGIFSGKGK  127

Query  728  PTTQVC  745
            PTTQV 
Sbjct  128  PTTQVT  133



>ref|XP_004138772.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Cucumis 
sativus]
 ref|XP_004172220.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Cucumis 
sativus]
 gb|KGN62858.1| hypothetical protein Csa_2G377940 [Cucumis sativus]
Length=317

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + + Y SLVAAVSYG+ASMAMVF+NKAVLMQYS SMTLLTLQQLA+TLLI+F R +GYTK
Sbjct  8    DKNSYRSLVAAVSYGIASMAMVFLNKAVLMQYSHSMTLLTLQQLATTLLIHFGRKMGYTK  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            AKG  ++TAK++F VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF+GK R
Sbjct  68   AKGLDMQTAKKIFPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFSGKGR  127

Query  728  PTTQV-CT  748
            PT QV C+
Sbjct  128  PTAQVICS  135



>ref|XP_002324378.2| hypothetical protein POPTR_0018s03360g [Populus trichocarpa]
 gb|EEF02943.2| hypothetical protein POPTR_0018s03360g [Populus trichocarpa]
Length=323

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E SPY SLVAAVSYG+ASMAMVFINKA+LMQY  SMTLLTLQQLA+ LLI+F R +GYT+
Sbjct  8    EASPYKSLVAAVSYGIASMAMVFINKAILMQYGHSMTLLTLQQLATALLIHFGRQMGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            ++G  ++TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGF +GK +
Sbjct  68   SRGVDMQTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFSSGKGK  127

Query  728  PTTQVC  745
            PTTQV 
Sbjct  128  PTTQVT  133



>emb|CDP12468.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVL  535
            M + + S + SL AAVSYG+ASMAMVFINKAVLMQY+ SMTLLTLQQLA+TLLI+F R +
Sbjct  1    MDAADTSSFLSLFAAVSYGIASMAMVFINKAVLMQYAHSMTLLTLQQLATTLLIHFGRSM  60

Query  536  GYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFA  715
            GY KA+G ++ETAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF 
Sbjct  61   GYMKARGLNVETAKKLIFVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFT  120

Query  716  GKARPTTQVC  745
            GK +PTTQV 
Sbjct  121  GKGKPTTQVT  130



>ref|XP_011031390.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Populus 
euphratica]
 ref|XP_011031391.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Populus 
euphratica]
 ref|XP_011031392.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Populus 
euphratica]
 ref|XP_011031393.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Populus 
euphratica]
Length=323

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  374  SPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAK  553
            SPY SLVAAVSYG+ASMAMVFINKAVLMQY  SMTLLTLQQ A+ LLI+F R  GYT+A+
Sbjct  10   SPYKSLVAAVSYGIASMAMVFINKAVLMQYGHSMTLLTLQQSATALLIHFGRRTGYTRAR  69

Query  554  GFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPT  733
            G  ++TAKRL  VSLFYNANVAFALASLKGVNIPMYIA+KRLTPLAVL+AG F+GK +PT
Sbjct  70   GVDMQTAKRLLPVSLFYNANVAFALASLKGVNIPMYIAMKRLTPLAVLIAGIFSGKGKPT  129

Query  734  TQVC  745
            TQV 
Sbjct  130  TQVT  133



>ref|XP_011077971.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Sesamum indicum]
Length=285

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + +P+ SL AA+SYG ASM MVFINKAVLMQY+ SMTLL LQQL +TLLI F RV+GYTK
Sbjct  6    DSTPHLSLFAALSYGAASMGMVFINKAVLMQYAHSMTLLALQQLMTTLLIRFGRVMGYTK  65

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+GF +E AK+L LVS FYNANVAFALASLKGVNIPMYIAIKRLTPL VL+AGFF GK R
Sbjct  66   ARGFDVEAAKKLLLVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLTVLIAGFFFGKGR  125

Query  728  PTTQV  742
            PTTQV
Sbjct  126  PTTQV  130



>ref|XP_011077820.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Sesamum indicum]
 ref|XP_011077898.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Sesamum indicum]
Length=321

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + +P+ SL AA+SYG ASM MVFINKAVLMQY+ SMTLL LQQL +TLLI F RV+GYTK
Sbjct  6    DSTPHLSLFAALSYGAASMGMVFINKAVLMQYAHSMTLLALQQLMTTLLIRFGRVMGYTK  65

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+GF +E AK+L LVS FYNANVAFALASLKGVNIPMYIAIKRLTPL VL+AGFF GK R
Sbjct  66   ARGFDVEAAKKLLLVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLTVLIAGFFFGKGR  125

Query  728  PTTQVC  745
            PTTQV 
Sbjct  126  PTTQVS  131



>ref|XP_010268352.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010268353.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Nelumbo nucifera]
Length=321

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  365  MEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYT  544
            +E SP+ S ++A SYGVASM+MVFINKA+LMQY  SMTLL LQQL ++LLI+F RV+GYT
Sbjct  12   LETSPFKSFISAFSYGVASMSMVFINKAILMQYGHSMTLLILQQLVTSLLIHFGRVMGYT  71

Query  545  KAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKA  724
            K+KGF   TAK+LF VS FYNANVAFALASLKGVNIPMYIA+KRLTPL VLVAGFF+GK 
Sbjct  72   KSKGFDTMTAKKLFPVSFFYNANVAFALASLKGVNIPMYIALKRLTPLGVLVAGFFSGKG  131

Query  725  RPTTQV  742
            RP+ QV
Sbjct  132  RPSIQV  137



>ref|XP_011078047.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X3 [Sesamum indicum]
Length=284

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + +P+ SL AA+SYG ASM MVFINKAVLMQY+ SMTLL LQQL +TLLI F RV+GYTK
Sbjct  6    DSTPHLSLFAALSYGAASMGMVFINKAVLMQYAHSMTLLALQQLMTTLLIRFGRVMGYTK  65

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+GF +E AK+L LVS FYNANVAFALASLKGVNIPMYIAIKRLTPL VL+AGFF GK R
Sbjct  66   ARGFDVEAAKKLLLVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLTVLIAGFFFGKGR  125

Query  728  PTTQ  739
            PTTQ
Sbjct  126  PTTQ  129



>ref|XP_010278061.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Nelumbo 
nucifera]
Length=327

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + SL+AA SYG++SMAMVFINKA+LMQY  SMTLLTLQQLA+TLLI+F RVLG+TK
Sbjct  10   ETSSFKSLIAAFSYGISSMAMVFINKAILMQYGYSMTLLTLQQLATTLLIHFGRVLGHTK  69

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+GF I TAK+LF VS FYNANVAFALASLKGVNIPMYIA+KRLTPLAVLVAG F+GK +
Sbjct  70   ARGFDIVTAKKLFPVSFFYNANVAFALASLKGVNIPMYIALKRLTPLAVLVAGIFSGKGK  129

Query  728  PTTQVC  745
            P+TQV 
Sbjct  130  PSTQVS  135



>ref|XP_010525916.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Tarenaya 
hassleriana]
 ref|XP_010525917.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Tarenaya 
hassleriana]
 ref|XP_010525918.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Tarenaya 
hassleriana]
Length=323

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A M+ S + SL AAVSYG+ASMAMVFINKAV+MQYS SMTLLTLQQLA+ LLI+F R +G
Sbjct  5    AEMDPSSFLSLFAAVSYGIASMAMVFINKAVIMQYSSSMTLLTLQQLATALLIFFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YTKAKG  + T K+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+F+G
Sbjct  65   YTKAKGIDMATGKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYFSG  124

Query  719  KARPTTQV  742
            K RPTTQV
Sbjct  125  KGRPTTQV  132



>gb|KCW82632.1| hypothetical protein EUGRSUZ_C04017 [Eucalyptus grandis]
Length=182

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + SP+ S+ AA+SYG+ASMAMVFINKAVLMQYS SMTLLTLQQLA+ LLI+F RV GY K
Sbjct  8    DASPFLSIFAALSYGIASMAMVFINKAVLMQYSNSMTLLTLQQLATALLIHFGRVAGYIK  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+G + ETA++L LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF GK  
Sbjct  68   AQGVNWETARKLLLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFRGKGT  127

Query  728  PTTQV  742
            PT QV
Sbjct  128  PTPQV  132



>ref|XP_004253065.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010314801.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Solanum lycopersicum]
Length=330

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 109/140 (78%), Gaps = 13/140 (9%)
 Frame = +2

Query  365  MEISPY-------------NSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlas  505
            M+ SPY              SL AA SYG+ASMAMVFINKAV+MQY+ SMTLL +QQ+ +
Sbjct  1    MDSSPYLRNLLTNRTHVLNGSLTAAFSYGIASMAMVFINKAVIMQYAHSMTLLAVQQVTT  60

Query  506  tllIYFARVLGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTP  685
             LLI+  RV+GYTKAK  + ETAKRLF VSLFYNANV FALASLKGVNIPMYIAIKRLTP
Sbjct  61   ALLIHLGRVMGYTKAKDLNAETAKRLFPVSLFYNANVGFALASLKGVNIPMYIAIKRLTP  120

Query  686  LAVLVAGFFAGKARPTTQVC  745
            LAVLVAGFF GK RPTTQV 
Sbjct  121  LAVLVAGFFTGKGRPTTQVT  140



>ref|XP_011044974.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Populus euphratica]
Length=322

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E SPY SLVAAVSYG+ASMAMVFINK +LMQY  SMTLLTLQQLA+ LLI+  R +GYT+
Sbjct  8    EASPYKSLVAAVSYGIASMAMVFINKDILMQYGHSMTLLTLQQLATALLIHVGRQMGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            AKG  ++TAK L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGF +GK +
Sbjct  68   AKGVDMQTAKILLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFSSGKGK  127

Query  728  PTTQVC  745
            PTTQV 
Sbjct  128  PTTQVT  133



>ref|XP_011044973.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Populus euphratica]
Length=323

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E SPY SLVAAVSYG+ASMAMVFINK +LMQY  SMTLLTLQQLA+ LLI+  R +GYT+
Sbjct  8    EASPYKSLVAAVSYGIASMAMVFINKDILMQYGHSMTLLTLQQLATALLIHVGRQMGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            AKG  ++TAK L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGF +GK +
Sbjct  68   AKGVDMQTAKILLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFSSGKGK  127

Query  728  PTTQVC  745
            PTTQV 
Sbjct  128  PTTQVT  133



>gb|KFK29748.1| hypothetical protein AALP_AA7G173700 [Arabis alpina]
Length=323

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SLV+AVSYG+ASMAMVFINKAV+MQY  SMTLLTLQQLA++LLI+F R +G
Sbjct  5    AEMEPSSSISLVSAVSYGIASMAMVFINKAVIMQYPHSMTLLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF G
Sbjct  65   YTRAKGIDLTTAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_010914083.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Elaeis 
guineensis]
Length=323

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
             ++E +P+ SL AA SYG+ASMAMVF+NKA+LMQYS SMTLLTLQQLA+TLLIYF RV+G
Sbjct  5    GNVEPTPFLSLFAAFSYGLASMAMVFVNKAILMQYSYSMTLLTLQQLATTLLIYFGRVMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YTKAK F++ TAK+L  VS+FYNANVAFALASLKGVNIPMYIA+KRLTPLAVLVAG F+G
Sbjct  65   YTKAKDFNVATAKKLLPVSVFYNANVAFALASLKGVNIPMYIALKRLTPLAVLVAGSFSG  124

Query  719  KARPTTQVC  745
            KARP TQV 
Sbjct  125  KARPPTQVS  133



>gb|KDO67335.1| hypothetical protein CISIN_1g020772mg [Citrus sinensis]
Length=231

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  353  TMASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARV  532
            T    EISP+  L AA+SYGV+SMAMVFINKAV+MQY+ SMTLLTLQQLA+ LLI   R 
Sbjct  3    TSTDAEISPFLGLFAALSYGVSSMAMVFINKAVIMQYAHSMTLLTLQQLATALLIQAGRQ  62

Query  533  LGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  712
            +GYTK+K   + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF
Sbjct  63   MGYTKSKAIDLMTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  122

Query  713  AGKARPTTQV  742
            +GK +PTTQV
Sbjct  123  SGKGKPTTQV  132



>gb|KHG10574.1| Putative UDP-sugar transporter [Gossypium arboreum]
Length=323

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  374  SPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAK  553
            S + SL AA+SYG+ASMAMVFINKA++MQY+ SMTLLTLQQLA+TLLI+F R +GYT+AK
Sbjct  10   SSFLSLFAALSYGIASMAMVFINKAIIMQYAHSMTLLTLQQLATTLLIHFGRQMGYTRAK  69

Query  554  GFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPT  733
            G  I TA+RL  +SLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF+GK +PT
Sbjct  70   GVDITTARRLLPISLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFSGKGKPT  129

Query  734  TQVC  745
            TQV 
Sbjct  130  TQVT  133



>ref|XP_010049832.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Eucalyptus 
grandis]
 gb|KCW82631.1| hypothetical protein EUGRSUZ_C04017 [Eucalyptus grandis]
Length=323

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            + SP+ S+ AA+SYG+ASMAMVFINKAVLMQYS SMTLLTLQQLA+ LLI+F RV GY K
Sbjct  8    DASPFLSIFAALSYGIASMAMVFINKAVLMQYSNSMTLLTLQQLATALLIHFGRVAGYIK  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+G + ETA++L LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF GK  
Sbjct  68   AQGVNWETARKLLLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFRGKGT  127

Query  728  PTTQV  742
            PT QV
Sbjct  128  PTPQV  132



>ref|XP_002515367.1| UDP-sugar transporter, putative [Ricinus communis]
 gb|EEF46816.1| UDP-sugar transporter, putative [Ricinus communis]
Length=323

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            +  E + + SL +A+SYG+ASMAMVFINKA+LMQYS SMTLLTLQQLA+ LLI+F R +G
Sbjct  5    SDQETTSFLSLFSALSYGIASMAMVFINKAILMQYSHSMTLLTLQQLATALLIHFGRQMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YTKAKG  ++TAK L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAG F+G
Sbjct  65   YTKAKGVDMQTAKSLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGCFSG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_008779598.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Phoenix 
dactylifera]
Length=354

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            +++E SP+ SL AA SYG+ASMAMVF+NKA+LMQYS SMTLLTLQQLA TLLI+F RV+G
Sbjct  5    SNVEPSPFLSLFAAFSYGLASMAMVFVNKAILMQYSYSMTLLTLQQLAMTLLIHFGRVMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YTKAK F++ TAK+L  +S+FYNANVAFALASLKGVNIPMYIA+KRLTPLAVLVAG F+G
Sbjct  65   YTKAKDFNMATAKKLLPISVFYNANVAFALASLKGVNIPMYIALKRLTPLAVLVAGSFSG  124

Query  719  KARPTTQV  742
            KARP TQV
Sbjct  125  KARPPTQV  132



>ref|XP_010432843.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Camelina 
sativa]
Length=323

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SLVAAVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +G
Sbjct  5    AEMEPSSSISLVAAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG   G
Sbjct  65   YTRAKGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGVLFG  124

Query  719  KARPTTQV  742
            K RPTTQV
Sbjct  125  KGRPTTQV  132



>ref|XP_010692995.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Beta 
vulgaris subsp. vulgaris]
Length=323

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVL  535
            +  +E + Y SL AA+SYGV+SMAMVFINKA+LM+YS SMTLLT+QQLA+ LLI+  RV+
Sbjct  4    LPDLEATQYVSLFAALSYGVSSMAMVFINKAILMEYSYSMTLLTVQQLATALLIHIGRVM  63

Query  536  GYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFA  715
            GYT+AK  +++TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF+
Sbjct  64   GYTRAKALNMDTAKKLLWVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFS  123

Query  716  GKARPTTQVC  745
            GK RP+ QV 
Sbjct  124  GKKRPSRQVS  133



>ref|XP_006284104.1| hypothetical protein CARUB_v10005245mg [Capsella rubella]
 gb|EOA17002.1| hypothetical protein CARUB_v10005245mg [Capsella rubella]
Length=323

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SL++AVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +G
Sbjct  5    AEMEPSSSISLISAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGF  G
Sbjct  65   YTRAKGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_009363633.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Pyrus 
x bretschneideri]
 ref|XP_009367982.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Pyrus 
x bretschneideri]
Length=323

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + SL AA+SYG ASMAMVFINKAV+M+YS SMTLLT+QQLA+ LLIY  R LGYT+
Sbjct  8    EASSFLSLSAALSYGAASMAMVFINKAVIMEYSHSMTLLTMQQLATALLIYVGRRLGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            ++G  + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF+GK R
Sbjct  68   SRGLEMSTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFSGKGR  127

Query  728  PTTQVC  745
            P+ QVC
Sbjct  128  PSIQVC  133



>ref|XP_006450206.1| hypothetical protein CICLE_v10008929mg [Citrus clementina]
 ref|XP_006450207.1| hypothetical protein CICLE_v10008929mg [Citrus clementina]
 ref|XP_006483491.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Citrus 
sinensis]
 gb|ESR63446.1| hypothetical protein CICLE_v10008929mg [Citrus clementina]
 gb|ESR63447.1| hypothetical protein CICLE_v10008929mg [Citrus clementina]
 gb|KDO67332.1| hypothetical protein CISIN_1g020772mg [Citrus sinensis]
Length=321

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  353  TMASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARV  532
            T    EISP+  L AA+SYGV+SMAMVFINKAV+MQY+ SMTLLTLQQLA+ LLI   R 
Sbjct  3    TSTDAEISPFLGLFAALSYGVSSMAMVFINKAVIMQYAHSMTLLTLQQLATALLIQAGRQ  62

Query  533  LGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  712
            +GYTK+K   + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF
Sbjct  63   MGYTKSKAIDLMTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  122

Query  713  AGKARPTTQV  742
            +GK +PTTQV
Sbjct  123  SGKGKPTTQV  132



>gb|KEH35961.1| GDP-mannose transporter GONST3 [Medicago truncatula]
Length=250

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  383  NSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFS  562
            +SL+AAVSYG+ASMAMVFINKAVLMQY+ SMTLLTLQQL +TLLI+F R +GYT+A+G  
Sbjct  14   SSLIAAVSYGIASMAMVFINKAVLMQYAHSMTLLTLQQLVTTLLIHFGRKMGYTRARGVD  73

Query  563  IETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            + TAK+L  VS FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG F GK RPTTQV
Sbjct  74   LATAKQLLPVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGCFMGKGRPTTQV  133



>gb|KEH35962.1| GDP-mannose transporter GONST3 [Medicago truncatula]
Length=272

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  383  NSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFS  562
            +SL+AAVSYG+ASMAMVFINKAVLMQY+ SMTLLTLQQL +TLLI+F R +GYT+A+G  
Sbjct  14   SSLIAAVSYGIASMAMVFINKAVLMQYAHSMTLLTLQQLVTTLLIHFGRKMGYTRARGVD  73

Query  563  IETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            + TAK+L  VS FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG F GK RPTTQV
Sbjct  74   LATAKQLLPVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGCFMGKGRPTTQV  133



>ref|XP_002867292.1| hypothetical protein ARALYDRAFT_491578 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43551.1| hypothetical protein ARALYDRAFT_491578 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SLVAAVSYG+ASMAMVFINKAV+MQY  SMTLLTLQQLA++LLI+F R +G
Sbjct  5    AEMEPSSSISLVAAVSYGIASMAMVFINKAVIMQYPHSMTLLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG   G
Sbjct  65   YTRAKGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGVLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_006412577.1| hypothetical protein EUTSA_v10025721mg [Eutrema salsugineum]
 gb|ESQ54030.1| hypothetical protein EUTSA_v10025721mg [Eutrema salsugineum]
Length=323

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SL++AVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +G
Sbjct  5    AEMEPSSSISLISAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+  G
Sbjct  65   YTRAKGIDMATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_004291270.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Fragaria 
vesca subsp. vesca]
Length=324

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  344  QRLTMASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYF  523
            ++LT A    S   SL AA+SYGVASMAMVFINKAVLM+YS SMTLLT+QQLA+ LLI+F
Sbjct  2    EKLTDADAASSSL-SLFAALSYGVASMAMVFINKAVLMEYSHSMTLLTMQQLATALLIHF  60

Query  524  ARVLGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVA  703
             R +GYT+++G  + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+A
Sbjct  61   GRKMGYTRSRGLEMSTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIA  120

Query  704  GFFAGKARPTTQV  742
            GFF+GK +P+TQV
Sbjct  121  GFFSGKGKPSTQV  133



>ref|XP_008393929.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Malus 
domestica]
Length=323

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + SL AA+SYG ASMAMVFINKAV+M+YS SMTLLT+QQLA+ LLIY  R  GYT+
Sbjct  8    EASSFLSLSAALSYGAASMAMVFINKAVIMEYSHSMTLLTMQQLATALLIYVGRRFGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            ++G  + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF+GK R
Sbjct  68   SRGLEMSTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFSGKGR  127

Query  728  PTTQVC  745
            P+ QVC
Sbjct  128  PSIQVC  133



>ref|XP_009403327.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Musa 
acuminata subsp. malaccensis]
Length=325

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  362  SMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGY  541
             +E +P+ SL AA SYG+ASMAMVFINKAVLMQY+ SMTLLTLQQLA+TLLI+F +V+GY
Sbjct  6    DLEPTPFLSLFAAFSYGIASMAMVFINKAVLMQYAYSMTLLTLQQLATTLLIHFGKVMGY  65

Query  542  TKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGK  721
            TKAK  ++ TAK+L  VS+FYNANVAFALASLKGVNIPMYIA+KRLTPLAVLV GFF GK
Sbjct  66   TKAKAVNMPTAKKLLPVSVFYNANVAFALASLKGVNIPMYIALKRLTPLAVLVFGFFRGK  125

Query  722  ARPTTQVC  745
            +RP+TQV 
Sbjct  126  SRPSTQVS  133



>ref|XP_004501225.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501226.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like isoform 
X2 [Cicer arietinum]
Length=323

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A  E S Y+SL AA+SYG+ASMAMVFINKAVLMQY+ SMTLLTLQQL +TLLI+  R +G
Sbjct  5    ADAETSSYSSLFAALSYGIASMAMVFINKAVLMQYAHSMTLLTLQQLVTTLLIHIGRNMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+A+G  + TAK+L  VS FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG F G
Sbjct  65   YTRARGVDMATAKQLLPVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGCFLG  124

Query  719  KARPTTQV  742
            K RP+TQV
Sbjct  125  KGRPSTQV  132



>ref|XP_003603557.1| UDP-sugar transporter sqv-7 [Medicago truncatula]
 gb|AES73808.1| GDP-mannose transporter GONST3 [Medicago truncatula]
 gb|AFK38239.1| unknown [Medicago truncatula]
Length=324

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  383  NSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFS  562
            +SL+AAVSYG+ASMAMVFINKAVLMQY+ SMTLLTLQQL +TLLI+F R +GYT+A+G  
Sbjct  14   SSLIAAVSYGIASMAMVFINKAVLMQYAHSMTLLTLQQLVTTLLIHFGRKMGYTRARGVD  73

Query  563  IETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            + TAK+L  VS FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG F GK RPTTQV
Sbjct  74   LATAKQLLPVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGCFMGKGRPTTQV  133



>ref|NP_567879.1| UDP-galactose transporter 7 [Arabidopsis thaliana]
 gb|AAK68758.1| putative protein [Arabidopsis thaliana]
 gb|AAL47342.1| putative protein [Arabidopsis thaliana]
 gb|AEE85934.1| UDP-galactose transporter 7 [Arabidopsis thaliana]
Length=323

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME +   SLVAAVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +G
Sbjct  5    AEMEPTSSISLVAAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL++G   G
Sbjct  65   YTRAKGIDMATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLISGVLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_010447521.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Camelina 
sativa]
Length=323

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SLV+AVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +G
Sbjct  5    AEMEPSSSISLVSAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL++G   G
Sbjct  65   YTRAKGIDLATAKKLLPVSVFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLISGVLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|NP_001031765.1| UDP-galactose transporter 7 [Arabidopsis thaliana]
 gb|AEE85935.1| UDP-galactose transporter 7 [Arabidopsis thaliana]
Length=308

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME +   SLVAAVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +G
Sbjct  5    AEMEPTSSISLVAAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL++G   G
Sbjct  65   YTRAKGIDMATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLISGVLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_007011628.1| UDP-N-acetylglucosamine (UAA) transporter family isoform 1 [Theobroma 
cacao]
 ref|XP_007011629.1| UDP-N-acetylglucosamine (UAA) transporter family isoform 1 [Theobroma 
cacao]
 gb|EOY29247.1| UDP-N-acetylglucosamine (UAA) transporter family isoform 1 [Theobroma 
cacao]
 gb|EOY29248.1| UDP-N-acetylglucosamine (UAA) transporter family isoform 1 [Theobroma 
cacao]
Length=323

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            YG+ASMAMVFINKA+LMQY+ SMTLLT+QQLA+ LLI+F R +GY+KAKG  I TAKRL 
Sbjct  21   YGIASMAMVFINKAILMQYAHSMTLLTVQQLATALLIHFGRQVGYSKAKGIDITTAKRLL  80

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
             +SLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF+GK +PTTQV 
Sbjct  81   PISLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFSGKGKPTTQVT  133



>ref|NP_001241044.1| uncharacterized protein LOC100777622 [Glycine max]
 gb|ACU19660.1| unknown [Glycine max]
 gb|KHN18234.1| Putative UDP-sugar transporter [Glycine soja]
Length=323

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A  + S ++SL AAVSYG  SMAMVFINKAVLMQY+ SMTLLTLQQL +TLLI+F R  G
Sbjct  5    ADADTSSFSSLFAAVSYGFTSMAMVFINKAVLMQYAYSMTLLTLQQLVTTLLIHFGRKTG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YTKA+   + TAKRL  +S+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAG F+G
Sbjct  65   YTKARELDMTTAKRLLPLSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGCFSG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>gb|EPS72338.1| hypothetical protein M569_02420, partial [Genlisea aurea]
Length=307

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSI  565
            SL+AAV+YG+ASMAMVFINKAVLMQY QSMTLLTLQQL +TLLI   R  GY ++K F++
Sbjct  1    SLIAAVTYGIASMAMVFINKAVLMQYPQSMTLLTLQQLMTTLLIRLGRSTGYVRSKDFNL  60

Query  566  ETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
             TAK+L +VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GFF GK RP+TQV
Sbjct  61   NTAKKLVVVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFFTGKGRPSTQV  119



>ref|XP_010112122.1| Putative UDP-sugar transporter [Morus notabilis]
 gb|EXC32747.1| Putative UDP-sugar transporter [Morus notabilis]
Length=323

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + SL AA+SYG+ASMAMVFINKA+LMQYS SMTLLTLQQLA+  LI+F R  GYTK
Sbjct  8    EASSFVSLFAALSYGIASMAMVFINKAILMQYSHSMTLLTLQQLATAALIHFCRRSGYTK  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            A+G  + TAK+L  VSLFYNANVAFALASLKGV IPMYIAIKRLTPLAVL+AG F+GK R
Sbjct  68   ARGLDMTTAKKLLPVSLFYNANVAFALASLKGVKIPMYIAIKRLTPLAVLIAGCFSGKGR  127

Query  728  PTTQV  742
            PT QV
Sbjct  128  PTAQV  132



>ref|XP_006845526.1| hypothetical protein AMTR_s00019p00170070 [Amborella trichopoda]
 gb|ERN07201.1| hypothetical protein AMTR_s00019p00170070 [Amborella trichopoda]
Length=331

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSI  565
            SL+AA+SYGVASMAMVFINKAVLM+Y+ SMTLLTLQQ  +TLLI+F RV G+ +AK  ++
Sbjct  22   SLIAALSYGVASMAMVFINKAVLMEYTYSMTLLTLQQFGTTLLIHFGRVFGFIQAKDVNL  81

Query  566  ETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
             TAK+L  +SLFYNANVAFALASLKGVNIPMYIA+KRLTPLAVLVAGFF+GK RP TQV 
Sbjct  82   RTAKKLLPISLFYNANVAFALASLKGVNIPMYIALKRLTPLAVLVAGFFSGKGRPATQVS  141

Query  746  TWTSSFLTG  772
               S  LTG
Sbjct  142  --LSVILTG  148



>ref|XP_009108919.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Brassica rapa]
 emb|CDY65657.1| BnaA08g30690D [Brassica napus]
Length=323

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  362  SMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGY  541
             ME +   SL+AAVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+  R +GY
Sbjct  6    EMEPTSSISLIAAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHCGRRMGY  65

Query  542  TKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGK  721
            T+A+G  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+  GK
Sbjct  66   TRARGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYLFGK  125

Query  722  ARPTTQV  742
             +PTTQV
Sbjct  126  GKPTTQV  132



>ref|XP_009108920.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Brassica rapa]
Length=309

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  362  SMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGY  541
             ME +   SL+AAVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LLI+  R +GY
Sbjct  6    EMEPTSSISLIAAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLIHCGRRMGY  65

Query  542  TKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGK  721
            T+A+G  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+  GK
Sbjct  66   TRARGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYLFGK  125

Query  722  ARPTTQV  742
             +PTTQV
Sbjct  126  GKPTTQV  132



>gb|KDP33466.1| hypothetical protein JCGZ_07037 [Jatropha curcas]
Length=321

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            YG+ASMAMVFINKA+L+QYS SMTLLTLQQLA+ LLI+F R +G+TKAK   ++TAKRL 
Sbjct  21   YGIASMAMVFINKAILLQYSHSMTLLTLQQLATALLIHFGRQMGFTKAKELDMQTAKRLL  80

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
             VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGFF+GK RPTTQV 
Sbjct  81   PVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFFSGKGRPTTQVA  133



>ref|XP_010438019.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X3 [Camelina sativa]
Length=313

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  383  NSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFS  562
            +SLV+AVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LL++F R +GYT+AKG  
Sbjct  3    SSLVSAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLLHFGRRMGYTRAKGID  62

Query  563  IETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG   GK +PTTQV
Sbjct  63   LATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGVLFGKGKPTTQV  122



>ref|XP_010438017.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Camelina sativa]
Length=343

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  383  NSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFS  562
            +SLV+AVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LL++F R +GYT+AKG  
Sbjct  33   SSLVSAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLLHFGRRMGYTRAKGID  92

Query  563  IETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG   GK +PTTQV
Sbjct  93   LATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGVLFGKGKPTTQV  152



>ref|XP_007137131.1| hypothetical protein PHAVU_009G102300g [Phaseolus vulgaris]
 gb|ESW09125.1| hypothetical protein PHAVU_009G102300g [Phaseolus vulgaris]
Length=323

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A  E S  +SL+AAV+YG ASM MVFINKAVLMQY+ SMTLLT QQLA++LLI+  R +G
Sbjct  5    ADAETSSLSSLLAAVAYGFASMLMVFINKAVLMQYAYSMTLLTFQQLATSLLIHVGRNMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YTKA+   + TAKRL  +S+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+F+G
Sbjct  65   YTKARELDMATAKRLLPLSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYFSG  124

Query  719  KARPTTQVC  745
            K RPT QV 
Sbjct  125  KGRPTAQVA  133



>ref|XP_008219958.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Prunus 
mume]
 ref|XP_008219959.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Prunus 
mume]
 ref|XP_008219960.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Prunus 
mume]
 ref|XP_008219961.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Prunus 
mume]
Length=323

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E+S   SL AA+SYG ASMAMVFINKAVLM+YS SMTLLT QQLA+ LLI+  R LGYT+
Sbjct  8    EVSSILSLSAALSYGAASMAMVFINKAVLMEYSHSMTLLTAQQLATALLIHVGRRLGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            ++G  + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGF +GK +
Sbjct  68   SRGLEMSTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFVSGKGK  127

Query  728  PTTQVC  745
            PT QV 
Sbjct  128  PTIQVS  133



>ref|XP_007224372.1| hypothetical protein PRUPE_ppa021028mg [Prunus persica]
 gb|EMJ25571.1| hypothetical protein PRUPE_ppa021028mg [Prunus persica]
Length=323

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E+S   SL AA+SYG ASMAMVFINKAVLM+YS SMTLLT+QQLA+ LLI+  R LGYT+
Sbjct  8    EVSSILSLSAALSYGAASMAMVFINKAVLMEYSHSMTLLTVQQLATALLIHVGRRLGYTR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
            ++G  + TAK+L  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AGF +GK +
Sbjct  68   SRGLEMSTAKKLLPVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGFVSGKGK  127

Query  728  PTTQVC  745
            PT QV 
Sbjct  128  PTIQVS  133



>emb|CDY57885.1| BnaC03g77290D [Brassica napus]
Length=323

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  362  SMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGY  541
             ME +   SL+AAVSYG+ SMAMVFINKAV+MQY  SMT+LTLQQLA++L I+  R +GY
Sbjct  6    EMEPTSSISLIAAVSYGIVSMAMVFINKAVIMQYPHSMTVLTLQQLATSLFIHCGRRMGY  65

Query  542  TKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGK  721
            T+A+G  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+  GK
Sbjct  66   TRARGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYLFGK  125

Query  722  ARPTTQV  742
             +PTTQV
Sbjct  126  GKPTTQV  132



>ref|XP_009770581.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Nicotiana sylvestris]
Length=295

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  422  MAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLF  601
            MAMVFINKAV+MQY+ SMTLLT+QQLA+ LLI+F RV+GYT+A+G + ETAK+LF VSLF
Sbjct  1    MAMVFINKAVIMQYAHSMTLLTVQQLATALLIHFGRVMGYTRARGLNAETAKKLFPVSLF  60

Query  602  YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
            YNANV FALASLKGVNIPMYIAIKRLTPLAVLVAGFF GKA+PTTQV 
Sbjct  61   YNANVGFALASLKGVNIPMYIAIKRLTPLAVLVAGFFTGKAKPTTQVT  108



>ref|XP_008346553.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Malus domestica]
 ref|XP_008346554.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Malus domestica]
 ref|XP_008364520.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Malus 
domestica]
Length=325

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            YG ASMAMVFINKAV+M+YS SMTLLT+QQLA+ LLI+  R LGYT+++G  + TAK+L 
Sbjct  23   YGAASMAMVFINKAVIMEYSHSMTLLTMQQLATALLIHVGRXLGYTRSRGLEMSTAKKLL  82

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
             VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF+GK RP  QVC
Sbjct  83   PVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFSGKGRPPIQVC  135



>emb|CAN81588.1| hypothetical protein VITISV_041431 [Vitis vinifera]
Length=296

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  428  MVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLFYN  607
            MVFINKAVLMQYS SMTLLT+QQLA+ LLI+F RV+GYT+A+G ++ +AKRLFLVSLFYN
Sbjct  1    MVFINKAVLMQYSSSMTLLTVQQLATALLIHFGRVMGYTRARGINMASAKRLFLVSLFYN  60

Query  608  ANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
            ANVAFALASLKGVNIPMYIAIKRLTPLAVL+ GFF+GK RP+TQV 
Sbjct  61   ANVAFALASLKGVNIPMYIAIKRLTPLAVLIXGFFSGKGRPSTQVS  106



>ref|XP_002437988.1| hypothetical protein SORBIDRAFT_10g005990 [Sorghum bicolor]
 gb|EER89355.1| hypothetical protein SORBIDRAFT_10g005990 [Sorghum bicolor]
Length=323

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 112/152 (74%), Gaps = 15/152 (10%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S   SL AA SYGVASMAMVF+NKAVLMQY  SMTLLTLQQ+A+ LLI+F +VLG +K
Sbjct  7    EPSSILSLAAAFSYGVASMAMVFVNKAVLMQYVHSMTLLTLQQIATALLIHFGQVLGMSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FS+ TAK+L  VS+FYNANV FALASLKGVNIPMYIAIKR+TPLAVLVAG   GK +
Sbjct  67   RKDFSLVTAKKLLPVSIFYNANVGFALASLKGVNIPMYIAIKRITPLAVLVAGCMRGKGK  126

Query  728  PTTQV-----CTWTS---------SF-LTGYC  778
            P TQV     CT T          SF L GYC
Sbjct  127  PPTQVILSVICTATGVLIAALGDFSFDLYGYC  158



>ref|XP_006655866.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Oryza 
brachyantha]
Length=323

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + SL AA SYG+ASMAMVF+NKA+LMQY+ SMTLLTLQQ+A+ + I+F ++LG +K
Sbjct  7    EPSSFLSLSAAFSYGIASMAMVFVNKAILMQYAHSMTLLTLQQIATAIFIHFGQILGMSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FSI T ++L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAG   GK +
Sbjct  67   RKDFSIATGRKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGCLRGKGK  126

Query  728  PTTQV  742
            P TQV
Sbjct  127  PPTQV  131



>gb|ACF87479.1| unknown [Zea mays]
 gb|AFW85520.1| hypothetical protein ZEAMMB73_164508 [Zea mays]
 gb|AFW85521.1| hypothetical protein ZEAMMB73_164508 [Zea mays]
 gb|AFW85522.1| hypothetical protein ZEAMMB73_164508 [Zea mays]
Length=196

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 111/152 (73%), Gaps = 15/152 (10%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S   SL +A SYGVASMAMVF+NKAVLMQY  SMTLLTLQQ+A+ LLI+F +VLG +K
Sbjct  7    EPSSILSLASAFSYGVASMAMVFVNKAVLMQYVHSMTLLTLQQIATALLIHFGQVLGMSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FS  TAK+L  VS+FYNANV FALASLKGVNIPMYIAIKR+TPLAVLVAG   GK +
Sbjct  67   RKDFSWITAKKLLPVSIFYNANVGFALASLKGVNIPMYIAIKRITPLAVLVAGCMRGKGK  126

Query  728  PTTQV-----CTWTS---------SF-LTGYC  778
            P TQV     CT T          SF L GYC
Sbjct  127  PPTQVILSVICTATGVLIAALGDFSFDLYGYC  158



>ref|XP_004964633.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631-like [Setaria 
italica]
Length=324

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S   SL AAVSYGVASMAMVF+NKAVLMQY  SMTLLTLQQ+A+ LLI+F +VLG ++
Sbjct  8    EPSSILSLAAAVSYGVASMAMVFVNKAVLMQYVHSMTLLTLQQIATALLIHFGQVLGMSR  67

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FS+ TAK+L  +S+FYNANV FALASLKGVNIPMYIAIKR+TPLAVLV+G   GK +
Sbjct  68   RKDFSLITAKKLLPISIFYNANVGFALASLKGVNIPMYIAIKRITPLAVLVSGCVRGKGK  127

Query  728  PTTQV  742
            P TQV
Sbjct  128  PPTQV  132



>ref|XP_010438018.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Camelina sativa]
Length=323

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  359  ASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLG  538
            A ME S   SLV+AVSYG+ASMAMVFINKAV+MQY  SMT+LTLQQLA++LL++F R +G
Sbjct  5    AEMEPSSSVSLVSAVSYGIASMAMVFINKAVIMQYPHSMTVLTLQQLATSLLLHFGRRMG  64

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
            YT+AKG  + TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG   G
Sbjct  65   YTRAKGIDLATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGVLFG  124

Query  719  KARPTTQV  742
            K +PTTQV
Sbjct  125  KGKPTTQV  132



>ref|XP_003564172.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X1 [Brachypodium distachyon]
Length=323

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + S  +A SYGVASMAMVF+NKAV+MQY  SMTLLTLQQLA+ L+I F++VLG +K
Sbjct  7    ETSSFLSFTSAFSYGVASMAMVFVNKAVVMQYVHSMTLLTLQQLATGLIIQFSQVLGLSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K  S+ TAK+L  +S+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GF  GK +
Sbjct  67   RKDLSMATAKKLLPLSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFLRGKGK  126

Query  728  PTTQV  742
            P TQV
Sbjct  127  PPTQV  131



>ref|NP_001057020.1| Os06g0188100 [Oryza sativa Japonica Group]
 dbj|BAD36524.1| putative UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter 
[Oryza sativa Japonica Group]
 dbj|BAD72465.1| putative UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter 
[Oryza sativa Japonica Group]
 dbj|BAF18934.1| Os06g0188100 [Oryza sativa Japonica Group]
 gb|EAY99959.1| hypothetical protein OsI_21963 [Oryza sativa Indica Group]
 gb|EAZ36085.1| hypothetical protein OsJ_20396 [Oryza sativa Japonica Group]
 dbj|BAG91314.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93935.1| unnamed protein product [Oryza sativa Japonica Group]
Length=323

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S + SL AA SYG+ASMAMVF+NKA+LMQY+ SMTLLTLQQ+A+ L+I+F ++LG +K
Sbjct  7    EPSSFLSLSAAFSYGIASMAMVFVNKAILMQYAHSMTLLTLQQIATALIIHFGQILGVSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FS+ T ++L  +S+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAG   GK +
Sbjct  67   RKDFSMATGRKLLPLSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGCLRGKGK  126

Query  728  PTTQV  742
            P TQV
Sbjct  127  PPTQV  131



>ref|XP_008346555.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Malus domestica]
Length=288

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            YG ASMAMVFINKAV+M+YS SMTLLT+QQLA+ LLI+  R LGYT+++G  + TAK+L 
Sbjct  23   YGAASMAMVFINKAVIMEYSHSMTLLTMQQLATALLIHVGRXLGYTRSRGLEMSTAKKLL  82

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQ  739
             VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF+GK RP  Q
Sbjct  83   PVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFSGKGRPPIQ  133



>ref|NP_001140325.1| hypothetical protein [Zea mays]
 gb|ACF83591.1| unknown [Zea mays]
 gb|AFW85519.1| hypothetical protein ZEAMMB73_164508 [Zea mays]
Length=285

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 111/152 (73%), Gaps = 15/152 (10%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S   SL +A SYGVASMAMVF+NKAVLMQY  SMTLLTLQQ+A+ LLI+F +VLG +K
Sbjct  7    EPSSILSLASAFSYGVASMAMVFVNKAVLMQYVHSMTLLTLQQIATALLIHFGQVLGMSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FS  TAK+L  VS+FYNANV FALASLKGVNIPMYIAIKR+TPLAVLVAG   GK +
Sbjct  67   RKDFSWITAKKLLPVSIFYNANVGFALASLKGVNIPMYIAIKRITPLAVLVAGCMRGKGK  126

Query  728  PTTQV-----CTWTS---------SF-LTGYC  778
            P TQV     CT T          SF L GYC
Sbjct  127  PPTQVILSVICTATGVLIAALGDFSFDLYGYC  158



>gb|EMT27185.1| hypothetical protein F775_18741 [Aegilops tauschii]
Length=408

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  371  ISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKA  550
            +S    L +A SYGVASMAMVF+NKAV+MQY  SMTLLTLQQLA+ L I+F +VLG +K 
Sbjct  93   VSWAGGLSSAFSYGVASMAMVFVNKAVIMQYVHSMTLLTLQQLATALFIHFGQVLGMSKR  152

Query  551  KGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARP  730
            K  SI TAK+L  VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GF  GK +P
Sbjct  153  KDLSIATAKKLLPVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFLRGKGKP  212

Query  731  TTQV  742
            +TQV
Sbjct  213  STQV  216



>ref|XP_010268354.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Nelumbo nucifera]
Length=291

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  422  MAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLF  601
            M+MVFINKA+LMQY  SMTLL LQQL ++LLI+F RV+GYTK+KGF   TAK+LF VS F
Sbjct  1    MSMVFINKAILMQYGHSMTLLILQQLVTSLLIHFGRVMGYTKSKGFDTMTAKKLFPVSFF  60

Query  602  YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            YNANVAFALASLKGVNIPMYIA+KRLTPL VLVAGFF+GK RP+ QV
Sbjct  61   YNANVAFALASLKGVNIPMYIALKRLTPLGVLVAGFFSGKGRPSIQV  107



>ref|XP_008658221.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG42685.1| UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter [Zea 
mays]
 gb|AFW85518.1| UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter [Zea 
mays]
Length=323

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 111/152 (73%), Gaps = 15/152 (10%)
 Frame = +2

Query  368  EISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTK  547
            E S   SL +A SYGVASMAMVF+NKAVLMQY  SMTLLTLQQ+A+ LLI+F +VLG +K
Sbjct  7    EPSSILSLASAFSYGVASMAMVFVNKAVLMQYVHSMTLLTLQQIATALLIHFGQVLGMSK  66

Query  548  AKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKAR  727
             K FS  TAK+L  VS+FYNANV FALASLKGVNIPMYIAIKR+TPLAVLVAG   GK +
Sbjct  67   RKDFSWITAKKLLPVSIFYNANVGFALASLKGVNIPMYIAIKRITPLAVLVAGCMRGKGK  126

Query  728  PTTQV-----CTWTS---------SF-LTGYC  778
            P TQV     CT T          SF L GYC
Sbjct  127  PPTQVILSVICTATGVLIAALGDFSFDLYGYC  158



>dbj|BAJ97855.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=323

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            YGVASMAMVF+NKAV+MQY  SMTLLTLQQLA+ L I+F +VLG +K K  S+ TAK+LF
Sbjct  20   YGVASMAMVFVNKAVVMQYVHSMTLLTLQQLATALFIHFGQVLGMSKRKDLSMATAKKLF  79

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
             VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GF  GK +P TQV
Sbjct  80   PVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFLRGKGKPPTQV  131



>dbj|BAJ89468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=323

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            YGVASMAMVF+NKAV+MQY  SMTLLTLQQLA+ L I+F +VLG +K K  S+ TAK+LF
Sbjct  20   YGVASMAMVFVNKAVVMQYVHSMTLLTLQQLATALFIHFGQVLGMSKRKDLSMATAKKLF  79

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
             VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GF  GK +P TQV
Sbjct  80   PVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFLRGKGKPPTQV  131



>ref|XP_010227926.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Brachypodium distachyon]
Length=318

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  395  AAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETA  574
            +A SYGVASMAMVF+NKAV+MQY  SMTLLTLQQLA+ L+I F++VLG +K K  S+ TA
Sbjct  11   SAFSYGVASMAMVFVNKAVVMQYVHSMTLLTLQQLATGLIIQFSQVLGLSKRKDLSMATA  70

Query  575  KRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            K+L  +S+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GF  GK +P TQV
Sbjct  71   KKLLPLSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFLRGKGKPPTQV  126



>gb|KDO67333.1| hypothetical protein CISIN_1g020772mg [Citrus sinensis]
 gb|KDO67334.1| hypothetical protein CISIN_1g020772mg [Citrus sinensis]
Length=296

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  422  MAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLF  601
            MAMVFINKAV+MQY+ SMTLLTLQQLA+ LLI   R +GYTK+K   + TAK+L  VSLF
Sbjct  1    MAMVFINKAVIMQYAHSMTLLTLQQLATALLIQAGRQMGYTKSKAIDLMTAKKLLPVSLF  60

Query  602  YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF+GK +PTTQV
Sbjct  61   YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFSGKGKPTTQV  107



>ref|XP_009130089.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-sugar transporter 
DDB_G0278631 [Brassica rapa]
Length=346

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  407  YGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLF  586
            Y +ASMAMVFI+KAV++QY  SMTLLTLQQLA++LLI+  R +GYT+++G  + TAK+L 
Sbjct  24   YAIASMAMVFIDKAVIIQYPHSMTLLTLQQLATSLLIHRGRRMGYTRSRGIDLSTAKKLL  83

Query  587  LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
             VS+FYNANVAFALASLKGVNIPMYIAIKRLTPLAVL+AG+  GK +PTTQV
Sbjct  84   PVSIFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLIAGYLFGKGKPTTQV  135



>gb|EMS45587.1| hypothetical protein TRIUR3_12824 [Triticum urartu]
Length=299

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +2

Query  422  MAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLF  601
            MAMVF+NKAV+MQY  SMTLLTLQQLA+ L I+F +VLG +K K  S+ TAK+L  VS+F
Sbjct  1    MAMVFVNKAVIMQYVHSMTLLTLQQLATALFIHFGQVLGMSKRKDLSMATAKKLLPVSIF  60

Query  602  YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            YNANVAFALASLKGVNIPMYIAIKRLTPLAVLV+GF  GK +P+TQV
Sbjct  61   YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVSGFLRGKGKPSTQV  107



>emb|CAA19763.1| putative protein [Arabidopsis thaliana]
 emb|CAB79878.1| putative protein [Arabidopsis thaliana]
Length=296

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  428  MVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLFYN  607
            MVFINKAV+MQY  SMT+LTLQQLA++LLI+F R +GYT+AKG  + TAK+L  VS+FYN
Sbjct  1    MVFINKAVIMQYPHSMTVLTLQQLATSLLIHFGRRMGYTRAKGIDMATAKKLLPVSIFYN  60

Query  608  ANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            ANVAFALASLKGVNIPMYIAIKRLTPLAVL++G   GK +PTTQV
Sbjct  61   ANVAFALASLKGVNIPMYIAIKRLTPLAVLISGVLFGKGKPTTQV  105



>ref|XP_002982976.1| hypothetical protein SELMODRAFT_179881 [Selaginella moellendorffii]
 gb|EFJ15785.1| hypothetical protein SELMODRAFT_179881 [Selaginella moellendorffii]
Length=345

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSI  565
            SL+AAVSYG AS+AMVF+NKAVLM+Y  SM+LLTLQQ+A+ LL++     G ++   FS+
Sbjct  32   SLIAAVSYGFASLAMVFLNKAVLMEYPYSMSLLTLQQVATVLLLHLGGSFGISQTPQFSL  91

Query  566  ETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
            + A++L  +S FYNANVAFALASL+GVNIPMYIA+KRLTPLAVLV   F GK +P TQV 
Sbjct  92   KIARKLLPLSFFYNANVAFALASLQGVNIPMYIALKRLTPLAVLVTDIFTGKGKPATQVA  151



>ref|XP_011082037.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X2 [Sesamum indicum]
Length=262

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +2

Query  533  LGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  712
            +GYTKA+GF++ TAK+L LVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF
Sbjct  1    MGYTKARGFNMATAKKLLLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  60

Query  713  AGKARPTTQVC  745
             GK RPTTQV 
Sbjct  61   TGKGRPTTQVT  71



>ref|XP_011078127.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 isoform 
X4 [Sesamum indicum]
Length=261

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +2

Query  533  LGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  712
            +GYTKA+GF +E AK+L LVS FYNANVAFALASLKGVNIPMYIAIKRLTPL VL+AGFF
Sbjct  1    MGYTKARGFDVEAAKKLLLVSFFYNANVAFALASLKGVNIPMYIAIKRLTPLTVLIAGFF  60

Query  713  AGKARPTTQVC  745
             GK RPTTQV 
Sbjct  61   FGKGRPTTQVS  71



>ref|XP_002965499.1| hypothetical protein SELMODRAFT_84207 [Selaginella moellendorffii]
 gb|EFJ32919.1| hypothetical protein SELMODRAFT_84207 [Selaginella moellendorffii]
Length=300

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  428  MVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLFYN  607
            MVF+NKAVLM+Y  SM+LLTLQQ+A+ LL++     G +++  FS++ A++L  +S FYN
Sbjct  1    MVFLNKAVLMEYPYSMSLLTLQQVATVLLLHLGGSFGISQSPQFSLKIARKLLPLSFFYN  60

Query  608  ANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVC  745
            ANVAFALASL+GVNIPMYIA+KRLTPLAVLV   F GK +P TQV 
Sbjct  61   ANVAFALASLQGVNIPMYIALKRLTPLAVLVTDIFTGKGKPATQVA  106



>ref|XP_008659941.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Zea mays]
 ref|XP_008659942.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Zea mays]
 ref|XP_008659943.1| PREDICTED: putative UDP-sugar transporter DDB_G0278631 [Zea mays]
Length=282

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  590  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
            +S+FYNANV FALASLKGVNIPMYIAIKR+TPLAVLVAG   GK +P TQV
Sbjct  40   MSIFYNANVGFALASLKGVNIPMYIAIKRITPLAVLVAGCMRGKGKPPTQV  90



>ref|XP_001762906.1| predicted protein [Physcomitrella patens]
 gb|EDQ72407.1| predicted protein [Physcomitrella patens]
Length=296

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = +2

Query  395  AAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIETA  574
            +A +YG+  + M F+NKAVL+Q+    + L LQ +AS +++Y  +  G T  +   ++ A
Sbjct  5    SATAYGLIGLLMGFVNKAVLLQWPYPNSFLALQMVASIVIVYAFKAWGLTTVQPLHVKAA  64

Query  575  KRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQVCTWT  754
            K L  V  FYN NV FALA+++ ++IP+Y  +KRLTP+ VLV   F G A P+ Q+   T
Sbjct  65   KALLPVVFFYNTNVGFALAAVRALSIPVYHVLKRLTPVMVLVGKSFMGGAIPSKQI---T  121

Query  755  SSFLTGYCSC  784
             S LT    C
Sbjct  122  LSVLTVVSGC  131



>ref|XP_001691747.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04855.1| predicted protein [Chlamydomonas reinhardtii]
Length=203

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 73/126 (58%), Gaps = 6/126 (5%)
 Frame = +2

Query  374  SPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIY---FARVLGYT  544
            +P+  + +AV YG  +++M F+NKA +        ++  Q +A+ LL++    A +LG+ 
Sbjct  35   TPFLGIGSAVLYGCTAVSMNFVNKASMQMLPLPNVVMVGQMVATFLLLHPMLEAGMLGFP  94

Query  545  KAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKA  724
            K   FS  T +RLF +++ Y ANV FAL  LK +NIPMY  +KRLTP+ VL       K 
Sbjct  95   K---FSWRTCRRLFWITVLYTANVGFALFGLKTLNIPMYNVLKRLTPMMVLTVKSIIRKR  151

Query  725  RPTTQV  742
             P  ++
Sbjct  152  WPRLEI  157



>ref|XP_001784945.1| predicted protein [Physcomitrella patens]
 gb|EDQ50253.1| predicted protein [Physcomitrella patens]
Length=309

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 63/109 (58%), Gaps = 0/109 (0%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSI  565
            S+ +A +YG+  + M F NKAVL  +    + LTLQ   S +++   +V G T  +   +
Sbjct  2    SIASACAYGLIGLLMGFFNKAVLEDWPYPNSFLTLQMAVSIVIVNVMQVSGLTTVQPLQL  61

Query  566  ETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  712
               K L  V  FYN NVAFAL +++ ++IP+Y  +KRLTP+ VL   F 
Sbjct  62   NAVKNLLPVVFFYNTNVAFALVAVRALSIPVYHVLKRLTPVMVLAGKFL  110



>ref|XP_002955833.1| hypothetical protein VOLCADRAFT_66339 [Volvox carteri f. nagariensis]
 gb|EFJ43034.1| hypothetical protein VOLCADRAFT_66339 [Volvox carteri f. nagariensis]
Length=324

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  533  LGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF  712
            LGY     FS +T KRLF +++ Y ANV FAL  LK +NIPMY  +KRLTP+ +L+    
Sbjct  36   LGYLGFPRFSWQTCKRLFWITVLYTANVGFALFGLKTLNIPMYNVLKRLTPMIILIVKAI  95

Query  713  AGKARPTTQV  742
              K  P  ++
Sbjct  96   YKKRWPRLEI  105



>ref|XP_001758197.1| predicted protein [Physcomitrella patens]
 gb|EDQ77019.1| predicted protein [Physcomitrella patens]
Length=315

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 0/120 (0%)
 Frame = +2

Query  380  YNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGF  559
            + S+ +A +Y +  + + F NKAVL  +    + LT+Q   +  ++Y  +  G    K  
Sbjct  1    WASVASACAYALVGLLVGFFNKAVLQGWPYPNSFLTMQIAVTIAVVYSMQAWGLITVKPL  60

Query  560  SIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQ  739
                 K L  V  FYN+NVAFAL ++  ++IP+Y  +KRLTP+ VL + +      P+T+
Sbjct  61   QRNAIKNLLPVVFFYNSNVAFALVAVNALSIPVYHVLKRLTPVMVLASRYLIWGHSPSTE  120



>emb|CBY32423.1| unnamed protein product [Oikopleura dioica]
Length=317

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 2/125 (2%)
 Frame = +2

Query  365  MEISPYNSLVAAVSYGVASMAMVFINKAVL--MQYsqsmtlltlqqlastllIYFARVLG  538
            M      SL AA+ YG+ S +M F+NK VL    +     L+  Q +  ++ I   + LG
Sbjct  3    MNDQTRRSLYAAIFYGICSGSMNFLNKLVLSSWHFPSPNFLMLAQMIVLSVGIDTLKALG  62

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
              KA  ++    +   ++S F+  N   AL +L G+NIPMY A++R  P+A L+ G    
Sbjct  63   KCKAVDYTWAHGRSCMVLSFFFAINTVIALFALNGMNIPMYNAMRRCVPIANLLLGVLFL  122

Query  719  KARPT  733
            + RPT
Sbjct  123  RIRPT  127



>emb|CBY09669.1| unnamed protein product [Oikopleura dioica]
Length=317

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 2/125 (2%)
 Frame = +2

Query  365  MEISPYNSLVAAVSYGVASMAMVFINKAVL--MQYsqsmtlltlqqlastllIYFARVLG  538
            M      SL AA+ YG+ S +M F+NK VL    +     L+  Q +  ++ I   + LG
Sbjct  3    MNDQTRRSLYAAIFYGICSGSMNFLNKLVLSSWHFPSPNFLMLAQMIVLSVGIDTLKALG  62

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
              KA  ++    +   ++S F+  N   AL +L G+NIPMY A++R  P+A L+ G    
Sbjct  63   KCKAVDYTWAHGRSCMVLSFFFAINTVIALFALNGMNIPMYNAMRRCVPIANLLLGVLFL  122

Query  719  KARPT  733
            + RPT
Sbjct  123  RIRPT  127



>ref|XP_002499609.1| Drug/Metabolite transporter superfamily [Micromonas sp. RCC299]
 gb|ACO60867.1| Drug/Metabolite transporter superfamily [Micromonas sp. RCC299]
Length=305

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (60%), Gaps = 3/104 (3%)
 Frame = +2

Query  428  MVFINKAVLMQYsqsmt--lltlqqlastllIYFARVLGYTKAKGFSIETAKRLFLVSLF  601
            M FINKAV+  Y    +  LL  Q   +  +++F R  G  +    S+  AK+L  V++ 
Sbjct  1    MGFINKAVMSVYGLEESNFLLLCQMAVTVAVLFFLRGAGRVQFAPISLAQAKKLLPVAIL  60

Query  602  YNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPT  733
            YNANVAFALASL  V++P Y  +KRLTP AV++A   A + RP 
Sbjct  61   YNANVAFALASLAKVSVPTYNTLKRLTP-AVVLAANKALRLRPD  103



>ref|XP_643057.1| hypothetical protein DDB_G0276625 [Dictyostelium discoideum AX4]
 gb|EAL69125.1| hypothetical protein DDB_G0276625 [Dictyostelium discoideum AX4]
Length=314

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 3/118 (3%)
 Frame = +2

Query  398  AVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFA--RVLGYTKAKGFSIET  571
            AV+YGV S+++ F NKAVL  Y  + +           L +    +  GY     F+++ 
Sbjct  17   AVAYGVTSVSITFFNKAVLNYYGFNFSNSLTLGQMIFSLFFLVTMKTFGYISYPDFNLDL  76

Query  572  AKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVA-GFFAGKARPTTQV  742
             K+L  +SL +   V   LA+L   N+P++ A++RL+ L V+V  GF  GK  PT +V
Sbjct  77   CKKLASLSLLFILMVISGLAALAKTNVPLFSALRRLSTLIVIVGEGFLLGKVTPTDEV  134



>ref|XP_006815022.1| PREDICTED: solute carrier family 35 member D3-like [Saccoglossus 
kowalevskii]
Length=206

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqsmt--lltlqqlastllIYFARVLGYTKAKGF  559
            S+ AAV YG+ S +M FINK V+  Y       ++  Q + +  L+   R  G      +
Sbjct  46   SVAAAVFYGICSGSMPFINKIVVTTYDFRHPNFIMLGQMIFTASLLEMLRKYGIVDVPPY  105

Query  560  SIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLV-AGFFAGKARPT-  733
            SI   K + + S+ Y  +  FAL++L  +NIPMY  IKR  PL  L+ A     K RP+ 
Sbjct  106  SIALGKDVLIASVCYTFHSVFALSALGDMNIPMYNVIKRCVPLVNLILAPIILKKGRPSL  165

Query  734  TQVCTWT  754
              VC+ T
Sbjct  166  CMVCSVT  172



>ref|XP_003728942.1| PREDICTED: UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter-like 
isoform 1 [Strongylocentrotus purpuratus]
 ref|XP_003728943.1| PREDICTED: UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter-like 
isoform 2 [Strongylocentrotus purpuratus]
Length=157

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 2/103 (2%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQY--sqsmtlltlqqlastllIYFARVLGYTKAKGF  559
            SL AA  YGV S +M FINK  +  Y  +    ++  Q   +   +    +LG      +
Sbjct  2    SLAAACFYGVCSGSMSFINKLAMNTYGFNYPEIIMLAQMSVTVAALKLVHLLGKVNLPNY  61

Query  560  SIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPL  688
            + E A+     SLFY  N  FAL++L G+NIPMY  +KR  PL
Sbjct  62   TRENARLCLFPSLFYVLNSTFALSALSGMNIPMYNVLKRTGPL  104



>ref|XP_003728944.1| PREDICTED: UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter-like 
[Strongylocentrotus purpuratus]
Length=157

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 2/103 (2%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqs--mtlltlqqlastllIYFARVLGYTKAKGF  559
            SL AA  YGV S +M FINK  +  Y  +    ++  Q   +   +    +LG      +
Sbjct  2    SLAAACFYGVCSGSMSFINKLAMNTYGFNYPEIIMLAQMGVTVAALKLVHLLGKVNLPNY  61

Query  560  SIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPL  688
            + E A+     SLFY  N  FAL++L G+NIPMY  +KR  PL
Sbjct  62   TRENARLCLFPSLFYVLNSTFALSALSGMNIPMYNVLKRTGPL  104



>gb|ELU16612.1| hypothetical protein CAPTEDRAFT_101209 [Capitella teleta]
Length=352

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 62/124 (50%), Gaps = 3/124 (2%)
 Frame = +2

Query  380  YNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFA--RVLGYTKAK  553
            Y  L+ A+ YG+ S +M F NKAVL  Y+       +       ++     R+   T   
Sbjct  6    YRGLIIALFYGITSASMAFANKAVLSHYNFDYPFFLVTCQMVVAIVLLESLRLTQTTSLV  65

Query  554  GFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAV-LVAGFFAGKARP  730
             FS++  +   + S+FY  +   +L++L G+NIPMY  IKR +P+ + L++     K  P
Sbjct  66   RFSLQRGRDFLMPSIFYAVHSVLSLSALSGMNIPMYGVIKRCSPVVILLLSAVVLKKGMP  125

Query  731  TTQV  742
             T +
Sbjct  126  QTGI  129



>ref|XP_003058215.1| Drug/Metabolite transporter superfamily [Micromonas pusilla CCMP1545]
 gb|EEH58166.1| Drug/Metabolite transporter superfamily [Micromonas pusilla CCMP1545]
Length=331

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = +2

Query  428  MVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKG------FSIETAKRLFL  589
            M F+NKAVL  Y    +   L       ++    VLG  +A         ++ TAK+L  
Sbjct  1    MGFVNKAVLTVYGMRESNFLLLAQMCLTVL----VLGALRAANQVSFPRINVATAKKLAP  56

Query  590  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVA  703
            V++ YNANVAFALASL  V++P Y  +KRLTP  VL+A
Sbjct  57   VAILYNANVAFALASLSKVSVPTYNTLKRLTPAVVLLA  94



>ref|XP_009029556.1| hypothetical protein HELRODRAFT_122800, partial [Helobdella robusta]
 gb|ESN92315.1| hypothetical protein HELRODRAFT_122800, partial [Helobdella robusta]
Length=302

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 4/132 (3%)
 Frame = +2

Query  392  VAAVSYGVASMAMVFINKAVLMQYsqsm--tlltlqqlastllIYFARVLGYTKAKGFSI  565
            + A  YG  S +M F+NKAVL  Y  +    L++ Q   +  ++   R+ G      F+ 
Sbjct  4    IIAFLYGACSASMAFVNKAVLSYYKFNFPFFLVSCQMAFTIAILEALRLSGNKFLVKFTF  63

Query  566  ETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGF-FAGKARPTTQV  742
            E A    L S+FY AN   +L++L G+NIPMY  IKR  P+ +L+ G     K  P   V
Sbjct  64   ERAWTFLLPSIFYAANSVLSLSALYGMNIPMYGVIKRCAPVVILILGVAILNKPLPQVSV  123

Query  743  CTWTSSFLTGYC  778
            C  +   +TG C
Sbjct  124  C-LSVGMITGGC  134



>gb|ETN65003.1| UDP-sugar transporter UST74c [Anopheles darlingi]
Length=340

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 68/132 (52%), Gaps = 2/132 (2%)
 Frame = +2

Query  353  TMASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllI--YFA  526
            +M  ++ + +  L +A+ YG++S  +  +NK VL  Y     L+      +  +I  + A
Sbjct  11   SMGDVDGTQFLKLSSAIFYGLSSFLITVVNKTVLTSYRFPSFLVLSLGQLTASIIVLFVA  70

Query  527  RVLGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAG  706
            + LG  K   FS++ A+R+F + L Y  N+ F L   + +++PM+ A++R + L  ++  
Sbjct  71   KRLGIVKYPDFSLDIARRIFPLPLIYLGNMMFGLGGTQALSLPMFAALRRFSILMTMLLE  130

Query  707  FFAGKARPTTQV  742
                  RPT  V
Sbjct  131  LVVLGIRPTFSV  142



>emb|CBY32879.1| unnamed protein product [Oikopleura dioica]
Length=294

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +2

Query  515  IYFARVLGYTKAK---GFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTP  685
            I F R +G         +++E  K+L L+SLFY +NV  AL +L G+NIPMY A++R  P
Sbjct  16   ITFLRKIGKINDNLVLAYTLERGKKLSLLSLFYVSNVILALFALSGMNIPMYNAMRRCVP  75

Query  686  LAVLVAGFFAGKARPTTQV  742
            +A L+ G      R TT +
Sbjct  76   IASLLLGPCIYPQRSTTSI  94



>emb|CBY18652.1| unnamed protein product [Oikopleura dioica]
Length=294

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +2

Query  515  IYFARVLGYTKAK---GFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTP  685
            I F R +G         +++E  K+L L+SLFY +NV  AL +L G+NIPMY A++R  P
Sbjct  16   ITFLRKIGKINDNLVLAYTLERGKKLSLLSLFYVSNVILALFALSGMNIPMYNAMRRCVP  75

Query  686  LAVLVAGFFAGKARPTTQV  742
            +A L+ G      R TT +
Sbjct  76   IASLLLGPCIYPQRSTTSI  94



>ref|XP_001599500.1| PREDICTED: UDP-sugar transporter UST74c [Nasonia vitripennis]
Length=326

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +2

Query  395  AAVSYGVASMAMVFINKAVL--MQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSIE  568
            +A+ YG++S+ +  +NK VL    +     L   Q LA+ ++++ A+ LGY    G    
Sbjct  15   SALGYGLSSLMITVVNKTVLTSFDFPSFQVLGIGQMLATVMVLFIAKALGYIDFPGLERS  74

Query  569  TAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFF--AGKARPTTQV  742
            T K++F + L Y  N+ F L   K +++PM+  ++R + L  ++  ++    KAR + Q+
Sbjct  75   TFKKIFPLPLIYICNMNFGLGGTKQLSLPMFTVLRRFSILMTMIGEYYILGVKARTSVQL  134

Query  743  CTWT  754
              +T
Sbjct  135  SVYT  138



>emb|CDX91779.1| BnaC08g06980D [Brassica napus]
Length=197

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  533  LGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVN  649
            +GYT++KG  + +AKRL LVS FYNAN+AFALA L+  N
Sbjct  35   MGYTRSKGIDLASAKRLLLVSNFYNANIAFALARLQSNN  73



>gb|KFB50841.1| AGAP005200-PA-like protein [Anopheles sinensis]
Length=347

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 69/131 (53%), Gaps = 2/131 (2%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYs--qsmtlltlqqlastllIYFAR  529
            MA  + + +  L +AV YG++S  +  +NK VL  Y     + L   Q  AS ++++ A+
Sbjct  15   MAGSDTTQFLKLSSAVFYGLSSFLITVVNKTVLTSYRFPSFLVLSLGQLTASIVVLFVAK  74

Query  530  VLGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGF  709
             LG  K   FS + A+R+F + L Y  N+ F L   + +++PM+ A++R + L  ++   
Sbjct  75   RLGLVKFPDFSRDIARRIFPLPLIYLGNMMFGLGGTQALSLPMFAALRRFSILLTMLLEL  134

Query  710  FAGKARPTTQV  742
                 RPT  V
Sbjct  135  LVLGIRPTLAV  145



>ref|XP_002160727.2| PREDICTED: solute carrier family 35 member D3-like [Hydra vulgaris]
Length=354

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 64/122 (52%), Gaps = 2/122 (2%)
 Frame = +2

Query  389  LVAAVSYGVASMAMVFINKAVLM--QYsqsmtlltlqqlastllIYFARVLGYTKAKGFS  562
            L+AA+ Y   S +M F+NK +L    Y     ++  Q + + +++   R+    K   ++
Sbjct  42   LLAALFYAFVSGSMSFMNKVILTSYHYDYPDVIMLFQVVLTAIVVDLCRMTNICKIPPWT  101

Query  563  IETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARPTTQV  742
             + ++  F  SL +  +   ALA+L G++IP+Y  ++R+ PLA L+   F  K  P+  +
Sbjct  102  FQRSREFFFPSLCFALHTTLALAALSGLSIPIYNVLRRMLPLATLLTAHFVLKKTPSYGI  161

Query  743  CT  748
             T
Sbjct  162  IT  163



>gb|KFM25567.1| Putative UDP-sugar transporter [Auxenochlorella protothecoides]
Length=311

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 66/125 (53%), Gaps = 2/125 (2%)
 Frame = +2

Query  365  MEISPYNSLVAAVSYGVASMAMVFINKAV--LMQYsqsmtlltlqqlastllIYFARVLG  538
            ME +P    +  + YGV S+++   N+AV  + Q++    +  +Q L S L IY  +  G
Sbjct  3    MEPTPSQRAIICIQYGVVSVSITLFNRAVFSVYQFNFPAFVTLIQILVSILYIYTLKYSG  62

Query  539  YTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAG  718
              +    +IE A+R+  ++LF+   V   + +L+ +N+PMY  ++R T L V+   + A 
Sbjct  63   RLRVGALTIEGARRVAPLALFWWLYVVSGVTALRFLNVPMYSVLRRSTTLVVVAGEYLAF  122

Query  719  KARPT  733
               PT
Sbjct  123  HKVPT  127



>ref|XP_001230977.2| AGAP005200-PA [Anopheles gambiae str. PEST]
 gb|EAU76830.2| AGAP005200-PA [Anopheles gambiae str. PEST]
Length=346

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 68/131 (52%), Gaps = 2/131 (2%)
 Frame = +2

Query  356  MASMEISPYNSLVAAVSYGVASMAMVFINKAVLMQYs--qsmtlltlqqlastllIYFAR  529
            MA  E + +  L +AV YG++S  +  +NK VL  Y     + L   Q  AS ++++ A+
Sbjct  15   MAGGETTQFLKLSSAVFYGLSSFLITVVNKTVLTSYRFPSFLVLSLGQLTASIVVLFVAK  74

Query  530  VLGYTKAKGFSIETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGF  709
             L   K   FS + A+R+F + L Y  N+ F L   + +++PM+ A++R + L  ++   
Sbjct  75   RLQLVKYPDFSRDIARRIFPLPLIYLGNMMFGLGGTQALSLPMFAALRRFSILLTMLLEL  134

Query  710  FAGKARPTTQV  742
                 RPT  V
Sbjct  135  LVLGIRPTLAV  145



>ref|XP_005829506.1| hypothetical protein GUITHDRAFT_141195 [Guillardia theta CCMP2712]
 gb|EKX42526.1| hypothetical protein GUITHDRAFT_141195 [Guillardia theta CCMP2712]
Length=347

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 4/121 (3%)
 Frame = +2

Query  386  SLVAAVSYGVASMAMVFINKAVLMQYsqsmtlltlqqlastllIYFARVLGYTKAKGFSI  565
            SLV AV Y   S+AMV  NK V+  +  S T   L   A T  I+  +V   T    FS+
Sbjct  59   SLVYAVFYCTTSIAMVATNKLVVSNFDFSFTSFLLLLQALTT-IFLVQVFPITPT--FSL  115

Query  566  ETAKRLFLVSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGF-FAGKARPTTQV  742
               ++L  +S FY  NV   L +++ + IP Y +IKRLTP+ VLV  F   GK +    +
Sbjct  116  HALRKLVPLSCFYLLNVTTGLLAVRLLTIPAYTSIKRLTPIYVLVFDFLLRGKRQSAMVI  175

Query  743  C  745
            C
Sbjct  176  C  176



>ref|XP_005646100.1| hypothetical protein COCSUDRAFT_37348 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21556.1| hypothetical protein COCSUDRAFT_37348 [Coccomyxa subellipsoidea 
C-169]
Length=290

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +2

Query  590  VSLFYNANVAFALASLKGVNIPMYIAIKRLTPLAVLVAGFFAGKARP----TTQVC  745
            V++ Y +NVAFAL  L+ +NIPMY  +KRLTP+ VLVA     K  P    T  VC
Sbjct  33   VTILYVSNVAFALMGLQNLNIPMYNTLKRLTPVIVLVARAVQTKKAPPRDITASVC  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1907210278062