BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20766_g4_i1 len=369 path=[2573:0-339 2913:340-368]

Length=369
                                                                      Score     E

ref|XP_010029289.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    4e-23   
ref|XP_010112088.1|  V-type proton ATPase subunit d2                  76.3    7e-23   
gb|KGN59587.1|  hypothetical protein Csa_3G827290                     76.3    7e-23   
ref|XP_004147464.1|  PREDICTED: V-type proton ATPase subunit d2-like  76.3    9e-23   
ref|XP_004489169.1|  PREDICTED: V-type proton ATPase subunit d2-like  75.9    9e-23   
ref|XP_007032460.1|  ATPase, V0/A0 complex, subunit C/D isoform 2     76.3    1e-22   
ref|XP_007032459.1|  ATPase, V0/A0 complex, subunit C/D isoform 1     76.3    1e-22   
ref|XP_007215618.1|  hypothetical protein PRUPE_ppa007912mg           76.3    1e-22   
ref|XP_010274438.1|  PREDICTED: V-type proton ATPase subunit d2-like  76.3    1e-22   
gb|KHG10145.1|  V-type proton ATPase subunit d2 -like protein         76.3    1e-22   
ref|XP_010274441.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    1e-22   
emb|CDX86419.1|  BnaA06g31360D                                        69.7    1e-22   
ref|XP_008775706.1|  PREDICTED: V-type proton ATPase subunit d2       76.6    1e-22   
ref|XP_008808360.1|  PREDICTED: V-type proton ATPase subunit d2-like  76.3    1e-22   
ref|XP_010934030.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    2e-22   
ref|XP_009405126.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    2e-22   
gb|KDP45481.1|  hypothetical protein JCGZ_09730                       76.3    2e-22   
ref|XP_010925056.1|  PREDICTED: V-type proton ATPase subunit d1-like  76.3    2e-22   
gb|KHG24135.1|  V-type proton ATPase subunit d2 -like protein         75.5    2e-22   
ref|XP_009407290.1|  PREDICTED: V-type proton ATPase subunit d2-like  75.9    2e-22   
ref|XP_003534461.1|  PREDICTED: V-type proton ATPase subunit d2-l...  76.3    2e-22   
ref|XP_002282568.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    2e-22   Vitis vinifera
gb|ACJ05375.1|  vacuolar ATPase subunit d                             76.3    2e-22   Vigna radiata [mung bean]
ref|XP_009790017.1|  PREDICTED: probable V-type proton ATPase sub...  77.8    2e-22   
ref|NP_001242797.1|  uncharacterized protein LOC100780773             76.3    2e-22   
ref|XP_010528319.1|  PREDICTED: V-type proton ATPase subunit d2       74.7    2e-22   
ref|XP_003621131.1|  V-type proton ATPase subunit d2                  76.3    2e-22   
gb|ACJ84580.1|  unknown                                               76.3    2e-22   Medicago truncatula
ref|XP_007139598.1|  hypothetical protein PHAVU_008G043300g           76.3    3e-22   
gb|ACJ84285.1|  unknown                                               76.3    3e-22   Medicago truncatula
ref|XP_008341542.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    3e-22   
ref|XP_004302350.1|  PREDICTED: V-type proton ATPase subunit d2-like  76.3    3e-22   
gb|AFK43068.1|  unknown                                               76.3    3e-22   
ref|XP_009347070.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    3e-22   
ref|XP_010554029.1|  PREDICTED: V-type proton ATPase subunit d2-like  74.3    3e-22   
ref|XP_009342867.1|  PREDICTED: V-type proton ATPase subunit d2-like  75.9    3e-22   
ref|XP_008379822.1|  PREDICTED: V-type proton ATPase subunit d2-like  75.9    3e-22   
ref|XP_003621132.1|  V-type proton ATPase subunit d2                  75.1    4e-22   
ref|NP_001189996.1|  V-type proton ATPase subunit d2                  73.2    6e-22   
ref|XP_006339198.1|  PREDICTED: V-type proton ATPase subunit d2-like  76.3    6e-22   
ref|XP_009129362.1|  PREDICTED: V-type proton ATPase subunit d1-like  73.2    7e-22   
ref|NP_189513.1|  V-type proton ATPase subunit d2                     73.2    7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009616415.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    7e-22   
ref|XP_006431094.1|  hypothetical protein CICLE_v10012084mg           76.3    7e-22   
ref|XP_009765131.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    7e-22   
gb|KDO72499.1|  hypothetical protein CISIN_1g018459mg                 76.3    7e-22   
ref|XP_011098583.1|  PREDICTED: V-type proton ATPase subunit d2       76.3    8e-22   
gb|EYU34665.1|  hypothetical protein MIMGU_mgv1a009170mg              73.6    9e-22   
gb|KDO72502.1|  hypothetical protein CISIN_1g018459mg                 75.5    9e-22   
ref|XP_002324040.1|  hypothetical protein POPTR_0017s11530g           74.3    9e-22   Populus trichocarpa [western balsam poplar]
gb|EPS71418.1|  hypothetical protein M569_03330                       75.9    1e-21   
ref|XP_006431093.1|  hypothetical protein CICLE_v10012084mg           75.5    1e-21   
ref|XP_010693325.1|  PREDICTED: V-type proton ATPase subunit d2       73.6    1e-21   
ref|XP_002521559.1|  vacuolar ATP synthase subunit ac39, putative     76.3    2e-21   Ricinus communis
ref|XP_009629848.1|  PREDICTED: V-type proton ATPase subunit d2-l...  75.1    2e-21   
ref|XP_010514580.1|  PREDICTED: V-type proton ATPase subunit d1-like  70.5    4e-21   
ref|XP_010502940.1|  PREDICTED: V-type proton ATPase subunit d1-like  70.1    4e-21   
ref|XP_009790018.1|  PREDICTED: V-type proton ATPase subunit d2-l...  75.1    4e-21   
ref|XP_010425652.1|  PREDICTED: V-type proton ATPase subunit d1-like  70.1    4e-21   
ref|XP_006395348.1|  hypothetical protein EUTSA_v10004498mg           70.1    4e-21   
ref|NP_189512.1|  V-type proton ATPase subunit d1                     70.1    4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAG40030.1|AF324679_1  AT3g28710                                   70.1    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151855.1|  PREDICTED: V-type proton ATPase subunit d1-like  70.1    5e-21   
ref|XP_006291408.1|  hypothetical protein CARUB_v10017547mg           70.1    5e-21   
ref|XP_006291406.1|  hypothetical protein CARUB_v10017545mg           70.1    5e-21   
ref|XP_009629856.1|  PREDICTED: V-type proton ATPase subunit d2-l...  75.1    5e-21   
ref|XP_011085772.1|  PREDICTED: V-type proton ATPase subunit d1-like  73.6    6e-21   
gb|EYU34106.1|  hypothetical protein MIMGU_mgv1a009166mg              73.2    7e-21   
gb|KHN13648.1|  V-type proton ATPase subunit d2                       75.5    7e-21   
gb|ABR16673.1|  unknown                                               72.8    9e-21   Picea sitchensis
gb|EMS47297.1|  putative V-type proton ATPase subunit d               80.5    8e-20   
emb|CAD27914.1|  putative vacuolar ATPase subunit d                   72.4    1e-19   Mesembryanthemum crystallinum
gb|ABG23315.1|  vacuolar proton-ATPase D subunit                      77.0    9e-19   Triticum aestivum [Canadian hard winter wheat]
emb|CDM83070.1|  unnamed protein product                              77.0    9e-19   
ref|XP_002458058.1|  hypothetical protein SORBIDRAFT_03g026290        75.1    1e-18   Sorghum bicolor [broomcorn]
ref|XP_004969389.1|  PREDICTED: probable V-type proton ATPase sub...  74.7    1e-18   
ref|XP_002972191.1|  hypothetical protein SELMODRAFT_96980            69.3    1e-18   
ref|XP_003569277.1|  PREDICTED: probable V-type proton ATPase sub...  76.6    1e-18   
ref|NP_001146493.1|  hypothetical protein                             73.9    2e-18   Zea mays [maize]
tpg|DAA58721.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...  73.9    2e-18   
ref|XP_006644318.1|  PREDICTED: probable V-type proton ATPase sub...  72.8    4e-18   
ref|NP_001043429.1|  Os01g0587000                                     72.8    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001784307.1|  predicted protein                                69.3    7e-18   
ref|XP_005650648.1|  vacuolar H+ ATPase V0 sector, subunit D          63.5    1e-14   
ref|XP_006855526.1|  hypothetical protein AMTR_s00057p00210030        76.6    4e-14   
emb|CDX95344.1|  BnaC04g28140D                                        69.3    1e-12   
ref|XP_002946855.1|  vacuolar H+ ATPase V0 sector, subunit D          51.6    1e-11   
ref|XP_001703440.1|  vacuolar H+ ATPase V0 sector, subunit D          54.3    5e-11   Chlamydomonas reinhardtii
ref|XP_007879700.1|  hypothetical protein PFL1_03986                  56.2    1e-09   
ref|XP_004340986.1|  Vacuolar proton pump d subunit, putative         58.5    1e-09   
emb|CDI53644.1|  probable vacuolar atp synthase subunit d             55.5    2e-09   
gb|KDQ62295.1|  hypothetical protein JAAARDRAFT_66057                 54.7    3e-09   
dbj|GAK64285.1|  ATPase V0 complex subunit D                          57.4    4e-09   
gb|ETS64657.1|  hypothetical protein PaG_00601                        57.0    4e-09   
ref|XP_007351085.1|  vacuolar ATP synthase subunit D 1                55.1    4e-09   
dbj|GAC71664.1|  vacuolar H+-ATPase V0 sector, subunit d              57.0    4e-09   
gb|EJT48677.1|  vacuolar ATP synthase subunit d                       49.3    4e-09   
ref|XP_005718344.1|  unnamed protein product                          58.2    5e-09   
gb|EST05411.1|  vacuolar H+-ATPase                                    55.5    5e-09   
ref|XP_001730381.1|  hypothetical protein MGL_2763                    50.1    5e-09   Malassezia globosa CBS 7966
ref|XP_008037822.1|  ATPase V0 complex subunit D                      50.1    8e-09   
ref|XP_758929.1|  hypothetical protein UM02782.1                      55.5    8e-09   Ustilago maydis 521
emb|CCF53024.1|  probable vacuolar atp synthase subunit d             58.2    8e-09   
emb|CBQ73181.1|  probable vacuolar atp synthase subunit d             55.5    9e-09   
dbj|GAC93399.1|  hypothetical protein PHSY_000964                     55.5    9e-09   
gb|EPT05205.1|  hypothetical protein FOMPIDRAFT_69178                 52.0    1e-08   
gb|KEP50904.1|  V-type proton ATPase subunit D                        51.2    2e-08   
gb|KDR82832.1|  hypothetical protein GALMADRAFT_238435                50.1    2e-08   
ref|XP_005844973.1|  hypothetical protein CHLNCDRAFT_138366           58.2    2e-08   
ref|XP_007866748.1|  ATPase, V0 complex, subunit D                    54.3    3e-08   
gb|EUC63240.1|  V-type proton ATPase subunit D 1                      51.2    4e-08   
emb|CCU97397.1|  unnamed protein product                              50.4    5e-08   
ref|XP_006682371.1|  hypothetical protein BATDEDRAFT_20958            54.3    5e-08   
gb|KHJ45470.1|  ATP synthase, subunit C                               47.8    5e-08   
gb|KDN51307.1|  putative vacuolar atp synthase subunit D              50.4    6e-08   
ref|XP_006956386.1|  vacuolar ATP synthase subunit D                  45.8    6e-08   
ref|XP_001835929.1|  vacuolar ATP synthase subunit                    50.4    8e-08   Coprinopsis cinerea okayama7#130
ref|XP_009546192.1|  vacuolar H+-ATPase V0 sector, subunit D          52.0    8e-08   
gb|KDE08503.1|  V-type proton ATPase subunit D                        49.7    9e-08   
gb|KDQ25771.1|  hypothetical protein PLEOSDRAFT_1113568               49.3    9e-08   
ref|XP_007271746.1|  ATPase, V0 complex, subunit D                    52.0    1e-07   
emb|CDO71435.1|  hypothetical protein BN946_scf184909.g29             48.5    1e-07   
ref|XP_002108995.1|  expressed hypothetical protein                   56.2    1e-07   Trichoplax adhaerens
ref|XP_007380197.1|  ATPase V0 complex subunit D                      53.9    2e-07   
ref|XP_005760681.1|  vacuolar H+-ATPase V0 sector, subunit D          58.2    2e-07   
ref|XP_644445.1|  vacuolar ATPase subunit DVA41                       58.2    2e-07   Dictyostelium discoideum AX4
gb|AAA64993.1|  vacuolar ATPase subunit DVA41                         58.2    2e-07   Dictyostelium discoideum
gb|EMS19531.1|  V-type H+-transporting ATPase subunit AC39            49.3    2e-07   
gb|KDQ11407.1|  hypothetical protein BOTBODRAFT_35294                 51.6    2e-07   
ref|XP_007845746.1|  vacuolar atp synthase subunit d                  50.1    2e-07   
ref|XP_009495703.1|  V-type proton ATPase subunit D                   57.8    2e-07   
gb|AFR92580.1|  V-type H -transporting ATPase subunit AC39            49.3    2e-07   
gb|EJU03246.1|  vacuolar ATP synthase subunit                         47.4    2e-07   
ref|XP_566778.1|  vacuolar ATP synthase subunit d                     49.3    2e-07   Cryptococcus neoformans var. neoformans JEC21
ref|XP_007768408.1|  ATPase V0 complex subunit D                      51.6    3e-07   
ref|XP_003191398.1|  vacuolar ATP synthase subunit d                  48.9    3e-07   
gb|KGB75624.1|  vacuolar ATP synthase subunit D                       48.9    3e-07   
emb|CDW53196.1|  Vacuolar h atpase protein 16                         45.8    3e-07   
ref|NP_001080200.1|  ATPase, H+ transporting, lysosomal 38kDa, V0...  50.4    3e-07   Xenopus laevis [clawed frog]
ref|XP_003371626.1|  vacuolar proton pump subunit D 1                 48.5    3e-07   
dbj|GAA55818.1|  V-type H+-transporting ATPase subunit AC39           52.8    3e-07   
ref|NP_001017310.1|  V-type proton ATPase subunit d 1                 50.4    3e-07   Xenopus tropicalis [western clawed frog]
ref|XP_005826878.1|  hypothetical protein GUITHDRAFT_96472            51.6    4e-07   
ref|XP_001605391.1|  PREDICTED: V-type proton ATPase subunit d        50.4    4e-07   Nasonia vitripennis
gb|EMD39971.1|  hypothetical protein CERSUDRAFT_81279                 51.2    4e-07   
ref|XP_001747906.1|  hypothetical protein                             55.1    4e-07   Monosiga brevicollis MX1
ref|XP_004998460.1|  proton ATPase accessory subunit                  57.0    4e-07   
ref|XP_003745596.1|  PREDICTED: V-type proton ATPase subunit d-like   51.2    5e-07   
ref|XP_006641495.1|  PREDICTED: V-type proton ATPase subunit d 1-...  50.1    5e-07   
ref|XP_010792242.1|  PREDICTED: V-type proton ATPase subunit d 1      50.8    5e-07   
ref|XP_009267532.1|  V-type proton ATPase subunit d                   46.6    5e-07   
emb|CCA70885.1|  probable vacuolar atp synthase subunit d             50.8    6e-07   
ref|XP_779935.2|  PREDICTED: V-type proton ATPase subunit d 1-lik...  50.4    6e-07   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001876271.1|  predicted protein                                48.5    6e-07   Laccaria bicolor S238N-H82
ref|XP_003330049.1|  ATP synthase (C/AC39) subunit                    48.9    8e-07   
ref|XP_006011813.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  48.5    9e-07   
ref|XP_004520031.1|  PREDICTED: V-type proton ATPase subunit d 1-...  49.7    9e-07   
ref|XP_008404240.1|  PREDICTED: V-type proton ATPase subunit d 1      50.4    1e-06   
ref|XP_005816503.1|  PREDICTED: V-type proton ATPase subunit d 1-...  50.4    1e-06   
ref|XP_007246947.1|  PREDICTED: V-type proton ATPase subunit d 1      50.4    1e-06   
ref|XP_010894466.1|  PREDICTED: V-type proton ATPase subunit d 1      50.4    1e-06   
gb|EGI64151.1|  V-type proton ATPase subunit d                        50.4    1e-06   
ref|XP_007304751.1|  ATPase V0 complex subunit D                      48.5    1e-06   
ref|XP_005180381.1|  PREDICTED: V-type proton ATPase subunit d 1-...  50.4    1e-06   
ref|XP_002605275.1|  hypothetical protein BRAFLDRAFT_115616           52.4    1e-06   Branchiostoma floridae
ref|XP_006269895.1|  PREDICTED: V-type proton ATPase subunit d 1      49.3    1e-06   
gb|EFN85494.1|  Vacuolar proton pump subunit d                        50.4    1e-06   
ref|XP_003295220.1|  hypothetical protein DICPUDRAFT_96211            55.5    1e-06   
ref|XP_007001011.1|  hypothetical protein TREMEDRAFT_42243            47.0    1e-06   
dbj|GAM20087.1|  hypothetical protein SAMD00019534_032620             52.0    1e-06   
ref|XP_011056441.1|  PREDICTED: V-type proton ATPase subunit d        50.4    2e-06   
gb|EFN71876.1|  Vacuolar proton pump subunit d                        50.4    2e-06   
ref|XP_007319763.1|  hypothetical protein SERLADRAFT_470602           48.5    2e-06   
ref|XP_003705831.1|  PREDICTED: V-type proton ATPase subunit d-like   50.1    2e-06   
ref|XP_003033801.1|  hypothetical protein SCHCODRAFT_75276            48.9    2e-06   
gb|KDR12194.1|  V-type proton ATPase subunit d                        50.4    2e-06   
ref|NP_001191854.1|  V-type proton ATPase subunit d                   49.7    2e-06   
gb|KFW85840.1|  V-type proton ATPase subunit d 2                      48.5    2e-06   
ref|XP_008636966.1|  PREDICTED: V-type proton ATPase subunit d 1      47.4    2e-06   
ref|XP_003436855.1|  AGAP013199-PA                                    47.0    2e-06   
gb|ELW56796.1|  V-type proton ATPase subunit d 1                      48.1    2e-06   
gb|AAI53473.1|  Atp6v0d1 protein                                      48.9    2e-06   Danio rerio [leopard danio]
ref|XP_010582237.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  47.8    3e-06   
ref|XP_001661299.1|  vacuolar ATP synthase subunit ac39               49.3    3e-06   Aedes aegypti
ref|XP_005016794.1|  PREDICTED: V-type proton ATPase subunit d 2      48.9    3e-06   
ref|XP_005229250.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    3e-06   
gb|AFU90892.1|  H+-transporting two-sector ATPase                     51.2    3e-06   
ref|XP_005152346.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    3e-06   
ref|XP_001870744.1|  vacuolar ATP synthase subunit ac39               49.3    3e-06   Culex quinquefasciatus
ref|XP_009641567.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    3e-06   
gb|ETN65678.1|  vacuolar ATP synthase subunit ac39                    49.3    3e-06   
ref|XP_311260.4|  AGAP000721-PA                                       49.3    3e-06   Anopheles gambiae str. PEST
ref|XP_010021036.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    3e-06   
ref|XP_505487.2|  YALI0F16181p                                        45.8    3e-06   Yarrowia lipolytica CLIB122
gb|KFQ57177.1|  V-type proton ATPase subunit d 1                      47.8    3e-06   
gb|ERE82659.1|  V-type proton ATPase subunit d 2-like protein         47.0    3e-06   
ref|XP_004359020.1|  vacuolar ATPase subunit DVA41                    50.8    3e-06   
ref|XP_009569492.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    3e-06   
ref|XP_008335358.1|  PREDICTED: V-type proton ATPase subunit d 1      48.5    4e-06   
ref|XP_003230531.2|  PREDICTED: V-type proton ATPase subunit d 1      47.4    4e-06   
ref|XP_003456933.1|  PREDICTED: V-type proton ATPase subunit d 1-...  48.5    4e-06   
dbj|BAN21505.1|  vacuolar ATP synthase subunit ac39                   48.1    4e-06   
ref|XP_003758446.1|  PREDICTED: V-type proton ATPase subunit d 1-...  48.1    4e-06   
ref|XP_002187230.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   Taeniopygia guttata
ref|XP_005708910.1|  V-type H+-transporting ATPase subunit d          47.4    4e-06   
ref|NP_955914.1|  V-type proton ATPase subunit d 1                    48.1    4e-06   Danio rerio [leopard danio]
ref|XP_009468745.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   
ref|XP_004704670.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   
ref|XP_006878754.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   
ref|XP_974905.1|  PREDICTED: V-type proton ATPase subunit d           50.8    4e-06   Tribolium castaneum [rust-red flour beetle]
ref|XP_004371547.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   
ref|XP_007404053.1|  hypothetical protein MELLADRAFT_41471            46.2    4e-06   
ref|XP_007938443.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   
ref|NP_001280240.1|  V-type proton ATPase subunit d 1                 47.8    4e-06   
ref|XP_005526345.1|  PREDICTED: V-type proton ATPase subunit d 1      47.4    4e-06   
ref|XP_003417065.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    4e-06   
ref|XP_007399299.1|  hypothetical protein PHACADRAFT_261648           46.6    4e-06   
ref|XP_006155679.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  47.8    4e-06   
dbj|BAM18150.1|  vacuolar H[+] ATPase subunit AC39-1                  50.8    4e-06   
emb|CAG12482.1|  unnamed protein product                              48.1    5e-06   Tetraodon nigroviridis
ref|XP_003969660.1|  PREDICTED: V-type proton ATPase subunit d 1-...  48.1    5e-06   
ref|XP_003262939.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  48.1    5e-06   
gb|EHJ64513.1|  V-type proton ATPase subunit d                        50.8    5e-06   
sp|Q25531.1|VA0D_MANSE  RecName: Full=V-type proton ATPase subuni...  50.8    5e-06   Manduca sexta [Carolina sphinx]
gb|KFH63935.1|  V-type proton ATPase subunit D                        44.3    5e-06   
ref|NP_001040429.1|  H+ transporting ATPase V0 subunit D              50.8    5e-06   Bombyx mori [silk moth]
ref|XP_001364830.1|  PREDICTED: V-type proton ATPase subunit d 1      47.0    5e-06   Monodelphis domestica
gb|EPZ35596.1|  V-type proton ATPase subunit d 1                      53.9    5e-06   
ref|XP_004744466.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  48.1    5e-06   
ref|XP_004057862.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  48.1    5e-06   
ref|XP_002711660.2|  PREDICTED: V-type proton ATPase subunit d 1      47.8    6e-06   Oryctolagus cuniculus [domestic rabbit]
ref|XP_393438.2|  PREDICTED: V-type proton ATPase subunit d isofo...  50.4    6e-06   Apis mellifera [bee]
dbj|BAH13305.1|  unnamed protein product                              48.5    6e-06   Homo sapiens [man]
ref|XP_002428920.1|  vacuolar ATP synthase subunit D, putative        50.4    6e-06   Pediculus humanus corporis [human body lice]
gb|AAC83085.1|  vacuolar adenosine triphosphatase subunit D           47.8    7e-06   Mus musculus [mouse]
gb|EFX90268.1|  hypothetical protein DAPPUDRAFT_300127                51.2    7e-06   
ref|XP_005103515.1|  PREDICTED: V-type proton ATPase subunit d 1-...  50.8    8e-06   
gb|KFW96249.1|  V-type proton ATPase subunit d 2                      45.8    8e-06   
ref|XP_005746759.1|  PREDICTED: V-type proton ATPase subunit d 1-...  48.5    8e-06   
ref|XP_008545613.1|  PREDICTED: V-type proton ATPase subunit d        50.1    8e-06   
ref|XP_002106075.1|  GD16660                                          49.7    8e-06   Drosophila simulans
gb|AFQ00928.1|  V-ATPase subunit D                                    50.1    8e-06   
gb|ERE77165.1|  V-type proton ATPase subunit d 1                      48.1    8e-06   
ref|XP_006020661.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    8e-06   
ref|XP_009249082.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  47.8    8e-06   
ref|XP_009500220.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    9e-06   
ref|XP_001963746.1|  GF21182                                          49.7    9e-06   Drosophila ananassae
gb|ENN81765.1|  hypothetical protein YQE_01858                        49.7    9e-06   
ref|XP_001355168.1|  GA15530                                          49.7    9e-06   Drosophila pseudoobscura pseudoobscura
ref|NP_570080.1|  vacuolar H[+] ATPase AC39 subunit 1                 49.7    9e-06   Drosophila melanogaster
ref|XP_010610540.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  48.1    9e-06   
ref|XP_004690532.1|  PREDICTED: V-type proton ATPase subunit d 1      46.6    9e-06   
ref|XP_006099547.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    9e-06   
ref|XP_005876450.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    1e-05   
ref|XP_003998179.1|  PREDICTED: V-type proton ATPase subunit d 1      48.1    1e-05   
ref|XP_010013648.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    1e-05   
gb|ELK02423.1|  V-type proton ATPase subunit d 2                      46.6    1e-05   
ref|XP_004431783.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    1e-05   
ref|XP_002918462.1|  PREDICTED: v-type proton ATPase subunit d 1-...  47.8    1e-05   
ref|XP_536816.2|  PREDICTED: V-type proton ATPase subunit d 1 iso...  47.8    1e-05   Canis lupus familiaris [dogs]
ref|NP_004682.2|  V-type proton ATPase subunit d 1                    47.8    1e-05   Homo sapiens [man]
ref|XP_003799438.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    1e-05   
ref|XP_001497719.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    1e-05   Equus caballus [domestic horse]
ref|XP_006924120.1|  PREDICTED: V-type proton ATPase subunit d 2      46.6    1e-05   
ref|NP_038505.2|  V-type proton ATPase subunit d 1                    47.8    1e-05   Mus musculus [mouse]
dbj|BAG35868.1|  unnamed protein product                              47.8    1e-05   Homo sapiens [man]
dbj|GAM22748.1|  hypothetical protein SAMD00019534_059230             48.5    1e-05   
ref|XP_004600657.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    1e-05   
ref|XP_009066557.1|  hypothetical protein LOTGIDRAFT_108853           48.9    1e-05   
ref|XP_006001856.1|  PREDICTED: V-type proton ATPase subunit d 2      46.6    1e-05   
ref|XP_004843089.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  47.8    1e-05   
ref|XP_001163837.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    1e-05   Pan troglodytes
gb|ESA12217.1|  hypothetical protein GLOINDRAFT_347456                52.8    1e-05   
gb|AFU90891.1|  H+-transporting two-sector ATPase                     49.3    1e-05   
ref|XP_004907076.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  47.8    1e-05   
emb|CAX72677.1|  Vacuolar H ATPase                                    50.4    1e-05   
ref|XP_002011347.1|  GI16480                                          50.1    1e-05   Drosophila mojavensis
emb|CAX72803.1|  Vacuolar H ATPase                                    50.4    1e-05   
gb|AAW26145.1|  SJCHGC06877 protein                                   50.4    1e-05   Schistosoma japonicum
gb|EHB17023.1|  V-type proton ATPase subunit d 1                      47.8    1e-05   
emb|CAX72683.1|  Vacuolar H ATPase                                    50.4    1e-05   
ref|XP_002075185.1|  GK16475                                          49.3    1e-05   
gb|AAP06204.1|  similar to GenBank Accession Number X98825 40-kDa...  50.4    1e-05   
ref|XP_004200035.1|  Piso0_002596                                     41.2    1e-05   
ref|XP_005076346.1|  PREDICTED: V-type proton ATPase subunit d 1      47.4    1e-05   
ref|XP_001995720.1|  GH17612                                          49.7    1e-05   
ref|XP_007430293.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    1e-05   
emb|CDK25374.1|  unnamed protein product                              45.8    1e-05   
ref|NP_001171740.1|  V-type proton ATPase subunit d 1                 50.1    1e-05   
ref|XP_006028155.1|  PREDICTED: V-type proton ATPase subunit d 1      49.3    1e-05   
ref|XP_008054933.1|  PREDICTED: V-type proton ATPase subunit d 1-...  47.4    1e-05   
ref|XP_008167637.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    1e-05   
gb|KHN11589.1|  V-type proton ATPase subunit d2                       52.4    2e-05   
ref|XP_009249083.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  47.8    2e-05   
emb|CBI22163.3|  unnamed protein product                              52.0    2e-05   
gb|KFP25967.1|  V-type proton ATPase subunit d 2                      45.8    2e-05   
ref|XP_001091627.2|  PREDICTED: v-type proton ATPase subunit d 1-...  47.0    2e-05   
ref|XP_001625997.1|  predicted protein                                46.6    2e-05   
ref|XP_010201318.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    2e-05   
emb|CAX72763.1|  Vacuolar H ATPase                                    50.1    2e-05   
ref|XP_005240683.1|  PREDICTED: V-type proton ATPase subunit d 2-...  45.8    2e-05   
gb|EFA83304.1|  vacuolar ATPase subunit DVA41                         52.0    2e-05   
ref|XP_005504962.1|  PREDICTED: V-type proton ATPase subunit d 1      48.1    2e-05   
ref|XP_007052980.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    2e-05   
gb|EGW07490.1|  V-type proton ATPase subunit d 2                      46.6    2e-05   
ref|XP_002199841.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    2e-05   
ref|XP_006462455.1|  hypothetical protein AGABI2DRAFT_193594          52.0    2e-05   
ref|XP_005490863.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    2e-05   
ref|XP_004643151.1|  PREDICTED: V-type proton ATPase subunit d 2      46.6    2e-05   
ref|XP_009943895.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  45.8    2e-05   
ref|XP_009633859.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    2e-05   
ref|XP_004280904.1|  PREDICTED: V-type proton ATPase subunit d 1      46.6    2e-05   
ref|XP_005150898.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    2e-05   
ref|NP_001008455.1|  V-type proton ATPase subunit d 2                 45.8    2e-05   
ref|XP_009571454.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    2e-05   
gb|EPY52766.1|  V-type ATPase V0 subunit D                            42.0    2e-05   
ref|XP_626260.1|  vacuolar ATP synthase subunit d                     40.0    2e-05   
ref|XP_007992158.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  46.6    2e-05   
ref|XP_008927997.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    2e-05   
ref|XP_010288593.1|  PREDICTED: V-type proton ATPase subunit d 2-...  46.2    2e-05   
gb|KFU96211.1|  V-type proton ATPase subunit d 2                      45.8    2e-05   
ref|XP_006180684.1|  PREDICTED: V-type proton ATPase subunit d 1      46.6    2e-05   
gb|KFO10200.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
gb|KFQ65914.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
gb|KFV62933.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
gb|KFV09527.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
ref|XP_010175104.1|  PREDICTED: V-type proton ATPase subunit d 2-...  46.2    3e-05   
ref|XP_010004714.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_009908791.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
gb|KGL84154.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
ref|XP_010189135.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_003512702.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  46.2    3e-05   
ref|XP_010136465.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_009890169.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_009869037.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_008629435.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.8    3e-05   
ref|XP_008629436.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.8    3e-05   
gb|KFZ66456.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
ref|XP_010566455.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_010299393.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_010222944.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_010153748.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
gb|KFO83685.1|  V-type proton ATPase subunit d 2                      45.8    3e-05   
ref|XP_009694495.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_007125961.1|  PREDICTED: histone-lysine N-methyltransferas...  45.1    3e-05   
emb|CDS28128.1|  vacuolar h atpase                                    50.1    3e-05   
ref|XP_009672974.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_009274316.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_009488991.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_009330794.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_010074888.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    3e-05   
ref|XP_007619691.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  46.2    3e-05   
ref|XP_009956353.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    3e-05   
ref|XP_009556340.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  45.4    3e-05   
ref|XP_009820739.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    3e-05   
emb|CCD81969.1|  putative vacuolar ATP synthase subunit ac39          49.3    3e-05   
gb|KFM24428.1|  putative V-type proton ATPase subunit d               47.8    3e-05   
ref|XP_008941567.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    3e-05   
ref|XP_010403322.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    3e-05   
gb|KGB35770.1|  V-type proton ATPase subunit d                        49.3    3e-05   
ref|XP_005362405.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    3e-05   
ref|XP_003125629.1|  PREDICTED: V-type proton ATPase subunit d 2      46.6    3e-05   
gb|KFM75562.1|  V-type proton ATPase subunit d 1                      48.5    3e-05   
gb|KFO98025.1|  V-type proton ATPase subunit d 2                      45.4    3e-05   
ref|XP_008504631.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    3e-05   
ref|XP_665957.1|  ATP synthase (C/AC39) subunit                       40.0    3e-05   
gb|ACO12359.1|  Vacuolar proton pump subunit d 1                      47.4    3e-05   
ref|XP_004015638.1|  PREDICTED: V-type proton ATPase subunit d 1      48.1    4e-05   
ref|XP_002173148.1|  V-type ATPase V0 subunit D                       40.4    4e-05   
ref|XP_006202486.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    4e-05   
gb|EMC89413.1|  V-type proton ATPase subunit d 1                      47.8    4e-05   
gb|KGK37873.1|  hypothetical protein JL09_g2976                       38.5    4e-05   
ref|XP_005066866.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    4e-05   
gb|KEI42769.1|  hypothetical protein L969DRAFT_98004                  41.6    5e-05   
gb|AAH11075.1|  ATPase, H+ transporting, lysosomal V0 subunit D1      45.4    5e-05   
ref|XP_006983320.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    5e-05   
ref|XP_006113044.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  45.8    5e-05   
ref|XP_005381802.1|  PREDICTED: V-type proton ATPase subunit d 2      46.2    5e-05   
ref|XP_010977663.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
ref|XP_010950297.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
gb|KDD75707.1|  AC39 subunit of ATP synthase                          50.8    5e-05   
ref|XP_010977661.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
ref|XP_010977662.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
ref|XP_010977659.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
ref|XP_010950272.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
ref|XP_004880645.1|  PREDICTED: V-type proton ATPase subunit d 2      45.4    5e-05   
ref|XP_010950288.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    5e-05   
ref|XP_008158589.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    5e-05   
ref|XP_006194008.1|  PREDICTED: V-type proton ATPase subunit d 2      45.1    5e-05   
ref|XP_010604742.1|  PREDICTED: V-type proton ATPase subunit d 2      44.7    6e-05   
ref|XP_010950280.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.1    6e-05   
ref|XP_009015933.1|  hypothetical protein HELRODRAFT_184940           47.0    6e-05   
ref|XP_009176009.1|  hypothetical protein T265_11160                  50.8    6e-05   
ref|XP_006773187.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    6e-05   
ref|XP_005479589.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  46.2    7e-05   
ref|XP_005479590.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  46.2    7e-05   
ref|XP_005499524.1|  PREDICTED: V-type proton ATPase subunit d 2      44.3    7e-05   
ref|XP_009084850.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  45.8    7e-05   
ref|XP_009084842.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  46.2    7e-05   
ref|XP_005042325.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    7e-05   
ref|XP_005880417.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    7e-05   
ref|XP_001876273.1|  predicted protein                                47.8    7e-05   
emb|CCG82704.1|  V-type proton ATPase subunit d                       50.4    7e-05   
ref|XP_004679810.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    7e-05   
emb|CDJ97451.1|  ATPase domain containing protein                     45.8    8e-05   
gb|AAH87899.1|  ATPase, H+ transporting, lysosomal V0 subunit D2      44.7    8e-05   
dbj|GAA93897.1|  hypothetical protein E5Q_00543                       40.8    8e-05   
ref|NP_780615.2|  V-type proton ATPase subunit d 2                    44.7    8e-05   
dbj|BAC40907.1|  unnamed protein product                              44.7    8e-05   
gb|AAN61104.1|  vacuolar proton-translocating ATPase d subunit d2...  44.7    8e-05   
emb|CDJ97248.1|  ATPase domain containing protein                     45.8    8e-05   
dbj|BAE41545.1|  unnamed protein product                              44.7    8e-05   
ref|XP_008063403.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    8e-05   
gb|EDK37261.2|  conserved hypothetical protein                        42.7    8e-05   
ref|XP_003760720.1|  PREDICTED: V-type proton ATPase subunit d 1-...  42.0    9e-05   
emb|CAH92343.1|  hypothetical protein                                 45.1    9e-05   
ref|XP_009966106.1|  PREDICTED: V-type proton ATPase subunit d 2      45.8    9e-05   
ref|XP_001485688.1|  conserved hypothetical protein                   42.7    9e-05   
ref|XP_003480049.1|  PREDICTED: V-type proton ATPase subunit d 2      44.3    9e-05   
ref|XP_005537651.1|  V-type ATPase V0 subunit d                       40.4    1e-04   
emb|CCX17420.1|  Similar to V-type proton ATPase subunit d; acc. ...  41.2    1e-04   
ref|XP_004767022.1|  PREDICTED: V-type proton ATPase subunit d 2      45.1    1e-04   
ref|XP_007363947.1|  ATPase V0 complex subunit D                      49.7    1e-04   
gb|EPX72655.1|  V-type ATPase V0 subunit D                            39.3    1e-04   
ref|XP_003219584.1|  PREDICTED: V-type proton ATPase subunit d 2      44.3    1e-04   
gb|EHB00476.1|  V-type proton ATPase subunit d 2                      44.7    1e-04   
ref|XP_535118.2|  PREDICTED: V-type proton ATPase subunit d 2         43.9    1e-04   
ref|XP_005025731.1|  PREDICTED: V-type proton ATPase subunit d 1      45.1    1e-04   
emb|CEF68577.1|  V-type proton ATPase subunit d 1                     43.9    1e-04   
gb|EOA96952.1|  Vacuolar proton pump subunit d 1                      45.1    1e-04   
ref|XP_002619091.1|  hypothetical protein CLUG_00250                  40.8    2e-04   
ref|XP_002672968.1|  predicted protein                                44.7    2e-04   
ref|XP_008827680.1|  PREDICTED: V-type proton ATPase subunit d 2      44.7    2e-04   
ref|XP_002710719.1|  PREDICTED: V-type proton ATPase subunit d 2      43.5    2e-04   
gb|EYB93479.1|  hypothetical protein Y032_0181g835                    45.1    2e-04   
gb|KIH64825.1|  ATP synthase, subunit C                               45.1    2e-04   
gb|ABK26050.1|  unknown                                               48.9    2e-04   
ref|XP_004656974.1|  PREDICTED: V-type proton ATPase subunit d 2      44.7    2e-04   
ref|NP_491515.2|  Protein VHA-16                                      45.1    2e-04   
gb|ETN78315.1|  ATP synthase, subunit C                               45.1    2e-04   
gb|ELU42228.1|  vacuolar ATP synthase subunit                         38.5    2e-04   
ref|XP_010373698.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  43.5    2e-04   
ref|XP_001384326.2|  vacuolar ATPase V0 domain subunit d (36 kDa)     40.8    2e-04   
ref|XP_008570790.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
gb|ELW46916.1|  V-type proton ATPase subunit d 2                      43.5    2e-04   
gb|EIF45609.1|  vacuolar atp synthase subunit d                       37.7    2e-04   
ref|XP_008687333.1|  PREDICTED: V-type proton ATPase subunit d 2      43.9    2e-04   
ref|XP_002759089.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
ref|XP_004047288.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
ref|XP_002916941.1|  PREDICTED: v-type proton ATPase subunit d 2-...  43.9    2e-04   
ref|XP_010373697.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  43.5    2e-04   
gb|EGT54237.1|  CBN-VHA-16 protein                                    44.7    2e-04   
ref|XP_007084380.1|  PREDICTED: V-type proton ATPase subunit d 2      43.9    2e-04   
ref|XP_006160810.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
ref|XP_003940546.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
ref|XP_005328687.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
gb|EFZ22284.1|  hypothetical protein SINV_00911                       42.7    2e-04   
ref|XP_004001664.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  43.9    2e-04   
ref|XP_007999201.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
ref|XP_006736686.1|  PREDICTED: V-type proton ATPase subunit d 2-...  43.5    2e-04   
ref|XP_006727183.1|  PREDICTED: V-type proton ATPase subunit d 2      43.9    2e-04   
ref|XP_001082286.1|  PREDICTED: v-type proton ATPase subunit d 2-...  43.1    2e-04   
gb|EHH64278.1|  V-type proton ATPase subunit d 2                      43.1    2e-04   
ref|NP_001126378.1|  V-type proton ATPase subunit d 2                 43.1    2e-04   
ref|XP_004393816.1|  PREDICTED: V-type proton ATPase subunit d 2      43.5    2e-04   
ref|XP_003782554.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    2e-04   
ref|XP_009211535.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  43.1    2e-04   
gb|EPB88757.1|  V-type proton ATPase subunit D                        48.5    3e-04   
emb|CDQ02180.1|  Protein BM-VHA-16, isoform d                         45.8    3e-04   
gb|ACO15510.1|  Vacuolar proton pump subunit d                        48.5    3e-04   
ref|XP_003384589.1|  PREDICTED: v-type proton ATPase subunit d 1-...  48.5    3e-04   
gb|EIE82759.1|  ATP synthase (C/AC39) subunit                         48.5    3e-04   
gb|ELU02654.1|  hypothetical protein CAPTEDRAFT_223415                46.2    3e-04   
ref|XP_006634348.1|  PREDICTED: V-type proton ATPase subunit d 2-...  39.7    3e-04   
ref|XP_007535411.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    4e-04   
ref|XP_008542929.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  43.1    4e-04   
ref|XP_001488467.1|  PREDICTED: V-type proton ATPase subunit d 2      43.1    4e-04   
ref|XP_008542930.1|  PREDICTED: V-type proton ATPase subunit d 2 ...  43.1    4e-04   
emb|CEI86028.1|  Putative ATP synthase (C/AC39) subunit               47.8    4e-04   
ref|NP_001011972.1|  V-type proton ATPase subunit d 2                 42.4    4e-04   
ref|XP_008972883.1|  PREDICTED: V-type proton ATPase subunit d 2      42.4    4e-04   
ref|NP_689778.1|  V-type proton ATPase subunit d 2                    42.4    4e-04   
ref|NP_001187441.1|  v-type proton ATPase subunit d                   45.4    4e-04   
emb|CEG67954.1|  Putative V-type proton ATPase subunit D              48.1    5e-04   
gb|EGT53919.1|  hypothetical protein CAEBREN_07979                    43.5    5e-04   
ref|XP_005692515.1|  PREDICTED: V-type proton ATPase subunit d 1      47.8    5e-04   
gb|EUB61786.1|  V-type proton ATPase subunit d                        47.8    5e-04   
emb|CDJ01443.1|  vacuolar h atpase                                    47.8    5e-04   
gb|ESX01986.1|  V-type proton ATPase subunit d                        40.4    5e-04   
ref|NP_001087665.1|  ATPase, H+ transporting, lysosomal 38kDa, V0...  44.7    6e-04   
emb|CDS09751.1|  Putative V-type proton ATPase subunit D              47.8    6e-04   
gb|KHN76787.1|  V-type proton ATPase subunit d 1                      43.9    7e-04   
gb|ADD38178.1|  V-type proton ATPase subunit d 1                      47.4    7e-04   
gb|ERG82484.1|  v-type proton atpase subunit d 1                      43.9    7e-04   
ref|XP_006011812.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  38.5    7e-04   
ref|XP_006011814.1|  PREDICTED: V-type proton ATPase subunit d 1 ...  38.5    8e-04   
emb|CDR37548.1|  CYFA0S01e11914g1_1                                   47.0    9e-04   
ref|XP_003137311.1|  vacuolar h ATPase 16                             44.3    0.001   
gb|ETN66526.1|  vacuolar ATP synthase subunit ac39                    44.7    0.001   



>ref|XP_010029289.1| PREDICTED: V-type proton ATPase subunit d2 [Eucalyptus grandis]
 gb|KCW56175.1| hypothetical protein EUGRSUZ_I01925 [Eucalyptus grandis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 58.2 bits (139),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA+L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRASL  27



>ref|XP_010112088.1| V-type proton ATPase subunit d2 [Morus notabilis]
 gb|EXC32621.1| V-type proton ATPase subunit d2 [Morus notabilis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 57.4 bits (137),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>gb|KGN59587.1| hypothetical protein Csa_3G827290 [Cucumis sativus]
Length=361

 Score = 76.3 bits (186),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_004147464.1| PREDICTED: V-type proton ATPase subunit d2-like [Cucumis sativus]
 ref|XP_004166299.1| PREDICTED: V-type proton ATPase subunit d2-like [Cucumis sativus]
 ref|XP_008443426.1| PREDICTED: V-type proton ATPase subunit d2 [Cucumis melo]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_004489169.1| PREDICTED: V-type proton ATPase subunit d2-like [Cicer arietinum]
Length=351

 Score = 75.9 bits (185),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_007032460.1| ATPase, V0/A0 complex, subunit C/D isoform 2 [Theobroma cacao]
 gb|EOY03386.1| ATPase, V0/A0 complex, subunit C/D isoform 2 [Theobroma cacao]
Length=352

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.6 bits (135),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_007032459.1| ATPase, V0/A0 complex, subunit C/D isoform 1 [Theobroma cacao]
 gb|EOY03385.1| ATPase, V0/A0 complex, subunit C/D isoform 1 [Theobroma cacao]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.6 bits (135),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_007215618.1| hypothetical protein PRUPE_ppa007912mg [Prunus persica]
 ref|XP_008230734.1| PREDICTED: V-type proton ATPase subunit d2 [Prunus mume]
 ref|XP_008230735.1| PREDICTED: V-type proton ATPase subunit d2 [Prunus mume]
 gb|EMJ16817.1| hypothetical protein PRUPE_ppa007912mg [Prunus persica]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.6 bits (135),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_010274438.1| PREDICTED: V-type proton ATPase subunit d2-like [Nelumbo nucifera]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.6 bits (135),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEA+ RGHR++L
Sbjct  1    MYGFEALTFNIHGGYLEAVVRGHRSSL  27



>gb|KHG10145.1| V-type proton ATPase subunit d2 -like protein [Gossypium arboreum]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_010274441.1| PREDICTED: V-type proton ATPase subunit d2 [Nelumbo nucifera]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.6 bits (135),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEA+ RGHR++L
Sbjct  1    MYGFEALTFNIHGGYLEAVVRGHRSSL  27



>emb|CDX86419.1| BnaA06g31360D [Brassica napus]
Length=844

 Score = 69.7 bits (169),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  524  ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  563


 Score = 62.8 bits (151),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  176  IAGKMYGFEALTFNIHGGYLEAIARGHRAAL  268
            + G+MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  490  LKGRMYGFEALTFNIHGGYLEAIVRGHRAGL  520



>ref|XP_008775706.1| PREDICTED: V-type proton ATPase subunit d2 [Phoenix dactylifera]
Length=351

 Score = 76.6 bits (187),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_008808360.1| PREDICTED: V-type proton ATPase subunit d2-like [Phoenix dactylifera]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_010934030.1| PREDICTED: V-type proton ATPase subunit d2 [Elaeis guineensis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_009405126.1| PREDICTED: V-type proton ATPase subunit d2 [Musa acuminata subsp. 
malaccensis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>gb|KDP45481.1| hypothetical protein JCGZ_09730 [Jatropha curcas]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_010925056.1| PREDICTED: V-type proton ATPase subunit d1-like [Elaeis guineensis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>gb|KHG24135.1| V-type proton ATPase subunit d2 -like protein [Gossypium arboreum]
Length=321

 Score = 75.5 bits (184),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  252  DTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  32   DYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 56.6 bits (135),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_009407290.1| PREDICTED: V-type proton ATPase subunit d2-like [Musa acuminata 
subsp. malaccensis]
Length=351

 Score = 75.9 bits (185),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTT+
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTV  70


 Score = 56.2 bits (134),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_003534461.1| PREDICTED: V-type proton ATPase subunit d2-like isoform 1 [Glycine 
max]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGG+LEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGFLEAIVRGHRAGL  27



>ref|XP_002282568.1| PREDICTED: V-type proton ATPase subunit d2 [Vitis vinifera]
 emb|CAN79922.1| hypothetical protein VITISV_042442 [Vitis vinifera]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>gb|ACJ05375.1| vacuolar ATPase subunit d [Vigna radiata]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGG+LEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGFLEAIVRGHRAGL  27



>ref|XP_009790017.1| PREDICTED: probable V-type proton ATPase subunit d isoform X1 
[Nicotiana sylvestris]
Length=380

 Score = 77.8 bits (190),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGP+LQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPFLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA TFNIH GYLEAI RGHR+ L
Sbjct  1    MYGFEAFTFNIHSGYLEAIVRGHRSGL  27



>ref|NP_001242797.1| uncharacterized protein LOC100780773 [Glycine max]
 gb|ACU20346.1| unknown [Glycine max]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGG+LEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGFLEAIVRGHRAGL  27



>ref|XP_010528319.1| PREDICTED: V-type proton ATPase subunit d2 [Tarenaya hassleriana]
Length=351

 Score = 74.7 bits (182),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSAT+YGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATKYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_003621131.1| V-type proton ATPase subunit d2 [Medicago truncatula]
 gb|ABN08957.1| H+-transporting two-sector ATPase, C (AC39) subunit [Medicago 
truncatula]
 gb|AES77349.1| vacuolar H+ ATPase V0 sector, subunit D [Medicago truncatula]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>gb|ACJ84580.1| unknown [Medicago truncatula]
 gb|AFK38531.1| unknown [Medicago truncatula]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_007139598.1| hypothetical protein PHAVU_008G043300g [Phaseolus vulgaris]
 gb|ESW11592.1| hypothetical protein PHAVU_008G043300g [Phaseolus vulgaris]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGG+LEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGFLEAIVRGHRAGL  27



>gb|ACJ84285.1| unknown [Medicago truncatula]
Length=312

 Score = 76.3 bits (186),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_008341542.1| PREDICTED: V-type proton ATPase subunit d2 [Malus domestica]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_004302350.1| PREDICTED: V-type proton ATPase subunit d2-like [Fragaria vesca 
subsp. vesca]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>gb|AFK43068.1| unknown [Medicago truncatula]
Length=312

 Score = 76.3 bits (186),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_009347070.1| PREDICTED: V-type proton ATPase subunit d2 [Pyrus x bretschneideri]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_010554029.1| PREDICTED: V-type proton ATPase subunit d2-like [Tarenaya hassleriana]
Length=351

 Score = 74.3 bits (181),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSAT+YGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATKYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_009342867.1| PREDICTED: V-type proton ATPase subunit d2-like [Pyrus x bretschneideri]
Length=351

 Score = 75.9 bits (185),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_008379822.1| PREDICTED: V-type proton ATPase subunit d2-like [Malus domestica]
Length=227

 Score = 75.9 bits (185),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +  D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  29   TAADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.5 bits (132),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_003621132.1| V-type proton ATPase subunit d2 [Medicago truncatula]
Length=219

 Score = 75.1 bits (183),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 55.8 bits (133),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|NP_001189996.1| V-type proton ATPase subunit d2 [Arabidopsis thaliana]
 gb|AEE77482.1| V-type proton ATPase subunit d2 [Arabidopsis thaliana]
Length=343

 Score = 73.2 bits (178),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_006339198.1| PREDICTED: V-type proton ATPase subunit d2-like [Solanum tuberosum]
 ref|XP_010312197.1| PREDICTED: V-type proton ATPase subunit d2 [Solanum lycopersicum]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIH GYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHSGYLEAIVRGHRSGL  27



>ref|XP_009129362.1| PREDICTED: V-type proton ATPase subunit d1-like [Brassica rapa]
 emb|CDY47250.1| BnaA02g29360D [Brassica napus]
 emb|CDY04027.1| BnaC02g37420D [Brassica napus]
Length=351

 Score = 73.2 bits (178),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|NP_189513.1| V-type proton ATPase subunit d2 [Arabidopsis thaliana]
 sp|Q9LHA4.1|VA0D2_ARATH RecName: Full=V-type proton ATPase subunit d2; Short=V-ATPase 
subunit d2; AltName: Full=Vacuolar H(+)-ATPase subunit d isoform 
2; AltName: Full=Vacuolar proton pump subunit d2 [Arabidopsis 
thaliana]
 gb|AAL16278.1|AF428348_1 AT3g28715/MZN14_21 [Arabidopsis thaliana]
 dbj|BAB03168.1| vacuolar atp synthase subunit (vacuolar proton pump) [Arabidopsis 
thaliana]
 gb|AAL32713.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15473.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE77481.1| V-type proton ATPase subunit d2 [Arabidopsis thaliana]
Length=351

 Score = 73.2 bits (178),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGPYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_009616415.1| PREDICTED: V-type proton ATPase subunit d2 [Nicotiana tomentosiformis]
 ref|XP_009616416.1| PREDICTED: V-type proton ATPase subunit d2 [Nicotiana tomentosiformis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +  D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  29   TSADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIH GYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHSGYLEAIVRGHRSGL  27



>ref|XP_006431094.1| hypothetical protein CICLE_v10012084mg [Citrus clementina]
 ref|XP_006482548.1| PREDICTED: V-type proton ATPase subunit d2-like [Citrus sinensis]
 gb|ESR44334.1| hypothetical protein CICLE_v10012084mg [Citrus clementina]
 gb|KDO72500.1| hypothetical protein CISIN_1g018459mg [Citrus sinensis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RG+RA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGYRAGL  27



>ref|XP_009765131.1| PREDICTED: V-type proton ATPase subunit d2 [Nicotiana sylvestris]
 ref|XP_009765132.1| PREDICTED: V-type proton ATPase subunit d2 [Nicotiana sylvestris]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIH GYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHSGYLEAIVRGHRSGL  27



>gb|KDO72499.1| hypothetical protein CISIN_1g018459mg [Citrus sinensis]
Length=348

 Score = 76.3 bits (186),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RG+RA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGYRAGL  27



>ref|XP_011098583.1| PREDICTED: V-type proton ATPase subunit d2 [Sesamum indicum]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.5 bits (127),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RG+R+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGYRSGL  27



>gb|EYU34665.1| hypothetical protein MIMGU_mgv1a009170mg [Erythranthe guttata]
Length=351

 Score = 73.6 bits (179),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGAYLQNEPSPLHTTTI  70


 Score = 56.2 bits (134),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRSGL  27



>gb|KDO72502.1| hypothetical protein CISIN_1g018459mg [Citrus sinensis]
Length=355

 Score = 75.5 bits (184),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 54.3 bits (129),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RG+RA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGYRAGL  27



>ref|XP_002324040.1| hypothetical protein POPTR_0017s11530g [Populus trichocarpa]
 ref|XP_011005075.1| PREDICTED: V-type proton ATPase subunit d2 [Populus euphratica]
 gb|EEF04173.1| hypothetical protein POPTR_0017s11530g [Populus trichocarpa]
Length=351

 Score = 74.3 bits (181),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHT TI
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTITI  70


 Score = 55.5 bits (132),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>gb|EPS71418.1| hypothetical protein M569_03330 [Genlisea aurea]
Length=351

 Score = 75.9 bits (185),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   SDYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.5 bits (127),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RG+R+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGYRSGL  27



>ref|XP_006431093.1| hypothetical protein CICLE_v10012084mg [Citrus clementina]
 gb|ESR44333.1| hypothetical protein CICLE_v10012084mg [Citrus clementina]
 gb|KDO72503.1| hypothetical protein CISIN_1g018459mg [Citrus sinensis]
 gb|KDO72504.1| hypothetical protein CISIN_1g018459mg [Citrus sinensis]
Length=268

 Score = 75.5 bits (184),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +  D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  29   TAADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.9 bits (128),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RG+RA L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGYRAGL  27



>ref|XP_010693325.1| PREDICTED: V-type proton ATPase subunit d2 [Beta vulgaris subsp. 
vulgaris]
Length=351

 Score = 73.6 bits (179),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSAT+YGPYLQNEP PLHTTT+
Sbjct  31   ADYNNLCQCETLDDIKMHLSATDYGPYLQNEPSPLHTTTL  70


 Score = 55.5 bits (132),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+TFNIHGGYLEAI RGHR+ L
Sbjct  1    MYGFEAMTFNIHGGYLEAIVRGHRSGL  27



>ref|XP_002521559.1| vacuolar ATP synthase subunit ac39, putative [Ricinus communis]
 gb|EEF40830.1| vacuolar ATP synthase subunit ac39, putative [Ricinus communis]
Length=351

 Score = 76.3 bits (186),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 52.8 bits (125),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNI GGYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNIDGGYLEAIVRGHRSGL  27



>ref|XP_009629848.1| PREDICTED: V-type proton ATPase subunit d2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=379

 Score = 75.1 bits (183),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGP+LQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPFLQNEPSPLHTTTI  70


 Score = 53.5 bits (127),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFN H GYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNTHSGYLEAIVRGHRSGL  27



>ref|XP_010514580.1| PREDICTED: V-type proton ATPase subunit d1-like [Camelina sativa]
Length=365

 Score = 70.5 bits (171),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  45   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  84


 Score = 57.0 bits (136),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  15   MYGFEALTFNIHGGYLEAIVRGHRAGL  41



>ref|XP_010502940.1| PREDICTED: V-type proton ATPase subunit d1-like [Camelina sativa]
Length=355

 Score = 70.1 bits (170),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.4 bits (137),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_009790018.1| PREDICTED: V-type proton ATPase subunit d2-like isoform X2 [Nicotiana 
sylvestris]
Length=352

 Score = 75.1 bits (183),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGP+LQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPFLQNEPSPLHTTTI  70


 Score = 52.4 bits (124),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA TFNIH GYLEAI RGHR+ L
Sbjct  1    MYGFEAFTFNIHSGYLEAIVRGHRSGL  27



>ref|XP_010425652.1| PREDICTED: V-type proton ATPase subunit d1-like [Camelina sativa]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_006395348.1| hypothetical protein EUTSA_v10004498mg [Eutrema salsugineum]
 gb|ESQ32634.1| hypothetical protein EUTSA_v10004498mg [Eutrema salsugineum]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|NP_189512.1| V-type proton ATPase subunit d1 [Arabidopsis thaliana]
 ref|XP_002875466.1| hypothetical protein ARALYDRAFT_484647 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002877125.1| hypothetical protein ARALYDRAFT_484645 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006395349.1| hypothetical protein EUTSA_v10004497mg [Eutrema salsugineum]
 ref|XP_009111605.1| PREDICTED: V-type proton ATPase subunit d1 [Brassica rapa]
 sp|Q9LJI5.1|VA0D1_ARATH RecName: Full=V-type proton ATPase subunit d1; Short=V-ATPase 
subunit d1; AltName: Full=Vacuolar H(+)-ATPase subunit d isoform 
1; AltName: Full=Vacuolar proton pump subunit d1 [Arabidopsis 
thaliana]
 dbj|BAB02186.1| vacuolar ATP synthase subunit AC39 [Arabidopsis thaliana]
 gb|AAK63968.1| AT3g28710/MZN14_20 [Arabidopsis thaliana]
 gb|AAL76134.1| AT3g28710/MZN14_20 [Arabidopsis thaliana]
 gb|AAN13080.1| putative adenosine triphosphatase [Arabidopsis thaliana]
 gb|EFH51725.1| hypothetical protein ARALYDRAFT_484647 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53384.1| hypothetical protein ARALYDRAFT_484645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE77480.1| V-type proton ATPase subunit d1 [Arabidopsis thaliana]
 gb|ESQ32635.1| hypothetical protein EUTSA_v10004497mg [Eutrema salsugineum]
 emb|CDY20018.1| BnaA09g02330D [Brassica napus]
 emb|CDY00120.1| BnaC09g01810D [Brassica napus]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>gb|AAG40030.1|AF324679_1 AT3g28710 [Arabidopsis thaliana]
 gb|AAG42915.1|AF327534_1 putative adenosine triphosphatase [Arabidopsis thaliana]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_009151855.1| PREDICTED: V-type proton ATPase subunit d1-like [Brassica rapa]
 emb|CDX85215.1| BnaC07g25260D [Brassica napus]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_006291408.1| hypothetical protein CARUB_v10017547mg [Capsella rubella]
 ref|XP_010502939.1| PREDICTED: V-type proton ATPase subunit d1 [Camelina sativa]
 ref|XP_010514582.1| PREDICTED: V-type proton ATPase subunit d1 [Camelina sativa]
 ref|XP_010425651.1| PREDICTED: V-type proton ATPase subunit d1 [Camelina sativa]
 gb|EOA24306.1| hypothetical protein CARUB_v10017547mg [Capsella rubella]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_006291406.1| hypothetical protein CARUB_v10017545mg [Capsella rubella]
 gb|EOA24304.1| hypothetical protein CARUB_v10017545mg [Capsella rubella]
Length=351

 Score = 70.1 bits (170),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  70


 Score = 57.0 bits (136),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RGHRA L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGHRAGL  27



>ref|XP_009629856.1| PREDICTED: V-type proton ATPase subunit d2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=351

 Score = 75.1 bits (183),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGP+LQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPFLQNEPSPLHTTTI  70


 Score = 52.0 bits (123),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFN H GYLEAI RGHR+ L
Sbjct  1    MYGFEALTFNTHSGYLEAIVRGHRSGL  27



>ref|XP_011085772.1| PREDICTED: V-type proton ATPase subunit d1-like [Sesamum indicum]
Length=351

 Score = 73.6 bits (179),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGSYLQNEPSPLHTTTI  70


 Score = 53.5 bits (127),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RG+R+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGYRSGL  27



>gb|EYU34106.1| hypothetical protein MIMGU_mgv1a009166mg [Erythranthe guttata]
Length=351

 Score = 73.2 bits (178),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYG YLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGSYLQNEPSPLHTTTI  70


 Score = 53.5 bits (127),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RG+R+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGYRSGL  27



>gb|KHN13648.1| V-type proton ATPase subunit d2 [Glycine soja]
Length=408

 Score = 75.5 bits (184),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  30   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  69


 Score = 51.2 bits (121),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGG+L AI RGHRA L
Sbjct  1    MYGFEALTFNIHGGFL-AIVRGHRAGL  26



>gb|ABR16673.1| unknown [Picea sitchensis]
Length=351

 Score = 72.8 bits (177),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   L QCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLSQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 53.5 bits (127),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGGYLEAI RG+R+ L
Sbjct  1    MYGFEALTFNIHGGYLEAIVRGYRSGL  27



>gb|EMS47297.1| putative V-type proton ATPase subunit d [Triticum urartu]
Length=401

 Score = 80.5 bits (197),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++ D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  29   TQADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 42.7 bits (99),  Expect(2) = 8e-20, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MY +E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYSWEMLSFNIHDGFLEAIVRGNRSGL  27



>emb|CAD27914.1| putative vacuolar ATPase subunit d [Mesembryanthemum crystallinum]
Length=353

 Score = 72.4 bits (176),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSAT+YGPYLQNEP PLHTTT+
Sbjct  31   ADYNNLCQCETLDDIKMHLSATDYGPYLQNEPSPLHTTTL  70


 Score = 50.1 bits (118),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEA+ FN+HGGYLEAI RG+R+ L
Sbjct  1    MYGFEAMNFNVHGGYLEAIVRGYRSGL  27



>gb|ABG23315.1| vacuolar proton-ATPase D subunit [Triticum aestivum]
 gb|EMT15889.1| Putative V-type proton ATPase subunit d [Aegilops tauschii]
Length=351

 Score = 77.0 bits (188),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++ D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  29   TQADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 42.4 bits (98),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MY +E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYSWEMLSFNIHDGFLEAIVRGNRSGL  27



>emb|CDM83070.1| unnamed protein product [Triticum aestivum]
Length=351

 Score = 77.0 bits (188),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++ D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  29   TQADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 42.4 bits (98),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MY +E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYSWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|XP_002458058.1| hypothetical protein SORBIDRAFT_03g026290 [Sorghum bicolor]
 gb|ACR36866.1| unknown [Zea mays]
 gb|ACF86788.2| unknown [Zea mays]
 gb|EES03178.1| hypothetical protein SORBIDRAFT_03g026290 [Sorghum bicolor]
 tpg|DAA58720.1| TPA: hypothetical protein ZEAMMB73_647212 [Zea mays]
Length=351

 Score = 75.1 bits (183),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHL+ATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLTATEYGPYLQNEPSPLHTTTI  70


 Score = 44.7 bits (104),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG+E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYGWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|XP_004969389.1| PREDICTED: probable V-type proton ATPase subunit d-like [Setaria 
italica]
Length=351

 Score = 74.7 bits (182),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHL+ATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLTATEYGPYLQNEPSPLHTTTI  70


 Score = 44.7 bits (104),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG+E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYGWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|XP_002972191.1| hypothetical protein SELMODRAFT_96980 [Selaginella moellendorffii]
 ref|XP_002977503.1| hypothetical protein SELMODRAFT_176203 [Selaginella moellendorffii]
 gb|EFJ21507.1| hypothetical protein SELMODRAFT_176203 [Selaginella moellendorffii]
 gb|EFJ27108.1| hypothetical protein SELMODRAFT_96980 [Selaginella moellendorffii]
Length=351

 Score = 69.3 bits (168),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   L QCETLDDIKMHLSAT+YGPYLQNEP PLHTT I
Sbjct  31   ADYNNLSQCETLDDIKMHLSATDYGPYLQNEPSPLHTTNI  70


 Score = 49.7 bits (117),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEALTFNIHGG+LEAI RG R+ +
Sbjct  1    MYGFEALTFNIHGGFLEAIVRGFRSGM  27



>ref|XP_003569277.1| PREDICTED: probable V-type proton ATPase subunit d [Brachypodium 
distachyon]
Length=351

 Score = 76.6 bits (187),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  70


 Score = 42.4 bits (98),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MY +E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYSWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|NP_001146493.1| hypothetical protein [Zea mays]
 gb|ACL54144.1| unknown [Zea mays]
 tpg|DAA58719.1| TPA: hypothetical protein ZEAMMB73_647212 [Zea mays]
Length=197

 Score = 73.9 bits (180),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +  D   LCQCETLDDIKMHL+ATEYGPYLQNEP PLHTTTI
Sbjct  29   TAADYNNLCQCETLDDIKMHLTATEYGPYLQNEPSPLHTTTI  70


 Score = 44.3 bits (103),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG+E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYGWEMLSFNIHDGFLEAIVRGNRSGL  27



>tpg|DAA58721.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_647212 
[Zea mays]
Length=169

 Score = 73.9 bits (180),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +  D   LCQCETLDDIKMHL+ATEYGPYLQNEP PLHTTTI
Sbjct  29   TAADYNNLCQCETLDDIKMHLTATEYGPYLQNEPSPLHTTTI  70


 Score = 44.3 bits (103),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG+E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYGWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|XP_006644318.1| PREDICTED: probable V-type proton ATPase subunit d-like [Oryza 
brachyantha]
Length=351

 Score = 72.8 bits (177),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDD+KMHL+ATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDVKMHLTATEYGPYLQNEPSPLHTTTI  70


 Score = 44.7 bits (104),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG+E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYGWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|NP_001043429.1| Os01g0587000 [Oryza sativa Japonica Group]
 sp|Q8RU33.1|VA0D_ORYSJ RecName: Full=Probable V-type proton ATPase subunit d; Short=V-ATPase 
subunit d; AltName: Full=Vacuolar proton pump subunit 
d [Oryza sativa Japonica Group]
 dbj|BAB89911.1| putative Vacuolar ATP synthase subunit d [Oryza sativa Japonica 
Group]
 dbj|BAF05343.1| Os01g0587000 [Oryza sativa Japonica Group]
 dbj|BAG90498.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70980.1| hypothetical protein OsI_02618 [Oryza sativa Indica Group]
 gb|EEE54888.1| hypothetical protein OsJ_02396 [Oryza sativa Japonica Group]
Length=351

 Score = 72.8 bits (177),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDD+KMHL+ATEYGPYLQNEP PLHTTTI
Sbjct  31   ADYNNLCQCENLDDVKMHLTATEYGPYLQNEPSPLHTTTI  70


 Score = 44.7 bits (104),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG+E L+FNIH G+LEAI RG+R+ L
Sbjct  1    MYGWEMLSFNIHDGFLEAIVRGNRSGL  27



>ref|XP_001784307.1| predicted protein [Physcomitrella patens]
 gb|EDQ50869.1| predicted protein [Physcomitrella patens]
Length=353

 Score = 69.3 bits (168),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +  D   LCQCETLDDIKMHL AT+YGPYL NEP PLHT TI
Sbjct  31   TSADYNNLCQCETLDDIKMHLGATDYGPYLANEPSPLHTATI  72


 Score = 47.4 bits (111),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFEAL FN+ GGYLEAI RG+R+ L
Sbjct  3    MYGFEALNFNVDGGYLEAIVRGYRSGL  29



>ref|XP_005650648.1| vacuolar H+ ATPase V0 sector, subunit D [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26104.1| vacuolar H+ ATPase V0 sector, subunit D [Coccomyxa subellipsoidea 
C-169]
Length=351

 Score = 63.5 bits (153),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  252  DTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            D   LCQCETL+DIK++L++T+YGPYL NEP PLHTTTI
Sbjct  32   DYNNLCQCETLEDIKLNLTSTDYGPYLANEPSPLHTTTI  70


 Score = 42.0 bits (97),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG E+L FNI  GY++A+ RGHR+ L
Sbjct  1    MYGLESLWFNIKDGYVDAVVRGHRSGL  27



>ref|XP_006855526.1| hypothetical protein AMTR_s00057p00210030 [Amborella trichopoda]
 gb|ERN16993.1| hypothetical protein AMTR_s00057p00210030 [Amborella trichopoda]
Length=346

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCETLDDIKMHLSATEYGPYLQNEP PLHTTTI
Sbjct  26   ADYNNLCQCETLDDIKMHLSATEYGPYLQNEPSPLHTTTI  65



>emb|CDX95344.1| BnaC04g28140D [Brassica napus]
Length=92

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   LCQCE LDDIKMHLSAT+YG YLQNEP PLHTTTI
Sbjct  22   ADYNNLCQCENLDDIKMHLSATKYGSYLQNEPSPLHTTTI  61



>ref|XP_002946855.1| vacuolar H+ ATPase V0 sector, subunit D [Volvox carteri f. nagariensis]
 gb|EFJ52081.1| vacuolar H+ ATPase V0 sector, subunit D [Volvox carteri f. nagariensis]
Length=351

 Score = 51.6 bits (122),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            GD   L QCETL+DIKM+L++T+YG Y+ NE  P++T  I
Sbjct  31   GDYNNLSQCETLEDIKMNLTSTDYGAYIANEASPIYTANI  70


 Score = 43.9 bits (102),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYG E +TFNI  G+LEAI RGHR+ L
Sbjct  1    MYGLEMMTFNIKDGFLEAIVRGHRSGL  27



>ref|XP_001703440.1| vacuolar H+ ATPase V0 sector, subunit D [Chlamydomonas reinhardtii]
 gb|EDP06122.1| vacuolar H+ ATPase V0 sector, subunit D [Chlamydomonas reinhardtii]
Length=351

 Score = 54.3 bits (129),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   L QCETL+DIK++L+AT+YGPYL NE  P++T TI
Sbjct  31   ADYNNLSQCETLEDIKLNLTATDYGPYLVNEASPIYTATI  70


 Score = 39.3 bits (90),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            MYGFE ++FNI  G+LE + R HR  +
Sbjct  1    MYGFEMMSFNIKDGFLEGVVRSHRTGM  27



>ref|XP_007879700.1| hypothetical protein PFL1_03986 [Pseudozyma flocculosa PF-1]
 gb|EPQ28683.1| hypothetical protein PFL1_03986 [Pseudozyma flocculosa PF-1]
Length=354

 Score = 56.2 bits (134),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM L AT+YG +LQNEP PL T+TI
Sbjct  33   LTQCETLDDFKMQLQATDYGNFLQNEPSPLSTSTI  67


 Score = 32.3 bits (72),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
             E ++FNI  GYLE + RG+R++L
Sbjct  1    MEMISFNIDTGYLEGVVRGYRSSL  24



>ref|XP_004340986.1| Vacuolar proton pump d subunit, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18922.1| Vacuolar proton pump d subunit, putative [Acanthamoeba castellanii 
str. Neff]
Length=304

 Score = 58.5 bits (140),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   L QCE+L+D+K+HL++T+YG +LQNEP P+HTTTI
Sbjct  45   ADYANLTQCESLEDMKLHLASTDYGDFLQNEPSPIHTTTI  84


 Score = 29.6 bits (65),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  206  LTFNIHGGYLEAIARGHRAAL  268
            +TFNI  G+ EAI RG+R+ +
Sbjct  21   MTFNIDDGFPEAIVRGYRSGI  41



>emb|CDI53644.1| probable vacuolar atp synthase subunit d [Melanopsichium pennsylvanicum 
4]
Length=356

 Score = 55.5 bits (132),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM L AT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLQATDYGNFLQNEPSPISTSTI  67


 Score = 32.3 bits (72),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRN  280
            E ++FN+  GYLE + RG+R++L   N
Sbjct  2    EMISFNVDHGYLEGVVRGYRSSLLTAN  28



>gb|KDQ62295.1| hypothetical protein JAAARDRAFT_66057 [Jaapia argillacea MUCL 
33604]
Length=364

 Score = 54.7 bits (130),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD +M LSAT+YG +L NEP PL T+TI
Sbjct  33   LTQCETLDDFRMQLSATDYGNFLANEPSPLSTSTI  67


 Score = 32.7 bits (73),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL FN+  G+LE I RG++A +  +N 
Sbjct  2    EALFFNVSSGFLEGIVRGYKAGILTQNQ  29



>dbj|GAK64285.1| ATPase V0 complex subunit D [Pseudozyma antarctica]
Length=362

 Score = 57.4 bits (137),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM LSAT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLSATDYGNFLQNEPSPISTSTI  67


 Score = 30.0 bits (66),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E ++FN+  G+LE + RG+R +L
Sbjct  2    EMISFNVDHGFLEGVVRGYRTSL  24



>gb|ETS64657.1| hypothetical protein PaG_00601 [Pseudozyma aphidis DSM 70725]
Length=362

 Score = 57.0 bits (136),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM LSAT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLSATDYGNFLQNEPSPISTSTI  67


 Score = 30.0 bits (66),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E ++FN+  G+LE + RG+R +L
Sbjct  2    EMISFNVDHGFLEGVVRGYRTSL  24



>ref|XP_007351085.1| vacuolar ATP synthase subunit D 1 [Auricularia delicata TFB-10046 
SS5]
 gb|EJD40922.1| vacuolar ATP synthase subunit D 1 [Auricularia delicata TFB-10046 
SS5]
Length=359

 Score = 55.1 bits (131),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++G+   L QCETLDD +M LS+T+YG +L NEP PL T+TI
Sbjct  26   TQGNYANLTQCETLDDFRMQLSSTDYGNFLANEPLPLTTSTI  67


 Score = 32.0 bits (71),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  GYLE I RG+++ L
Sbjct  2    EALFFNVSSGYLEGIVRGYKSGL  24



>dbj|GAC71664.1| vacuolar H+-ATPase V0 sector, subunit d [Pseudozyma antarctica 
T-34]
Length=362

 Score = 57.0 bits (136),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM LSAT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLSATDYGNFLQNEPSPISTSTI  67


 Score = 30.0 bits (66),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E ++FN+  G+LE + RG+R +L
Sbjct  2    EMISFNVDHGFLEGVVRGYRTSL  24



>gb|EJT48677.1| vacuolar ATP synthase subunit d [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKC97367.1| vacuolar ATP synthase subunit d [Trichosporon asahii var. asahii 
CBS 8904]
Length=348

 Score = 49.3 bits (116),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D ++ LSAT+YG +L NEP PL T TI
Sbjct  33   LTQCENLEDFRLQLSATDYGNFLANEPLPLSTATI  67


 Score = 37.4 bits (85),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL FN+  GYLE I RG+R AL  +N+
Sbjct  2    EALQFNVDNGYLEGIVRGYRGALLTQNN  29



>ref|XP_005718344.1| unnamed protein product [Chondrus crispus]
 emb|CDF38451.1| unnamed protein product [Chondrus crispus]
Length=449

 Score = 58.2 bits (139),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S  D   L QCE+LDD++MHL+AT+YG +LQNEP PL T TI
Sbjct  126  SSSDFVALTQCESLDDVRMHLTATDYGNFLQNEPTPLSTKTI  167


 Score = 28.5 bits (62),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +2

Query  206  LTFNIHGGYLEAIARGHRAAL  268
            L FN+  GYLE I RG+R+  
Sbjct  104  LLFNVDDGYLEGILRGYRSGF  124



>gb|EST05411.1| vacuolar H+-ATPase [Pseudozyma brasiliensis GHG001]
Length=362

 Score = 55.5 bits (132),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM L AT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLQATDYGNFLQNEPSPISTSTI  67


 Score = 31.2 bits (69),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            E ++FN+  G+LE I RG+R +L   N+
Sbjct  2    EMISFNMDHGFLEGIVRGYRTSLLTSNN  29



>ref|XP_001730381.1| hypothetical protein MGL_2763 [Malassezia globosa CBS 7966]
 gb|EDP43167.1| hypothetical protein MGL_2763 [Malassezia globosa CBS 7966]
Length=354

 Score = 50.1 bits (118),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D++M LSAT+YG +L NEP PL T+ I
Sbjct  33   LTQCENLEDLRMQLSATDYGNFLANEPSPLATSAI  67


 Score = 36.6 bits (83),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL+FNI+GGYLE I RG++ ++
Sbjct  2    EALSFNINGGYLEGIVRGYKNSM  24



>ref|XP_008037822.1| ATPase V0 complex subunit D [Trametes versicolor FP-101664 SS1]
 gb|EIW59499.1| ATPase V0 complex subunit D [Trametes versicolor FP-101664 SS1]
Length=375

 Score = 50.1 bits (118),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCET++D +  LSAT+YG +L NEP P+ T+TI
Sbjct  33   LTQCETIEDFRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 35.8 bits (81),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL FN+ GG+LE I RG++A L  +N 
Sbjct  2    EALLFNVSGGFLEGIVRGYKAGLLTQNQ  29



>ref|XP_758929.1| hypothetical protein UM02782.1 [Ustilago maydis 521]
 gb|EAK83693.1| hypothetical protein UM02782.1 [Ustilago maydis 521]
Length=365

 Score = 55.5 bits (132),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM L AT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLQATDYGNFLQNEPSPISTSTI  67


 Score = 30.4 bits (67),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRN  280
            E ++FN+  G+LE + RG+R +L   N
Sbjct  2    EMISFNVDHGFLEGVVRGYRTSLLTAN  28



>emb|CCF53024.1| probable vacuolar atp synthase subunit d [Ustilago hordei]
Length=358

 Score = 58.2 bits (139),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM LSAT+YG +LQNEP+P+ T+TI
Sbjct  33   LTQCETLDDFKMQLSATDYGNFLQNEPWPISTSTI  67


 Score = 27.7 bits (60),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (63%), Gaps = 0/27 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRN  280
            E ++FN+  G+LE + RG+  +L   N
Sbjct  2    EMISFNVDHGFLEGVVRGYCTSLLASN  28



>emb|CBQ73181.1| probable vacuolar atp synthase subunit d [Sporisorium reilianum 
SRZ2]
Length=360

 Score = 55.5 bits (132),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM L AT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLQATDYGNFLQNEPSPISTSTI  67


 Score = 30.4 bits (67),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRN  280
            E ++FN+  G+LE + RG+R +L   N
Sbjct  2    EMISFNVDHGFLEGVVRGYRTSLLTAN  28



>dbj|GAC93399.1| hypothetical protein PHSY_000964 [Pseudozyma hubeiensis SY62]
Length=360

 Score = 55.5 bits (132),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD KM L AT+YG +LQNEP P+ T+TI
Sbjct  33   LTQCETLDDFKMQLQATDYGNFLQNEPSPISTSTI  67


 Score = 30.4 bits (67),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAALPVRN  280
             E ++FN+  G+LE + RG+R +L   N
Sbjct  1    MEMISFNVDHGFLEGVVRGYRTSLLTAN  28



>gb|EPT05205.1| hypothetical protein FOMPIDRAFT_69178 [Fomitopsis pinicola FP-58527 
SS1]
Length=373

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCET++D +  LSATEYG +L NEP P+ T+TI
Sbjct  33   LTQCETIEDFRTQLSATEYGNFLANEPLPISTSTI  67


 Score = 33.5 bits (75),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL FN+  G+LE I RG++A L  +N 
Sbjct  2    EALFFNVDNGFLEGIVRGYKAGLLTQNQ  29



>gb|KEP50904.1| V-type proton ATPase subunit D [Rhizoctonia solani 123E]
Length=370

 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +M L+AT+YG +L NEP P+ T+TI
Sbjct  33   LTQCETLEDFRMQLAATDYGNFLANEPLPISTSTI  67


 Score = 33.9 bits (76),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+ GG+LE + RG++A L
Sbjct  2    EALFFNVSGGFLEGVLRGYKAGL  24



>gb|KDR82832.1| hypothetical protein GALMADRAFT_238435 [Galerina marginata CBS 
339.88]
Length=359

 Score = 50.1 bits (118),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +  LSAT+YG +L NEP P+ T+TI
Sbjct  33   LAQCETLEDFRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 34.7 bits (78),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL FN++ G+LEAI RG++A +  +N 
Sbjct  2    EALFFNVNNGFLEAIVRGYKAGVLTQNQ  29



>ref|XP_005844973.1| hypothetical protein CHLNCDRAFT_138366 [Chlorella variabilis]
 gb|EFN52871.1| hypothetical protein CHLNCDRAFT_138366 [Chlorella variabilis]
Length=346

 Score = 58.2 bits (139),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  252  DTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            D   LCQCETL+DIK++L+ T+YGP+L NE  P+HTTT+
Sbjct  27   DYNNLCQCETLEDIKLYLTGTDYGPFLANEASPMHTTTL  65


 Score = 26.6 bits (57),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FN+  G+LEA+ RG++  L
Sbjct  4    FNVKDGFLEAVVRGYKLGL  22



>ref|XP_007866748.1| ATPase, V0 complex, subunit D [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ54439.1| ATPase, V0 complex, subunit D [Gloeophyllum trabeum ATCC 11539]
Length=366

 Score = 54.3 bits (129),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD +M LSAT+YG +L NEP PL T+TI
Sbjct  33   LTQCETLDDFRMQLSATDYGNFLANEPSPLSTSTI  67


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LE I RG++A +
Sbjct  2    EALFFNVSNGFLEGILRGYKAGI  24



>gb|EUC63240.1| V-type proton ATPase subunit D 1 [Rhizoctonia solani AG-3 Rhs1AP]
Length=352

 Score = 51.2 bits (121),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +M L+AT+YG +L NEP P+ T+TI
Sbjct  33   LTQCETLEDFRMQLAATDYGNFLANEPLPISTSTI  67


 Score = 32.3 bits (72),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+ GG+LE + RG++A L
Sbjct  2    EALFFNVSGGFLEGVLRGYKAGL  24



>emb|CCU97397.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=347

 Score = 50.4 bits (119),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D++M LSAT+YG +L NEP PL  + I
Sbjct  33   LTQCETLEDLRMQLSATDYGNFLANEPSPLAVSAI  67


 Score = 33.1 bits (74),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
             EALTFNI+GG++E I RG+  ++
Sbjct  1    MEALTFNINGGFVEGIVRGYMNSM  24



>ref|XP_006682371.1| hypothetical protein BATDEDRAFT_20958 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77004.1| hypothetical protein BATDEDRAFT_20958 [Batrachochytrium dendrobatidis 
JAM81]
Length=346

 Score = 54.3 bits (129),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D K+ L+AT+YG +LQNEP P+ TTTI
Sbjct  33   LIQCETLEDFKLQLAATDYGNFLQNEPSPIATTTI  67


 Score = 29.3 bits (64),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E+L FN+  G+LE I RG++A +
Sbjct  2    ESLFFNVEVGFLEGIVRGYKAGI  24



>gb|KHJ45470.1| ATP synthase, subunit C [Trichuris suis]
Length=773

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPL  353
            S  D   L QC+TL+D+K+HL +T+YG +L NEP P+
Sbjct  451  SPSDYSNLVQCDTLEDLKLHLQSTDYGQFLANEPGPI  487


 Score = 35.4 bits (80),  Expect(2) = 5e-08, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 5/52 (10%)
 Frame = +2

Query  113  LEGLLYPSVFRIRLRSLTNLSIAGKMYGFEALTFNIHGGYLEAIARGHRAAL  268
            L G+ Y ++F I     ++   A  M  FE L FNI+ GYLE + RG R  +
Sbjct  403  LYGIGYSNLFVI-----SSKRTAFSMVSFEELMFNINHGYLEGLVRGFRGGI  449



>gb|KDN51307.1| putative vacuolar atp synthase subunit D [Tilletiaria anomala 
UBC 951]
Length=359

 Score = 50.4 bits (119),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D +M LSAT+YG +L NEP P+ T+TI
Sbjct  33   LTQCENLEDFRMQLSATDYGNFLANEPSPISTSTI  67


 Score = 32.3 bits (72),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
             E ++FNI  GYLE + RG+RA L
Sbjct  1    MEMISFNIANGYLEGVVRGYRAGL  24



>ref|XP_006956386.1| vacuolar ATP synthase subunit D [Wallemia sebi CBS 633.66]
 gb|EIM23721.1| vacuolar ATP synthase subunit D [Wallemia sebi CBS 633.66]
Length=357

 Score = 45.8 bits (107),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC+TL+D +M LSAT+YG +L NE  PL T+ I
Sbjct  38   LQQCDTLEDFRMQLSATDYGNFLANESLPLSTSKI  72


 Score = 37.0 bits (84),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  194  GFEALTFNIHGGYLEAIARGHRAAL  268
            G E L FN+H GYLE I RG++AAL
Sbjct  5    GSEMLFFNVHNGYLEGILRGYKAAL  29



>ref|XP_001835929.1| vacuolar ATP synthase subunit [Coprinopsis cinerea okayama7#130]
 gb|EAU85994.1| vacuolar ATP synthase subunit [Coprinopsis cinerea okayama7#130]
Length=357

 Score = 50.4 bits (119),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +  LSAT+YG +L NEP PL T+TI
Sbjct  33   LTQCETLEDFRTQLSATDYGNFLANEPLPLSTSTI  67


 Score = 32.0 bits (71),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +2

Query  203  ALTFNIHGGYLEAIARGHRAALPVRNS  283
            AL+FNI+ G+LE + RG++A +  +N 
Sbjct  3    ALSFNINHGFLEGVVRGYKAGILTQNQ  29



>ref|XP_009546192.1| vacuolar H+-ATPase V0 sector, subunit D [Heterobasidion irregulare 
TC 32-1]
 gb|ETW81560.1| vacuolar H+-ATPase V0 sector, subunit D [Heterobasidion irregulare 
TC 32-1]
Length=356

 Score = 52.0 bits (123),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++G  G L QCE+L+D +  LSAT+YG +L NEP P+ T+TI
Sbjct  26   TQGQYGNLTQCESLEDFRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 30.8 bits (68),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LE I RG++A +
Sbjct  2    EALFFNVDSGFLEGIVRGYKAGI  24



>gb|KDE08503.1| V-type proton ATPase subunit D [Microbotryum violaceum p1A1 Lamole]
Length=356

 Score = 49.7 bits (117),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD +M LSAT+YG +L NE  P+ T+TI
Sbjct  33   LTQCETLDDFRMQLSATDYGNFLANETPPISTSTI  67


 Score = 32.7 bits (73),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN H GYLE I RG +A L
Sbjct  2    EALFFNSHSGYLEGIIRGFKAGL  24



>gb|KDQ25771.1| hypothetical protein PLEOSDRAFT_1113568 [Pleurotus ostreatus 
PC15]
Length=354

 Score = 49.3 bits (116),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE+L+D +  LSAT+YG +L NEP PL T+TI
Sbjct  33   LTQCESLEDFRTQLSATDYGNFLANEPLPLSTSTI  67


 Score = 33.1 bits (74),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LEAI RG++A +
Sbjct  2    EALLFNVDSGFLEAIVRGYKAGI  24



>ref|XP_007271746.1| ATPase, V0 complex, subunit D [Fomitiporia mediterranea MF3/22]
 gb|EJC97890.1| ATPase, V0 complex, subunit D [Fomitiporia mediterranea MF3/22]
Length=356

 Score = 52.0 bits (123),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++G    L QCETL+D +M LS+T+YG +L NEP P+ T+TI
Sbjct  26   TQGHYANLTQCETLEDFRMQLSSTDYGNFLANEPLPISTSTI  67


 Score = 30.4 bits (67),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LE I RG++A +
Sbjct  2    EALFFNVSAGFLEGIVRGYKAGI  24



>emb|CDO71435.1| hypothetical protein BN946_scf184909.g29 [Trametes cinnabarina]
Length=160

 Score = 48.5 bits (114),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCET++D +  LSAT+YG +L NEP P+ T+TI
Sbjct  33   LTQCETIEDFRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 33.5 bits (75),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAALPVRNS  283
             EAL FN+  G+LE I RG++A L  +N 
Sbjct  1    MEALFFNVDSGFLEGIVRGYKAGLLTQNQ  29



>ref|XP_002108995.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV29793.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=350

 Score = 56.2 bits (134),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++GD   L QCETL+D+K+HL +T+YG +LQNEP PL   TI
Sbjct  28   TQGDYLNLVQCETLEDLKLHLQSTDYGTFLQNEPSPLQVATI  69


 Score = 25.8 bits (55),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FN+  GYLE + RG R+ +
Sbjct  8    FNVDHGYLEGLCRGFRSGI  26



>ref|XP_007380197.1| ATPase V0 complex subunit D [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN12630.1| ATPase V0 complex subunit D [Punctularia strigosozonata HHB-11173 
SS5]
Length=358

 Score = 53.9 bits (128),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD +M LSAT+YG +L NEP P+ T+TI
Sbjct  33   LTQCETLDDFRMQLSATDYGNFLANEPSPISTSTI  67


 Score = 27.3 bits (59),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E L FN   G+LE I RG++A L
Sbjct  2    EGLFFNSSAGFLEGIVRGYKAGL  24



>ref|XP_005760681.1| vacuolar H+-ATPase V0 sector, subunit D [Emiliania huxleyi CCMP1516]
 gb|EOD08252.1| vacuolar H+-ATPase V0 sector, subunit D [Emiliania huxleyi CCMP1516]
Length=344

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  252  DTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            D   L QCET+DD+KMHLS+T+YG +LQNEP P+ TTT+
Sbjct  27   DYANLTQCETIDDMKMHLSSTDYGNFLQNEPSPISTTTL  65



>ref|XP_644445.1| vacuolar ATPase subunit DVA41 [Dictyostelium discoideum AX4]
 ref|XP_644805.1| vacuolar ATPase subunit DVA41 [Dictyostelium discoideum AX4]
 sp|P54641.2|VA0D_DICDI RecName: Full=V-type proton ATPase subunit d; Short=V-ATPase 
subunit d; AltName: Full=DVA41; AltName: Full=V-ATPase 41 kDa 
accessory protein; AltName: Full=Vacuolar proton pump subunit 
d [Dictyostelium discoideum]
 gb|EAL70519.1| vacuolar ATPase subunit DVA41 [Dictyostelium discoideum AX4]
 gb|EAL70753.1| vacuolar ATPase subunit DVA41 [Dictyostelium discoideum AX4]
Length=356

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            SR D   LCQC+ L+D+KMH  +T+YG +L  EP P+HTTTI
Sbjct  35   SRADYNNLCQCDNLEDMKMHFISTDYGDFLAGEPSPIHTTTI  76



>gb|AAA64993.1| vacuolar ATPase subunit DVA41 [Dictyostelium discoideum AX3]
Length=356

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            SR D   LCQC+ L+D+KMH  +T+YG +L  EP P+HTTTI
Sbjct  35   SRADYNNLCQCDNLEDMKMHFISTDYGDFLAGEPSPIHTTTI  76



>gb|EMS19531.1| V-type H+-transporting ATPase subunit AC39 [Rhodosporidium toruloides 
NP11]
 emb|CDR48786.1| RHTO0S20e01354g1_1 [Rhodosporidium toruloides]
Length=364

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD +M LSAT+YG +L NE  P+ T+TI
Sbjct  33   LTQCETLDDFRMQLSATDYGNFLANETPPISTSTI  67


 Score = 32.0 bits (71),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN H GYLE + RG +A L
Sbjct  2    EALFFNSHSGYLEGVLRGFKAGL  24



>gb|KDQ11407.1| hypothetical protein BOTBODRAFT_35294 [Botryobasidium botryosum 
FD-172 SS1]
Length=361

 Score = 51.6 bits (122),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +M LSAT+YG +L NEP P+ T TI
Sbjct  33   LTQCETLEDFRMQLSATDYGNFLANEPLPISTATI  67


 Score = 29.6 bits (65),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LE I RG+++ L
Sbjct  2    EALFFNVASGFLEGIVRGYKSGL  24



>ref|XP_007845746.1| vacuolar atp synthase subunit d [Moniliophthora roreri MCA 2997]
 gb|ESK95025.1| vacuolar atp synthase subunit d [Moniliophthora roreri MCA 2997]
Length=359

 Score = 50.1 bits (118),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +  LSAT+YG +L NEP PL T TI
Sbjct  33   LTQCETLEDFRTQLSATDYGNFLANEPLPLSTATI  67


 Score = 31.2 bits (69),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRN  280
            EAL FN+  G+LE   RG++A +  +N
Sbjct  2    EALLFNVDSGFLEGTVRGYKAGILTQN  28



>ref|XP_009495703.1| V-type proton ATPase subunit D [Fonticula alba]
 gb|KCV70097.1| V-type proton ATPase subunit D [Fonticula alba]
Length=317

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD+K+HLS ++YG +LQNEP PL TTTI
Sbjct  3    LAQCETLDDLKLHLSGSDYGNFLQNEPSPLATTTI  37



>gb|AFR92580.1| V-type H -transporting ATPase subunit AC39 [Cryptococcus neoformans 
var. grubii H99]
Length=356

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D ++ LS+T+YG +L NEP PL T+TI
Sbjct  33   LTQCENLEDFRLQLSSTDYGSFLANEPLPLSTSTI  67


 Score = 32.0 bits (71),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  GYLE + RG++ AL
Sbjct  2    EALGFNMSSGYLEGVVRGYKGAL  24



>gb|EJU03246.1| vacuolar ATP synthase subunit [Dacryopinax sp. DJM-731 SS1]
Length=362

 Score = 47.4 bits (111),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC+TL+D +M LS T+YG +L NEP P+ T+TI
Sbjct  33   LTQCDTLEDFRMQLSQTDYGNFLANEPSPITTSTI  67


 Score = 33.9 bits (76),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+H G++E I RG+R+ L
Sbjct  2    EALFFNVHAGFIEGIVRGYRSGL  24



>ref|XP_566778.1| vacuolar ATP synthase subunit d [Cryptococcus neoformans var. 
neoformans JEC21]
 ref|XP_777943.1| hypothetical protein CNBA4120 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL23296.1| hypothetical protein CNBA4120 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW40959.1| vacuolar ATP synthase subunit d, putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=356

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D ++ LS+T+YG +L NEP PL T+TI
Sbjct  33   LTQCENLEDFRLQLSSTDYGSFLANEPLPLSTSTI  67


 Score = 31.6 bits (70),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  GYLE + RG++ AL
Sbjct  2    EALGFNMSSGYLEGVVRGYKGAL  24



>ref|XP_007768408.1| ATPase V0 complex subunit D [Coniophora puteana RWD-64-598 SS2]
 gb|EIW80955.1| ATPase V0 complex subunit D [Coniophora puteana RWD-64-598 SS2]
Length=362

 Score = 51.6 bits (122),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D K  LSAT+YG +L NEP P+ TTTI
Sbjct  33   LTQCETLEDFKTQLSATDYGNFLANEPSPISTTTI  67


 Score = 29.3 bits (64),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E L FN+  G+LE I RG++A +
Sbjct  2    EGLFFNVDNGFLEGIVRGYKAGI  24



>ref|XP_003191398.1| vacuolar ATP synthase subunit d [Cryptococcus gattii WM276]
 gb|ADV19611.1| vacuolar ATP synthase subunit d, putative [Cryptococcus gattii 
WM276]
Length=356

 Score = 48.9 bits (115),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D ++ LS+T+YG +L NEP PL T+TI
Sbjct  33   LTQCENLEDFRLQLSSTDYGNFLANEPLPLSTSTI  67


 Score = 32.0 bits (71),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  GYLE + RG++ AL
Sbjct  2    EALGFNMSSGYLEGVVRGYKGAL  24



>gb|KGB75624.1| vacuolar ATP synthase subunit D [Cryptococcus gattii R265]
Length=356

 Score = 48.9 bits (115),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D ++ LS+T+YG +L NEP PL T+TI
Sbjct  33   LTQCENLEDFRLQLSSTDYGNFLANEPLPLSTSTI  67


 Score = 32.0 bits (71),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  GYLE + RG++ AL
Sbjct  2    EALGFNMSSGYLEGVVRGYKGAL  24



>emb|CDW53196.1| Vacuolar h atpase protein 16 [Trichuris trichiura]
Length=351

 Score = 45.8 bits (107),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S  D   L QC+TL+D+K+HL +T+YG +L NEP P+    +
Sbjct  29   SPSDYSNLVQCDTLEDLKLHLQSTDYGQFLANEPGPITVNVL  70


 Score = 35.0 bits (79),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  FE LTFNI+ GYLE + RG R  +
Sbjct  1    MVSFEELTFNINHGYLEGLVRGFRGGI  27



>ref|NP_001080200.1| ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [Xenopus 
laevis]
 gb|AAH42233.1| Atp6v0d1 protein [Xenopus laevis]
Length=351

 Score = 50.4 bits (119),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQGDYLNLVQCETLEDLKLHLQSTDYGTFLANEASPLAVSVI  70


 Score = 30.0 bits (66),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MTSFSELYFNVDSGYLEGLVRGFKAGI  27



>ref|XP_003371626.1| vacuolar proton pump subunit D 1 [Trichinella spiralis]
 gb|EFV52429.1| vacuolar proton pump subunit D 1 [Trichinella spiralis]
Length=794

 Score = 48.5 bits (114),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S  D   L QC+TL+D+K+HL +T+YG +L NEP P+    I
Sbjct  29   SPSDYTNLVQCDTLEDLKLHLQSTDYGQFLANEPGPITVNVI  70


 Score = 32.3 bits (72),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M   + LTFNI  GYLE + RG R  +
Sbjct  1    MVALDELTFNIDHGYLEGLVRGFRGGI  27



>dbj|GAA55818.1| V-type H+-transporting ATPase subunit AC39 [Clonorchis sinensis]
Length=1026

 Score = 52.8 bits (125),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            + D  +L QCETLDD+K+HL  T+YG +L NEP PL  +TI
Sbjct  705  QSDYHVLVQCETLDDLKLHLQDTDYGDFLANEPGPLAVSTI  745


 Score = 27.7 bits (60),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  206  LTFNIHGGYLEAIARGHRAAL  268
            L+FN   GYLE +ARG ++ L
Sbjct  682  LSFNADNGYLEGLARGIKSGL  702



>ref|NP_001017310.1| V-type proton ATPase subunit d 1 [Xenopus (Silurana) tropicalis]
 gb|AAI25666.1| ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [Xenopus 
(Silurana) tropicalis]
Length=351

 Score = 50.4 bits (119),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQGDYLNLVQCETLEDLKLHLQSTDYGTFLANEASPLAVSVI  70


 Score = 30.0 bits (66),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MTSFSELYFNVDSGYLEGLVRGFKAGI  27



>ref|XP_005826878.1| hypothetical protein GUITHDRAFT_96472 [Guillardia theta CCMP2712]
 gb|EKX39898.1| hypothetical protein GUITHDRAFT_96472 [Guillardia theta CCMP2712]
Length=348

 Score = 51.6 bits (122),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC++L+D++MHL  T+YG +LQNEP PL T TI
Sbjct  33   LGQCDSLEDMRMHLQVTDYGTFLQNEPSPLQTMTI  67


 Score = 28.9 bits (63),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E LTFN   G+ EA+ RG+R+ +
Sbjct  2    ELLTFNKDDGFTEAVVRGYRSGI  24



>ref|XP_001605391.1| PREDICTED: V-type proton ATPase subunit d [Nasonia vitripennis]
Length=348

 Score = 50.4 bits (119),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLSVSVI  67


 Score = 29.6 bits (65),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLEA+ RG +  +
Sbjct  6    FNIDGGYLEALCRGFKCGI  24



>gb|EMD39971.1| hypothetical protein CERSUDRAFT_81279 [Ceriporiopsis subvermispora 
B]
Length=372

 Score = 51.2 bits (121),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCET++D++  LSAT+YG +L NEP P+ T+TI
Sbjct  33   LTQCETIEDLRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 29.3 bits (64),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL +N+  G+LE I RG++A L
Sbjct  2    EALFYNVDHGFLEGIVRGYKAGL  24



>ref|XP_001747906.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ87293.1| predicted protein [Monosiga brevicollis MX1]
Length=349

 Score = 55.1 bits (131),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            R D   LCQCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  27   RSDYMNLCQCETLEDLKLHLQTTDYGNFLANEPSPLAVSTI  67


 Score = 25.0 bits (53),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FN+  GY E + RG R+ L
Sbjct  6    FNMDDGYFEGLVRGFRSGL  24



>ref|XP_004998460.1| proton ATPase accessory subunit [Salpingoeca rosetta]
 gb|EGD76285.1| proton ATPase accessory subunit [Salpingoeca rosetta]
Length=349

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +RGD   L QCETL+D+K+HL+ T+YG +L NEP PL  +TI
Sbjct  26   TRGDYANLSQCETLEDLKLHLATTQYGNFLSNEPSPLAVSTI  67



>ref|XP_003745596.1| PREDICTED: V-type proton ATPase subunit d-like [Metaseiulus occidentalis]
Length=349

 Score = 51.2 bits (121),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL +T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDMKLHLQSTDYGNFLANEPSPLAVSTI  67


 Score = 28.9 bits (63),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            + + FN+H GYLE + RG ++ +
Sbjct  2    QEILFNVHSGYLEGLVRGFKSGI  24



>ref|XP_006641495.1| PREDICTED: V-type proton ATPase subunit d 1-like [Lepisosteus 
oculatus]
Length=351

 Score = 50.1 bits (118),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQGDYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.6 bits (65),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGI  27



>ref|XP_010792242.1| PREDICTED: V-type proton ATPase subunit d 1 [Notothenia coriiceps]
Length=100

 Score = 50.8 bits (120),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQGDYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.9 bits (63),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_009267532.1| V-type proton ATPase subunit d [Wallemia ichthyophaga EXF-994]
 gb|EOR01812.1| V-type proton ATPase subunit d [Wallemia ichthyophaga EXF-994]
Length=357

 Score = 46.6 bits (109),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC+ L+D++M LSAT+YG +L NE  PL T+TI
Sbjct  38   LQQCDNLEDLRMQLSATDYGNFLSNETLPLSTSTI  72


 Score = 33.1 bits (74),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +2

Query  194  GFEALTFNIHGGYLEAIARGHRAAL  268
            G E L FN+  GYLE I RG++A L
Sbjct  5    GSEMLFFNVQNGYLEGIIRGYKAGL  29



>emb|CCA70885.1| probable vacuolar atp synthase subunit d [Piriformospora indica 
DSM 11827]
Length=362

 Score = 50.8 bits (120),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D +M LSAT+YG +L NEP P+ T+ I
Sbjct  33   LTQCETLEDFRMQLSATDYGNFLANEPLPISTSKI  67


 Score = 28.9 bits (63),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E L FN+  G+LE I RG++A L
Sbjct  2    EGLFFNVSAGFLEGILRGYKAGL  24



>ref|XP_779935.2| PREDICTED: V-type proton ATPase subunit d 1-like isoform 1 [Strongylocentrotus 
purpuratus]
Length=348

 Score = 50.4 bits (119),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE L+D+K+HL +T+YG +LQNEP PL  + I
Sbjct  33   LVQCEILEDLKLHLQSTDYGNFLQNEPSPLSVSVI  67


 Score = 29.3 bits (64),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +2

Query  209  TFNIHGGYLEAIARGHRAAL  268
            TFNI GGYLE + RG +  +
Sbjct  5    TFNIDGGYLEGLVRGFKGGI  24



>ref|XP_001876271.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR13773.1| predicted protein [Laccaria bicolor S238N-H82]
Length=356

 Score = 48.5 bits (114),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE+L+D +  LSAT+YG +L NEP P+ T+TI
Sbjct  33   LTQCESLEDFRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 30.8 bits (68),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            E+L FN+  G+LE + RG++A +  +N 
Sbjct  2    ESLFFNVDSGFLEGVIRGYKAGILTQNQ  29



>ref|XP_003330049.1| ATP synthase (C/AC39) subunit [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 ref|XP_003334904.1| ATP synthase (C/AC39) subunit [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP85630.1| ATP synthase (C/AC39) subunit [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP90485.1| ATP synthase (C/AC39) subunit [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=354

 Score = 48.9 bits (115),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC+TLDD KM LSAT+YG +L NE  P+ T+TI
Sbjct  33   LTQCDTLDDFKMQLSATDYGNFLANETPPISTSTI  67


 Score = 30.4 bits (67),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN H G+LE + RG +A L
Sbjct  2    EALFFNSHSGFLEGVIRGFKAGL  24



>ref|XP_006011813.1| PREDICTED: V-type proton ATPase subunit d 1 isoform X2 [Latimeria 
chalumnae]
Length=351

 Score = 48.5 bits (114),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLAVSVI  70


 Score = 30.8 bits (68),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F+ L FN+  GYLE + RG +A +
Sbjct  1    MSSFQELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_004520031.1| PREDICTED: V-type proton ATPase subunit d 1-like [Ceratitis capitata]
Length=349

 Score = 49.7 bits (117),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL +T+YG +L NEP PL  + I
Sbjct  34   LVQCETLEDLKLHLQSTDYGSFLANEPSPLSVSVI  68


 Score = 29.3 bits (64),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E   FNI GGYLE + RG +  +
Sbjct  3    EGCYFNIDGGYLEGLCRGFKCGI  25



>ref|XP_008404240.1| PREDICTED: V-type proton ATPase subunit d 1 [Poecilia reticulata]
Length=350

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQGDYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_005816503.1| PREDICTED: V-type proton ATPase subunit d 1-like [Xiphophorus 
maculatus]
 ref|XP_007558879.1| PREDICTED: V-type proton ATPase subunit d 1 [Poecilia formosa]
Length=350

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQGDYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_007246947.1| PREDICTED: V-type proton ATPase subunit d 1 [Astyanax mexicanus]
Length=350

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQGDYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_010894466.1| PREDICTED: V-type proton ATPase subunit d 1 [Esox lucius]
Length=351

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQGDYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  70


 Score = 28.5 bits (62),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  4    FSELYFNVDNGYLEGLVRGFKAGI  27



>gb|EGI64151.1| V-type proton ATPase subunit d [Acromyrmex echinatior]
Length=302

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLSVSVI  67


 Score = 28.1 bits (61),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_007304751.1| ATPase V0 complex subunit D [Stereum hirsutum FP-91666 SS1]
 gb|EIM85806.1| ATPase V0 complex subunit D [Stereum hirsutum FP-91666 SS1]
Length=361

 Score = 48.5 bits (114),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            ++G    L QC+TL+D +  LSAT+YG +L NEP P+ T+TI
Sbjct  26   NQGHYSNLTQCDTLEDFRTQLSATDYGNFLANEPLPISTSTI  67


 Score = 30.0 bits (66),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LE I RG++A +
Sbjct  2    EALFFNVDTGFLEGIIRGYKAGI  24



>ref|XP_005180381.1| PREDICTED: V-type proton ATPase subunit d 1-like, partial [Musca 
domestica]
Length=235

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL +T+YG +L NEP PL  + I
Sbjct  35   LVQCETLEDLKLHLQSTDYGSFLANEPSPLSVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  8    FNIDGGYLEGLCRGFKCGI  26



>ref|XP_002605275.1| hypothetical protein BRAFLDRAFT_115616 [Branchiostoma floridae]
 gb|EEN61285.1| hypothetical protein BRAFLDRAFT_115616 [Branchiostoma floridae]
Length=350

 Score = 52.4 bits (124),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            R D   L QCETL+D+K+HL++T+YG +L NEP PL    I
Sbjct  29   RADYANLVQCETLEDLKLHLASTDYGNFLANEPSPLTVNVI  69


 Score = 26.2 bits (56),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%), Gaps = 0/25 (0%)
 Frame = +2

Query  194  GFEALTFNIHGGYLEAIARGHRAAL  268
              + L FNI  GYLE + RG +  +
Sbjct  2    AMQELYFNIDNGYLEGLVRGFKGGI  26



>ref|XP_006269895.1| PREDICTED: V-type proton ATPase subunit d 1 [Alligator mississippiensis]
Length=351

 Score = 49.3 bits (116),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSCFPELYFNVDNGYLEGLVRGFKAGV  27



>gb|EFN85494.1| Vacuolar proton pump subunit d [Harpegnathos saltator]
 gb|EZA56805.1| V-type proton ATPase subunit d [Cerapachys biroi]
Length=348

 Score = 50.4 bits (119),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLSVSVI  67


 Score = 27.7 bits (60),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_003295220.1| hypothetical protein DICPUDRAFT_96211 [Dictyostelium purpureum]
 gb|EGC28253.1| hypothetical protein DICPUDRAFT_96211 [Dictyostelium purpureum]
Length=346

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  252  DTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            D   LCQC+TL+D+KMH  +T+YG +L  EP P+HTTTI
Sbjct  28   DYNNLCQCDTLEDMKMHFLSTDYGDFLAGEPSPIHTTTI  66



>ref|XP_007001011.1| hypothetical protein TREMEDRAFT_42243 [Tremella mesenterica DSM 
1558]
 gb|EIW73195.1| hypothetical protein TREMEDRAFT_42243 [Tremella mesenterica DSM 
1558]
Length=356

 Score = 47.0 bits (110),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC+ L+D ++ LS+T+YG +L NEP PL T TI
Sbjct  33   LTQCDNLEDFRLQLSSTDYGNFLANEPLPLSTATI  67


 Score = 31.2 bits (69),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL FN+  G+LE + RG++  L  +N+
Sbjct  2    EALNFNMDAGFLEGMVRGYKGGLLTQNN  29



>dbj|GAM20087.1| hypothetical protein SAMD00019534_032620 [Acytostelium subglobosum 
LB1]
Length=356

 Score = 52.0 bits (123),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  249  GDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
             D   L QC+ L+D+K+HLS T+YG +L  EP PLHTTTI
Sbjct  37   ADYSNLRQCDNLEDMKLHLSQTDYGDFLAGEPSPLHTTTI  76


 Score = 26.2 bits (56),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +2

Query  209  TFNIHGGYLEAIARGHRAAL  268
            TFN   GYLEA+ RG R  +
Sbjct  14   TFNKDDGYLEALLRGFRKGI  33



>ref|XP_011056441.1| PREDICTED: V-type proton ATPase subunit d [Acromyrmex echinatior]
 ref|XP_011056442.1| PREDICTED: V-type proton ATPase subunit d [Acromyrmex echinatior]
Length=348

 Score = 50.4 bits (119),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLSVSVI  67


 Score = 27.7 bits (60),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>gb|EFN71876.1| Vacuolar proton pump subunit d [Camponotus floridanus]
Length=322

 Score = 50.4 bits (119),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLSVSVI  67


 Score = 28.1 bits (61),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_007319763.1| hypothetical protein SERLADRAFT_470602 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN92147.1| hypothetical protein SERLA73DRAFT_191592 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24001.1| hypothetical protein SERLADRAFT_470602 [Serpula lacrymans var. 
lacrymans S7.9]
Length=361

 Score = 48.5 bits (114),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+     L QC+TL+D +  LSAT+YG +L NEP PL T TI
Sbjct  26   SQSQYASLTQCDTLEDFRTQLSATDYGNFLANEPSPLSTATI  67


 Score = 29.6 bits (65),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E L FN++ G+LE I RG++A +
Sbjct  2    EGLFFNVNSGFLEGIVRGYKAGI  24



>ref|XP_003705831.1| PREDICTED: V-type proton ATPase subunit d-like [Megachile rotundata]
Length=348

 Score = 50.1 bits (118),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLAVSVI  67


 Score = 27.7 bits (60),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_003033801.1| hypothetical protein SCHCODRAFT_75276 [Schizophyllum commune 
H4-8]
 gb|EFI98898.1| hypothetical protein SCHCODRAFT_75276 [Schizophyllum commune 
H4-8]
Length=356

 Score = 48.9 bits (115),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC+TL+D +  LSAT+YG +L NEP PL T+TI
Sbjct  33   LTQCDTLEDFRTQLSATDYGNFLANEPLPLSTSTI  67


 Score = 28.9 bits (63),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN+  G+LE I RG +A +
Sbjct  2    EALFFNVDNGFLEGIVRGFKAGV  24



>gb|KDR12194.1| V-type proton ATPase subunit d, partial [Zootermopsis nevadensis]
Length=319

 Score = 50.4 bits (119),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLQGTDYGSFLANEPSPLQVSVI  67


 Score = 27.7 bits (60),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|NP_001191854.1| V-type proton ATPase subunit d [Acyrthosiphon pisum]
 gb|AAV31420.1| vacuolar ATP synthase subunit d 1 [Aphis citricidus]
Length=351

 Score = 49.7 bits (117),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD+K+HL +T+YG +L NEP PL  + I
Sbjct  35   LEQCETLDDLKLHLQSTDYGQFLANEPSPLAVSVI  69


 Score = 28.1 bits (61),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  8    FNIDGGYLEGLCRGFKCGI  26



>gb|KFW85840.1| V-type proton ATPase subunit d 2 [Manacus vitellinus]
Length=367

 Score = 48.5 bits (114),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NE  PL  +TI
Sbjct  36   LAQCETLEDLKLHLQTTDYGNFLANETGPLTISTI  70


 Score = 29.3 bits (64),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/27 (41%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M G+    FN+  GYLE + RG +A +
Sbjct  1    MPGYSEFYFNVDHGYLEGLVRGFKAGI  27



>ref|XP_008636966.1| PREDICTED: V-type proton ATPase subunit d 1 [Corvus brachyrhynchos]
 ref|XP_008636967.1| PREDICTED: V-type proton ATPase subunit d 1 [Corvus brachyrhynchos]
 gb|KFO63070.1| V-type proton ATPase subunit d 1 [Corvus brachyrhynchos]
Length=351

 Score = 47.4 bits (111),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 30.0 bits (66),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSCFPELCFNVDNGYLEGLVRGFKAGV  27



>ref|XP_003436855.1| AGAP013199-PA [Anopheles gambiae str. PEST]
 gb|EGK97213.1| AGAP013199-PA [Anopheles gambiae str. PEST]
Length=347

 Score = 47.0 bits (110),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+ L +TEYGP+L NE  P+  + I
Sbjct  33   LIQCETLEDLKLQLQSTEYGPFLANETSPITVSII  67


 Score = 30.8 bits (68),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/19 (58%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLEA+ RG ++++
Sbjct  6    FNIDGGYLEALCRGFKSSI  24



>gb|ELW56796.1| V-type proton ATPase subunit d 1 [Tupaia chinensis]
Length=408

 Score = 48.1 bits (113),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.6 bits (65),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGLKAGV  27



>gb|AAI53473.1| Atp6v0d1 protein [Danio rerio]
Length=137

 Score = 48.9 bits (115),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.9 bits (63),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_010582237.1| PREDICTED: V-type proton ATPase subunit d 1 isoform X2 [Haliaeetus 
leucocephalus]
Length=292

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.6 bits (65),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_001661299.1| vacuolar ATP synthase subunit ac39 [Aedes aegypti]
 gb|ABF18406.1| vacuolar H+-ATPase V0 sector subunit d [Aedes aegypti]
 gb|EAT36933.1| AAEL011025-PA [Aedes aegypti]
Length=348

 Score = 49.3 bits (116),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLQGTDYGQFLANEPSPLAVSVI  67


 Score = 28.1 bits (61),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 3/27 (11%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M GF    FNI GGYLE + RG +  +
Sbjct  1    MPGF---MFNIDGGYLEGLCRGFKCGI  24



>ref|XP_005016794.1| PREDICTED: V-type proton ATPase subunit d 2 [Anas platyrhynchos]
Length=351

 Score = 48.9 bits (115),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  36   LAQCETLEDLKLHLQTTDYGNFLANEPGPLTISTI  70


 Score = 28.1 bits (61),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M G+    FN+  GYLE + RG +A +
Sbjct  1    MPGYSEFYFNVDHGYLEGLVRGFKAGI  27



>ref|XP_005229250.1| PREDICTED: V-type proton ATPase subunit d 1 [Falco peregrinus]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.6 bits (65),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>gb|AFU90892.1| H+-transporting two-sector ATPase, partial [Sonneratia caseolaris]
 gb|AFU90893.1| H+-transporting two-sector ATPase, partial [Sonneratia ovata]
 gb|AFU90894.1| H+-transporting two-sector ATPase, partial [Sonneratia lanceolata]
 gb|AFU90895.1| H+-transporting two-sector ATPase, partial [Sonneratia apetala]
 gb|AFU90896.1| H+-transporting two-sector ATPase, partial [Sonneratia griffithii]
Length=55

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  297  MHLSATEYGPYLQNEPYPLHTTTI  368
            MHLSATEYGPYLQNEP PLHTTTI
Sbjct  1    MHLSATEYGPYLQNEPSPLHTTTI  24



>ref|XP_005152346.1| PREDICTED: V-type proton ATPase subunit d 1 [Melopsittacus undulatus]
 ref|XP_005440351.1| PREDICTED: V-type proton ATPase subunit d 1 [Falco cherrug]
 ref|XP_009945972.1| PREDICTED: V-type proton ATPase subunit d 1 [Leptosomus discolor]
 ref|XP_010582227.1| PREDICTED: V-type proton ATPase subunit d 1 isoform X1 [Haliaeetus 
leucocephalus]
 gb|KFQ07744.1| V-type proton ATPase subunit d 1 [Leptosomus discolor]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.6 bits (65),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_001870744.1| vacuolar ATP synthase subunit ac39 [Culex quinquefasciatus]
 gb|EDS34105.1| vacuolar ATP synthase subunit ac39 [Culex quinquefasciatus]
Length=348

 Score = 49.3 bits (116),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLQGTDYGQFLANEPSPLAVSVI  67


 Score = 27.7 bits (60),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_009641567.1| PREDICTED: V-type proton ATPase subunit d 1 [Egretta garzetta]
 gb|KFP19657.1| V-type proton ATPase subunit d 1 [Egretta garzetta]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.6 bits (65),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>gb|ETN65678.1| vacuolar ATP synthase subunit ac39 [Anopheles darlingi]
Length=348

 Score = 49.3 bits (116),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLQGTDYGQFLANEPSPLAVSVI  67


 Score = 28.1 bits (61),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_311260.4| AGAP000721-PA [Anopheles gambiae str. PEST]
 gb|EAA06911.5| AGAP000721-PA [Anopheles gambiae str. PEST]
 gb|KFB42060.1| AGAP000721-PA-like protein [Anopheles sinensis]
Length=348

 Score = 49.3 bits (116),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLQGTDYGQFLANEPSPLAVSVI  67


 Score = 28.1 bits (61),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI GGYLE + RG +  +
Sbjct  6    FNIDGGYLEGLCRGFKCGI  24



>ref|XP_010021036.1| PREDICTED: V-type proton ATPase subunit d 1 [Nestor notabilis]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_505487.2| YALI0F16181p [Yarrowia lipolytica]
 emb|CAG78296.2| YALI0F16181p [Yarrowia lipolytica CLIB122]
Length=346

 Score = 45.8 bits (107),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC++L+D K  LS+TEYG +L N P P+ T+TI
Sbjct  33   LTQCDSLEDFKTQLSSTEYGNFLSNVPSPISTSTI  67


 Score = 31.6 bits (70),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            E L FNI+ GY+EA+ RG+++ L
Sbjct  2    EGLYFNINNGYVEALVRGYQSGL  24



>gb|KFQ57177.1| V-type proton ATPase subunit d 1 [Nestor notabilis]
Length=352

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>gb|ERE82659.1| V-type proton ATPase subunit d 2-like protein, partial [Cricetulus 
griseus]
Length=385

 Score = 47.0 bits (110),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  TEYG +L NE  PL  + I
Sbjct  99   LVQCETLEDLKIHLQTTEYGNFLANETNPLTVSKI  133


 Score = 30.0 bits (66),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 6/39 (15%)
 Frame = +2

Query  152  LRSLTNLSIAGKMYGFEALTFNIHGGYLEAIARGHRAAL  268
            L SL+N+    ++Y      FN+  GYLE + RG +A+L
Sbjct  58   LLSLSNMRETAELY------FNVDHGYLEGLVRGCKASL  90



>ref|XP_004359020.1| vacuolar ATPase subunit DVA41 [Dictyostelium fasciculatum]
 gb|EGG21170.1| vacuolar ATPase subunit DVA41 [Dictyostelium fasciculatum]
Length=356

 Score = 50.8 bits (120),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S  D   L QC++L+D+K+HLS T+YG +L  EP P+HTTT+
Sbjct  35   SAADYTNLRQCDSLEDMKLHLSQTDYGDFLAGEPSPIHTTTM  76


 Score = 26.2 bits (56),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +2

Query  209  TFNIHGGYLEAIARGHRAAL  268
            TFN   GYLEA+ RG R  +
Sbjct  14   TFNKDDGYLEALLRGFRKGI  33



>ref|XP_009569492.1| PREDICTED: V-type proton ATPase subunit d 1 [Cuculus canorus]
 gb|KFO71403.1| V-type proton ATPase subunit d 1 [Cuculus canorus]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MASFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_008335358.1| PREDICTED: V-type proton ATPase subunit d 1 [Cynoglossus semilaevis]
Length=330

 Score = 48.5 bits (114),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQSDYTNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_003230531.2| PREDICTED: V-type proton ATPase subunit d 1 [Anolis carolinensis]
Length=395

 Score = 47.4 bits (111),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  73   SQADYLNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  114


 Score = 29.6 bits (65),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +2

Query  206  LTFNIHGGYLEAIARGHRAAL  268
            L FN+ GGYLE + RG +A +
Sbjct  51   LYFNVDGGYLEGLVRGFKAGV  71



>ref|XP_003456933.1| PREDICTED: V-type proton ATPase subunit d 1-like [Oreochromis 
niloticus]
 ref|XP_004576245.1| PREDICTED: V-type proton ATPase subunit d 1-like [Maylandia zebra]
 ref|XP_005746758.1| PREDICTED: V-type proton ATPase subunit d 1-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_006804495.1| PREDICTED: V-type proton ATPase subunit d 1-like [Neolamprologus 
brichardi]
 ref|XP_008295543.1| PREDICTED: V-type proton ATPase subunit d 1 [Stegastes partitus]
 ref|XP_010736123.1| PREDICTED: V-type proton ATPase subunit d 1 [Larimichthys crocea]
Length=350

 Score = 48.5 bits (114),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>dbj|BAN21505.1| vacuolar ATP synthase subunit ac39, partial [Riptortus pedestris]
Length=285

 Score = 48.1 bits (113),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE+L+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCESLEDLKLHLQGTDYGSFLANEPSPLTVSVI  67


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 3/27 (11%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M GF    FNI GGYLE + RG +  +
Sbjct  1    MMGF---MFNIDGGYLEGLCRGFKCGI  24



>ref|XP_003758446.1| PREDICTED: V-type proton ATPase subunit d 1-like [Sarcophilus 
harrisii]
Length=351

 Score = 48.1 bits (113),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQSDYVNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSAFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_002187230.1| PREDICTED: V-type proton ATPase subunit d 1 [Taeniopygia guttata]
 ref|XP_005052535.1| PREDICTED: V-type proton ATPase subunit d 1 [Ficedula albicollis]
 ref|XP_009088941.1| PREDICTED: V-type proton ATPase subunit d 1 [Serinus canaria]
 ref|XP_010401733.1| PREDICTED: V-type proton ATPase subunit d 1 [Corvus cornix cornix]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSCFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_005708910.1| V-type H+-transporting ATPase subunit d [Galdieria sulphuraria]
 gb|EME32390.1| V-type H+-transporting ATPase subunit d [Galdieria sulphuraria]
Length=351

 Score = 47.4 bits (111),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D++MHL+ TEY   LQ+EP PL  + I
Sbjct  37   LTQCETLEDVRMHLNGTEYSVVLQDEPSPLTASII  71


 Score = 29.6 bits (65),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FN+  GY+EA+ RG++++L
Sbjct  10   FNVDDGYIEALVRGYKSSL  28



>ref|NP_955914.1| V-type proton ATPase subunit d 1 [Danio rerio]
 sp|Q6PGV1.1|VA0D1_DANRE RecName: Full=V-type proton ATPase subunit d 1; Short=V-ATPase 
subunit d 1; AltName: Full=Vacuolar proton pump subunit d 
1 [Danio rerio]
 gb|AAH56822.1| ATPase, H+ transporting, V0 subunit D isoform 1 [Danio rerio]
 gb|AAT68084.1| v-ATPase AC39 subunit [Danio rerio]
Length=350

 Score = 48.1 bits (113),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.5 bits (62),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FSELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_009468745.1| PREDICTED: V-type proton ATPase subunit d 1 [Nipponia nippon]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSCFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_004704670.1| PREDICTED: V-type proton ATPase subunit d 1 [Echinops telfairi]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_006878754.1| PREDICTED: V-type proton ATPase subunit d 1 [Elephantulus edwardii]
 ref|XP_006863674.1| PREDICTED: V-type proton ATPase subunit d 1 [Chrysochloris asiatica]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_974905.1| PREDICTED: V-type proton ATPase subunit d [Tribolium castaneum]
 gb|EFA03371.1| hypothetical protein TcasGA2_TC013357 [Tribolium castaneum]
Length=348

 Score = 50.8 bits (120),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDLKLHLQGTDYGSFLANEPSPLAVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>ref|XP_004371547.1| PREDICTED: V-type proton ATPase subunit d 1 [Trichechus manatus 
latirostris]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_007404053.1| hypothetical protein MELLADRAFT_41471 [Melampsora larici-populina 
98AG31]
 gb|EGG13115.1| hypothetical protein MELLADRAFT_41471 [Melampsora larici-populina 
98AG31]
Length=352

 Score = 46.2 bits (108),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QC++L+D KM LSAT+YG +L NE  P+ T+TI
Sbjct  33   LTQCDSLEDFKMQLSATDYGTFLANETPPISTSTI  67


 Score = 30.8 bits (68),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL FN H G+LE I RG +A L
Sbjct  2    EALFFNSHSGFLEGIIRGFKAGL  24



>ref|XP_007938443.1| PREDICTED: V-type proton ATPase subunit d 1 [Orycteropus afer 
afer]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|NP_001280240.1| V-type proton ATPase subunit d 1 [Gallus gallus]
 ref|XP_003209719.1| PREDICTED: V-type proton ATPase subunit d 1 [Meleagris gallopavo]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSCFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_005526345.1| PREDICTED: V-type proton ATPase subunit d 1 [Pseudopodoces humilis]
Length=351

 Score = 47.4 bits (111),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  246  RGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            +GD   L QCE+L+D+K+HL +T+YG +L NE  PL  + I
Sbjct  30   QGDYVNLVQCESLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSCFPELYFNVDNGYLEGLVRGFKAGV  27



>ref|XP_003417065.1| PREDICTED: V-type proton ATPase subunit d 1 [Loxodonta africana]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQSDYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFSELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_007399299.1| hypothetical protein PHACADRAFT_261648, partial [Phanerochaete 
carnosa HHB-10118-sp]
 gb|EKM51487.1| hypothetical protein PHACADRAFT_261648, partial [Phanerochaete 
carnosa HHB-10118-sp]
Length=368

 Score = 46.6 bits (109),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCET++D +  LSAT+YG +L NE  P+ T+TI
Sbjct  33   LTQCETIEDFRTQLSATDYGNFLANESLPISTSTI  67


 Score = 30.0 bits (66),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAALPVRNS  283
            EAL +N   G+LE I RG++A L  +N 
Sbjct  2    EALFYNADTGFLEGIVRGYKAGLLAQNQ  29



>ref|XP_006155679.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
d 1 [Tupaia chinensis]
Length=352

 Score = 47.8 bits (112),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGLKAGV  27



>dbj|BAM18150.1| vacuolar H[+] ATPase subunit AC39-1 [Papilio xuthus]
Length=348

 Score = 50.8 bits (120),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDLKLHLQGTDYGTFLANEPSPLSVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>emb|CAG12482.1| unnamed protein product [Tetraodon nigroviridis]
Length=350

 Score = 48.1 bits (113),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.1 bits (61),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FPELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_003969660.1| PREDICTED: V-type proton ATPase subunit d 1-like [Takifugu rubripes]
Length=350

 Score = 48.1 bits (113),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  28   SQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  69


 Score = 28.1 bits (61),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 15/24 (63%), Gaps = 0/24 (0%)
 Frame = +2

Query  197  FEALTFNIHGGYLEAIARGHRAAL  268
            F  L FN+  GYLE + RG +A +
Sbjct  3    FPELYFNVDNGYLEGLVRGFKAGI  26



>ref|XP_003262939.1| PREDICTED: V-type proton ATPase subunit d 1 isoform 3 [Nomascus 
leucogenys]
Length=392

 Score = 48.1 bits (113),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.1 bits (61),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGLKAGV  27



>gb|EHJ64513.1| V-type proton ATPase subunit d [Danaus plexippus]
Length=348

 Score = 50.8 bits (120),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDLKLHLQGTDYGTFLANEPSPLAVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>sp|Q25531.1|VA0D_MANSE RecName: Full=V-type proton ATPase subunit d; Short=V-ATPase 
subunit d; AltName: Full=M40; AltName: Full=V-ATPase 40 kDa 
subunit; AltName: Full=Vacuolar proton pump subunit d [Manduca 
sexta]
 emb|CAA67343.1| 40-kDa V-ATPase subunit [Manduca sexta]
Length=348

 Score = 50.8 bits (120),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDLKLHLQGTDYGTFLANEPSPLSVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>gb|KFH63935.1| V-type proton ATPase subunit D [Mortierella verticillata NRRL 
6337]
Length=346

 Score = 44.3 bits (103),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPY  347
            L QCETL+D+K+ LSA++YG  LQNEP+
Sbjct  33   LTQCETLEDVKLQLSASDYGSLLQNEPH  60


 Score = 32.0 bits (71),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +2

Query  200  EALTFNIHGGYLEAIARGHRAAL  268
            EAL +N   GYLEAI RG+R+++
Sbjct  2    EALFYNADDGYLEAIVRGYRSSI  24



>ref|NP_001040429.1| H+ transporting ATPase V0 subunit D [Bombyx mori]
 gb|ABF51370.1| H+ transporting ATPase V0 subunit D [Bombyx mori]
Length=348

 Score = 50.8 bits (120),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDLKLHLQGTDYGTFLANEPSPLSVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>ref|XP_001364830.1| PREDICTED: V-type proton ATPase subunit d 1 [Monodelphis domestica]
Length=351

 Score = 47.0 bits (110),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQQDYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 29.3 bits (64),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSSFPELYFNVDNGYLEGLVRGFKAGV  27



>gb|EPZ35596.1| V-type proton ATPase subunit d 1 [Rozella allomycis CSF55]
Length=345

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD+K+ L++T+YG +LQNEP P+ T+TI
Sbjct  31   LSQCETLDDLKLQLASTDYGNFLQNEPSPIATSTI  65



>ref|XP_004744466.1| PREDICTED: V-type proton ATPase subunit d 1 isoform X1 [Mustela 
putorius furo]
Length=387

 Score = 48.1 bits (113),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.1 bits (61),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_004057862.1| PREDICTED: V-type proton ATPase subunit d 1 isoform 2 [Gorilla 
gorilla gorilla]
Length=392

 Score = 48.1 bits (113),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.1 bits (61),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_002711660.2| PREDICTED: V-type proton ATPase subunit d 1 [Oryctolagus cuniculus]
Length=541

 Score = 47.8 bits (112),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  219  SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  260


 Score = 28.5 bits (62),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (57%), Gaps = 0/30 (0%)
 Frame = +2

Query  179  AGKMYGFEALTFNIHGGYLEAIARGHRAAL  268
            A  M  F  L FN+  GYLE + RG +A +
Sbjct  188  AAAMSFFPELYFNVDNGYLEGLVRGLKAGV  217



>ref|XP_393438.2| PREDICTED: V-type proton ATPase subunit d isoform X2 [Apis mellifera]
 ref|XP_003692408.1| PREDICTED: V-type proton ATPase subunit d-like [Apis florea]
 ref|XP_006620926.1| PREDICTED: V-type proton ATPase subunit d-like [Apis dorsata]
Length=348

 Score = 50.4 bits (119),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLSVSVI  67


 Score = 25.8 bits (55),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>dbj|BAH13305.1| unnamed protein product [Homo sapiens]
Length=392

 Score = 48.5 bits (114),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYPNLVQCETLEDLKLHLRSTDYGNFLANEASPLTVSVI  70


 Score = 27.7 bits (60),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_002428920.1| vacuolar ATP synthase subunit D, putative [Pediculus humanus 
corporis]
 gb|EEB16182.1| vacuolar ATP synthase subunit D, putative [Pediculus humanus 
corporis]
Length=343

 Score = 50.4 bits (119),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  +TI
Sbjct  33   LVQCETLEDLKLHLQGTDYGNFLANEPSPLAVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 12/21 (57%), Gaps = 0/21 (0%)
 Frame = +2

Query  206  LTFNIHGGYLEAIARGHRAAL  268
              FNI  GYLE + RG +  +
Sbjct  4    CVFNIDAGYLEGLCRGFKCGI  24



>gb|AAC83085.1| vacuolar adenosine triphosphatase subunit D [Mus musculus]
Length=351

 Score = 47.8 bits (112),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.1 bits (61),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGMKAGV  27



>gb|EFX90268.1| hypothetical protein DAPPUDRAFT_300127 [Daphnia pulex]
Length=348

 Score = 51.2 bits (121),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD+K+HL +T+YG +L NEP PL  + I
Sbjct  33   LVQCETLDDLKLHLQSTDYGQFLANEPSPLAVSVI  67


 Score = 24.6 bits (52),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHR  259
            FNI  GYLE + RG +
Sbjct  6    FNIDNGYLEGLCRGFK  21



>ref|XP_005103515.1| PREDICTED: V-type proton ATPase subunit d 1-like [Aplysia californica]
Length=349

 Score = 50.8 bits (120),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETLDD+K+HL +T+YG +L NEP PL  + I
Sbjct  34   LVQCETLDDLKLHLQSTDYGNFLANEPSPLTVSVI  68


 Score = 25.0 bits (53),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 13/21 (62%), Gaps = 0/21 (0%)
 Frame = +2

Query  206  LTFNIHGGYLEAIARGHRAAL  268
            L FNI  GYLE + RG +  +
Sbjct  5    LAFNIDHGYLEGLLRGFKGGI  25



>gb|KFW96249.1| V-type proton ATPase subunit d 2, partial [Phalacrocorax carbo]
Length=228

 Score = 45.8 bits (107),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NE  PL  +TI
Sbjct  36   LAQCETLEDLKLHLQTTDYGNFLANETGPLTISTI  70


 Score = 30.0 bits (66),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M G+    FN+  GYLE + RG +AA+
Sbjct  1    MPGYSEFYFNVDHGYLEGLVRGFKAAI  27



>ref|XP_005746759.1| PREDICTED: V-type proton ATPase subunit d 1-like isoform X2 [Pundamilia 
nyererei]
Length=353

 Score = 48.5 bits (114),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  31   SQADYLNLVQCETLEDLKLHLQSTDYGSFLANEASPLTVSVI  72


 Score = 27.3 bits (59),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  203  ALTFNIHGGYLEAIARGHRAAL  268
            +L FN+  GYLE + RG +A +
Sbjct  8    SLYFNVDNGYLEGLVRGFKAGI  29



>ref|XP_008545613.1| PREDICTED: V-type proton ATPase subunit d [Microplitis demolitor]
Length=348

 Score = 50.1 bits (118),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL+ T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLAGTDYGSFLANEPSPLAVSVI  67


 Score = 25.8 bits (55),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDNGYLEGLCRGFKCGI  24



>ref|XP_002106075.1| GD16660 [Drosophila simulans]
 gb|EDX17022.1| GD16660 [Drosophila simulans]
Length=215

 Score = 49.7 bits (117),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  35   LVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVI  69


 Score = 26.2 bits (56),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  8    FNIDNGYLEGLCRGFKCGI  26



>gb|AFQ00928.1| V-ATPase subunit D [Locusta migratoria]
Length=348

 Score = 50.1 bits (118),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  33   LVQCETLEDLKLHLQGTDYGSFLANEPSPLQVSVI  67


 Score = 25.4 bits (54),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDAGYLEGLCRGFKCGI  24



>gb|ERE77165.1| V-type proton ATPase subunit d 1 [Cricetulus griseus]
Length=266

 Score = 48.1 bits (113),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 27.7 bits (60),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_006020661.1| PREDICTED: V-type proton ATPase subunit d 2 [Alligator sinensis]
 ref|XP_006269774.1| PREDICTED: V-type proton ATPase subunit d 2 [Alligator mississippiensis]
Length=351

 Score = 46.2 bits (108),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NE  PL  +TI
Sbjct  36   LAQCETLEDLKLHLQTTDYGNFLANETGPLTVSTI  70


 Score = 29.6 bits (65),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAALPVRNS  283
            M G+    FN+  GYLE + RG +A + +RN+
Sbjct  1    MQGYSEFYFNVDHGYLEGLVRGFKAGI-LRNA  31



>ref|XP_009249082.1| PREDICTED: V-type proton ATPase subunit d 1 isoform X1 [Pongo 
abelii]
Length=281

 Score = 47.8 bits (112),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  SRGDTGLLCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            S+ D   L QCETL+D+K+HL +T+YG +L NE  PL  + I
Sbjct  29   SQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI  70


 Score = 28.1 bits (61),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M  F  L FN+  GYLE + RG +A +
Sbjct  1    MSFFPELYFNVDNGYLEGLVRGLKAGV  27



>ref|XP_009500220.1| PREDICTED: V-type proton ATPase subunit d 2, partial [Phalacrocorax 
carbo]
Length=213

 Score = 45.4 bits (106),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NE  PL  +TI
Sbjct  36   LAQCETLEDLKLHLQTTDYGNFLANETGPLTISTI  70


 Score = 30.0 bits (66),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 0/27 (0%)
 Frame = +2

Query  188  MYGFEALTFNIHGGYLEAIARGHRAAL  268
            M G+    FN+  GYLE + RG +AA+
Sbjct  1    MPGYSEFYFNVDHGYLEGLVRGFKAAI  27



>ref|XP_001963746.1| GF21182 [Drosophila ananassae]
 ref|XP_001976828.1| GG18679 [Drosophila erecta]
 ref|XP_002071875.1| GK10228 [Drosophila willistoni]
 ref|XP_002100150.1| GE16319 [Drosophila yakuba]
 gb|EDV34195.1| GF21182 [Drosophila ananassae]
 gb|EDV45755.1| GG18679 [Drosophila erecta]
 gb|EDW82861.1| GK10228 [Drosophila willistoni]
 gb|EDX01258.1| GE16319 [Drosophila yakuba]
Length=350

 Score = 49.7 bits (117),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  35   LVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVI  69


 Score = 25.8 bits (55),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  8    FNIDNGYLEGLCRGFKCGI  26



>gb|ENN81765.1| hypothetical protein YQE_01858, partial [Dendroctonus ponderosae]
 gb|ERL89014.1| hypothetical protein D910_06392 [Dendroctonus ponderosae]
Length=348

 Score = 49.7 bits (117),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCE+L+D+K+HL +T+YG +L NEP PL  +TI
Sbjct  33   LVQCESLEDLKLHLQSTDYGTFLANEPSPLAVSTI  67


 Score = 25.8 bits (55),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  6    FNIDNGYLEGLCRGFKCGI  24



>ref|XP_001355168.1| GA15530 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002022805.1| GL14761 [Drosophila persimilis]
 gb|EAL32225.1| GA15530 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW26871.1| GL14761 [Drosophila persimilis]
Length=350

 Score = 49.7 bits (117),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  35   LVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVI  69


 Score = 25.8 bits (55),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  8    FNIDNGYLEGLCRGFKCGI  26



>ref|NP_570080.1| vacuolar H[+] ATPase AC39 subunit 1 [Drosophila melanogaster]
 ref|XP_002037064.1| GM12314 [Drosophila sechellia]
 sp|Q9W4P5.1|VA0D1_DROME RecName: Full=V-type proton ATPase subunit d 1; Short=V-ATPase 
subunit d 1; AltName: Full=V-ATPase 39 kDa subunit; AltName: 
Full=Vacuolar H+ ATPase subunit AC39-1; AltName: Full=Vacuolar 
proton pump subunit d 1 [Drosophila melanogaster]
 gb|AAF45902.1| vacuolar H[+] ATPase AC39 subunit 1 [Drosophila melanogaster]
 gb|AAL39675.1| LD24653p [Drosophila melanogaster]
 gb|EDW53223.1| GM12314 [Drosophila sechellia]
 gb|ACL90736.1| VhaAC39-PA [synthetic construct]
Length=350

 Score = 49.7 bits (117),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  264  LCQCETLDDIKMHLSATEYGPYLQNEPYPLHTTTI  368
            L QCETL+D+K+HL  T+YG +L NEP PL  + I
Sbjct  35   LVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVI  69


 Score = 25.8 bits (55),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = +2

Query  212  FNIHGGYLEAIARGHRAAL  268
            FNI  GYLE + RG +  +
Sbjct  8    FNIDNGYLEGLCRGFKCGI  26



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512602628472