BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20750_g1_i1 len=1522 path=[2653:0-231 2885:232-269 2923:270-684
25:685-724 23:725-726 25:727-766 23:767-768 25:769-808 64:809-1521]

Length=1522
                                                                      Score     E

emb|CDP08030.1|  unnamed protein product                                166   3e-41   
ref|XP_010644255.1|  PREDICTED: uncharacterized protein LOC100255568    155   3e-37   
emb|CDP21917.1|  unnamed protein product                                153   6e-37   
gb|EYU27017.1|  hypothetical protein MIMGU_mgv1a019065mg                149   2e-35   
emb|CDP16262.1|  unnamed protein product                                143   3e-33   
ref|XP_007040748.1|  Uncharacterized protein TCM_016622                 141   3e-32   
gb|KDP43572.1|  hypothetical protein JCGZ_16859                         137   4e-31   
ref|XP_010034341.1|  PREDICTED: uncharacterized protein LOC104423568    136   7e-31   
ref|XP_002528769.1|  conserved hypothetical protein                     132   2e-29   Ricinus communis
ref|XP_009371589.1|  PREDICTED: uncharacterized protein LOC103960820    132   2e-29   
ref|XP_004152420.1|  PREDICTED: uncharacterized protein LOC101209159    131   3e-29   
emb|CBI20388.3|  unnamed protein product                                128   4e-29   
emb|CDP08013.1|  unnamed protein product                                129   8e-29   
ref|XP_010644262.1|  PREDICTED: uncharacterized protein LOC100258913    130   9e-29   
ref|XP_008437035.1|  PREDICTED: uncharacterized protein LOC103482584    130   1e-28   
ref|XP_010055454.1|  PREDICTED: uncharacterized protein LOC104443651    129   2e-28   
ref|XP_008342346.1|  PREDICTED: uncharacterized protein LOC103405164    128   5e-28   
ref|XP_009372850.1|  PREDICTED: uncharacterized protein LOC103961896    128   5e-28   
ref|XP_010644254.1|  PREDICTED: uncharacterized protein LOC100260642    127   8e-28   
emb|CAN75530.1|  hypothetical protein VITISV_001347                     127   8e-28   Vitis vinifera
emb|CBI20386.3|  unnamed protein product                                122   4e-27   
ref|XP_010054394.1|  PREDICTED: uncharacterized protein LOC104442692    124   9e-27   
ref|XP_010039338.1|  PREDICTED: uncharacterized protein LOC104428025    122   1e-26   
ref|XP_010648157.1|  PREDICTED: uncharacterized protein LOC100255511    123   2e-26   
gb|KDP45940.1|  hypothetical protein JCGZ_11843                         122   2e-26   
ref|XP_007146455.1|  hypothetical protein PHAVU_006G042000g             118   1e-25   
ref|XP_006428074.1|  hypothetical protein CICLE_v10027429mg             120   1e-25   
emb|CBI20393.3|  unnamed protein product                                120   2e-25   
ref|XP_007217306.1|  hypothetical protein PRUPE_ppa015371mg             119   4e-25   
ref|XP_006398220.1|  hypothetical protein EUTSA_v10000764mg             119   4e-25   
ref|XP_010040315.1|  PREDICTED: uncharacterized protein LOC104429114    117   4e-25   
ref|XP_007146454.1|  hypothetical protein PHAVU_006G042000g             118   6e-25   
ref|XP_006279990.1|  hypothetical protein CARUB_v10025861mg             119   6e-25   
ref|XP_010068533.1|  PREDICTED: uncharacterized protein LOC104455440    118   7e-25   
ref|XP_008224917.1|  PREDICTED: uncharacterized protein LOC103324616    118   7e-25   
gb|KFK25862.1|  hypothetical protein AALP_AA8G171900                    118   9e-25   
ref|XP_010068523.1|  PREDICTED: uncharacterized protein LOC104455426    118   1e-24   
ref|XP_007214131.1|  hypothetical protein PRUPE_ppa018036mg             117   1e-24   
gb|KDO59993.1|  hypothetical protein CISIN_1g045810mg                   115   6e-24   
gb|KFK31559.1|  hypothetical protein AALP_AA6G127600                    115   6e-24   
ref|XP_009128804.1|  PREDICTED: uncharacterized protein LOC103853646    115   7e-24   
emb|CDP00343.1|  unnamed protein product                                115   7e-24   
ref|XP_010441715.1|  PREDICTED: uncharacterized protein LOC104724856    115   9e-24   
ref|XP_010039368.1|  PREDICTED: uncharacterized protein LOC104428062    114   1e-23   
ref|XP_007214884.1|  hypothetical protein PRUPE_ppa022062mg             114   1e-23   
ref|XP_011018639.1|  PREDICTED: uncharacterized protein LOC105121611    114   2e-23   
ref|NP_199361.1|  uncharacterized protein                               114   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010042029.1|  PREDICTED: uncharacterized protein LOC104431034    114   2e-23   
ref|XP_010065308.1|  PREDICTED: uncharacterized protein LOC104452548    113   3e-23   
ref|XP_010494654.1|  PREDICTED: uncharacterized protein LOC104771778    113   3e-23   
ref|XP_010441710.1|  PREDICTED: uncharacterized protein LOC104724...    113   3e-23   
ref|XP_010104853.1|  hypothetical protein L484_024054                   113   4e-23   
ref|XP_010063737.1|  PREDICTED: uncharacterized protein LOC104450749    113   5e-23   
ref|XP_010481570.1|  PREDICTED: uncharacterized protein LOC104760...    112   6e-23   
ref|XP_010481571.1|  PREDICTED: uncharacterized protein LOC104760...    112   6e-23   
ref|XP_002863477.1|  hypothetical protein ARALYDRAFT_494436             112   7e-23   
ref|XP_010068527.1|  PREDICTED: uncharacterized protein LOC104455430    111   8e-23   
ref|XP_010086810.1|  hypothetical protein L484_009581                   112   1e-22   
emb|CDP10893.1|  unnamed protein product                                111   1e-22   
ref|XP_010040126.1|  PREDICTED: uncharacterized protein LOC104428902    111   1e-22   
ref|XP_008371249.1|  PREDICTED: uncharacterized protein LOC103434679    111   1e-22   
ref|XP_010063782.1|  PREDICTED: uncharacterized protein LOC104450784    111   1e-22   
ref|XP_006368456.1|  hypothetical protein POPTR_0001s02970g             111   2e-22   
ref|XP_010065320.1|  PREDICTED: uncharacterized protein LOC104452555    110   2e-22   
ref|XP_010441713.1|  PREDICTED: uncharacterized protein LOC104724...    111   2e-22   
ref|XP_007040801.1|  Uncharacterized protein TCM_016663                 110   3e-22   
ref|XP_010065323.1|  PREDICTED: uncharacterized protein LOC104452565    107   3e-22   
ref|XP_008228196.1|  PREDICTED: uncharacterized protein LOC103327633    109   4e-22   
ref|XP_010068526.1|  PREDICTED: uncharacterized protein LOC104455429    110   4e-22   
ref|XP_010251680.1|  PREDICTED: uncharacterized protein LOC104593502    108   9e-22   
ref|XP_010039366.1|  PREDICTED: uncharacterized protein LOC104428060    108   1e-21   
ref|XP_006437480.1|  hypothetical protein CICLE_v10030709mg             108   1e-21   
ref|XP_010529242.1|  PREDICTED: uncharacterized protein LOC104806182    107   2e-21   
emb|CAE04180.2|  OSJNBa0029C04.11                                       107   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002863469.1|  hypothetical protein ARALYDRAFT_494429             107   3e-21   
ref|XP_010063749.1|  PREDICTED: uncharacterized protein LOC104450757    107   3e-21   
gb|EMT20379.1|  hypothetical protein F775_22833                         107   4e-21   
ref|XP_010064817.1|  PREDICTED: uncharacterized protein LOC104451970    107   4e-21   
gb|EEE60448.1|  hypothetical protein OsJ_13680                          107   5e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CDY39431.1|  BnaAnng05620D                                          106   7e-21   
gb|AAU44568.1|  hypothetical protein AT5G45540                          105   9e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KDO53052.1|  hypothetical protein CISIN_1g040228mg                   105   1e-20   
ref|XP_010034372.1|  PREDICTED: uncharacterized protein LOC104423603    105   1e-20   
gb|KFK23934.1|  hypothetical protein AALP_AAs69373U000100               104   1e-20   
ref|NP_199367.1|  uncharacterized protein                               105   1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39432.1|  BnaAnng05630D                                          104   2e-20   
ref|XP_010068534.1|  PREDICTED: uncharacterized protein LOC104455442    104   2e-20   
ref|XP_010067369.1|  PREDICTED: uncharacterized protein LOC104454266    104   2e-20   
ref|XP_007216290.1|  hypothetical protein PRUPE_ppa020495mg             104   2e-20   
ref|XP_010032440.1|  PREDICTED: uncharacterized protein LOC104421...    104   3e-20   
ref|XP_010040316.1|  PREDICTED: uncharacterized protein LOC104429115    104   3e-20   
gb|EEE60550.1|  hypothetical protein OsJ_13900                          103   4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006484676.1|  PREDICTED: uncharacterized protein LOC102625373    103   4e-20   
gb|EEC76824.1|  hypothetical protein OsI_14965                          103   5e-20   Oryza sativa Indica Group [Indian rice]
emb|CAI44657.1|  OSJNBa0061C06.7                                        103   5e-20   Oryza sativa [red rice]
ref|XP_010494665.1|  PREDICTED: uncharacterized protein LOC104771784    102   1e-19   
ref|XP_010039369.1|  PREDICTED: uncharacterized protein LOC104428065    100   1e-19   
ref|XP_002867956.1|  hypothetical protein ARALYDRAFT_914755             102   2e-19   
ref|XP_010040122.1|  PREDICTED: uncharacterized protein LOC104428898    102   2e-19   
ref|XP_006398229.1|  hypothetical protein EUTSA_v10000780mg             102   2e-19   
ref|XP_010042289.1|  PREDICTED: uncharacterized protein LOC104431335  97.4    5e-19   
ref|XP_010441702.1|  PREDICTED: uncharacterized protein LOC104724847    100   6e-19   
ref|XP_006282348.1|  hypothetical protein CARUB_v10028645mg             100   6e-19   
ref|XP_010481562.1|  PREDICTED: uncharacterized protein LOC104760352    100   7e-19   
gb|KFK28577.1|  hypothetical protein AALP_AA7G014900                  99.8    7e-19   
ref|XP_008813358.1|  PREDICTED: uncharacterized protein LOC103724015  99.8    1e-18   
emb|CDY38969.1|  BnaC07g18510D                                        99.4    1e-18   
gb|EMT18884.1|  hypothetical protein F775_16946                       99.4    1e-18   
ref|XP_010058313.1|  PREDICTED: uncharacterized protein LOC104446102  98.6    2e-18   
ref|XP_009101588.1|  PREDICTED: uncharacterized protein LOC103827791  99.0    2e-18   
ref|XP_010449415.1|  PREDICTED: uncharacterized protein LOC104731663  99.0    2e-18   
gb|KCW53047.1|  hypothetical protein EUGRSUZ_J02342                   97.8    2e-18   
ref|XP_010251959.1|  PREDICTED: uncharacterized protein LOC104593692  98.2    3e-18   
ref|XP_010034672.1|  PREDICTED: uncharacterized protein LOC104423941  97.4    3e-18   
ref|XP_008228365.1|  PREDICTED: uncharacterized protein LOC103327776  98.2    3e-18   
ref|XP_006362595.1|  PREDICTED: uncharacterized protein LOC102603128  98.2    3e-18   
gb|KFK31554.1|  hypothetical protein AALP_AA6G127000                  98.2    3e-18   
ref|XP_007040746.1|  Uncharacterized protein TCM_016620               97.8    3e-18   
ref|XP_006464314.1|  PREDICTED: uncharacterized protein LOC102619729  97.8    3e-18   
ref|XP_010535680.1|  PREDICTED: uncharacterized protein LOC104810911  98.2    3e-18   
emb|CDP21223.1|  unnamed protein product                              97.1    3e-18   
ref|XP_010039370.1|  PREDICTED: uncharacterized protein LOC104428069  95.5    4e-18   
ref|XP_003580057.1|  PREDICTED: uncharacterized protein LOC100843617  97.4    5e-18   
ref|XP_010068269.1|  PREDICTED: uncharacterized protein LOC104455124  97.1    6e-18   
ref|XP_010067381.1|  PREDICTED: uncharacterized protein LOC104454275  97.1    6e-18   
ref|XP_010095740.1|  hypothetical protein L484_003352                 97.1    7e-18   
ref|XP_010041068.1|  PREDICTED: uncharacterized protein LOC104429975  96.3    1e-17   
ref|XP_004977741.1|  PREDICTED: uncharacterized protein LOC101758603  96.3    1e-17   
ref|XP_010100619.1|  hypothetical protein L484_011550                 96.7    1e-17   
dbj|BAK07923.1|  predicted protein                                    96.3    1e-17   
gb|EMT20380.1|  hypothetical protein F775_22834                       96.3    1e-17   
ref|XP_010675838.1|  PREDICTED: uncharacterized protein LOC104891781  96.3    1e-17   
ref|XP_010034671.1|  PREDICTED: uncharacterized protein LOC104423940  95.9    2e-17   
ref|XP_002863480.1|  hypothetical protein ARALYDRAFT_916927           96.3    2e-17   
ref|XP_006281933.1|  hypothetical protein CARUB_v10028141mg           95.9    2e-17   
ref|XP_010034373.1|  PREDICTED: uncharacterized protein LOC104423604  95.5    2e-17   
gb|KDO39532.1|  hypothetical protein CISIN_1g004958mg                 95.5    2e-17   
ref|XP_006280549.1|  hypothetical protein CARUB_v10026489mg           94.0    2e-17   
ref|XP_010904720.1|  PREDICTED: uncharacterized protein LOC105032071  95.5    2e-17   
gb|KCW51835.1|  hypothetical protein EUGRSUZ_J01287                   94.7    2e-17   
ref|XP_010063694.1|  PREDICTED: uncharacterized protein LOC104450714  95.1    3e-17   
gb|EMT32449.1|  hypothetical protein F775_04044                       95.1    3e-17   
ref|XP_006280036.1|  hypothetical protein CARUB_v10025913mg           95.1    3e-17   
ref|XP_006653146.1|  PREDICTED: uncharacterized protein LOC102710869  94.4    4e-17   
ref|XP_008225847.1|  PREDICTED: uncharacterized protein LOC103325459  94.4    5e-17   
ref|XP_010494651.1|  PREDICTED: uncharacterized protein LOC104771774  94.4    6e-17   
ref|XP_010481574.1|  PREDICTED: uncharacterized protein LOC104760361  94.4    6e-17   
ref|XP_002457356.1|  hypothetical protein SORBIDRAFT_03g005935        94.0    7e-17   Sorghum bicolor [broomcorn]
ref|XP_010434458.1|  PREDICTED: uncharacterized protein LOC104718408  94.0    8e-17   
ref|XP_006414015.1|  hypothetical protein EUTSA_v10024439mg           94.0    8e-17   
ref|XP_008362520.1|  PREDICTED: uncharacterized protein LOC103426202  93.6    1e-16   
gb|KFK23681.1|  hypothetical protein AALP_AAs63807U000200             93.6    1e-16   
ref|XP_008349242.1|  PREDICTED: uncharacterized protein LOC103412469  93.2    1e-16   
gb|KFK28578.1|  hypothetical protein AALP_AA7G015200                  93.2    2e-16   
ref|XP_007214073.1|  hypothetical protein PRUPE_ppa017743mg           92.8    2e-16   
ref|XP_006653150.1|  PREDICTED: uncharacterized protein LOC102712803  92.8    2e-16   
ref|XP_004983450.1|  PREDICTED: uncharacterized protein LOC101760534  92.4    2e-16   
ref|XP_010494649.1|  PREDICTED: uncharacterized protein LOC104771771  92.8    2e-16   
ref|XP_004303690.1|  PREDICTED: uncharacterized protein LOC101298623  92.4    2e-16   
gb|EMS50308.1|  hypothetical protein TRIUR3_05861                     92.0    2e-16   
ref|XP_010317012.1|  PREDICTED: uncharacterized protein LOC101243762  92.0    2e-16   
emb|CAH65940.1|  OSIGBa0147M20.2                                      92.0    3e-16   Oryza sativa [red rice]
emb|CDX83933.1|  BnaC08g17120D                                        91.7    3e-16   
ref|XP_010654430.1|  PREDICTED: uncharacterized protein LOC100251477  91.7    3e-16   
ref|XP_006428081.1|  hypothetical protein CICLE_v10027077mg           92.0    3e-16   
ref|XP_010481582.1|  PREDICTED: uncharacterized protein LOC104760366  92.0    3e-16   
gb|KFK23680.1|  hypothetical protein AALP_AAs63807U000100             91.7    4e-16   
ref|XP_009347581.1|  PREDICTED: uncharacterized protein LOC103939247  91.7    4e-16   
ref|XP_010039361.1|  PREDICTED: uncharacterized protein LOC104428054  90.1    4e-16   
ref|XP_010654879.1|  PREDICTED: uncharacterized protein LOC100246334  91.7    4e-16   
ref|XP_010068529.1|  PREDICTED: uncharacterized protein LOC104455435  88.2    5e-16   
gb|EMT21234.1|  hypothetical protein F775_07197                       91.3    5e-16   
ref|XP_010529252.1|  PREDICTED: uncharacterized protein LOC104806186  91.3    5e-16   
ref|XP_002459209.1|  hypothetical protein SORBIDRAFT_02g000570        91.3    6e-16   Sorghum bicolor [broomcorn]
ref|XP_010034370.1|  PREDICTED: uncharacterized protein LOC104423602  89.4    6e-16   
gb|EMT10076.1|  hypothetical protein F775_01397                       90.9    7e-16   
gb|KCW51834.1|  hypothetical protein EUGRSUZ_J01284                   88.2    7e-16   
gb|EEE60456.1|  hypothetical protein OsJ_13705                        90.5    8e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KDO40246.1|  hypothetical protein CISIN_1g004920mg                 90.5    8e-16   
ref|XP_010654435.1|  PREDICTED: uncharacterized protein LOC100256613  90.5    8e-16   
gb|KDO38886.1|  hypothetical protein CISIN_1g039951mg                 90.1    8e-16   
ref|XP_006428080.1|  hypothetical protein CICLE_v10027546mg           90.5    9e-16   
emb|CDX87779.1|  BnaC02g31700D                                        90.5    9e-16   
gb|ABA94980.1|  expressed protein                                     90.5    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010034368.1|  PREDICTED: uncharacterized protein LOC104423600  87.4    1e-15   
ref|XP_003627290.1|  hypothetical protein MTR_8g020780                89.7    1e-15   
ref|XP_010034364.1|  PREDICTED: uncharacterized protein LOC104423596  89.4    1e-15   
ref|XP_008228369.1|  PREDICTED: uncharacterized protein LOC103327780  89.7    2e-15   
ref|XP_006663073.1|  PREDICTED: uncharacterized protein LOC102709120  89.4    2e-15   
ref|XP_007146453.1|  hypothetical protein PHAVU_006G041900g           89.4    2e-15   
gb|EMT12120.1|  hypothetical protein F775_22042                       89.4    2e-15   
ref|XP_010061838.1|  PREDICTED: uncharacterized protein LOC104449398  89.0    3e-15   
ref|XP_010677076.1|  PREDICTED: uncharacterized protein LOC104892776  88.6    3e-15   
ref|XP_007024692.1|  Uncharacterized protein TCM_029186               88.6    4e-15   
emb|CDX90102.1|  BnaA08g18820D                                        88.2    4e-15   
gb|EAZ02516.1|  hypothetical protein OsI_24619                        88.2    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009392549.1|  PREDICTED: uncharacterized protein LOC103978475  88.2    5e-15   
emb|CAE05328.2|  OSJNBa0056L23.26                                     88.2    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580068.2|  PREDICTED: uncharacterized protein LOC100846771  87.8    5e-15   
gb|EMS54784.1|  hypothetical protein TRIUR3_29974                     87.8    5e-15   
ref|XP_010905306.1|  PREDICTED: uncharacterized protein LOC105032542  87.8    6e-15   
ref|XP_010237421.1|  PREDICTED: uncharacterized protein LOC100828820  88.2    6e-15   
gb|EMT21377.1|  hypothetical protein F775_05712                       88.2    6e-15   
ref|NP_001045426.2|  Os01g0953100                                     87.8    7e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56017.1|  hypothetical protein OsJ_04788                        87.8    7e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010654882.1|  PREDICTED: uncharacterized protein LOC100261798  87.0    7e-15   
ref|XP_004977724.1|  PREDICTED: uncharacterized protein LOC101782233  87.4    7e-15   
ref|XP_011013300.1|  PREDICTED: uncharacterized protein LOC105117357  87.4    9e-15   
ref|XP_006280006.1|  hypothetical protein CARUB_v10025879mg           87.4    9e-15   
gb|EMT32551.1|  hypothetical protein F775_00653                       87.0    1e-14   
gb|EMS65395.1|  hypothetical protein TRIUR3_09082                     87.4    1e-14   
ref|XP_004974407.1|  PREDICTED: uncharacterized protein LOC101770604  87.0    1e-14   
gb|EMS64125.1|  hypothetical protein TRIUR3_19935                     87.0    1e-14   
ref|XP_010670792.1|  PREDICTED: uncharacterized protein LOC104887761  87.0    1e-14   
ref|XP_002863470.1|  predicted protein                                87.0    1e-14   
ref|XP_011040249.1|  PREDICTED: uncharacterized protein LOC105136553  86.7    1e-14   
ref|XP_010441722.1|  PREDICTED: uncharacterized protein LOC104724...  85.9    1e-14   
gb|EMS53204.1|  hypothetical protein TRIUR3_14023                     86.7    2e-14   
gb|EAY92921.1|  hypothetical protein OsI_14725                        86.3    2e-14   Oryza sativa Indica Group [Indian rice]
gb|EEE60461.1|  hypothetical protein OsJ_13711                        86.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EMT16644.1|  hypothetical protein F775_03233                       85.9    2e-14   
gb|EMS51957.1|  hypothetical protein TRIUR3_07227                     85.9    2e-14   
emb|CAH65942.1|  OSIGBa0147M20.4                                      85.9    2e-14   Oryza sativa [red rice]
gb|KCW53128.1|  hypothetical protein EUGRSUZ_J02420                   85.5    3e-14   
ref|XP_003632780.2|  PREDICTED: uncharacterized protein LOC100854005  85.9    3e-14   
emb|CAE04417.2|  OSJNBb0040D15.7                                      85.5    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663434.1|  PREDICTED: uncharacterized protein LOC102709123  85.1    4e-14   
ref|XP_008224933.1|  PREDICTED: uncharacterized protein LOC103324630  85.1    4e-14   
gb|EAZ38443.1|  hypothetical protein OsJ_22821                        85.5    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006398228.1|  hypothetical protein EUTSA_v10001216mg           85.5    4e-14   
ref|NP_001058721.1|  Os07g0109100                                     85.1    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EMT09518.1|  hypothetical protein F775_22766                       85.1    5e-14   
ref|XP_006653153.1|  PREDICTED: uncharacterized protein LOC102713624  85.5    5e-14   
ref|XP_010441721.1|  PREDICTED: uncharacterized protein LOC104724...  84.7    5e-14   
ref|XP_007146447.1|  hypothetical protein PHAVU_006G041300g           84.7    6e-14   
emb|CDY38971.1|  BnaC07g18490D                                        84.7    7e-14   
gb|KDO70909.1|  hypothetical protein CISIN_1g007340mg                 84.3    7e-14   
ref|XP_008670985.1|  PREDICTED: uncharacterized protein LOC103648281  84.7    7e-14   
ref|XP_009128802.1|  PREDICTED: uncharacterized protein LOC103853...  84.7    7e-14   
ref|XP_009128803.1|  PREDICTED: uncharacterized protein LOC103853...  84.3    8e-14   
ref|XP_010097434.1|  hypothetical protein L484_003205                 84.3    8e-14   
gb|EAZ02517.1|  hypothetical protein OsI_24621                        84.3    9e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_003577300.1|  PREDICTED: uncharacterized protein LOC100843708  84.0    1e-13   
gb|KFK33780.1|  hypothetical protein AALP_AA5G059100                  83.6    1e-13   
ref|XP_010441716.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  84.0    1e-13   
ref|XP_010032288.1|  PREDICTED: uncharacterized protein LOC104421862  81.3    1e-13   
ref|XP_009417395.1|  PREDICTED: uncharacterized protein LOC103997790  84.0    1e-13   
ref|XP_002322521.2|  hypothetical protein POPTR_0016s01380g           83.6    1e-13   Populus trichocarpa [western balsam poplar]
gb|EEC76723.1|  hypothetical protein OsI_14744                        83.6    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010034369.1|  PREDICTED: uncharacterized protein LOC104423601  83.6    1e-13   
ref|XP_002459210.1|  hypothetical protein SORBIDRAFT_02g000580        83.6    1e-13   Sorghum bicolor [broomcorn]
ref|XP_011014308.1|  PREDICTED: uncharacterized protein LOC105118132  83.6    1e-13   
ref|XP_010650636.1|  PREDICTED: uncharacterized protein LOC104879474  83.6    1e-13   
gb|EMT11984.1|  hypothetical protein F775_00068                       83.6    1e-13   
ref|XP_009417393.1|  PREDICTED: uncharacterized protein LOC103997789  83.2    1e-13   
gb|EMT18905.1|  hypothetical protein F775_01698                       83.6    1e-13   
gb|EAY81637.1|  hypothetical protein OsI_36806                        83.2    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_006464478.1|  PREDICTED: uncharacterized protein LOC102617005  83.2    2e-13   
ref|XP_010045164.1|  PREDICTED: uncharacterized protein LOC104433...  83.2    2e-13   
ref|XP_009101590.1|  PREDICTED: uncharacterized protein LOC103827792  83.2    2e-13   
ref|XP_011014307.1|  PREDICTED: uncharacterized protein LOC105118131  83.2    2e-13   
ref|XP_002863478.1|  hypothetical protein ARALYDRAFT_494437           83.2    2e-13   
ref|NP_001068343.1|  Os11g0639300                                     83.2    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KCW87317.1|  hypothetical protein EUGRSUZ_B03804                   83.2    2e-13   
ref|XP_010045162.1|  PREDICTED: uncharacterized protein LOC104433...  82.8    2e-13   
emb|CDX87780.1|  BnaC02g31690D                                        83.2    2e-13   
ref|XP_006663432.1|  PREDICTED: uncharacterized protein LOC102708570  82.8    2e-13   
ref|XP_011080567.1|  PREDICTED: uncharacterized protein LOC105163796  82.4    3e-13   
ref|XP_010644941.1|  PREDICTED: uncharacterized protein LOC104877757  82.4    3e-13   
emb|CAN83215.1|  hypothetical protein VITISV_018465                   82.0    3e-13   Vitis vinifera
gb|EMS62773.1|  hypothetical protein TRIUR3_05330                     82.0    3e-13   
emb|CAN73463.1|  hypothetical protein VITISV_034873                   82.0    4e-13   Vitis vinifera
emb|CAN59756.1|  hypothetical protein VITISV_034568                   82.0    4e-13   Vitis vinifera
gb|EMT04283.1|  hypothetical protein F775_01734                       82.0    4e-13   
ref|XP_006658238.1|  PREDICTED: uncharacterized protein LOC102720893  82.0    4e-13   
emb|CBI35872.3|  unnamed protein product                              82.4    4e-13   
ref|XP_010650642.1|  PREDICTED: uncharacterized protein LOC100252444  82.0    4e-13   
gb|KFK31565.1|  hypothetical protein AALP_AA6G128300                  82.0    4e-13   
ref|XP_002863471.1|  hypothetical protein ARALYDRAFT_494430           82.0    4e-13   
emb|CDP19717.1|  unnamed protein product                              81.6    5e-13   
ref|XP_002448921.1|  hypothetical protein SORBIDRAFT_05g001620        81.6    5e-13   
gb|EAY92953.1|  hypothetical protein OsI_14747                        81.6    5e-13   
emb|CAN77527.1|  hypothetical protein VITISV_041423                   81.6    5e-13   
ref|XP_006653140.1|  PREDICTED: uncharacterized protein LOC102708891  81.6    5e-13   
ref|XP_010650647.1|  PREDICTED: uncharacterized protein LOC100241320  81.6    5e-13   
ref|XP_010692889.1|  PREDICTED: uncharacterized protein LOC104905931  81.6    5e-13   
gb|EMT32605.1|  hypothetical protein F775_13701                       81.6    6e-13   
ref|XP_003561517.1|  PREDICTED: uncharacterized protein LOC100832608  81.6    6e-13   
ref|XP_006282059.1|  hypothetical protein CARUB_v10028304mg           81.6    6e-13   
ref|XP_006428002.1|  hypothetical protein CICLE_v10025090mg           81.3    6e-13   
gb|EMT26387.1|  hypothetical protein F775_21325                       81.6    6e-13   
gb|AAT73634.1|  hypothetical protein                                  81.3    7e-13   
ref|XP_010240214.1|  PREDICTED: uncharacterized protein LOC104585398  81.3    7e-13   
gb|KDP38349.1|  hypothetical protein JCGZ_04274                       81.6    7e-13   
ref|XP_010441714.1|  PREDICTED: uncharacterized protein LOC104724854  81.3    8e-13   
ref|XP_007041677.1|  Uncharacterized protein TCM_006509               80.9    8e-13   
gb|EMT27660.1|  hypothetical protein F775_03806                       81.3    9e-13   
ref|XP_006282044.1|  hypothetical protein CARUB_v10028286mg           81.3    9e-13   
ref|XP_002450142.1|  hypothetical protein SORBIDRAFT_05g001100        80.9    1e-12   
ref|XP_010240712.1|  PREDICTED: uncharacterized protein LOC100838865  80.9    1e-12   
ref|XP_010654883.1|  PREDICTED: uncharacterized protein LOC104880292  81.3    1e-12   
ref|NP_199360.1|  uncharacterized protein                             80.9    1e-12   
ref|XP_010654885.1|  PREDICTED: uncharacterized protein LOC100263568  80.5    1e-12   
emb|CBI36697.3|  unnamed protein product                              80.5    1e-12   
ref|XP_002445038.1|  hypothetical protein SORBIDRAFT_07g003190        80.5    1e-12   
ref|XP_007024687.1|  Uncharacterized protein isoform 1                80.5    1e-12   
ref|XP_002526963.1|  conserved hypothetical protein                   80.5    1e-12   
gb|EEC76720.1|  hypothetical protein OsI_14740                        79.7    1e-12   
ref|XP_008655730.1|  PREDICTED: uncharacterized protein LOC103634...  80.5    1e-12   
ref|XP_010917867.1|  PREDICTED: uncharacterized protein LOC105042386  80.5    1e-12   
ref|XP_007214584.1|  hypothetical protein PRUPE_ppa025788mg           80.1    2e-12   
gb|EMT15385.1|  hypothetical protein F775_01204                       80.1    2e-12   
emb|CDY26372.1|  BnaA02g23980D                                        80.5    2e-12   
ref|XP_006280029.1|  hypothetical protein CARUB_v10025906mg           80.1    2e-12   
emb|CAE03063.1|  OSJNBa0089E12.1                                      80.1    2e-12   
gb|EAY92956.1|  hypothetical protein OsI_14750                        80.1    2e-12   
ref|XP_002307878.2|  hypothetical protein POPTR_0006s01270g           79.7    2e-12   
ref|XP_009378272.1|  PREDICTED: uncharacterized protein LOC103966786  77.8    2e-12   
ref|NP_199366.1|  uncharacterized protein                             80.1    2e-12   
emb|CAH65968.1|  H0820C10.1                                           79.7    2e-12   
ref|XP_004979468.1|  PREDICTED: uncharacterized protein LOC101757...  79.7    2e-12   
ref|XP_009375975.1|  PREDICTED: uncharacterized protein LOC103964736  79.7    2e-12   
emb|CDM80209.1|  unnamed protein product                              79.7    3e-12   
ref|XP_008671463.1|  PREDICTED: uncharacterized protein LOC103648845  79.3    3e-12   
ref|NP_001052113.1|  Os04g0150300                                     79.0    3e-12   
ref|XP_010654884.1|  PREDICTED: uncharacterized protein LOC100251572  79.3    3e-12   
ref|XP_007217587.1|  hypothetical protein PRUPE_ppa019290mg           79.0    3e-12   
emb|CDM86208.1|  unnamed protein product                              79.0    3e-12   
gb|EMT26776.1|  hypothetical protein F775_04165                       79.0    3e-12   
tpg|DAA38641.1|  TPA: putative protein of unknown function (DUF59...  79.0    4e-12   
gb|EAZ29624.1|  hypothetical protein OsJ_13691                        79.0    4e-12   
emb|CAE04520.2|  OSJNBb0076A11.4                                      79.0    4e-12   
gb|EMS50843.1|  hypothetical protein TRIUR3_33796                     79.0    4e-12   
ref|XP_002513101.1|  conserved hypothetical protein                   79.0    4e-12   
ref|XP_006653193.1|  PREDICTED: uncharacterized protein LOC102707671  79.3    4e-12   
ref|XP_003566088.1|  PREDICTED: uncharacterized protein LOC100822318  79.0    4e-12   
ref|XP_002321760.1|  hypothetical protein POPTR_0015s11900g           78.6    5e-12   
ref|XP_008385094.1|  PREDICTED: uncharacterized protein LOC103447684  78.6    5e-12   
ref|XP_006657393.1|  PREDICTED: uncharacterized protein LOC102714841  79.0    5e-12   
emb|CBH32630.1|  conserved hypothetical protein, expressed            78.2    5e-12   
gb|KCW66957.1|  hypothetical protein EUGRSUZ_F00719                   78.2    5e-12   
ref|XP_002513096.1|  conserved hypothetical protein                   78.6    5e-12   
gb|EMT08417.1|  hypothetical protein F775_22864                       78.2    6e-12   
gb|AFW57389.1|  putative protein of unknown function (DUF594) dom...  78.2    7e-12   
ref|XP_010256381.1|  PREDICTED: uncharacterized protein LOC104596790  78.2    7e-12   
gb|EMS50370.1|  hypothetical protein TRIUR3_28914                     78.2    7e-12   
gb|EAZ29640.1|  hypothetical protein OsJ_13707                        78.2    7e-12   
ref|XP_007221914.1|  hypothetical protein PRUPE_ppa026837mg           78.2    7e-12   
gb|KEH43307.1|  DUF594 family protein                                 77.8    8e-12   
emb|CAE04415.2|  OSJNBb0040D15.5                                      77.8    8e-12   
gb|EMS65912.1|  hypothetical protein TRIUR3_02247                     77.8    9e-12   
ref|XP_002450141.1|  hypothetical protein SORBIDRAFT_05g001090        77.8    1e-11   
ref|XP_006645531.1|  PREDICTED: uncharacterized protein LOC102702059  77.8    1e-11   
gb|EMS45218.1|  hypothetical protein TRIUR3_19950                     77.8    1e-11   
ref|XP_010481573.1|  PREDICTED: uncharacterized protein LOC104760360  77.8    1e-11   
dbj|BAK00025.1|  predicted protein                                    77.4    1e-11   
ref|XP_006653190.1|  PREDICTED: uncharacterized protein LOC102704885  77.4    1e-11   
ref|XP_009595825.1|  PREDICTED: uncharacterized protein LOC104092041  77.4    1e-11   
ref|XP_006398219.1|  hypothetical protein EUTSA_v10000775mg           77.4    1e-11   
gb|KCW53495.1|  hypothetical protein EUGRSUZ_J02761                   76.6    1e-11   
ref|NP_199359.3|  uncharacterized protein                             77.0    1e-11   
gb|KHN00959.1|  hypothetical protein glysoja_000627                   77.0    2e-11   
ref|XP_009758086.1|  PREDICTED: uncharacterized protein LOC104210813  77.0    2e-11   
ref|XP_007024623.1|  Uncharacterized protein isoform 1                77.0    2e-11   
ref|XP_007024624.1|  Uncharacterized protein isoform 2                77.0    2e-11   
ref|XP_003555479.1|  PREDICTED: uncharacterized protein LOC100799916  76.6    2e-11   
ref|XP_002458635.1|  hypothetical protein SORBIDRAFT_03g037110        76.6    2e-11   
ref|XP_006653148.1|  PREDICTED: uncharacterized protein LOC102711695  76.6    2e-11   
emb|CAE04990.1|  OSJNBa0057M08.29                                     76.6    2e-11   
ref|XP_002310459.2|  hypothetical protein POPTR_0007s02480g           76.3    2e-11   
dbj|BAJ89418.1|  predicted protein                                    76.3    3e-11   
ref|XP_006428077.1|  hypothetical protein CICLE_v10027080mg           76.3    3e-11   
ref|XP_010495724.1|  PREDICTED: uncharacterized protein LOC104772863  76.3    3e-11   
ref|XP_004977743.1|  PREDICTED: uncharacterized protein LOC101760235  76.3    3e-11   
ref|XP_002269508.1|  PREDICTED: uncharacterized protein LOC100261035  76.3    3e-11   
emb|CAE04529.2|  OSJNBb0076A11.13                                     76.3    3e-11   
ref|XP_007023048.1|  Uncharacterized protein TCM_027053               76.3    3e-11   
emb|CAE04193.2|  OSJNBa0011E07.2                                      75.9    3e-11   
gb|EAZ29630.1|  hypothetical protein OsJ_13696                        75.9    4e-11   
ref|XP_006374419.1|  hypothetical protein POPTR_0015s07020g           75.9    4e-11   
ref|XP_006374420.1|  hypothetical protein POPTR_0015s07020g           75.9    4e-11   
ref|XP_004985802.1|  PREDICTED: uncharacterized protein LOC101763926  75.9    4e-11   
gb|EEC66778.1|  hypothetical protein OsI_33168                        75.5    4e-11   
ref|XP_004977747.1|  PREDICTED: uncharacterized protein LOC101761830  75.5    5e-11   
ref|XP_010034787.1|  PREDICTED: uncharacterized protein LOC104424106  75.5    5e-11   
ref|NP_001044525.1|  Os01g0798800                                     75.5    5e-11   
gb|EMT21154.1|  hypothetical protein F775_01100                       75.5    5e-11   
emb|CAE05325.2|  OSJNBa0056L23.23                                     75.5    5e-11   
ref|XP_010445807.1|  PREDICTED: uncharacterized protein LOC104728544  75.5    5e-11   
gb|EEC71644.1|  hypothetical protein OsI_04079                        75.5    5e-11   
gb|EMT12415.1|  hypothetical protein F775_22537                       72.4    5e-11   
ref|XP_010034687.1|  PREDICTED: uncharacterized protein LOC104423969  75.5    5e-11   
gb|KCW44581.1|  hypothetical protein EUGRSUZ_L01905                   75.1    5e-11   
gb|KHM99576.1|  hypothetical protein glysoja_006419                   75.5    5e-11   
ref|XP_010481563.1|  PREDICTED: uncharacterized protein LOC104760353  75.5    5e-11   
dbj|BAJ99618.1|  predicted protein                                    75.1    6e-11   
ref|XP_010227345.1|  PREDICTED: uncharacterized protein LOC100823635  74.7    6e-11   
ref|XP_006586078.1|  PREDICTED: uncharacterized protein LOC100794157  75.5    6e-11   
gb|KFK31560.1|  hypothetical protein AALP_AA6G127700                  75.1    7e-11   
gb|KCW53387.1|  hypothetical protein EUGRSUZ_J02618                   74.7    7e-11   
ref|XP_004496121.1|  PREDICTED: uncharacterized protein LOC101495...  75.1    7e-11   
ref|XP_010086813.1|  hypothetical protein L484_009584                 74.7    8e-11   
ref|XP_008384008.1|  PREDICTED: uncharacterized protein LOC103446655  74.7    8e-11   
ref|XP_008662204.1|  PREDICTED: putative protein of unknown funct...  74.3    9e-11   
ref|XP_002307876.1|  hypothetical protein POPTR_0006s01250g           74.7    9e-11   
ref|XP_002322346.2|  hypothetical protein POPTR_0015s12520g           74.3    9e-11   
ref|XP_004974964.1|  PREDICTED: uncharacterized protein LOC101768...  74.3    9e-11   
gb|KCW53050.1|  hypothetical protein EUGRSUZ_J02347                   74.7    9e-11   
ref|XP_010034674.1|  PREDICTED: uncharacterized protein LOC104423944  74.7    1e-10   
ref|XP_006653145.1|  PREDICTED: uncharacterized protein LOC102710584  74.7    1e-10   
ref|XP_002870001.1|  predicted protein                                74.7    1e-10   
gb|AFW57755.1|  putative protein of unknown function (DUF594) dom...  74.3    1e-10   
ref|XP_008662201.1|  PREDICTED: putative protein of unknown funct...  74.3    1e-10   
gb|EMT16300.1|  Putative disease resistance RPP13-like protein 1      74.7    1e-10   
ref|XP_004974963.1|  PREDICTED: uncharacterized protein LOC101768...  74.3    1e-10   
ref|NP_001169592.1|  putative protein of unknown function (DUF594...  74.3    1e-10   
gb|EMT12931.1|  hypothetical protein F775_03729                       74.3    1e-10   
ref|XP_010229183.1|  PREDICTED: uncharacterized protein LOC100832216  74.3    1e-10   
ref|XP_008662202.1|  PREDICTED: putative protein of unknown funct...  73.9    1e-10   
ref|XP_008662203.1|  PREDICTED: putative protein of unknown funct...  73.9    1e-10   
ref|XP_002321759.1|  hypothetical protein POPTR_0015s11870g           73.9    1e-10   
gb|EMT21997.1|  hypothetical protein F775_52188                       74.3    1e-10   
gb|EAZ41798.1|  hypothetical protein OsJ_26338                        73.9    1e-10   
dbj|BAD03401.1|  hypothetical protein                                 73.9    1e-10   
gb|KFK31555.1|  hypothetical protein AALP_AA6G127100                  73.9    1e-10   
ref|XP_010046501.1|  PREDICTED: uncharacterized protein LOC104435447  73.9    1e-10   
ref|XP_010101719.1|  hypothetical protein L484_017349                 73.9    1e-10   
ref|XP_010097448.1|  hypothetical protein L484_004684                 73.9    2e-10   
dbj|BAJ97744.1|  predicted protein                                    73.9    2e-10   
gb|EMT02880.1|  hypothetical protein F775_08276                       73.9    2e-10   
ref|XP_008384010.1|  PREDICTED: uncharacterized protein LOC103446657  73.6    2e-10   
ref|XP_011026346.1|  PREDICTED: uncharacterized protein LOC105126985  73.6    2e-10   
emb|CBI35870.3|  unnamed protein product                              73.9    2e-10   
gb|KCW53127.1|  hypothetical protein EUGRSUZ_J02419                   73.6    2e-10   
ref|XP_006653151.1|  PREDICTED: uncharacterized protein LOC102713074  73.6    2e-10   
ref|NP_001064403.1|  Os10g0348600                                     73.6    2e-10   
ref|XP_004288842.1|  PREDICTED: uncharacterized protein LOC101309774  73.2    2e-10   
gb|EMS61124.1|  hypothetical protein TRIUR3_09753                     73.6    2e-10   
gb|EMT20900.1|  hypothetical protein F775_23116                       73.2    3e-10   
ref|XP_010112454.1|  hypothetical protein L484_013838                 72.4    3e-10   
gb|EAZ05897.1|  hypothetical protein OsI_28135                        73.2    3e-10   
gb|EMS47411.1|  hypothetical protein TRIUR3_14463                     73.2    3e-10   
ref|XP_002267918.2|  PREDICTED: uncharacterized protein LOC100242192  73.2    3e-10   
gb|KCW53121.1|  hypothetical protein EUGRSUZ_J02413                   73.2    3e-10   
emb|CAN77530.1|  hypothetical protein VITISV_041426                   72.8    3e-10   
ref|XP_002321761.2|  hypothetical protein POPTR_0015s11930g           72.8    3e-10   
gb|EMT12317.1|  hypothetical protein F775_33107                       72.0    3e-10   
ref|XP_006374598.1|  hypothetical protein POPTR_0015s12510g           72.8    4e-10   
ref|XP_010097432.1|  hypothetical protein L484_003203                 72.8    4e-10   
gb|KDO40247.1|  hypothetical protein CISIN_1g046883mg                 70.9    4e-10   
ref|XP_010233122.1|  PREDICTED: uncharacterized protein LOC104583094  72.8    4e-10   
ref|XP_007015633.1|  Uncharacterized protein TCM_041206               72.4    4e-10   
gb|EMT08351.1|  hypothetical protein F775_22779                       72.4    4e-10   
ref|XP_010650637.1|  PREDICTED: uncharacterized protein LOC104879475  72.4    4e-10   
emb|CDM80026.1|  unnamed protein product                              72.0    4e-10   
ref|XP_010034772.1|  PREDICTED: uncharacterized protein LOC104424087  72.4    4e-10   
ref|XP_002321757.2|  hypothetical protein POPTR_0015s11860g           71.2    5e-10   
ref|XP_007024662.1|  Uncharacterized protein TCM_029163               72.0    5e-10   
ref|XP_010650649.1|  PREDICTED: uncharacterized protein LOC100852780  72.0    6e-10   
ref|XP_007041672.1|  Uncharacterized protein TCM_006503               72.4    6e-10   
gb|KCW53129.1|  hypothetical protein EUGRSUZ_J02421                   72.0    6e-10   
ref|XP_004977742.1|  PREDICTED: uncharacterized protein LOC101759821  72.0    6e-10   
ref|XP_011036419.1|  PREDICTED: uncharacterized protein LOC105133946  72.0    6e-10   
ref|XP_007022010.1|  Uncharacterized protein TCM_032137               72.0    6e-10   
gb|KEH40110.1|  DUF594 family protein                                 72.0    7e-10   
ref|XP_010034689.1|  PREDICTED: uncharacterized protein LOC104423973  71.6    7e-10   
emb|CAE02175.2|  OSJNBa0080E14.6                                      71.6    8e-10   
ref|XP_006446041.1|  hypothetical protein CICLE_v10014545mg           71.6    8e-10   
ref|XP_007041674.1|  Uncharacterized protein TCM_006506               71.2    9e-10   
ref|XP_010540150.1|  PREDICTED: uncharacterized protein LOC104814000  71.6    9e-10   
ref|XP_011001065.1|  PREDICTED: uncharacterized protein LOC105108443  71.2    9e-10   
ref|XP_007041676.1|  Uncharacterized protein TCM_006508               71.2    9e-10   
ref|XP_006374720.1|  hypothetical protein POPTR_0015s15920g           71.2    1e-09   
ref|XP_006663621.1|  PREDICTED: uncharacterized protein LOC102702983  71.2    1e-09   
ref|XP_007201599.1|  hypothetical protein PRUPE_ppa019270mg           71.2    1e-09   
ref|XP_009405632.1|  PREDICTED: uncharacterized protein LOC103988731  71.2    1e-09   
gb|EAZ29611.1|  hypothetical protein OsJ_13683                        70.9    1e-09   
emb|CBI36716.3|  unnamed protein product                              70.1    1e-09   
ref|XP_010529253.1|  PREDICTED: uncharacterized protein LOC104806187  71.2    1e-09   
gb|EMS53240.1|  hypothetical protein TRIUR3_15308                     70.9    1e-09   
ref|NP_193644.1|  uncharacterized protein                             70.9    1e-09   
gb|EMS54412.1|  hypothetical protein TRIUR3_08631                     70.9    1e-09   
emb|CBI36696.3|  unnamed protein product                              70.9    2e-09   
gb|KHN00983.1|  hypothetical protein glysoja_000651                   70.9    2e-09   
gb|KDO60975.1|  hypothetical protein CISIN_1g041586mg                 70.9    2e-09   
ref|XP_010033736.1|  PREDICTED: uncharacterized protein LOC104422985  70.5    2e-09   
gb|EEC81382.1|  hypothetical protein OsI_24593                        70.9    2e-09   
ref|XP_006437161.1|  hypothetical protein CICLE_v10033775mg           70.5    2e-09   
ref|XP_006467208.1|  PREDICTED: uncharacterized protein LOC102619155  70.5    2e-09   
gb|EAY92954.1|  hypothetical protein OsI_14748                        70.5    2e-09   
ref|XP_006388860.1|  hypothetical protein POPTR_0088s00240g           70.5    2e-09   
ref|NP_001058700.1|  Os07g0105800                                     70.5    2e-09   
gb|EAY92945.1|  hypothetical protein OsI_14741                        70.1    2e-09   
ref|XP_010034366.1|  PREDICTED: uncharacterized protein LOC104423598  70.1    2e-09   
ref|XP_007227680.1|  hypothetical protein PRUPE_ppa026037mg           68.9    2e-09   
gb|KCW59534.1|  hypothetical protein EUGRSUZ_H02289                   70.1    2e-09   
dbj|BAC83041.1|  hypothetical protein                                 70.1    2e-09   
ref|XP_003564400.2|  PREDICTED: uncharacterized protein LOC100835510  70.1    2e-09   
gb|EAZ02978.1|  hypothetical protein OsI_25118                        70.1    2e-09   
emb|CAE02958.2|  OSJNBb0050N09.9                                      70.1    2e-09   



>emb|CDP08030.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 141/489 (29%), Positives = 227/489 (46%), Gaps = 91/489 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q+ +V  V  Q     ++  +PT ++F  G +K  ER  +L L 
Sbjct  110   LEDNELWIRHLLGLVIQLVAVAYVFAQS--IHTDLSVPTILLFFAGAIKYAERTRALYLG  167

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                         L S  S+  IR E  D T       ++V+  YE    F+G I+DH F 
Sbjct  168   C-----------LGSQTSE--IRGE-TDWTTEQNPHLDVVQTGYEFFTTFRGLIVDHMFS  213

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E  K +++F   +  DAF+V+E+EL+FMYD+++TKM  V    G       ++RF+C+
Sbjct  214   FHERNKSRNFFSRRSARDAFRVIEVELNFMYDSLYTKMAVVHSNIGY------VFRFICS  267

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
              L+V   + F  H    +   D+ VTY L+ GAV LD +ALI +IFS W +V ++   V 
Sbjct  268   VLIVLSLVEFASHHSPEINHFDVAVTYILLYGAVGLDLVALIKVIFSDWTVVVLKNRRV-  326

Query  800   TPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSG  621
                                                 ++I+S +       T+ + + WS 
Sbjct  327   ------------------------------------KRIVSAVR-----DTLSSDRRWSN  345

Query  620   EIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrre  441
              I QY+L+   L  +R +  D   E   LK V+D   + +   +++ LK  +F+++K + 
Sbjct  346   TISQYNLINFCL-NQRWRWLDIAAETIGLKAVLDEMKYKKDFFIQDNLKEFIFQELKGKA  404

Query  440   kakeaaaepekETYHRQEVMDKIKKIHLA------PKvvdsssddvvvsvddDIENYANF  279
                            + E     K+I+ A      P  +   S  +  SV ++++ Y   
Sbjct  405   --------------RKAETNKVAKEIYSARGKRALPDYICYRSSTMSSSVSEEVD-YDES  449

Query  278   VLTLHVATEICYFTADKTKGGDDEAGAKLLCIQISQYLAYLLVLEEKITSAVPGSIGMRF  99
             +L  H+ATE+CY T+   K  + E      C  IS Y+ YLLV+   + SAV G   +RF
Sbjct  450   LLLWHIATELCYSTSPGDKNSNRE-----FCKLISDYMLYLLVMRPTMMSAVAGIGQIRF  504

Query  98    KDICKDQIK  72
             +D C++  K
Sbjct  505   QDTCEEAKK  513



>ref|XP_010644255.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644256.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644258.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
Length=733

 Score =   155 bits (392),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 153/543 (28%), Positives = 240/543 (44%), Gaps = 92/543 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q  +V  V  +  I    W+ PT ++ + G +K  ER  +L LA
Sbjct  107   LEDNELWLRHLLGLVIQFIAVAYVFLE-SISNDLWI-PTILMLVAGTIKYAERTRALYLA  164

Query  1340  SSRFVRKSIGKSLDS------------------VASKELIRAEGKDMTD---------NI  1242
                  ++S+    D+                  V  K +I  E +  T            
Sbjct  165   CLGNFKESMLPPPDAGPNYAQLMEEYSSKKEAHVPVKIIIAPEKRASTSASSVPEEPSTG  224

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              N    +   Y+  +IFKG I+D  F   E    + +F  +  E AF+V+E+EL+FMYDA
Sbjct  225   PNHISEMESGYKFFKIFKGLIVDLMFSFQERNDSRKFFFGMLPEKAFRVIEVELNFMYDA  284

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             ++TKM  V +  G   YF   +RF+C   +     +F  H K  +   DIGVTY L+ GA
Sbjct  285   LYTKMAVVNRKIG---YF---FRFICTGCIAVALQLFASHHKHKIHKFDIGVTYALLIGA  338

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVAR  702
             + LD +A++ LIFS W +V ++  T    +              AR+             
Sbjct  339   IGLDVIAIVKLIFSDWTIVLLKNSTAKRWIY------------YARE-------------  373

Query  701   KLKQKIISLIYYGHKLITVVNS---KSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLK  531
                     L +Y  KL     S   + WS  I Q+ L+++ L   R K  D   +   LK
Sbjct  374   -------KLFFY--KLWEPSKSFFDRRWSNSISQHGLIRYCLR-ERFKWFDKLADICGLK  423

Query  530   GVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYH--RQEVMDKIKKIHL  357
              ++D   + +T  VEEKLK  +F+++K + K+ E   E  K      R+    +I K   
Sbjct  424   DLLDEIQYKKTVTVEEKLKEFIFKELKEKAKSSEQLEEKAKSAEEKARRAEQSRIAKEIC  483

Query  356   APKvvdsssddvvvsvddDIE-NYANFVLTLHVATEICYFTADKTKGGDDEAGA------  198
             + +     S +   S+   +E  Y   +L  H+AT++C++   + K   D+         
Sbjct  484   SGRGDWILSQNACHSLLWSVEKEYDECLLMWHIATDLCHYKEQEEKEKPDDVQEEELRRL  543

Query  197   -KLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKD---------QIKNTFDHLCD  48
              + LCI +S+Y+ YLLV+   + SAV G   +RF+D C +         Q  N F   C 
Sbjct  544   DRQLCICLSEYMLYLLVMRPTMMSAVAGIGQIRFRDTCAEAKKFFRRGQQEPNCFKKFCK  603

Query  47    TFK  39
               K
Sbjct  604   QLK  606



>emb|CDP21917.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   153 bits (387),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 134/483 (28%), Positives = 210/483 (43%), Gaps = 90/483 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q  +V  V  Q    ++ + +PT ++   G +K  ER  +L LA
Sbjct  110   LEDNELWIRHLLGLIIQFSAVAYVFSQS--LRNVFYVPTILLIFAGTIKYAERTRALYLA  167

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                                     E ++++   ++  +IV+  YE    F+G I+DH F 
Sbjct  168   C----------------------LEEENLSPEDISDIDIVQNGYELFTTFRGLIVDHMFS  205

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E  K + +F   +  DAF+VME+EL+F+YD ++TKM  V   KG     +C+ R +C+
Sbjct  206   FHERSKSRKFFFQRSAFDAFRVMEVELNFIYDTLYTKMAVVHSKKG-----YCL-RLICS  259

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
              L+V     F  H K  +   D+  TY L+ GAVLLD +A   LIFS W +VK++  TV 
Sbjct  260   ILIVLSFERFASHHKPDINHFDVATTYILLSGAVLLDFVAFTKLIFSDWTIVKLKNLTVK  319

Query  800   TPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSG  621
             T V             V  KL                                 SK WS 
Sbjct  320   TTV-----------YAVREKLSC-------------------------------SKRWSN  337

Query  620   EIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrre  441
              + Q +L+   +  +R +  D   E   +K V+D   + +   + E LK+ +F + K + 
Sbjct  338   TLWQCNLINFCV-NQRWRWLDIAAETVGIKDVLDEMYYKEDIVIPEDLKDFIFIEFKVKA  396

Query  440   kakeaaaepekETYHRQEVMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHV  261
                +     ++    R ++       H    ++ S               Y   +L  H+
Sbjct  397   TKAKTTNVAKEIYSARGDLALLDYTNHYPYPIISSKV------------EYDESLLLWHI  444

Query  260   ATEICYFTADKTKGGDDEAGAKLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKD  81
             ATE+CY T       DD    +  C  IS Y+ YLLV+   + SAV G   +RF+D C++
Sbjct  445   ATELCYCTIP-----DDGNSNRNYCKLISDYMLYLLVMRPNLMSAVSGIGQIRFRDTCEE  499

Query  80    QIK  72
               K
Sbjct  500   AKK  502



>gb|EYU27017.1| hypothetical protein MIMGU_mgv1a019065mg [Erythranthe guttata]
Length=696

 Score =   149 bits (377),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 132/512 (26%), Positives = 220/512 (43%), Gaps = 95/512 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q+ +V+ V +Q       WLL T ++ L G  K  ER  +L  A
Sbjct  104   LEDNELWIRHLLGFIIQLIAVVYVFFQSLPNSQFWLL-TVLMLLAGAYKYTERTRALYGA  162

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMT------------------------------  1251
                  + ++  + D+  +   +  E   M                               
Sbjct  163   CLSNFKAALLPNPDAGPNYARLMEEYSAMVAARVPVTIAKEPERGSSSLSTNNNDNNNIF  222

Query  1250  -DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
                I++  EIV   Y+   IFKG I+DH F   E  + +D+F      DAF V+E+EL+F
Sbjct  223   ETEILSPMEIVLNGYKFFNIFKGLIVDHMFSFHERNESRDFFFRRQAADAFSVLEVELNF  282

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             MYDA++TKM+ V       S F  + R  C+ L+      F    K ++   D  VTY L
Sbjct  283   MYDALYTKMVMVN------SIFVYLLRGACSVLIGMCLQQFICLPKHNISLSDKIVTYVL  336

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDT  714
             +GGAV LD +A  +L+FS W +V           A++   +  + +P  ++         
Sbjct  337   LGGAVCLDLVAYFNLLFSDWTIVS----------AKQAMSRFLIRSPFGKR---------  377

Query  713   PVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLL  534
                              H+         WS  + Q+S +   L   R +  +   +   +
Sbjct  378   ----------------NHR---------WSNAMSQHSFISFCLKP-RFRWVNTVADFLGV  411

Query  533   KGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQE-VMDKIKKIHL  357
             K ++D C + ++   E+ LK  +F +++ + +  +     ++    R E V+    + + 
Sbjct  412   KDILDECKYKKSIVCEQNLKEFIFNELRTKAQKAQTNKMAKEIYSARGECVLLDYPRHYS  471

Query  356   APKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDDEAGAKLLCIQI  177
              P +  S SD            Y   +L  H+ATE+CYFT+      +     + +C  +
Sbjct  472   YPLISSSVSDLE--------SEYDESLLMWHIATELCYFTSTDQSNNNPN---REICKVL  520

Query  176   SQYLAYLLVLEEKITSAVPGSIGMRFKDICKD  81
             S Y+ YLLV+  K+ SAV G   +RF D C++
Sbjct  521   SDYMLYLLVMRPKLMSAVAGIGQIRFTDTCEE  552



>emb|CDP16262.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   143 bits (361),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 135/508 (27%), Positives = 229/508 (45%), Gaps = 69/508 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   +     V  + YQ  I    W+ PT ++F+ GI+K  ER  SL LA
Sbjct  111   LEDNELWLRHLYGLVFHSVEVFYIFYQ-SIENKLWI-PTVLMFVAGIIKYSERTRSLYLA  168

Query  1340  S-SRFVRKSI---------GKSLDSVASK---------ELI-----RAEGKDMTDNIMNQ  1233
             S  RF    +          K ++   SK         ++I     R +   + +  +  
Sbjct  169   SLDRFTDSMLPEPDPGPDYAKLMNEYYSKKEAKLPTRIQMIGEPCRRNKASRVKEGQLTN  228

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
              E+V  A++  + F+G   D  F   E  + +D+F N   EDAF+V+E+EL+F YD  FT
Sbjct  229   LEVVLYAHQFFRTFRGLFADFIFSFRERSQSRDFFLNRTAEDAFRVVEVELNFYYDVFFT  288

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHS---KLHMKPGDIGVTYCLVGGA  882
             K+  +    G      CI RFV  +++ TV  +  FHS   K + +  ++ +TY L+ GA
Sbjct  289   KVSVLYTNLG------CIGRFV--SVVCTVVALGLFHSERKKRNFEGFNVEITYTLLYGA  340

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVAR  702
             + LD +A+I LIFS  A+VK+          R+L  KK   T  A               
Sbjct  341   IALDVIAIIMLIFSDSAVVKM------NEFRRRLAFKKQSGTAQAASQPSAAAGGASTQS  394

Query  701   KLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVI  522
               +     L ++          + WS  +   +L+ + L   RL+  + F  +  L  ++
Sbjct  395   PFRNFFRRLWHFFR--------RRWSETVSTCNLISYCLHP-RLELKEKFFGYIGLGNIL  445

Query  521   DSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKI-HLAPKv  345
             D+  + +T     +L++L+F ++K + K  +     +  +  R + + +++    L P +
Sbjct  446   DTMKYVKTEPFSTELRDLIFTELKTKSKIADDLDTAKDISSARGDWILRVEGFGELLPYI  505

Query  344   vdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDDEAGAKLLCIQISQYL  165
                              +Y   +L  H+ATE+CY  +D+          + L   +S Y+
Sbjct  506   SQM--------------DYDESLLLWHIATELCY--SDEIAKASSPNKHRHLSKLLSDYM  549

Query  164   AYLLVLEEKITSAVPGSIGMRFKDICKD  81
              YLLV++  + SAV G   +RF+D C +
Sbjct  550   LYLLVMQPTMMSAVTGIGQIRFRDTCAE  577



>ref|XP_007040748.1| Uncharacterized protein TCM_016622 [Theobroma cacao]
 gb|EOY25249.1| Uncharacterized protein TCM_016622 [Theobroma cacao]
Length=800

 Score =   141 bits (355),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 170/344 (49%), Gaps = 46/344 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL+   Q  +VL V  Q    ++ W+ PT ++F+ GI+K VER  +L LA
Sbjct  117   LEDNQLWLRHLLSLGFQAGAVLYVFVQSLPNENLWI-PTALMFVAGIIKYVERTRALFLA  175

Query  1340  SSRFVRKSI----------GKSLDSVASKELIRAEGK-DMT---------------DNIM  1239
             S    R S+           K ++  ASK+  +   + +MT               +  +
Sbjct  176   SLDQFRDSMLKDPDPGPNYAKLMEEYASKKDAKLPTRINMTPEPDKESKASDVPPKEGDL  235

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             N  E+V  AY+  QIFKG ++D  F   E  + +D+F     EDA +++E+EL+F+Y  +
Sbjct  236   NHLEVVHYAYDYFQIFKGLVVDLIFSFRERDESRDFFTRRTAEDALRIIEVELNFLYGTL  295

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGA  882
             +TKM  V    G       I+RF+  A  +    IF+F +K     G DIG+TY L+ GA
Sbjct  296   YTKMEVVHSTIGY------IFRFIAFAANLATLGIFYFQTKKDEFHGVDIGITYTLLLGA  349

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVAR  702
             V LD +A + LIFS      I  + +++P  R          P+A        +  P   
Sbjct  350   VALDVVAFLMLIFSDRTFASI-FKYLESPYCR----------PIAAFFGGFLALKKPRWH  398

Query  701   KLKQ-KIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRR  573
             + K+  I +  +  H L+T +  + WSG I  ++L+++ L  RR
Sbjct  399   RCKKCGIQNSDHRHHALVTPLGFRRWSGSISAHNLIRYCLKSRR  442



>gb|KDP43572.1| hypothetical protein JCGZ_16859 [Jatropha curcas]
Length=751

 Score =   137 bits (346),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 111/374 (30%), Positives = 187/374 (50%), Gaps = 53/374 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  +VQ  +   V  Q  + +++ ++PT ++FL G++K +ER  SL  A
Sbjct  111   LEDNQLWLRHLLALIVQAIATGYVFIQ-TLPKNKVMIPTCLLFLAGLIKYLERTCSLYFA  169

Query  1340  SSRFVRKSIGKSLD------------SVASKELI----RAEGKDMTDNI------MNQYE  1227
             S    R S+ +  D            ++   E +    + EG+  T +I      +N  +
Sbjct  170   SRDKFRDSMLRKPDPGLNYAKFVEVFALEQPEELQLKKKNEGEKKTTDIRLEVRKLNDLD  229

Query  1226  IVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKM  1047
             +V++AY+  +IFKG I+D  F   E  + + +F +++  DAFKV+ +EL+F+Y+ ++TK+
Sbjct  230   LVKEAYKYFKIFKGLIVDLIFSFRERDQSRYFFNSISPGDAFKVLAIELNFIYEVLYTKI  289

Query  1046  IAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLD  870
             + V   KG+       +RF+ +  ++    IF+FH K H     D+ VTY L+ GAV LD
Sbjct  290   VVVHSKKGM------FFRFISSISVIAALTIFYFHVKKHNFDKFDVKVTYALLLGAVGLD  343

Query  869   QMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQ  690
              +ALI  IFS+W +V + +E V    AR   Q       +  K    K          + 
Sbjct  344   TVALIMAIFSNWTIVAV-LERVS---ARPEDQSSNWPLLLFNKFLSLK----------RS  389

Query  689   KIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFL-------LK  531
             K+ +     H L T +  + WS  +  ++L+++ L  R  K     ++HF        ++
Sbjct  390   KMDACGTDKHTLYTPIPFRRWSESVKGHNLIRYCLKERPRKVHH--IKHFCFVNQCVSIR  447

Query  530   GVIDSCLHTQTAKV  489
               ID C+ T   KV
Sbjct  448   KNIDQCIKTSYRKV  461



>ref|XP_010034341.1| PREDICTED: uncharacterized protein LOC104423568 [Eucalyptus grandis]
Length=693

 Score =   136 bits (342),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 133/513 (26%), Positives = 227/513 (44%), Gaps = 85/513 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q+     V YQ  +  ++ ++PT +VF+ G++K +ER  +L   
Sbjct  110   LEDNELWSRHLLNLFFQLVVAGYVFYQ-SLPDNKLIVPTILVFIGGLIKYIERTRALYFG  168

Query  1340  SSRFVRKSIGKSLD------------SVASKELIRAEGKDMTD------------NIMNQ  1233
             S    R S+ KS D            S   K  I  E   M +             I++ 
Sbjct  169   SFSKFRASLLKSGDAGPNYAKLMEEHSSKKKANIPVEIVMMPEPNIQITAPVDEEEILDD  228

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
              +++  A+    IFKG ++D  F   E  + + +F+ +  +DAF+V+E+EL+F YD ++T
Sbjct  229   RKMIEAAFRYFNIFKGLLVDLIFSFRERDESRRFFRKIKAKDAFRVIEVELNFFYDVLYT  288

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   V   KG       ++R +    ++    +F+  +K      DI +TY L+ GAV L
Sbjct  289   KAAVVHCLKGY------LFRALSIGFVIIAFALFYVLNKQSFYEYDIKITYTLLLGAVGL  342

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             + +AL  LI S W        T+   V  + ++   + +     L + K+ D+  A    
Sbjct  343   EFVALSMLICSDW--------TIALLVLGRSEKHSLIKSTFIEFLLKFKSEDSSFA----  390

Query  692   QKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSC  513
                          + +++++ WS  I QY+L+   L  RR K  + FL+   L+   D  
Sbjct  391   -------------LHILHAR-WSKSIFQYNLIDSQLK-RRPKWIEKFLDFISLREFFDDW  435

Query  512   LHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHLAPKvvdss  333
                Q  +  E+L  L+F ++K++                  E ++ IKK+  A       
Sbjct  436   RFRQEKQYNEELSELIFNELKQKSVYA--------------EDLESIKKMCAARGKWALE  481

Query  332   sddvvvsvddDI------ENYANFVLTLHVATEICYFTADKTKGGDDEAGAKLLCIQISQ  171
                       D+       +Y   +L  H+ATE+CY T + TK   D   +K+L    S 
Sbjct  482   QSQEQQPNCKDLLPFVRDVDYGESLLLWHIATELCYNTEEMTK---DREISKIL----SD  534

Query  170   YLAYLLVLEEKITSAVPGSIGMRFKDICKDQIK  72
             Y+ +L++ +  + S V G   +RF+D C +  K
Sbjct  535   YMLHLMIKQPNMMSTVAGIGEIRFQDTCAEMDK  567



>ref|XP_002528769.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33591.1| conserved hypothetical protein [Ricinus communis]
Length=769

 Score =   132 bits (332),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 136/256 (53%), Gaps = 34/256 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q  +   V  Q  + +++ ++PT ++FL GI+K  ER  SL LA
Sbjct  118   LEDNELWLRHLLALVFQAVATGYVFIQ-TLPENKVMIPTFLLFLAGIIKYSERTRSLYLA  176

Query  1340  SSRFVRKSI----------GKSLDSVASKE---------LIRAEGKDMTDNIM-------  1239
             S    R S+           K ++  ASK+         +I    K  T  I        
Sbjct  177   SMDRFRDSMLKEPDPGPNYAKLMEEYASKKQAKLPTQIIMIPEPEKVNTTGIAREKIILK  236

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             NQ E+V+KAYE  Q+F+G I+D  F   E    +++F N++ EDA +V+E EL+FMY+ +
Sbjct  237   NQLEVVQKAYEFFQVFRGLIVDLIFSFKERNDSREFFYNISAEDALRVIEAELNFMYEVL  296

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGA  882
             FTK++ VQ   G   YF   +R +    +V    +F F+ K     G D+GVTY L+ GA
Sbjct  297   FTKVVVVQSKWG---YF---FRLISFGSVVAALCVFHFYVKKESFDGFDVGVTYALLFGA  350

Query  881   VLLDQMALIHLIFSHW  834
             + LD +A +  IFS W
Sbjct  351   IGLDIVAFLMAIFSDW  366



>ref|XP_009371589.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
 ref|XP_009371593.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
Length=739

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 141/537 (26%), Positives = 238/537 (44%), Gaps = 85/537 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q+ + + V Y     +++  LPTG++FL GI+K  ER  SL  A
Sbjct  111   LEDNTLWLRHFLGLIFQVAAAVYV-YIRSFPKNKLWLPTGLLFLSGIIKYAERTRSLYSA  169

Query  1340  SSRFVRKSIGKSLD------------------------------SVASKELIRAEGKDMT  1251
             S    ++++ K  D                              S  S+ +    GKD  
Sbjct  170   SLDNFKEAMMKKADPGPNYAKLMEEYSARKDSQLPTHIELTAERSKESRTVTYVIGKDEL  229

Query  1250  DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFM  1071
             D+ +    +VR A+  +QIFKG I+D  F   E  + +  F     ++AFK++ +EL+FM
Sbjct  230   DSDI---AVVRHAHYFYQIFKGLIVDLIFSFHERHESRAVFHERTPKEAFKLIAVELNFM  286

Query  1070  YDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYCL  894
             Y+A+FTK   V       +Y   I R V  + +V VAL+FF+   K  +   D+ +TY L
Sbjct  287   YEALFTKAAVVHT---KPAY---ILRVVSFSAIV-VALVFFYRLEKEGLHSFDVRITYTL  339

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARK-----LKQKKTVDTPVARKLKQK  729
             + GA+ LD +A + L FS W +  +     ++ +A+      L  K++   P A+   + 
Sbjct  340   LFGAISLDSIATVMLTFSDWTIAALNKFLQNSGLAKTIFGKYLDFKRSWWWPTAKTRNEG  399

Query  728   KTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDF-  552
               +    A K  + I  +++           + W   +  ++L+ +SL  +R K    + 
Sbjct  400   GQIPKTKATKCLEWIRRILF-----------RRWYESVSTFNLIHYSLKEKRKKSPKWYD  448

Query  551   ---------LEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETY  399
                      +  F LK + D   +     + E+L   +FE +  +    +      K   
Sbjct  449   CFGIGYIKVITLFGLKDLHDKLTYRTKKPLAEELWVFIFEQLISKSMLADDPETARKIGA  508

Query  398   HRQEVMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKG  219
              R + +       L     DS     ++S   D+E Y   +L  H+ATE+C F  DK+K 
Sbjct  509   ARGDWV-------LEGSDWDSKVITKLLSYVVDVE-YDKSILLWHIATELC-FNDDKSKT  559

Query  218   --------GDDEAGAKLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKDQIK  72
                      D+   +K     IS Y+ YLLV++  + S++ G   +RF+D C +  K
Sbjct  560   EGEAAPEVSDETKKSKEHSRTISDYMLYLLVMQPSMMSSITGIGQIRFRDTCAEAKK  616



>ref|XP_004152420.1| PREDICTED: uncharacterized protein LOC101209159 [Cucumis sativus]
 ref|XP_004158159.1| PREDICTED: uncharacterized protein LOC101224461 [Cucumis sativus]
 gb|KGN50284.1| hypothetical protein Csa_5G165300 [Cucumis sativus]
Length=757

 Score =   131 bits (330),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 141/529 (27%), Positives = 245/529 (46%), Gaps = 63/529 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL+  + Q+ + + V  Q  I Q++  +P  ++FL GI+K  ER  +L LA
Sbjct  128   LEDNALWLRHLIGLLFQVVATVYVFIQ-TIPQNKLRVPAILMFLAGIIKYAERTRALYLA  186

Query  1340  SSRFVRKSIGKSLDS-------------------VASKELIRAEGKDMTD-------NIM  1239
             S    R S+ K  D                      + +L+    ++ +          +
Sbjct  187   SLGSFRASMLKEPDPGPDYAKLMEEFTCKKDAHLPTTIQLVNEPNQEWSPFTSTAKAGDL  246

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             NQ E+V+ A+     FKG I+D  F   E  + +D+F      DA KV+E+EL+F+Y+ +
Sbjct  247   NQLEVVQYAFLYFNKFKGLIVDLIFSFKERNESRDFFLKRTPSDALKVIEVELNFIYEVL  306

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYCLVGGA  882
             FTK++ +       + F  I+RF+ ++  VTVAL+ F    K   +  D+ +TY L+ GA
Sbjct  307   FTKVVVIH------NIFGSIFRFI-SSCSVTVALVLFSRLDKTDFRKLDVRITYALLVGA  359

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLK-----QKKTVDTPVARKLKQKKTVD  717
             + LD ++    +FS W +  +  +  D+ +A   +     ++K V           K +D
Sbjct  360   LALDFVSFSMTVFSDWTIATLIKD--DSILATFFEYLLWLKRKRVSVHKKSPFSGLKKLD  417

Query  716   TP-VARKLKQKI--ISLIYYG-HKLITVVNSKSWS---GEIIQYSLLKHSLAGRRLKCAD  558
             TP + R+ ++ +   +LI Y   + I   +S++ S   G    ++  K     RR+K  D
Sbjct  418   TPRIFRRWRESVSQFNLIAYCLSERIPTDDSRNTSVCCG--CSFAWNKTVRLLRRIK--D  473

Query  557   DFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMD  378
               +++   K   D   +     V EKL +L+FE++  + KA E     E+    R   + 
Sbjct  474   FVIDYLGAKEFFDDWKYVSRQPVFEKLWDLIFEEMLEKSKAAETVEITEEICSSRGSYV-  532

Query  377   KIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDDEAGA  198
              +K + L  ++        +  V      +   ++  H+ATE+CY     T    ++ G 
Sbjct  533   -LKSMDLPSEIDIGELISDIDEVA-----FDESLMLWHIATELCYRDEQNTNTNVNDTGT  586

Query  197   --KLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKDQIKNTFDH  57
               +     +S Y+ YLLV+   + SAV G   +RF+D C +  K  FD 
Sbjct  587   SYREFSKVLSDYMLYLLVMLPSMMSAVAGIGEIRFRDTCAEA-KKFFDR  634



>emb|CBI20388.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 168/359 (47%), Gaps = 67/359 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q  +V  V  +  I    W+ PT ++ + G +K  ER  +L LA
Sbjct  107   LEDNELWPRHLLGLVIQFIAVAYVFLE-SISNDLWI-PTILMLVAGTIKYAERTRALYLA  164

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                         L++    ++I A  K ++ +          A    +IFKG I+D  F 
Sbjct  165   C-----------LEAHVPVKIIIAPEKRVSTS----------ASSFFKIFKGLIVDLMFS  203

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E    + +F  +  E AF+V+E+EL+FMYDA++TKM+ V +  G   YF    RF+C 
Sbjct  204   FQERNDSRKFFFGMLPEKAFRVIEVELNFMYDALYTKMVVVNRKIG---YF---LRFICT  257

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
               +     +F  H K  +   DIGVTY L+ GA+ LD +A++ LIFS W +V ++  T  
Sbjct  258   GCIAVALQLFSSHHKHKIHKFDIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAK  317

Query  800   TPV--AR-KLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKS  630
               +  AR KL   K  +T        K  +D                           + 
Sbjct  318   ERIYYAREKLFFCKLWET-------SKSFLD---------------------------RR  343

Query  629   WSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDI  453
             WS  I Q+ L+++ L   R K  D   +   LK ++D   + +T  VEE LK  +FE++
Sbjct  344   WSNSISQHGLIRYCLR-ERFKWFDKLADILGLKDLLDEIQYKKTVTVEENLKEFIFEEL  401



>emb|CDP08013.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   129 bits (325),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 102/356 (29%), Positives = 162/356 (46%), Gaps = 73/356 (21%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q+ +V  V  Q    ++ + +PT ++   G +K  ER  +L LA
Sbjct  110   LEDNELWIRHLLGLIIQLAAVAYVFSQS--LRNTFYVPTILLIFAGTIKYAERTRALYLA  167

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                                     E ++++   ++  +IV+  YE    F+G I+DH F 
Sbjct  168   C----------------------LEEENLSPEDISDIDIVQYGYEFFTTFRGLIVDHMFS  205

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E  K + +F   +  DAF+VME+EL+F+YD ++TKM  V   KG     +C+ R +C+
Sbjct  206   FHERSKSRKFFFQRSALDAFRVMEVELNFIYDTLYTKMAVVHSKKG-----YCL-RLICS  259

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
              L+V     F  H K ++   D+  TY L+ GAVLLD +A   LIFS W +VK++  TV 
Sbjct  260   ILIVLSFERFASHHKPNINHFDVATTYILLSGAVLLDFVAFTKLIFSDWTIVKLKNLTV-  318

Query  800   TPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSG  621
                       K++   V  KL                                 SK WS 
Sbjct  319   ----------KSIVYAVRDKLSC-------------------------------SKRWSN  337

Query  620   EIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDI  453
              I Q +L+   +  +R +  D   E   +K V+D   + +     E LK+ +F ++
Sbjct  338   TIWQCNLINFCV-NQRWRWLDIAAETVGIKDVLDEMYYKEDIVTPEDLKDFIFNEL  392



>ref|XP_010644262.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
 ref|XP_010644264.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
Length=735

 Score =   130 bits (327),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 172/389 (44%), Gaps = 76/389 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   ++Q+ +V  V+ Q     SE  +PT ++ L GI+K  ER  +L L 
Sbjct  112   LEDNELWIRHLFGLLIQLIAVGYVILQ--ALPSELWIPTSLMLLAGIIKYAERTRALYLG  169

Query  1340  SSRFVRKSIGKSLDSVAS-----------------------KELIRAEGKDMTDNI--MN  1236
                  + S+    D+  +                       KE       D    +  ++
Sbjct  170   CLGNFKASMLPPADAGPNYAQLMEEYTSKKIAHVPADIKIEKEFGGGASADYAVRVERLS  229

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
               ++V   ++   IFKG I+D  F   E    + +F   N EDAFKV+E+EL+FMYDA++
Sbjct  230   DLDVVEGGFKYFNIFKGLIVDLMFTFQERKDSRRYFFARNTEDAFKVLEVELNFMYDALY  289

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKL----------HMKPGDIGV  906
             TKM+ V    G   YF    RFVC+  LV     F  H K            M P D+ V
Sbjct  290   TKMVVVN---GNIGYF---LRFVCSTCLVASLERFAAHHKQKNGGHPPNQGKMHPFDVYV  343

Query  905   TYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKK  726
             TY L+ GA+ LD +A+I LIFS W +V          + R  + K+ +       LK +K
Sbjct  344   TYALLIGAICLDSIAVIKLIFSDWTIV----------LLRYRRAKEFL-------LKTRK  386

Query  725   TVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLE  546
                             L  Y     +    + WS  + Q+SL+++ L   R K  D  ++
Sbjct  387   ---------------RLTIYRIGSWSKTFGRRWSNSMSQHSLVRYCLK-ERFKWIDVTVD  430

Query  545   HFLLKGVIDSCLHTQTAKVEEKLKNLVFE  459
              F LK ++D   + +  KV + LK  + E
Sbjct  431   WFGLKDILDEIQYKEHIKVPKDLKIFICE  459



>ref|XP_008437035.1| PREDICTED: uncharacterized protein LOC103482584 [Cucumis melo]
Length=757

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 139/527 (26%), Positives = 243/527 (46%), Gaps = 59/527 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL+  + Q+ + + V  Q  I Q++  +P  ++FL GI+K  ER  +L LA
Sbjct  128   LEDNALWLRHLIGLLFQVVATVYVFIQ-TIPQNKLRVPAILMFLAGIIKYAERTRALYLA  186

Query  1340  SSRFVRKSIGKSLDS-------------------VASKELIRAEGKDMT-------DNIM  1239
             S    R S+ K  D                      + +L+    ++ +       +  +
Sbjct  187   SLGSFRASMLKEPDPGPDYAKLMEEFTCKKDAHLPTTIQLVNEPNQEWSPFTSTAKEGDL  246

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             NQ E+V+ A+     FKG I+D  F   E  + +D+F      DA KV+E+EL+F+Y+ +
Sbjct  247   NQLEVVQYAFLYFNKFKGLIVDLIFSFKERNESRDFFLKRTPSDALKVIEVELNFIYEVL  306

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYCLVGGA  882
             FTK++ +    G       I+RF+ ++  VTVAL+ F    K   +  D+ +TY L+ GA
Sbjct  307   FTKVVVIHNLSG------SIFRFI-SSCSVTVALVLFSRLDKTDFRKLDVRITYALLVGA  359

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLK-----QKKTVDTPVARKLKQKKTVD  717
             + LD +++   +FS W +  +  +  D+ +A   +     +++ V           K +D
Sbjct  360   LALDFVSISMTVFSDWTIATLIKD--DSILATFFEYLLWLKRQRVSVHKKSPFSGLKKLD  417

Query  716   TP-VARKLKQKI--ISLIYYG-HKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFL  549
             TP + R+ ++ +   +LI Y   + I + +S++ S  I        +   R L+   DF+
Sbjct  418   TPRIFRRWRESVSQFNLIAYCLSERIPMDDSRNTS--ICCGCSFAWNKTVRLLRRTKDFV  475

Query  548   EHFL-LKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKI  372
               +L  K   D   +     V EKL +L+FE++  + KA E     E+    R   +  +
Sbjct  476   IDYLGAKEFFDDWKYVSRQPVFEKLWDLIFEEMLEKSKAAETVEITEEICSSRGSYV--L  533

Query  371   KKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKG--GDDEAGA  198
             K + L  ++        +  V      +   ++  H+ATE+CY     T     D     
Sbjct  534   KSMDLRSEIDIGELISDIDEVA-----FDESLMLWHIATELCYRDEQNTNTNVNDTSTTY  588

Query  197   KLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKDQIKNTFDH  57
             +     +S Y+ YL+V+   + SAV G   +RF+D C +  K  FD 
Sbjct  589   REFSKLLSDYMLYLIVMLPSMMSAVAGIGEIRFRDTCAEA-KKFFDR  634



>ref|XP_010055454.1| PREDICTED: uncharacterized protein LOC104443651 [Eucalyptus grandis]
Length=711

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 136/520 (26%), Positives = 238/520 (46%), Gaps = 79/520 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +V  V YQ     ++  +P  +VFL GI+K  ER  +L LA
Sbjct  110   LEDNELWLRHLLGLIFQVIAVAYVFYQS--LPNKLWMPIVLVFLSGIIKYGERTRALYLA  167

Query  1340  S-SRFVRK---------SIGKSLDSVASKEL------IR--------AEGKDMTDNI-MN  1236
             S SRF            +  K ++  +SK+       IR        +  +D T N  M+
Sbjct  168   SRSRFSYSMHTKPDPGPNYAKLMEEYSSKKEANLPAEIRMIPERDKESRTQDTTVNSGMD  227

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
               E+V++A    + FKG  +D  F   E    +++F   N ED  +++E+EL+F YD ++
Sbjct  228   DIEVVQEARRFFETFKGLFVDIIFSFRERNTSREFFHRRNAEDTLRLLEVELNFFYDVLY  287

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK++ VQ   G    ++C  R +C + +    +++FF  K      ++ VTY L+ GA+ 
Sbjct  288   TKVVVVQDKFG----YFC--RLICFSSMEIALVLYFFMDKDRFGRFNVQVTYTLLLGAIA  341

Query  875   LDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARK-LKQKKTVDTPVARK  699
             L+ +A++  IFS W           T  A K  +K +V   + R  L  KK   +    +
Sbjct  342   LEVLAVLRFIFSDW-----------TVSALKNPEKHSVLATILRSYLSLKKCTCSDEEEE  390

Query  698   LKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR--RLKCADDFLEHFL----  537
              K   ++    G K       + WS  I  Y+L+ +S+  R  +++   D + H      
Sbjct  391   AKIGFLA----GLKSCLF---RRWSKSISTYNLIDYSIRERPQKIQTFCDRVGHPFSKIV  443

Query  536   ----LKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQE-VMDKI  372
                 LK ++D   ++      ++L   + ++++ +    +     ++    R + V++ +
Sbjct  444   DLMGLKELLDHMRYSSRTPFTKELWLFIHQELRDKSVLADDMGFAKRIYSARGDWVLNDL  503

Query  371   KKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDDEAGAKL  192
                 L P V D                Y   ++  HVAT++ Y T   T+  +D    + 
Sbjct  504   HWSKLLPYVNDV--------------EYDESLILWHVATDLLYSTTTNTEESNDR--HRG  547

Query  191   LCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKDQIK  72
                 +S Y+ YLLV++ K+ S+V G   +RF+D C +  K
Sbjct  548   FSKDLSDYMLYLLVVQSKMMSSVVGIGRIRFQDTCAEAKK  587



>ref|XP_008342346.1| PREDICTED: uncharacterized protein LOC103405164 [Malus domestica]
Length=739

 Score =   128 bits (321),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 140/539 (26%), Positives = 241/539 (45%), Gaps = 89/539 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q+ + + V  +       WL PTG++FL GI+K  ER  SL  A
Sbjct  111   LEDNTLWLRHFLGLIFQVAAAVYVFIRSFPKNKLWL-PTGLLFLAGIIKYAERTRSLYSA  169

Query  1340  SSRFVRKSIGKSLD------------------------------SVASKELIRAEGKDMT  1251
             S    ++++ K  D                              S  S+ +    GKD  
Sbjct  170   SLDNFKEAMIKEADPGPNYAKLMEEYSSRKDSQLPTHIELTAERSKESRTVTYVIGKDEL  229

Query  1250  DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFM  1071
             D+      +V+ A+  +QIFKG I+D  F   E  + +  F     ++AFK++ +EL+FM
Sbjct  230   DS---DIAVVKHAHYFYQIFKGLIVDLIFSFHERQESRAVFLERTPKEAFKLIAVELNFM  286

Query  1070  YDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYCL  894
             Y+A+FTK   V       +Y   I R V  + +V +AL+FF+   K  +   D+ +TY L
Sbjct  287   YEALFTKAAVVHT---KPAY---ILRVVSFSAIV-IALVFFYRLEKEGLHSFDVRITYTL  339

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARK-----LKQKKTVDTPVARKLKQK  729
             + GA+ LD +A++ L FS W +  +     ++ +A+      L  K++   P A+   + 
Sbjct  340   LFGAISLDSIAIVMLTFSDWTIAALNKFWQNSGLAKTIFGKYLDFKRSRWWPKAKTRNEG  399

Query  728   KTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFL  549
               +    A K  + I  +++           + W   +  ++L+ +SL  +R K +  + 
Sbjct  400   GQIPKTKATKCLEWIRRILF-----------RRWYESVSTFNLIHYSLKEKR-KISPTWY  447

Query  548   EH-----------FLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekET  402
             ++           F LK + D  ++     + E+L   +FE +  +    +      K  
Sbjct  448   DYFGIGYIKVITLFGLKDLHDKLIYRTKKPLAEELWVFIFEQLISKSMLADDPETARKIG  507

Query  401   YHRQEVMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTK  222
               R + +       L     DS     ++S   D+E Y   +L  H+ATE+C F  DK++
Sbjct  508   AARGDWV-------LEGSDWDSKVITKLLSYVVDVE-YDKSILLWHIATELC-FNDDKSE  558

Query  221   GGDDEAG---------AKLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFKDICKDQIK  72
               + EAG         +K     IS Y+ YLLV++  + S++ G   +RF+D C +  K
Sbjct  559   -AEGEAGPEVSDETKKSKEHSKTISDYMLYLLVMQPSMMSSITGIGQIRFRDTCAEAKK  616



>ref|XP_009372850.1| PREDICTED: uncharacterized protein LOC103961896 [Pyrus x bretschneideri]
 ref|XP_009372923.1| PREDICTED: uncharacterized protein LOC103961896 [Pyrus x bretschneideri]
Length=756

 Score =   128 bits (321),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 129/559 (23%), Positives = 236/559 (42%), Gaps = 117/559 (21%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q+ + + V  Q       W  PT ++FL G +K  ER  +L  A
Sbjct  112   LEDNTLWLRHFLGLVFQVIAAVYVFIQSFPTNKLW-PPTLLLFLAGTIKYAERTRALYCA  170

Query  1340  SSRFVRKSI----------GKSLDSVASKELIR---------------------AEGKDM  1254
             S    ++S+           K ++  +SK+  +                     AE  DM
Sbjct  171   SLDNFKESLIKKPDPGPNYAKLMEEYSSKKDAKLPTRIELTAERSKESRTVTYVAEEGDM  230

Query  1253  TDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
              DN    + +VR AY  ++IF+G I+D  F   E  + + +F + + E+ F+++ +EL+F
Sbjct  231   RDN----FAVVRHAYHFYEIFRGLIVDLIFSFHEGFESRAFFHDRSAEETFRLIAIELNF  286

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYC  897
             MY+A+FTK + V    G      C++R + +   V +AL+FF+   K      D+G+TY 
Sbjct  287   MYEALFTKAVVVHSKLG------CLFRAI-SFTAVFIALVFFYKLEKKAFHKVDVGITYT  339

Query  896   LVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVD  717
             L+ GA+ LD +A+  +IFS W +  +      + VA+ L +  ++  P      ++ T  
Sbjct  340   LLYGALCLDSIAIFLVIFSEWTVTAMHKSWQKSWVAKILGKYLSLKKP------RRSTES  393

Query  716   TPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDF-----  552
             T      +Q +                + W   I  ++ + +SL   R   ++ F     
Sbjct  394   TTCLEWCRQILF---------------RRWCESISSFNFIHYSLKEHRKLSSNIFDYFGI  438

Query  551   -----LEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQE  387
                  ++ F LK + D   +  +  + E L   +F+++K +    +     ++ +  R +
Sbjct  439   GYIAIIDLFGLKDLRDKMKYRTSRPLTEGLWEFIFKELKAKSVLADDPETAKRISTARGD  498

Query  386   VMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADK-------  228
              + +  + +        S    V        +Y   +L  H+ATE+CY   +K       
Sbjct  499   WILQDSEWNDTQHATLLSYVVDV--------DYDQSILLWHIATELCYNCEEKETSHSES  550

Query  227   ---------------------------TKGGDDEAGAKLLCIQISQYLAYLLVLEEKITS  129
                                         +   +E   + +   +S Y+ YLLV++  +TS
Sbjct  551   SKNETSRHESSKNETSRHESSKNETSRRESSKNEPSRREISKTLSDYMLYLLVMQPSLTS  610

Query  128   AVPGSIGMRFKDICKDQIK  72
             +V G   +RF+D C +  K
Sbjct  611   SVAGIGQIRFRDTCAEAKK  629



>ref|XP_010644254.1| PREDICTED: uncharacterized protein LOC100260642 [Vitis vinifera]
Length=721

 Score =   127 bits (319),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 113/386 (29%), Positives = 173/386 (45%), Gaps = 73/386 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q  +V  V  +  I    W+ PT ++ + G +K  ER  +L LA
Sbjct  107   LEDNELWPRHLLGLVIQFIAVAYVFLE-SISNDLWI-PTILMLVAGTIKYAERTRALYLA  164

Query  1340  SSRFVRKSIGKSLDS------------------VASKELIRAEGKDMTD---------NI  1242
                  ++S+    D+                  V  K +I  E +  T            
Sbjct  165   CLGNFKESMLPPPDAGPNYAQLMEEYSSKKEAHVPVKIIIAPEKRVSTSASSVPEEPSTG  224

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              N    +   Y+  +IFKG I+D  F   E    + +F  +  E AF+V+E+EL+FMYDA
Sbjct  225   PNHISEMESGYKFFKIFKGLIVDLMFSFQERNDSRKFFFGMLPEKAFRVIEVELNFMYDA  284

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             ++TKM+ V +  G   YF    RF+C   +     +F  H K  +   DIGVTY L+ GA
Sbjct  285   LYTKMVVVNRKIG---YF---LRFICTGCIAVALQLFSSHHKHKIHKFDIGVTYALLIGA  338

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPV--AR-KLKQKKTVDTPVARKLKQKKTVDTP  711
             + LD +A++ LIFS W +V ++  T    +  AR KL   K  +T        K  +D  
Sbjct  339   ISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREKLFFCKLWET-------SKSFLD--  389

Query  710   VARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLK  531
                                      + WS  I Q+ L+++ L   R K  D   +   LK
Sbjct  390   -------------------------RRWSNSISQHGLIRYCLR-ERFKWFDKLADILGLK  423

Query  530   GVIDSCLHTQTAKVEEKLKNLVFEDI  453
              ++D   + +T  VEE LK  +FE++
Sbjct  424   DLLDEIQYKKTVTVEENLKEFIFEEL  449



>emb|CAN75530.1| hypothetical protein VITISV_001347 [Vitis vinifera]
Length=730

 Score =   127 bits (319),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 130/466 (28%), Positives = 203/466 (44%), Gaps = 88/466 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q  +V  V  +  I    W+ PT ++ + G +K  ER  +L LA
Sbjct  107   LEDNELWPRHLLGLVIQFIAVAYVFLE-SISNDLWI-PTILMLVAGTIKYAERTRALYLA  164

Query  1340  SSRFVRKSIGKSLDS------------------VASKELIRAEGKDMTD---------NI  1242
                  ++S+    D+                  V  K +I  E +  T            
Sbjct  165   CLGNFKESMLPPPDAGPNYAQLMEEYSSKKEAHVPVKIIIAPEKRVSTSASSVPEEPSTG  224

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              N    +   Y+  +IFKG I+D  F   E    + +F  +  E AF+V+E+EL+FMYDA
Sbjct  225   PNHISEMESGYKFFKIFKGLIVDLMFSFQERNDSRKFFFGMLPEKAFRVIEVELNFMYDA  284

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             ++TKM+ V +  G   YF    RF+C   +     +F  H K  +   DIGVTY L+ GA
Sbjct  285   LYTKMVVVNRKIG---YF---LRFICTGCIAVALQLFSSHHKHKIHKFDIGVTYALLIGA  338

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVAR  702
             + LD +A++ LIFS W +V ++  T         K++                       
Sbjct  339   ISLDVIAIVKLIFSDWTIVLLKNSTA--------KER-----------------------  367

Query  701   KLKQKIISLIYYGH------KLITVVNS---KSWSGEIIQYSLLKHSLAGRRLKCADDFL  549
                      IYY        KL     S   + WS  I Q+ L+++ L   R K  D   
Sbjct  368   ---------IYYAREKLFFCKLWETSKSFLDRRWSNSISQHGLIRYCLR-ERFKWFDKLA  417

Query  548   EHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYH--RQEVMDK  375
             +   LK ++D   + +T  VEE LK  +FE++K + K+ E   E  K      R+    +
Sbjct  418   DILGLKDLLDEIQYKKTVTVEENLKEFIFEELKEKAKSSEQLEEKAKSAEEKARRAEKSR  477

Query  374   IKKIHLAPKvvdsssddvvvsvddDIE-NYANFVLTLHVATEICYF  240
             I K   + +     S +   S+   +E  Y   +L  H+AT++CY+
Sbjct  478   IAKEICSGRGDWILSQNACHSLLWSVEKEYDECLLMWHIATDLCYY  523



>emb|CBI20386.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 163/359 (45%), Gaps = 72/359 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  ++Q  +V  V  +  I    W+ PT ++ + G +K  ER  +L LA
Sbjct  107   LEDNELWLRHLLGLVIQFIAVAYVFLE-SISNDLWI-PTILMLVAGTIKYAERTRALYLA  164

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                               K +I  E +  T            A    +IFKG I+D  F 
Sbjct  165   C---------------LVKIIIAPEKRASTS-----------ASSFFKIFKGLIVDLMFS  198

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E    + +F  +  E AF+V+E+EL+FMYDA++TKM  V +  G   YF   +RF+C 
Sbjct  199   FQERNDSRKFFFGMLPEKAFRVIEVELNFMYDALYTKMAVVNRKIG---YF---FRFICT  252

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
               +     +F  H K  +   DIGVTY L+ GA+ LD +A++ LIFS W +V ++  T  
Sbjct  253   GCIAVALQLFASHHKHKIHKFDIGVTYALLIGAIGLDVIAIVKLIFSDWTIVLLKNSTAK  312

Query  800   TPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNS---KS  630
               +              AR+                     L +Y  KL     S   + 
Sbjct  313   RWIY------------YARE--------------------KLFFY--KLWEPSKSFFDRR  338

Query  629   WSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDI  453
             WS  I Q+ L+++ L   R K  D   +   LK ++D   + +T  VEEKLK  +F+++
Sbjct  339   WSNSISQHGLIRYCLR-ERFKWFDKLADICGLKDLLDEIQYKKTVTVEEKLKEFIFKEL  396



>ref|XP_010054394.1| PREDICTED: uncharacterized protein LOC104442692 [Eucalyptus grandis]
Length=750

 Score =   124 bits (311),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/262 (31%), Positives = 137/262 (52%), Gaps = 33/262 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +   V  Q  + Q++ L+PT ++ L G++K  ER  +L LA
Sbjct  79    LEDNALWLRHLLGLIFQVSAAAYVFLQTSLPQNKLLVPTILMLLAGLIKYAERTRALYLA  138

Query  1340  SSRFVRKSI----------GKSLDSVASKELIR------------AEGKDMT-----DNI  1242
             S +  ++S+           K +D  +S++  +             E K M      + I
Sbjct  139   SLKTFKESMLKDPDPGPNYAKLMDEYSSRKEAKLPATIKITGEPDRESKTMMYEGVEEEI  198

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              ++ ++VR AY   +IFKG I+D  F   E  + + +F++ + E+AFKV+ +EL+FMYD 
Sbjct  199   SSESDVVRHAYHFFEIFKGLIVDLIFSFRERHESRQFFQHRDAEEAFKVIAVELNFMYDV  258

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             ++TK+  V    G    F+ +   V + +L T      FH        D+ +TYCL+ GA
Sbjct  259   LYTKVRVVHSMVGYIFRFFALTNIVVSLVLFTCLKKNKFHRV------DVRITYCLLYGA  312

Query  881   VLLDQMALIHLIFSHWAMVKIE  816
             + LD +A+   +FS W + +I+
Sbjct  313   IALDAIAIFMAVFSDWTVARIK  334



>ref|XP_010039338.1| PREDICTED: uncharacterized protein LOC104428025 [Eucalyptus grandis]
Length=511

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 132/241 (55%), Gaps = 13/241 (5%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             MED++LW RHLL  + QIC+ + +  Q         +PT +VFL  I K  ER L+L L+
Sbjct  106   MEDSSLWPRHLLGLVFQICAAIYIFVQIFPNDKSMAIPTMLVFLAAITKNAERTLALNLS  165

Query  1340  SSRFVRKSIGKS--LDSVASKELI---RAEGKDMTDNIMNQYEIVRKAYECHQIFKGFII  1176
             S   +R+ +     +   A  ELI     + K+  + ++ +  +V+ AY   QIFK F+I
Sbjct  166   SHPRLREWVYSQHMISDDADNELIEELNVQVKEEEEAMLAESIVVKHAYYFFQIFKVFLI  225

Query  1175  DHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASYFWCI  999
             D  +   +    + +F  ++  DA +V+ +EL FMY+ + TK +A++  W    SY   I
Sbjct  226   DFLYTGRQRAISRRYFHKVSAMDALRVISVELHFMYEVLHTKALAIRSNW----SY---I  278

Query  998   WRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
             +RF+    +VT   +F    K H+   D+ +TY L+ G + LD +AL+ LIFS+W + +I
Sbjct  279   FRFIAFTNIVTAFFLFNRLKKHHLLEIDVEITYFLLLGGIALDAIALVMLIFSYWTVAEI  338

Query  818   E  816
             +
Sbjct  339   K  339



>ref|XP_010648157.1| PREDICTED: uncharacterized protein LOC100255511 [Vitis vinifera]
Length=759

 Score =   123 bits (309),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 133/268 (50%), Gaps = 44/268 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   ++Q+ +V  V+ Q     SE  +PT ++ L GI+K  ER  +L L 
Sbjct  112   LEDNELWIRHLFGLLIQLIAVGYVILQ--ALPSELWIPTSLMLLAGIIKYAERTRALYLG  169

Query  1340  SSRFVRKSI-------------GKSLDSVASKELI--------RAEGKDMTD-----NIM  1239
                  + SI              + ++  +SK+++        + E +   D       +
Sbjct  170   CLGNFKASILPPADAGPEATDYARLMEGYSSKKIVHVPAYIKVQTEFRASADYAVRPKRL  229

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             +  ++V   ++   IFKG I+D  F   E    + +    N EDAFKV+E+EL+FMYDA+
Sbjct  230   SDLDVVEGGFKYFNIFKGLIVDLMFTFQERKDSRRYVFARNTEDAFKVLEVELNFMYDAL  289

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSK----------LHMKPGDIG  909
             +TKM+ V    G   Y  C+ RFVC+  LV     F  H K            M P D+ 
Sbjct  290   YTKMVVVN---GNIGY--CL-RFVCSTCLVASLERFAAHHKQKNGGHPPNQAKMHPFDVY  343

Query  908   VTYCLVGGAVLLDQMALIHLIFSHWAMV  825
             VTY L+ GA+ LD +A+I LIFS W +V
Sbjct  344   VTYALLIGAICLDSIAVIKLIFSDWTIV  371



>gb|KDP45940.1| hypothetical protein JCGZ_11843 [Jatropha curcas]
Length=764

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 100/349 (29%), Positives = 172/349 (49%), Gaps = 49/349 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQ-YKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RH+L  + Q  +   V  Q     Q++ ++PT ++FL GI+K +ER  SL L
Sbjct  110   LEDNELWLRHMLALVFQAVATGYVFVQTLGNGQNKVMVPTFLLFLAGIIKYLERTRSLYL  169

Query  1343  ASSRFVRKSI----------GKSLDSVASK-------ELIRAEGKDMTDN----------  1245
             AS    R S+           K ++  ASK       ++I     +  +N          
Sbjct  170   ASMDRFRDSMLKEPDPGPNYAKLMEEYASKKQAKLPTQIIMIPEPEKGNNASRITAKSIK  229

Query  1244  IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
             + +Q E+V+KA+   +IF+G ++D  F   E    +++F N++ EDA +V+E EL+F+Y+
Sbjct  230   LDDQLEVVQKAFGFFKIFRGLVVDLIFSFKERNDSREFFNNVSAEDALRVIEAELNFIYE  289

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVG  888
              +FTK++ VQ   G   YF   +R V  + +V+   +F F  K     G D+GVTY L+ 
Sbjct  290   VLFTKVVVVQSKWG---YF---FRTVAFSSVVSALAVFHFSVKKDKFNGFDVGVTYALLF  343

Query  887   GAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQK--KTVDTPVARK---LKQKKT  723
             GA+ LD ++LI  + S W    ++   + +    +        +   + RK   +K+ K 
Sbjct  344   GAIGLDTISLIMALLSDWRAAALKTSDIISESCWEYVTAFFNNLAVVIFRKFLVIKRSKW  403

Query  722   VDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR  576
                 +   +K  +         LIT +  + WSG +  ++L+++ L GR
Sbjct  404   CAYEIEPNVKFTV---------LITPIFFRRWSGYVAGHNLIRYCLKGR  443



>ref|XP_007146455.1| hypothetical protein PHAVU_006G042000g [Phaseolus vulgaris]
 gb|ESW18449.1| hypothetical protein PHAVU_006G042000g [Phaseolus vulgaris]
Length=449

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/265 (30%), Positives = 129/265 (49%), Gaps = 45/265 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+L  MVQ+C    V        + W+ PT +VF+ G++K  ER  SLQLA
Sbjct  109   LEDNELWRRHMLGLMVQVCLTGYVFLLTLPDNTLWI-PTALVFMAGLIKFAERTRSLQLA  167

Query  1340  SSRFVRKSI----------GKSLDSVASK-----------------ELIRAEGKD-----  1257
             S    R+S+           K +D   S+                 E    E  +     
Sbjct  168   SLGNFRQSMVHDPDPGPNYAKLVDEFRSRLQAGLPAEIVTMPEISDEFTDTEPPNSAKLQ  227

Query  1256  ----MTDNI--MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKV  1095
                  +D+I  ++  +++R AY+    FKG I+D  F  +E  K + +   L   DA +V
Sbjct  228   PHIRRSDDIADLSDLKVMRGAYDYFNTFKGLIVDMIFSFEERSKSRTYLLGLTAVDALRV  287

Query  1094  MEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGD  915
             +E+EL+ +Y + +TK   ++ W G++      +RFV  + +V   ++F +  K   +P D
Sbjct  288   IEVELNLIYQSFYTKTTIIESWLGLS------FRFVSISSVVAALVVFIYEQKTGCEPFD  341

Query  914   IGVTYCLVGGAVLLDQMALIHLIFS  840
             + VTY L+ GAV L+ +++   IFS
Sbjct  342   VKVTYILLYGAVALEVLSIFMFIFS  366



>ref|XP_006428074.1| hypothetical protein CICLE_v10027429mg [Citrus clementina]
 gb|ESR41314.1| hypothetical protein CICLE_v10027429mg [Citrus clementina]
Length=763

 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 95/351 (27%), Positives = 165/351 (47%), Gaps = 52/351 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q  + + + +   +      +PT ++F+ G +K VER  +L LA
Sbjct  108   LEDNELWLRHLLGYVFQAAAAVYIFFM-ALPNDSVSIPTILLFIAGTIKYVERTRALYLA  166

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQY-----EIVRKAYECHQIFKGFII  1176
             S    R S+ K  DS       + E K     + + Y     E+V  AY    +FKGFI+
Sbjct  167   SLDKFRDSMLKKPDS-------KVEAKVSAQILHSGYNLDYLEVVHFAYLYFNLFKGFIV  219

Query  1175  DHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIW  996
             D  F  +E  + + +F  L+ EDA +++E++L+F+Y  + TK+      + + S F CI+
Sbjct  220   DLIFSFNEREQSRAFFDKLSPEDALRIIEVQLNFIYGVLHTKI------RVMHSVFGCIF  273

Query  995   RFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
             RF+    +V     F+F    +   G D+G+TY L  GA+  D +AL  L+FS W  V +
Sbjct  274   RFISFGSIVAALSYFYFAVDKYRFVGIDVGITYTLFLGAIAQDVVALFMLVFSDWTFVAL  333

Query  818   -------EMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGH  660
                     +  + + +A  L+    +  P  ++   + +      R +K ++++      
Sbjct  334   GNHKNVSRLGEIKSSIAATLRWCLVLKNPQWQECHAQHS-----HRGIKHEVLA------  382

Query  659   KLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLH  507
                T    + WSG +  +SL+++ L  R  +              + SCLH
Sbjct  383   ---TPFLFRRWSGSVSGHSLIRYWLKARPSRVHK-----------VKSCLH  419



>emb|CBI20393.3| unnamed protein product [Vitis vinifera]
Length=643

 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 100/355 (28%), Positives = 160/355 (45%), Gaps = 71/355 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   ++Q+ +V  V+ Q     SE  +PT ++ L GI+K  ER  +L L 
Sbjct  112   LEDNELWIRHLFGLLIQLIAVGYVILQ--ALPSELWIPTSLMLLAGIIKYAERTRALYLG  169

Query  1340  SSRFVRKSIGKSLDSVAS-KELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
                  + S+    D+  +  +L+         + ++  ++V   ++   IFKG I+D  F
Sbjct  170   CLGNFKASMLPPADAGPNYAQLMEEYTSKKIAHRLSDLDVVEGGFKYFNIFKGLIVDLMF  229

Query  1163  LHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVC  984
                E    + +F   N EDAFKV+E+EL+FMYDA++TKM+                    
Sbjct  230   TFQERKDSRRYFFARNTEDAFKVLEVELNFMYDALYTKMVV-------------------  270

Query  983   NALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETV  804
                            K+H  P D+ VTY L+ GA+ LD +A+I LIFS W +V       
Sbjct  271   --------------GKMH--PFDVYVTYALLIGAICLDSIAVIKLIFSDWTIV-------  307

Query  803   DTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWS  624
                + R  + K+ +       LK +K                L  Y     +    + WS
Sbjct  308   ---LLRYRRAKEFL-------LKTRK---------------RLTIYRIGSWSKTFGRRWS  342

Query  623   GEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFE  459
               + Q+SL+++ L   R K  D  ++ F LK ++D   + +  KV + LK  + E
Sbjct  343   NSMSQHSLVRYCLK-ERFKWIDVTVDWFGLKDILDEIQYKEHIKVPKDLKIFICE  396



>ref|XP_007217306.1| hypothetical protein PRUPE_ppa015371mg [Prunus persica]
 gb|EMJ18505.1| hypothetical protein PRUPE_ppa015371mg [Prunus persica]
Length=690

 Score =   119 bits (298),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 134/522 (26%), Positives = 217/522 (42%), Gaps = 116/522 (22%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEW--------LLPTGIVFLVGIVKCVE  1365
             +EDN LW RHLL   VQ   VLV  Y   +F   W         +P   +F+VGI+K  E
Sbjct  111   LEDNELWLRHLLGVAVQ---VLVAFY---VFLRAWSNKVLNFLAIP---MFIVGIIKFGE  161

Query  1364  RILSLQLASSRFVRKSI----------GKSLDSVASK-------------ELIRAE----  1266
             R   L+ ASS   R+S+           + ++  +SK             E  +AE    
Sbjct  162   RTWVLRSASSEHFRESMLPHPDPGPSYARYMEEYSSKKAEGFKVELGPPIEAPKAENNSN  221

Query  1265  --GKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVM  1092
               G  + D+I N   I+ KAY   + FK    D         K + +F+N N E AF+V+
Sbjct  222   DAGGVLDDSIQNAV-ILNKAYSFFETFKRLCADLILSFHNIEKSQTFFQNRNSEQAFEVI  280

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDI  912
             E+EL FMYD  +T+ + V    G       I R +  +L V+V L+F F  K      D+
Sbjct  281   EIELGFMYDVFYTRAVLVHSRLG------GILRCISLSLTVSVFLVFLFKEKHAYTGEDV  334

Query  911   GVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQ  732
              +TY L+ GA++L+  A++ L+ S W  +++                             
Sbjct  335   AITYVLLVGAIILEMYAVVMLLSSDWTTLQLN----------------------------  366

Query  731   KKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDF  552
                       K K  ++ L +     I +V    WS ++ QY+L+   L  R  KC   F
Sbjct  367   ----------KHKNGVLKLFHTAVSSIPLVKRNRWSNKLGQYNLITFCLKNRPAKCI--F  414

Query  551   LEH-FLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHR--QEVM  381
             ++    +  +++   +  +  V ++LKNL+F  +K + K+       ++    R  Q + 
Sbjct  415   IKKDLFINKLLEKYRYQDSEDVSKELKNLIFTQLKEKSKSASNFDACKQLCARRGAQVLR  474

Query  380   DKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICY-FTADKTKGGDDEA  204
             D    + L   +                  +   +L  H+AT++CY F   +        
Sbjct  475   DAKCLVRLGWTIFGV--------------EFEQSILLWHIATDLCYNFDVKRNSNVVPNQ  520

Query  203   GAKLLCIQISQYLAYLLVLEEKITSAVPGSIG-MRFKDICKD  81
               K    Q+S Y+ YLLV+       +P  IG +RF+D C +
Sbjct  521   NCK-NSKQLSDYMLYLLVM---CPFMLPNGIGQIRFQDTCAE  558



>ref|XP_006398220.1| hypothetical protein EUTSA_v10000764mg [Eutrema salsugineum]
 gb|ESQ39673.1| hypothetical protein EUTSA_v10000764mg [Eutrema salsugineum]
Length=927

 Score =   119 bits (298),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 150/307 (49%), Gaps = 46/307 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + L VL Q  +  + W  PT +VF  G++K VER L+L LA
Sbjct  111   LEDNELWLRHLLGLAFQAIATLYVLLQ-SLPNALWK-PTVLVFATGVIKYVERTLALYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIR----------------AEGKDMTDNIM  1239
             S      S   R   G    K ++  A+K+++R                A+ K   D  +
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEFAAKKVMRMPTQIIKMEEPEKDPRADAKVKPDE-L  227

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
              +  I++ AY+   IFKG ++D  F   +  + + +F +L  ++A +++E+EL+F+Y+A+
Sbjct  228   TELNILQYAYKYFNIFKGLVVDLIFTFQQRAESQRFFSSLEADEALRILEVELNFIYEAL  287

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK   +  W G++      +RF+    L+    IF +  K      D+G+TY L+ G +
Sbjct  288   YTKAEILHNWIGVS------FRFIALGCLIAALRIFQYKKKDQYVGFDVGLTYALLIGGI  341

Query  878   LLDQMALIHLIFSHWAMVKI-----EMETVDTPVARKLKQKKTVDTPVARKLKQKK----  726
              LD +ALI    S W  V++     E++  D  + + L         V RKLK +K    
Sbjct  342   ALDSIALIMFCLSDWTFVRLRKMKDEVDDDDNWLDKTLNWILKWILGVRRKLKTEKYKCF  401

Query  725   --TVDTP  711
               T D P
Sbjct  402   KSTEDKP  408



>ref|XP_010040315.1| PREDICTED: uncharacterized protein LOC104429114 [Eucalyptus grandis]
Length=514

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 132/244 (54%), Gaps = 17/244 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW RHLL  + Q+ + + V  Q         +P  +VFL  ++K VERIL+L L+
Sbjct  54    LEDSSLWGRHLLNLIFQVGASIYVFVQIFTSDKSMAIPRMLVFLAAVIKNVERILALYLS  113

Query  1340  SSRFVRKSIGKSLDSVASK-------ELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFK  1188
             S + +RKS+   +D   SK       E +   G   TD      E  +V+ AY   QIFK
Sbjct  114   SFQRLRKSMISQMDDGLSKILSDESDEALTVLGDGYTDEEARLAESIVVKLAYYFFQIFK  173

Query  1187  GFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYF  1008
              F+ D  F   +    + +F+ ++  DA +V+ +EL F+Y+ + TK +A    + + SY 
Sbjct  174   VFLGDLIFTRQKREISRKYFRKISAIDALRVISVELHFIYEVLRTKALAT---RCMLSY-  229

Query  1007  WCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
               ++RF+    +V VA I F H + H +   D+ +TY L+ G + LD +AL  L+FS+W 
Sbjct  230   --MFRFIAFTSIV-VAFILFNHFRKHRLFKLDVKITYILLFGGIALDVIALFRLVFSYWT  286

Query  830   MVKI  819
             + KI
Sbjct  287   VAKI  290



>ref|XP_007146454.1| hypothetical protein PHAVU_006G042000g [Phaseolus vulgaris]
 gb|ESW18448.1| hypothetical protein PHAVU_006G042000g [Phaseolus vulgaris]
Length=616

 Score =   118 bits (295),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/265 (30%), Positives = 129/265 (49%), Gaps = 45/265 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+L  MVQ+C    V        + W+ PT +VF+ G++K  ER  SLQLA
Sbjct  109   LEDNELWRRHMLGLMVQVCLTGYVFLLTLPDNTLWI-PTALVFMAGLIKFAERTRSLQLA  167

Query  1340  SSRFVRKSI----------GKSLDSVASK-----------------ELIRAEGKD-----  1257
             S    R+S+           K +D   S+                 E    E  +     
Sbjct  168   SLGNFRQSMVHDPDPGPNYAKLVDEFRSRLQAGLPAEIVTMPEISDEFTDTEPPNSAKLQ  227

Query  1256  ----MTDNI--MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKV  1095
                  +D+I  ++  +++R AY+    FKG I+D  F  +E  K + +   L   DA +V
Sbjct  228   PHIRRSDDIADLSDLKVMRGAYDYFNTFKGLIVDMIFSFEERSKSRTYLLGLTAVDALRV  287

Query  1094  MEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGD  915
             +E+EL+ +Y + +TK   ++ W G++      +RFV  + +V   ++F +  K   +P D
Sbjct  288   IEVELNLIYQSFYTKTTIIESWLGLS------FRFVSISSVVAALVVFIYEQKTGCEPFD  341

Query  914   IGVTYCLVGGAVLLDQMALIHLIFS  840
             + VTY L+ GAV L+ +++   IFS
Sbjct  342   VKVTYILLYGAVALEVLSIFMFIFS  366



>ref|XP_006279990.1| hypothetical protein CARUB_v10025861mg [Capsella rubella]
 gb|EOA12888.1| hypothetical protein CARUB_v10025861mg [Capsella rubella]
Length=873

 Score =   119 bits (297),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 131/259 (51%), Gaps = 33/259 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + VL Q  +  + W  P  +VF  G++K VER L+L LA
Sbjct  113   LEDNELWLRHLLGLFFQSVATVYVLLQ-SLPNALWK-PILLVFATGVIKYVERTLALYLA  170

Query  1340  S------SRFVRKSIG----KSLDSVASKELIRAEGK---------------DMTDNIMN  1236
             S      S   R   G    K ++  A+K+ ++   +               D+   I+ 
Sbjct  171   SLDKFKDSMIQRPDPGPNYAKLMEEFAAKKDMKMPTQIIKIGEPEKDPKADADVRPKILT  230

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
                I++  Y+   IFKG ++D  F   E  + K +F +L+ ++A +++E+EL+F+Y+A++
Sbjct  231   PLNILQYGYKYFNIFKGLVVDLIFTFQERAESKRFFNSLDADEALRILEVELNFIYEALY  290

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W G       I+RF+    L+    IF + +K   +  D+G+TY L+ G + 
Sbjct  291   TKAEILHNWIGF------IFRFIALGCLIAALRIFQYKNKKDYREFDVGLTYALLLGGIA  344

Query  875   LDQMALIHLIFSHWAMVKI  819
             LD +ALI    S W  V++
Sbjct  345   LDCIALIMFCASDWTFVRL  363



>ref|XP_010068533.1| PREDICTED: uncharacterized protein LOC104455440 [Eucalyptus grandis]
Length=740

 Score =   118 bits (296),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 135/244 (55%), Gaps = 17/244 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED+ LW RHLL+ + QI + + +  Q  +     ++PT +VFL G++K VERIL+L L+
Sbjct  107   LEDSLLWRRHLLSLIFQIGATIYIFAQIFLTNKLLVIPTMLVFLAGVIKNVERILALHLS  166

Query  1340  SSRFVRKSIGKSLDSV--ASKELIRAEGKDMTDN-----IMNQYEIVRKAYECHQIFKGF  1182
             S   +R+S    + S   A K L++     +  N      + +  +V+ A    QIFK F
Sbjct  167   SLPRLRESALSQMSSSEGAYKNLVQELNVQLDRNSNKEATLAESIVVKHADSFLQIFKVF  226

Query  1181  IIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASYFW  1005
             ++D  F   E    +++F  ++  DA +V+ +EL F Y+ + TK +A+   W    SY  
Sbjct  227   LVDFIFRRQEREISREYFCKVSAMDALRVISVELHFTYEILHTKALAIHSNW----SY--  280

Query  1004  CIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
              I+RF+    +V +A + F   K H +K  D+ +TY L+ G + LD +AL  L+FS W +
Sbjct  281   -IFRFIAFTHVV-IAFVLFNRVKKHRLKEPDVEITYLLLFGGIALDAIALFMLVFSDWMV  338

Query  827   VKIE  816
             VKI+
Sbjct  339   VKIK  342



>ref|XP_008224917.1| PREDICTED: uncharacterized protein LOC103324616 [Prunus mume]
 ref|XP_008224918.1| PREDICTED: uncharacterized protein LOC103324616 [Prunus mume]
Length=715

 Score =   118 bits (295),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 144/289 (50%), Gaps = 46/289 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIV-FLVGIVKCVERILSLQL  1344
             +EDN LW RH L  + Q+ + + V  Q   F +  L P+ I+ FL G +K  ER   L L
Sbjct  112   LEDNTLWLRHFLGLIFQVIAAIYVFIQS--FPTNKLWPSTILLFLAGTIKYAERTRGLYL  169

Query  1343  ASSRFVRKSIGKSLDS----------VASKELIR---------------------AEGKD  1257
             AS    ++S+ K+ D            +SK+  +                     AE  D
Sbjct  170   ASLDNFKESMLKTPDPGPNYAKLMEEYSSKKEAKLPTHIELTAERSKESRTVTYVAEAGD  229

Query  1256  MTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELS  1077
             M ++I     +VR AY  ++IF+G I+D  F   E  + + +F+    +DAF+++ +EL+
Sbjct  230   MENDIA----MVRHAYHFYKIFRGLIVDLIFSFHERFESRAFFQEREAKDAFRLIAIELN  285

Query  1076  FMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTY  900
             F+Y+A+FTK + V   +G      CI+R +     V++AL FF+  + H     D+G+TY
Sbjct  286   FVYEALFTKAVVVHSTQG------CIFRAISFT-AVSIALGFFYKLEKHDYHKFDVGITY  338

Query  899   CLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTP  753
              L+ GA+ LD +AL  LIFS W +  +      + VA  LK+  +   P
Sbjct  339   TLLFGALGLDSIALFMLIFSDWTVAALTKSWQKSFVATILKKYLSFKRP  387



>gb|KFK25862.1| hypothetical protein AALP_AA8G171900 [Arabis alpina]
Length=763

 Score =   118 bits (295),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 132/259 (51%), Gaps = 33/259 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + VL Q  +  + W+ P  +VF  G++K VER L+L LA
Sbjct  111   LEDNELWLRHLLGLTFQAIATVYVLLQ-SLPNALWI-PILLVFAAGVIKYVERTLALYLA  168

Query  1340  SSRFVRKSI----------GKSLDSVASKELIRAEGK----DMTDN-----------IMN  1236
             S    + S+           K ++  A+K+ ++   +    D TD            +  
Sbjct  169   SLDKFKDSMIQQPDPGPNYAKLMEEYAAKKDMKMPTQIIMIDDTDTDPKSSDEVRPQVFT  228

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
             Q  I++ AY+   IFKG ++D  F   +  + K +F +L  E+A  ++E+EL+F+Y+A+F
Sbjct  229   QLNILQYAYKYFNIFKGLVVDLIFTFQQRAESKRFFSSLEAEEALSIIEVELNFIYEALF  288

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W G+      I+RF+    L+    IF + +K      D+ +T+ L+ G + 
Sbjct  289   TKAEILHNWIGV------IFRFIALGCLIAALCIFQYKNKDQYGGFDVSLTFALLIGGIA  342

Query  875   LDQMALIHLIFSHWAMVKI  819
             LD +ALI    S W +V++
Sbjct  343   LDSIALIMFCLSDWTLVRL  361



>ref|XP_010068523.1| PREDICTED: uncharacterized protein LOC104455426 [Eucalyptus grandis]
Length=922

 Score =   118 bits (295),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 132/239 (55%), Gaps = 11/239 (5%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             MED+ LW RHLL+ + Q+ S + V  Q        L+PT +VFL G++K VER ++L ++
Sbjct  107   MEDSVLWRRHLLSLVYQVSSGIYVFMQIFPKDKSLLIPTILVFLAGVIKNVERTVALNIS  166

Query  1340  SSRFVRK---SIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDH  1170
             S   +R+   S  +  + VA K     E  ++    +++  +V+ AY   Q+F   + D 
Sbjct  167   SLPKLREWPFSQRQDPNEVAFKFDHVLEYPNLKWVNLDETSVVKHAYYLFQMFMVLLGDI  226

Query  1169  SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
              F   EC   + +F  ++  DA +V+ +EL F+Y+ + TK +A+   + I SY   I+RF
Sbjct  227   MFTLHECQVSRKYFNKISAMDALRVISVELQFIYEVLHTKTLAI---RSIWSY---IFRF  280

Query  989   VCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
             +     V VA + F H K H  P  D+ +TY L+ G + LD +AL+ L+FS W +V I+
Sbjct  281   IAFT-NVAVAFVLFNHLKRHQLPDLDVEITYSLLFGGIALDVIALLMLVFSDWTIVGIK  338



>ref|XP_007214131.1| hypothetical protein PRUPE_ppa018036mg [Prunus persica]
 gb|EMJ15330.1| hypothetical protein PRUPE_ppa018036mg [Prunus persica]
Length=675

 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 144/283 (51%), Gaps = 46/283 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIV-FLVGIVKCVERILSLQL  1344
             +EDN LW RH L  + Q+ + + V  Q   F +  L P+ I+ FL G +K  ER   L L
Sbjct  112   LEDNTLWLRHFLGLIFQVIAAIYVFIQS--FPTNKLWPSTILLFLAGTIKYAERTRGLYL  169

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIR---------------------AEGKD  1257
             AS    ++S+           K ++  +SK+  +                     AE  D
Sbjct  170   ASLDNFKESMLKKPDPGPNYAKLMEEYSSKKEAKLPTHIELTAERSKESRTVTYVAEPGD  229

Query  1256  MTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELS  1077
             M ++I     +VR AY  ++IF+G I+D  F   E  + + +F+    +DAF+++ +EL+
Sbjct  230   MENDI----AMVRHAYHFYKIFRGLIVDLIFSFHERFESRAFFQEREAKDAFRLIAIELN  285

Query  1076  FMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTY  900
             F+Y+A+FTK + V   +G      CI+R + +   V++AL FF+  + H     D+G+TY
Sbjct  286   FVYEALFTKAVVVHSMRG------CIFRAI-SFTAVSIALGFFYKLEKHDYHKFDVGITY  338

Query  899   CLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQK  771
              L+ GA+ LD +AL  LIFS W +  +      + VA  LK++
Sbjct  339   TLLFGALGLDSIALFMLIFSDWTVAALTKSWQKSFVATILKKQ  381



>gb|KDO59993.1| hypothetical protein CISIN_1g045810mg [Citrus sinensis]
Length=763

 Score =   115 bits (289),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 124/241 (51%), Gaps = 20/241 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q  + + + +   +      +PT ++F+ G +K  ER  +L LA
Sbjct  108   LEDNELWLRHLLGYVFQAAAAVYIFFM-ALPNDSVSIPTILLFIAGTIKYAERTRALYLA  166

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQY-----EIVRKAYECHQIFKGFII  1176
             S    R S+ K  DS       + E K     + + Y     E+V  AY    +FKGFI+
Sbjct  167   SLDKFRDSMLKKPDS-------KVEAKVSAQILHSGYSLDYLEVVHFAYLYFNLFKGFIV  219

Query  1175  DHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIW  996
             D  F  +E  + + +F  L+ EDA +++E++L+F+Y  + TK+      + + S F CI+
Sbjct  220   DLIFSFNEREQSRAFFDKLSPEDALRIIEVQLNFIYGVLHTKI------RVMHSVFGCIF  273

Query  995   RFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
             RF+    +V     F+F    +   G D+G+TY L  GAV  D +AL  L+FS W  V +
Sbjct  274   RFISFGSIVAALSYFYFAVDKYRFVGIDVGITYTLFLGAVAQDVVALFMLVFSDWTFVAL  333

Query  818   E  816
              
Sbjct  334   R  334



>gb|KFK31559.1| hypothetical protein AALP_AA6G127600 [Arabis alpina]
Length=884

 Score =   115 bits (289),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 131/259 (51%), Gaps = 33/259 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q  +  + W  P  +VF  GI+K VER LSL  A
Sbjct  111   LEDNELWLRHLLGLAFQSIATVYVFLQ-SLPNALWK-PIFLVFAAGIIKYVERTLSLYQA  168

Query  1340  S------SRFVRKSIG----KSLDSVASK-------ELIRAEG--KDMTDNI------MN  1236
             S      S   R   G    K ++  A+K       ++I+ E   KD  D+       + 
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMNMPIQIIKVEEPEKDPRDDAKVRPDDLT  228

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
             +  I++ AY+   IFKG ++D  F   E  + K +F +LN  +A +++E+EL+F+Y+A++
Sbjct  229   ELNILQYAYKYFNIFKGLVVDLIFTFQERAESKRFFSSLNAGEALRILEVELNFIYEALY  288

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W GI      ++RF+    L+    IF +  K      D+G+TY L+ G + 
Sbjct  289   TKAEILHNWIGI------LFRFIALGCLIEALRIFTYKKKDQYGEFDVGLTYALLIGGLA  342

Query  875   LDQMALIHLIFSHWAMVKI  819
             LD +AL+    S W  +++
Sbjct  343   LDFIALLMFCLSDWTFIRL  361



>ref|XP_009128804.1| PREDICTED: uncharacterized protein LOC103853646 [Brassica rapa]
Length=859

 Score =   115 bits (289),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 151/330 (46%), Gaps = 55/330 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q     ++   P  +V   G++K VER L+L LA
Sbjct  111   LEDNELWLRHLLGLGFQAIATVYVFLQS--LPNDLWRPIVLVSATGVIKYVERTLALYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIRAE---------------GKDMTDNIMN  1236
             S      S   R   G    K ++  A+K++++                 G  +  + + 
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKVMKMPTQIIKIEEPEKDPKAGAKVKPDDLT  228

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
             +  I++ AY+   IFKG ++D  F   +  + K +F  L  ++A +++E+EL+F+Y+A++
Sbjct  229   ELNILQYAYKYFNIFKGLVVDLIFTFQQRAESKRFFSELKPDEALRILEVELNFIYEALY  288

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W G+      I+RF+    L+    IF +  K      D+G+TY L+ G + 
Sbjct  289   TKAEILHNWIGV------IFRFIALGCLIAALRIFQYKDKKDYGDFDVGLTYALLIGGIA  342

Query  875   LDQMALIHLIFSHWAMVKIE--METVDTP------------VARKLKQKKTVDTPVARKL  738
             LD +ALI    S W  V++    + VD P            VAR LK +K       R  
Sbjct  343   LDCIALIMFCLSDWTFVRLRKMKDEVDDPDTKFDKFLNRILVARGLKTEKY------RCF  396

Query  737   KQKKTVDTPVARKLK--QKIISLIYYGHKL  654
             K K  V   V  KL    KII  I    +L
Sbjct  397   KPKDAVSHEVNNKLNWFNKIIKPILISMRL  426



>emb|CDP00343.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   115 bits (287),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 121/244 (50%), Gaps = 23/244 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHLL  ++Q  +V  V  Q    ++ + +PT ++   G +K  ER  +L LA
Sbjct  167   LKDNELWIRHLLGLIIQFSAVAYVFSQS--LRNVFYVPTILLIFAGTIKYAERTRALYLA  224

Query  1340  SSRFVRKSIGKSLDSVASKEL-IRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
                         L +    E+ I  E    T    N  E   K +     F+G I+DH F
Sbjct  225   C-----------LAAQVPVEIEIVKEHDRGTQTSANPEEENLKLF---TTFRGLIVDHMF  270

Query  1163  LHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVC  984
                E  K + +F   +  DAF+VME+EL+F+YD ++TKM  V   KG         R +C
Sbjct  271   SFHERSKSRKFFFQRSAFDAFRVMEVELNFIYDTLYTKMAVVHSKKGYR------LRLIC  324

Query  983   NALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETV  804
             + L+V     F  H K  +   D+  TY L+ GAVLLD +A   LIFS W +VK++  TV
Sbjct  325   SILIVLSFERFASHHKPDINHFDVATTYILLSGAVLLDFVAFTKLIFSDWTIVKLKNLTV  384

Query  803   DTPV  792
              T V
Sbjct  385   KTTV  388



>ref|XP_010441715.1| PREDICTED: uncharacterized protein LOC104724856 [Camelina sativa]
Length=834

 Score =   115 bits (287),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 129/260 (50%), Gaps = 33/260 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + VL Q  +  + W  P  +VF  G++K VER L+L LA
Sbjct  111   LEDNELWLRHLLGLFFQAVATVYVLLQ-SLPNALWK-PILLVFSAGVIKYVERTLALYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASK-------ELIRAE--------GKDMTDNIMN  1236
             S      S   R   G    K ++  A+K       ++I+ E          ++    + 
Sbjct  169   SLDKFKNSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIEEPEKDPKADAEVRPKTLT  228

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
                I++ AY+    FKG ++D  F + E  + K +F +L  ++A +++E+EL+FMY+A++
Sbjct  229   PLNILQYAYKYFNFFKGLVVDLIFTYQELAESKRFFSSLEADEALRILEVELNFMYEALY  288

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W G       I+RF+    L+    IF   +K      D+G+TY L+ G + 
Sbjct  289   TKAEILHNWIGF------IFRFIALGCLIAALCIFQNKNKDEYGGFDVGLTYALLLGGIA  342

Query  875   LDQMALIHLIFSHWAMVKIE  816
             LD +ALI    S W  V++ 
Sbjct  343   LDSIALIMFCASDWMFVRLR  362



>ref|XP_010039368.1| PREDICTED: uncharacterized protein LOC104428062 [Eucalyptus grandis]
Length=705

 Score =   114 bits (286),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 139/251 (55%), Gaps = 25/251 (10%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL+ + Q+ + + V     IF S+   ++PT +VF    +K VER+ +L 
Sbjct  107   LEDSSLWQRHLLSLIFQVGATVYVFVW--IFPSDKSLVIPTILVFFAAFIKNVERLWALY  164

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAEGK------DMTDNIMNQYEIVRKAYECHQIFKG  1185
             L++   +R+ +   LD   S +L    GK      +  +  +++  +V+ AY   QIFK 
Sbjct  165   LSNFSKLREWVF--LDDTISYDLY---GKLIPVYFNEEEAKLDESTMVKHAYYFFQIFKI  219

Query  1184  FIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASYF  1008
             FI D  F   +    +++F  ++  DA +++ +EL F+Y+ + TK +A++ +W       
Sbjct  220   FITDFIFTRQQRNMSRNYFYKVSAMDALRIISVELQFIYEVLHTKALAIRSKWS------  273

Query  1007  WCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
              CI+RF+   + + +A I F   K H  P  D+G+TYCL+ G + LD ++L+ L+FS W 
Sbjct  274   -CIFRFIA-FIDIVMACIMFNRLKKHRLPQLDVGITYCLILGGIALDVISLVMLVFSDWT  331

Query  830   MVKIEMETVDT  798
             +  I+  T  +
Sbjct  332   VAGIKHPTTRS  342



>ref|XP_007214884.1| hypothetical protein PRUPE_ppa022062mg [Prunus persica]
 gb|EMJ16083.1| hypothetical protein PRUPE_ppa022062mg [Prunus persica]
Length=696

 Score =   114 bits (286),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 138/523 (26%), Positives = 230/523 (44%), Gaps = 92/523 (18%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL----LPTGIVFLVGIVKCVERILSL  1350
             EDN LW RHLL    Q+     VL+  + + SE L    LP   +F+VGI+K  ER   L
Sbjct  110   EDNELWMRHLLRLGSQLLVASNVLF--RAWSSEALNFLALP---MFIVGIIKSGERTWVL  164

Query  1349  QLASSRFVRKSI------GKSLD------SVASKELIRAE-----------GKDMT----  1251
             + ASS   R S+      G + D      S    E  R E           G D +    
Sbjct  165   RSASSEQFRDSMLQDPDPGPNYDRYMEDYSSRRDEGFRVELETFSASKAATGSDQSREPA  224

Query  1250  -DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
              D+  +Q + + KAY   +  K    D      +    +++F+  N E AFKV+E+EL F
Sbjct  225   ADDDSSQNDPINKAYTFFESSKKLCADLILNFHDVDNSQNFFQATNFEKAFKVIEIELGF  284

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD  +TK + V  + G+     CI  F    L V V LIF F  K   +  D+ +TY +
Sbjct  285   IYDVFYTKAVLV--YSGLGGILRCITFF----LTVLVFLIFLFTEKQAYREMDVIITYIM  338

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDT  714
             + GA++L+  ALI L+ S W  + +           K K   TV   V +   + +  +T
Sbjct  339   LAGAIVLEIYALIILLSSDWTKLWLN----------KNKNTNTVACVVNKNKHKNEHTNT  388

Query  713   PVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLL  534
                      ++  ++     + +VN+KSWS  + QY L+K  L  +  KC   F +   +
Sbjct  389   VAC------VVGFLHKTVSYLPLVNNKSWSNSLGQYKLIKFCLKTKPAKCI-IFKKDCYI  441

Query  533   KGVIDSCLHTQTAKVE-EKLKNLVFEDIkrrekakeaaaepekETYHRQE-VMDKIKKIH  360
                ++   + + +KV  + +K L+F+ +  +    ++  + ++    R + V+DK K + 
Sbjct  442   NTYLEKHRYKKYSKVPIDFVKQLIFKQLLEKSATAKSFKDRKELCAGRGDKVLDK-KGLK  500

Query  359   LAPKvvdsssddvvvsvddDIENYANF---VLTLHVATEICYFTADKTKGGDDEAGAKLL  189
             +    +                N A F   +L  H+AT++CY +    +  + +   KL 
Sbjct  501   ILGWTI----------------NDAEFDQSILLWHIATDLCYNSDLNEENQNCQTRKKLP  544

Query  188   CIQ------ISQYLAYLLVLEEKITSAVPGSIG-MRFKDICKD  81
                      +S Y+ YLLV+       +P  IG +R++D C +
Sbjct  545   NKNCQASRLLSNYMLYLLVI---CPFMLPNGIGEIRYRDTCSE  584



>ref|XP_011018639.1| PREDICTED: uncharacterized protein LOC105121611 [Populus euphratica]
Length=727

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 124/262 (47%), Gaps = 33/262 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+LT + Q  + L V +        W+ PT ++FL G++K  ER  SL  A
Sbjct  109   LEDNELWLRHMLTFVTQGLATLYVFFLTLTSNKVWI-PTVLLFLAGVIKYFERTCSLYRA  167

Query  1340  SSRFVRKSIGKSLDS---------------------------VASKELIRAEGKDMTDNI  1242
             S    R S+ +  D                               K++           +
Sbjct  168   SMDRFRDSMLEDPDPGPNYAKLMEEYDSKIEAKIPTEIIIIEEPDKQMPTTARDTQIKKL  227

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              +  E+V++AY    IFKG I+D  F   +  + + +F +++ EDA KV+E+EL+F+Y+ 
Sbjct  228   KDDLEVVQRAYYYFNIFKGLIVDLIFSFKDRNESRKFFHSIDAEDALKVLEVELNFIYEV  287

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             +FTK + V     +  Y + +  F+   +LV +AL  F   K    P D+  TY L+ G+
Sbjct  288   LFTKAVVVH---SVIGYVFRLLSFIL--VLVALALFRFNVKKDKFSPLDVKFTYVLLLGS  342

Query  881   VLLDQMALIHLIFSHWAMVKIE  816
             V LD +A +  IFS W +  + 
Sbjct  343   VSLDTIAFVRAIFSDWTVADLN  364



>ref|NP_199361.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09176.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95257.1| uncharacterized protein AT5G45480 [Arabidopsis thaliana]
Length=877

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 131/270 (49%), Gaps = 36/270 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + VL Q  +  + W  P  +VF  G++K VER L+L LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVLLQ-SLPNALWK-PILLVFATGVIKYVERTLALYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIRAEG---------KDMTDNI-------M  1239
             S      S   R   G    K ++  A+K+ ++            KD  D+         
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKVGEPEKDPRDDAPVKPPDGF  228

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                 I++ AY+   IFKG ++D  F   +  + K +F +L  E+A +++E+EL+F+Y A+
Sbjct  229   TPLNILQYAYKYFNIFKGLVVDLIFTFQQRAESKRFFDSLKAEEALRILEVELNFIYAAL  288

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK   +  W G       ++RF+    L     IF + SK      D+G+TY L+ G +
Sbjct  289   YTKAEILHNWIGF------LFRFIALGCLAAALRIFQYKSKKDYSGFDVGLTYALLLGGI  342

Query  878   LLDQMALIHLIFSHWAMVKIE--METVDTP  795
              LD +ALI    S W  V++    + VD P
Sbjct  343   ALDCIALIMFCASDWTFVRLRKMKDEVDDP  372



>ref|XP_010042029.1| PREDICTED: uncharacterized protein LOC104431034 [Eucalyptus grandis]
Length=666

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 135/259 (52%), Gaps = 29/259 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW RH+L+ + Q+ + + V  Q        ++PT +VFLVG+ K  ER+ +L L+
Sbjct  54    LEDSSLWQRHMLSLIFQVGAAIYVFVQIFPINKSQVIPTMLVFLVGVTKNAERLRALNLS  113

Query  1340  SSRFVRKS------IGKSLDSVASKELIRAEGKDMTDNIMNQYE-------IVRKAYECH  1200
             S   +R+S      +GK++ S  + + +  E     D   +  E       +V+ AY   
Sbjct  114   SLPRLRESMLSGLRLGKTIISQGANDKLIEEVNAPRDGYSDGEEAKLLESTMVKHAYYFF  173

Query  1199  QIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
             QIF  FI +  F  +E    +++F  ++  DA +V+ +EL+FMY+ ++TK +A+      
Sbjct  174   QIFNVFIGNLIFKREERKMSREYFCKVSAIDALRVISIELNFMYEVLYTKALAMHS----  229

Query  1019  ASYFWCIWRFVCNAL-LVTVALIFFFHSKLHMKPG----DIGVTYCLVGGAVLLDQMALI  855
                    W ++C  +   ++ L F   ++L  K G    D+ +TY L+ G + LD +AL+
Sbjct  230   ------RWSYICRFINFTSIVLAFVLFNRLQ-KDGLFELDVEITYSLLFGGIALDVIALL  282

Query  854   HLIFSHWAMVKIEMETVDT  798
              LIFS W +  I+  T  +
Sbjct  283   MLIFSDWTVAGIKWYTTGS  301



>ref|XP_010065308.1| PREDICTED: uncharacterized protein LOC104452548 [Eucalyptus grandis]
Length=703

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 132/242 (55%), Gaps = 15/242 (6%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW RHLL+ + QI + + V           ++PT +VF  GI++ +ERIL+L L+
Sbjct  76    LEDSSLWRRHLLSLIFQIGAAIYVFAHIFPNDKSLMIPTILVFSSGIIQNLERILALNLS  135

Query  1340  SSRFVRKSIGK--SLDSVASKELIRAEGKDMTDN---IMNQYEIVRKAYECHQIFKGFII  1176
             S   +R+ + +  ++D     E +   G   +D     + +  +V+ AY   QIFK F+ 
Sbjct  136   SLPRLREWVQEFPNVDQNKLAEELDVLGDGYSDEEEPRLTESIVVKHAYFFFQIFKVFLG  195

Query  1175  DHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWC-I  999
             D  F H E    +++F  ++  DA +V+ +EL FMY+ + TK +A++       Y W  I
Sbjct  196   DLIFTHRERKFSREYFNKVSAMDALRVISVELHFMYEVLHTKALAIR-------YKWNYI  248

Query  998   WRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVK  822
             +RF+   + V VA I F   K    P  D+ +TY L+ G + LD +AL  L+FS W + +
Sbjct  249   FRFIA-IIDVVVAFILFNRLKKDRLPELDLKITYSLLFGGIFLDVVALFMLVFSDWTIAR  307

Query  821   IE  816
             I+
Sbjct  308   IK  309



>ref|XP_010494654.1| PREDICTED: uncharacterized protein LOC104771778 [Camelina sativa]
Length=866

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 128/260 (49%), Gaps = 34/260 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + VL Q  +  + W  P  +VF  G++K VER LSL LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVLLQ-SLPNALWK-PILLVFSAGVIKYVERTLSLYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIR----------------AEGKDMTDNIM  1239
             S      S   R   G    K ++  A+K+ ++                A  +      +
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIGEPEKDPKATAQVRPPREL  228

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                 I++ AY+   IFKG ++D  F   E  + K +F +L+  +A +++E+EL+F+Y+A+
Sbjct  229   TPLNILQYAYKYFNIFKGLVVDLIFTFQERAESKRFFNSLDANEALRILEVELNFIYEAL  288

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK   +  W G       ++RF+    L+    IF + +K      D+G+TY L+ G +
Sbjct  289   YTKAEILHNWIGF------LFRFIALGCLIAALRIFQYKNKKDYSEFDVGLTYALLVGGI  342

Query  878   LLDQMALIHLIFSHWAMVKI  819
              LD +ALI    S W  V++
Sbjct  343   ALDCIALIMFCASDWTFVRL  362



>ref|XP_010441710.1| PREDICTED: uncharacterized protein LOC104724853 isoform X1 [Camelina 
sativa]
 ref|XP_010441711.1| PREDICTED: uncharacterized protein LOC104724853 isoform X2 [Camelina 
sativa]
 ref|XP_010441712.1| PREDICTED: uncharacterized protein LOC104724853 isoform X3 [Camelina 
sativa]
Length=876

 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 128/260 (49%), Gaps = 34/260 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q  +  + W  P  +VF  G++K VER LSL LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVFLQ-SLPNALWK-PIVLVFSAGVIKYVERTLSLYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIR----------------AEGKDMTDNIM  1239
             S      S   R   G    K ++  A+K+ ++                A  +      +
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIGEPEKDPKATAQVRPPREL  228

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                 I++ AY+   IFKG ++D  F   E  + K +F +L+ ++A +++E+EL+F+Y+A+
Sbjct  229   TPLNILQYAYKYFNIFKGLVVDLIFTFQERAESKRFFSSLDADEALRILEVELNFIYEAL  288

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK   +  W G       ++RF+    L+    IF + +K      D+G+TY L+ G +
Sbjct  289   YTKAEILHNWIGF------LFRFIALGCLIAALRIFQYKNKKDYSEFDVGLTYALLVGGI  342

Query  878   LLDQMALIHLIFSHWAMVKI  819
              LD +ALI    S W  V++
Sbjct  343   ALDCIALIMFCASDWTFVRL  362



>ref|XP_010104853.1| hypothetical protein L484_024054 [Morus notabilis]
 gb|EXC02089.1| hypothetical protein L484_024054 [Morus notabilis]
Length=801

 Score =   113 bits (282),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 134/286 (47%), Gaps = 58/286 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L    Q+ + + V  Q     + W+ PT ++FL GI+K  ER  +L LA
Sbjct  112   LEDNELWLRHFLGLATQVMATIYVFVQTIPGNTLWI-PTVMMFLGGIIKYGERTRALNLA  170

Query  1340  SSRFVRKSI----------GKSLDSVASKELIRAEGK-----------------------  1260
             S    R S+           K ++  +SK+  R   K                       
Sbjct  171   SLNSFRDSLLQKPDPGPNYAKLMEEYSSKKDARLPTKIHMTPEPQRIHMTPEPSSKKDAR  230

Query  1259  -----DMT-------------DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKD  1134
                   MT             +  +   E+V +AY  + IFKG I+D  F   E  + + 
Sbjct  231   LPTKIHMTPDPQRKTQTSTEDEEYLTNIEVVVEAYHFYTIFKGLIVDSIFSFRERNESRQ  290

Query  1133  WFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALI  954
             +F +   +DA KV+E+EL+F+Y+A++TK++ V +  G       ++RFV  + +V    +
Sbjct  291   FFADRTPKDALKVLEVELNFIYEALYTKVVVVHKIIGY------VFRFVAFSAVVVTLGL  344

Query  953   FFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
             F    K   K  D+GVTY L+ GA+ LD +AL+ LI S W ++ ++
Sbjct  345   FITADKDGFKEFDVGVTYTLLFGALALDFIALLMLIVSDWTLISLQ  390



>ref|XP_010063737.1| PREDICTED: uncharacterized protein LOC104450749 [Eucalyptus grandis]
Length=793

 Score =   113 bits (282),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 139/248 (56%), Gaps = 23/248 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQS--EWLLPTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL    Q+ + + V  Q  IF S    +LPT ++FL G++K VER L+L 
Sbjct  107   LEDSSLWRRHLLNLTFQVSAAIYVFVQ--IFPSYKSLVLPTMLIFLAGVIKKVERTLALN  164

Query  1346  LAS-----SRFVRKSIGKSLDSVASKELIRAEGKDMT----DNIMNQYEIVRKAYECHQI  1194
             L+S      R + + +    +S+   E I AE    +    +  + +  +V+ AY   QI
Sbjct  165   LSSLPRLRERVLSQDVALDDESIFDDEDIVAELDGYSHGEEEAKLPESIVVKHAYYFFQI  224

Query  1193  FKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIA  1017
              K F+ D  F + +    + +F++++  DA +V+ +EL F+Y+ + TK + ++ +W    
Sbjct  225   SKLFLTDLIFTYRQRYISRRYFRSVSAVDALRVISVELHFIYEVLHTKALTIRSKW----  280

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFS  840
             SY   ++RF+   ++V +A +FF   K H  P  D+ +TY L+ G + LD +A++ L+FS
Sbjct  281   SY---VFRFIA-FIVVVMAFVFFNRLKKHQLPKLDVKITYLLLFGGIALDVIAVLMLVFS  336

Query  839   HWAMVKIE  816
              W + KI+
Sbjct  337   DWTVAKIQ  344



>ref|XP_010481570.1| PREDICTED: uncharacterized protein LOC104760359 isoform X1 [Camelina 
sativa]
Length=866

 Score =   112 bits (281),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 128/260 (49%), Gaps = 34/260 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q  +  + W  P  +VF  G++K VER LSL LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVFLQ-SLPNALWK-PIVLVFSAGVIKYVERTLSLYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIR----------------AEGKDMTDNIM  1239
             S      S   R   G    K ++  A+K+ ++                A  +      +
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIGEPEKDPKATAQVRPPREL  228

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                 I++ AY+   IFKG ++D  F   E  + K +F +L+ ++A +++E+EL+F+Y+A+
Sbjct  229   TPLNILQYAYKYFNIFKGLVVDLIFTFQERAESKRFFSSLDADEALRILEVELNFIYEAL  288

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK   +  W G       ++RF+    L+    IF + +K      D+G+TY L+ G +
Sbjct  289   YTKAEILHNWIGF------LFRFIALGCLIAALRIFQYKNKKDYSDFDVGLTYALLVGGI  342

Query  878   LLDQMALIHLIFSHWAMVKI  819
              LD +ALI    S W  V++
Sbjct  343   ALDCIALIMFCASDWTFVRL  362



>ref|XP_010481571.1| PREDICTED: uncharacterized protein LOC104760359 isoform X2 [Camelina 
sativa]
Length=869

 Score =   112 bits (281),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 128/260 (49%), Gaps = 34/260 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q  +  + W  P  +VF  G++K VER LSL LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVFLQ-SLPNALWK-PIVLVFSAGVIKYVERTLSLYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIR----------------AEGKDMTDNIM  1239
             S      S   R   G    K ++  A+K+ ++                A  +      +
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIGEPEKDPKATAQVRPPREL  228

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                 I++ AY+   IFKG ++D  F   E  + K +F +L+ ++A +++E+EL+F+Y+A+
Sbjct  229   TPLNILQYAYKYFNIFKGLVVDLIFTFQERAESKRFFSSLDADEALRILEVELNFIYEAL  288

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK   +  W G       ++RF+    L+    IF + +K      D+G+TY L+ G +
Sbjct  289   YTKAEILHNWIGF------LFRFIALGCLIAALRIFQYKNKKDYSDFDVGLTYALLVGGI  342

Query  878   LLDQMALIHLIFSHWAMVKI  819
              LD +ALI    S W  V++
Sbjct  343   ALDCIALIMFCASDWTFVRL  362



>ref|XP_002863477.1| hypothetical protein ARALYDRAFT_494436 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39736.1| hypothetical protein ARALYDRAFT_494436 [Arabidopsis lyrata subsp. 
lyrata]
Length=870

 Score =   112 bits (280),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 131/269 (49%), Gaps = 35/269 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + VL Q  +  + W   T +VF  G++K VER L+L LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVLLQ-SLPNALWK-ATLLVFATGVIKYVERTLALYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIRAE------GKDMTD---------NIMN  1236
             S      S   R   G    K ++  A+K+ ++        G+   D           + 
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIGEPEKDPKASAQVRPEKLT  228

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
                I++ AY+   IFKG ++D  F   +  + K +F +L   +A +++E+EL+F+Y A++
Sbjct  229   PLNILQYAYKYFNIFKGLVVDLIFTFQQRAESKRFFDSLEAHEALRILEVELNFIYAALY  288

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W G       I+RF+    L+    IF + SK      D+G+TY L+ G + 
Sbjct  289   TKAEILHNWIGF------IFRFIALGCLIAALRIFQYKSKKDYSGFDVGLTYALLLGGIA  342

Query  875   LDQMALIHLIFSHWAMVKIE--METVDTP  795
             LD +ALI    S W  V++    + VD P
Sbjct  343   LDSIALIMFCASDWTFVRLRKMKDEVDDP  371



>ref|XP_010068527.1| PREDICTED: uncharacterized protein LOC104455430 [Eucalyptus grandis]
Length=545

 Score =   111 bits (278),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 134/245 (55%), Gaps = 23/245 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQ  1347
             +EDN+LW RHLL+ + Q+ + + V    +IF S+   ++PT +VFL G +K +ER L+L 
Sbjct  107   LEDNSLWQRHLLSLIFQVGAAIYVF--VRIFPSDKSLVIPTILVFLAGFIKVMERTLALY  164

Query  1346  LAS------SRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKG  1185
             L+S      S F+   +G + D     +L+     D  +    +  +V+ AY   QIFK 
Sbjct  165   LSSFPKLRESMFLDSKLGTATD---LSQLLENLTTDEDEAKFTESIMVKHAYSFFQIFKI  221

Query  1184  FIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASYF  1008
             FI+D  +   +     D+F  ++  +A +V+ +EL+F+Y+ + TK + ++ +W    SY 
Sbjct  222   FIVDLIYTQKQRKMSMDYFHKVSAMNALRVISVELNFIYELLHTKALTIRHKW----SYI  277

Query  1007  WCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
             + I  F      + VAL  F H K +  P  D+ +++ ++ G +++D +AL  LIFS W 
Sbjct  278   FRIIAFTS----IVVALGLFNHLKRYGLPELDVKISHIILFGGIIIDGIALFQLIFSDWT  333

Query  830   MVKIE  816
             +  I+
Sbjct  334   VAGIK  338



>ref|XP_010086810.1| hypothetical protein L484_009581 [Morus notabilis]
 gb|EXB23820.1| hypothetical protein L484_009581 [Morus notabilis]
Length=718

 Score =   112 bits (279),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 128/527 (24%), Positives = 222/527 (42%), Gaps = 114/527 (22%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  +VQ+     V  +     +  LL   I F+ GIVK  ER   L+ A
Sbjct  128   LEDNELWLRHFLGLIVQVGVAFYVFLRAWNSGTMSLLSIPI-FVAGIVKFGERTWVLRSA  186

Query  1340  SSRFVRKSIGKSLDS-----------VASKELIRAEGKDMTDNIMNQ-------------  1233
             SS   R+S+  S D             A KE    EG  +   I++              
Sbjct  187   SSEHFRESMLPSPDPGPNYARYMEEYCAKKE----EGFHVKSTIIDAGRAGDQEHPGTAN  242

Query  1232  ---------YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMEL  1080
                       EIVRKA+    +F+    D    + +    + +F+ ++ + AFKV+E EL
Sbjct  243   TTAISVDSTAEIVRKAHRFFLVFRRLCADLILSYHDITGSRAFFRKISFDSAFKVIEFEL  302

Query  1079  SFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTY  900
               MYDA +TK + +    GI     CI  F   ++L+T    FFF +K      D+ ++Y
Sbjct  303   GLMYDAFYTKAVLINSRVGI--ILRCISFFSTVSVLIT----FFFANKEAYLRVDVVISY  356

Query  899   CLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTV  720
              L+ GA++L+  A+I ++ S W +++             L + K+V++ V R        
Sbjct  357   ILLVGAIVLEICAVIVMLASDWTVLR-------------LSRHKSVNSMVNRIF------  397

Query  719   DTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHF  540
               PV+ + + K               N + WS ++ QY+L+   L  +  KC  +  + F
Sbjct  398   --PVSVRGRDK---------------NKRRWSNKMAQYNLISICLENKPPKCI-NLQKVF  439

Query  539   LLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIH  360
              +  +++   H     V   LK L+FE +           +     +   + + + +  H
Sbjct  440   FVDKLLEKYRHMYVRDVPTHLKELIFEQL----------KDKSSGDFENCKELCRRRGDH  489

Query  359   LAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADK-------------TKG  219
             +       ++  +  + + + +     +L  H+AT++CY++ D               +G
Sbjct  490   VLRTENLLNNVVLGRTTELEFDQS---ILLWHIATDLCYYSGDDHSNTGHIRGGATYNRG  546

Query  218   GDDEAGAKLLCIQISQYLAYLLVLEEKITSAVPGSIG-MRFKDICKD  81
              DD   A  L   +S Y+ YL+V+       +P  IG +RF+D C +
Sbjct  547   IDDHRKASKL---LSDYMLYLVVV---CPFMLPNGIGQIRFQDTCAE  587



>emb|CDP10893.1| unnamed protein product [Coffea canephora]
Length=583

 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 120/244 (49%), Gaps = 23/244 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHLL  ++Q  +V  V  Q    ++ + +PT ++   G +K  ER  +L LA
Sbjct  110   LKDNELWIRHLLGLIIQFSAVAYVFSQS--LRNVFYVPTILLIFAGTIKYAERTRALYLA  167

Query  1340  SSRFVRKSIGKSLDSVASKEL-IRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
                         L +    E+ I  E    T    N  E   K +     F+G I+DH F
Sbjct  168   C-----------LAAQVPVEIEIVKEHDRGTQTSANPEEENLKLF---TTFRGLIVDHMF  213

Query  1163  LHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVC  984
                E  K + +F   +  DAF+VME+EL+F+YD ++TKM  V   KG         R +C
Sbjct  214   SFHERSKSRKFFFQRSAFDAFRVMEVELNFIYDTLYTKMAVVHSKKGYR------LRLIC  267

Query  983   NALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETV  804
             + L+V     F  H K  +   D+  TY L  GAVLL+ +A   LIFS W +VK++  TV
Sbjct  268   SILIVLSFERFASHHKPDINHFDVATTYILHSGAVLLNFVAFTKLIFSDWTIVKLKNLTV  327

Query  803   DTPV  792
              T V
Sbjct  328   KTTV  331



>ref|XP_010040126.1| PREDICTED: uncharacterized protein LOC104428902 [Eucalyptus grandis]
Length=655

 Score =   111 bits (278),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 154/313 (49%), Gaps = 42/313 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL--PTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL+ + Q+ + + V     IF S  LL  PT +VFL GI K  ER+ +L 
Sbjct  54    LEDSSLWRRHLLSFIFQVGATIYVYVH--IFPSNHLLAIPTMLVFLAGITKNAERLRALN  111

Query  1346  LASSRFVRKSIGKSLDS-----VASKELIRAEGKDMTDNI--------------MNQYEI  1224
             L+S   +RKS+  SL S     +  + L   EG  +   +              + +  +
Sbjct  112   LSSFSRLRKSMLLSLQSKKIAFLTDESLHDDEGDQLIKELNVQRGARYSDEEAKLPESTV  171

Query  1223  VRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMI  1044
             V+ A+   QIF+ FI +  F++++    + +F+N++  DA +V+ +EL+F+Y+ ++TK +
Sbjct  172   VKHAHYFFQIFRVFIGNLIFIYEDREMSRKYFRNVSTIDALRVISVELNFIYEVLYTKAL  231

Query  1043  AVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQM  864
             A+    G       I+RF+    +V   ++F    K  +   D+ +TY L+ G + L+ +
Sbjct  232   AIYSLWGY------IFRFIAFTSIVLAFVVFNRLKKHGLSKLDVEITYSLLFGGIALEVI  285

Query  863   ALIHLIFSHWAMVKIEMETVDT-----------PVARKLKQKKTVDTPVARKLKQKKTV-  720
             AL  L+FS W +  I+     +                L++ + +   V R +     V 
Sbjct  286   ALFMLVFSDWTVAGIKRYNTGSSKLDSFLHKLVSATDNLRKPRFIMGGVERNINAAYMVL  345

Query  719   DTP-VARKLKQKI  684
             DTP + R+  + I
Sbjct  346   DTPFIFRRWSESI  358



>ref|XP_008371249.1| PREDICTED: uncharacterized protein LOC103434679 [Malus domestica]
Length=760

 Score =   111 bits (278),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 136/279 (49%), Gaps = 44/279 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q+ + + V  Q       W  PT ++FL G +K  ER  +L  A
Sbjct  112   LEDNTLWLRHFLGLVFQVIAAVYVFIQSFPTNKLW-PPTLLLFLAGTIKYAERTRALYXA  170

Query  1340  SSRFVRKSIGKSLDS--------------VASK-----ELIR------------AEGKDM  1254
             S    ++S+ K  D               + SK     EL              AE  DM
Sbjct  171   SLDNFKESMLKKPDPGPNYAKLMEEYSSKIESKLPTYIELTAERSKESRTVTYVAEPGDM  230

Query  1253  TDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
              +NI     +VR AY  ++IF+G I+D  F   E  + + +F   + E+ F+++ +EL+F
Sbjct  231   ENNIA----VVRHAYHFYEIFRGLIVDLIFSFHERFESRAFFHERSAEETFRLIAIELNF  286

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYC  897
             MY+A+FTK + V    G      C++R + +   V +AL+FF+   K      D+G+TY 
Sbjct  287   MYEALFTKAVVVHSKLG------CLFRAI-SFTAVFIALVFFYKLEKKAFHKVDVGITYT  339

Query  896   LVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKL  780
             L+ GA+ LD +A+  ++FS W +  +      + VA K+
Sbjct  340   LLYGALGLDSIAIFLVVFSEWTVTAMXKSWQKSWVATKI  378



>ref|XP_010063782.1| PREDICTED: uncharacterized protein LOC104450784 [Eucalyptus grandis]
Length=679

 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 130/245 (53%), Gaps = 17/245 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL T   Q+ SV+ V           + PT +VFL G++K VE+IL+L L+
Sbjct  61    LEDNTLWRRHLFTLTFQVGSVIHVFAHIIPCNKSLVFPTMLVFLAGVIKTVEKILALNLS  120

Query  1340  S-SRFVRKSIGK--SLDSVASK------ELIRAEGKDMTDNIMNQYEIVRKAYECHQIFK  1188
             S  RF    + +  SLD   +       +L+     D  D  + +  +V+ AY   +I K
Sbjct  121   SLPRFKEWVLSQQDSLDDTDNDSIVEFIDLLDGYSHDEEDAKLAESTVVKHAYYFFRISK  180

Query  1187  GFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASY  1011
              F+ D  F   +    +++F+ ++  DA +V+ +EL+F+Y+ + TK + ++ +W    SY
Sbjct  181   VFLTDLIFTRRQRKISQEYFRAISAMDALRVISVELNFIYEVLHTKALVIRTKW----SY  236

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                I+RF+    +V   ++F    K  +   D+ +TY L+ G + LD +A++ LIFS W 
Sbjct  237   ---IFRFIAFTNIVMALVLFNRLKKQQLHKLDVKITYILLFGGITLDVIAVLMLIFSDWT  293

Query  830   MVKIE  816
             +  ++
Sbjct  294   IAGVK  298



>ref|XP_006368456.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
 gb|ERP65025.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
Length=729

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/388 (26%), Positives = 166/388 (43%), Gaps = 61/388 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+LT   Q  + L V +        W+ PT ++FL G++K  ER  SL  A
Sbjct  109   LEDNELWLRHMLTFATQGFATLYVFFLTLTSNKVWI-PTVLLFLAGVIKYFERTYSLYSA  167

Query  1340  SSRFVRKSIGKSLDS---------------------------VASKELIRAEGKDMTDNI  1242
             S    R S+ +  D                               K++           +
Sbjct  168   SLDQFRDSMLEDPDPGPNYAKLMEEYDSKIEAKIPTEIIIIEEPDKQMPTTARDTQIKKL  227

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              +  E+V++AY    IFKG I+D  F   +  + + +F +++ EDA KV+E+EL+F+Y+ 
Sbjct  228   KDDLEVVQRAYYYFNIFKGLIVDLIFSFKDRNESRKFFHSIDAEDALKVLEVELNFIYEV  287

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFF--HSKLHMKPGDIGVTYCLVG  888
             +FTK + V     +  Y + +  F+   +LV +AL  F   + K    P D+  TY L+ 
Sbjct  288   LFTKAVVVHS---VIGYVFRLLSFIL--VLVALALFRFIVKNKKDTFHPLDVKFTYVLLL  342

Query  887   GAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPV  708
             G+V LD +A +  IFS W +  +             K  K  D+        K  V    
Sbjct  343   GSVSLDTIAFVRAIFSDWTVADLN------------KPGKHPDSC------WKSCVAFFS  384

Query  707   ARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSL---AGRRLKCADDFLEHFL  537
             A K     + L      +  ++  +SWS  +  Y+L+++ +    GR     D  L+   
Sbjct  385   AWK-----VPLFNVKRAIFKLIGLRSWSESVKGYNLVRYCVNRPKGRIGIFMDKVLDFVG  439

Query  536   LKGVIDSCLHTQTAKVEEKLKNLVFEDI  453
             LK   D        +   +L  ++F+++
Sbjct  440   LKDFFDGIFRVSNKRFTSELWEVIFDEL  467



>ref|XP_010065320.1| PREDICTED: uncharacterized protein LOC104452555 [Eucalyptus grandis]
Length=634

 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 102/367 (28%), Positives = 173/367 (47%), Gaps = 41/367 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL--PTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL  + Q+ + + V  Q  IF S  LL  PT +VFL  I K  ER+ +L 
Sbjct  68    LEDSSLWRRHLLGFIFQVGATIYVYVQ--IFPSNHLLAIPTMLVFLAKITKNAERLRALN  125

Query  1346  LASSRFVRKSIGKSLDS--VAS---------------KELIRAEGKDMTDNIMNQYE--I  1224
             L+S   +RKS+  SL S  +A                KEL    G   +D  +   E  +
Sbjct  126   LSSFSRLRKSMLLSLQSKKIAFLTDESLHDDRGDQLIKELNVQRGARYSDEEVKLPESTV  185

Query  1223  VRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMI  1044
             V+ A+   QIF+ FI +  F++++    + +F+N++  DA +V+ +EL+F+Y+ ++TK +
Sbjct  186   VKHAHYFFQIFRVFIGNLIFIYEDRKMSRKYFRNVSAIDALRVISVELNFIYEVLYTKAL  245

Query  1043  AVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQM  864
             A+    G       I+RF+    +V   ++F    K  +   D+  TY L+ G + L+ +
Sbjct  246   AIYSLWG------YIFRFIAFTSIVLAFVVFNRLKKHGLSKLDVESTYSLLFGGIALEVI  299

Query  863   ALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKI  684
             AL  L+FS W +  I+     +        K    T     L++ + V   V R +    
Sbjct  300   ALFMLVFSDWTIAGIKRYNTRSSKLDSFLHKLVSTTD---DLRKPRFVMGGVVRNINAAY  356

Query  683   ISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSL--AGRRLKCADDFLEHFLLKGVIDSCL  510
             +        L T    + WS  I   +L   +L  + R++        +F L+  I SCL
Sbjct  357   MV-------LDTPFIFRRWSESIFACNLCSETLKESPRKMYKYHRCSSNFRLREKIISCL  409

Query  509   HTQTAKV  489
             H  + ++
Sbjct  410   HQASKQI  416



>ref|XP_010441713.1| PREDICTED: uncharacterized protein LOC104724853 isoform X4 [Camelina 
sativa]
Length=882

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 128/266 (48%), Gaps = 40/266 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q  +  + W  P  +VF  G++K VER LSL LA
Sbjct  111   LEDNELWLRHLLGLFFQSVATVYVFLQ-SLPNALWK-PIVLVFSAGVIKYVERTLSLYLA  168

Query  1340  S------SRFVRKSIG----KSLDSVASKELIR----------------------AEGKD  1257
             S      S   R   G    K ++  A+K+ ++                      A  + 
Sbjct  169   SLDKFKDSMIQRPDPGPNYAKLMEEYAAKKDMKMPTQIIKIGEPEKDPKPEKDPKATAQV  228

Query  1256  MTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELS  1077
                  +    I++ AY+   IFKG ++D  F   E  + K +F +L+ ++A +++E+EL+
Sbjct  229   RPPRELTPLNILQYAYKYFNIFKGLVVDLIFTFQERAESKRFFSSLDADEALRILEVELN  288

Query  1076  FMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYC  897
             F+Y+A++TK   +  W G       ++RF+    L+    IF + +K      D+G+TY 
Sbjct  289   FIYEALYTKAEILHNWIGF------LFRFIALGCLIAALRIFQYKNKKDYSEFDVGLTYA  342

Query  896   LVGGAVLLDQMALIHLIFSHWAMVKI  819
             L+ G + LD +ALI    S W  V++
Sbjct  343   LLVGGIALDCIALIMFCASDWTFVRL  368



>ref|XP_007040801.1| Uncharacterized protein TCM_016663 [Theobroma cacao]
 gb|EOY25302.1| Uncharacterized protein TCM_016663 [Theobroma cacao]
Length=778

 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 154/342 (45%), Gaps = 52/342 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + L V  Q  I    W+  T ++F+ G +K VER  +L LA
Sbjct  110   LEDNELWLRHLLGLGFQAVATLYVFVQ-SIPNKLWI-STTLMFVAGTIKYVERTRALYLA  167

Query  1340  SSRFVRKSIGKSLD---------------------------SVASKELIRAEGKDMTDNI  1242
             S    R S+ K  D                           S   KE  RA    +    
Sbjct  168   SLDRFRDSMLKEADPGPNYAKLMEEYAFKRENKLPAQIIMVSEPDKE-ARATDVPVKKGW  226

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
             +N  E+V  AY+   IFKG ++D  F   E  + +++FK    +DA +V+E+EL+F+Y+ 
Sbjct  227   LNDLEVVHYAYKYFLIFKGLVVDLIFSFRERNESREFFKEREADDALRVIEVELNFIYEV  286

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVC-NALLVTVALIFFFHSKLHMKPGDIGVTYCLVGG  885
             ++TK+  V       S +  I+R +   ++L  + L  F   +      D+G+TY L+ G
Sbjct  287   LYTKVEVVH------SIWGYIFRGIAFGSVLAALGLFHFKTDRHEFNEFDVGITYTLLLG  340

Query  884   AVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVA  705
             A+ LD +AL+ LIFS W    I+    ++ +             +A   K    +  P  
Sbjct  341   AIALDVIALLMLIFSDWTSATIKDPDSNSGI-------------IAMIFKGFLWLKRPRW  387

Query  704   RKLKQKIIS--LIYYGHKLITVVNSKSWSGEIIQYSLLKHSL  585
             R+   K  +  L    + L T +  + WSG +  Y+L+ + L
Sbjct  388   RRHPCKTANPKLETTHYVLATPIVVRRWSGSLSSYNLVSYCL  429



>ref|XP_010065323.1| PREDICTED: uncharacterized protein LOC104452565 [Eucalyptus grandis]
Length=356

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 132/254 (52%), Gaps = 21/254 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW RH+L+ + Q+   + V  Q        ++PT +VFL G+ K VER+ +L L+
Sbjct  107   LEDSSLWRRHMLSLIFQVGVAIYVFVQIFPINKSQVIPTMLVFLAGVTKNVERLQALNLS  166

Query  1340  SSRFVRKS------IGKSLDSVASKELIRAEGKDMTDNIMNQYE-------IVRKAYECH  1200
             S   +R+S      +GK++ S  + + +  E   + D   +  E       +V+ AY   
Sbjct  167   SFPRLRESMLSGIRLGKTILSQGADDKLMEEVNALEDGYSDGEEAKLAERTVVKHAYYFF  226

Query  1199  QIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAV-QQWKG  1023
             QIF  FI +  F  +E    + +F  +   DA +V+ +EL+FMY+ ++TK +A+  +W  
Sbjct  227   QIFNVFIGNLIFKREEREMSRKYFCKVYAIDALRVISVELNFMYEVLYTKALAIHSRW--  284

Query  1022  IASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
               SY   I+R +    +V   ++F    K  +   D+ +TY L+ G + +D +AL  L+F
Sbjct  285   --SY---IFRLIDFTSIVLAFILFNRLQKDGLSKLDVEITYSLLFGGIAIDVIALFMLVF  339

Query  842   SHWAMVKIEMETVD  801
             S W +  I   T D
Sbjct  340   SDWTVAGISGITQD  353



>ref|XP_008228196.1| PREDICTED: uncharacterized protein LOC103327633 [Prunus mume]
Length=540

 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 118/472 (25%), Positives = 197/472 (42%), Gaps = 97/472 (21%)
 Frame = -3

Query  1397  VFLVGIVKCVERILSLQLASSRFVRKSI----------GKSLDSVASK------------  1284
             +F+VGI+K  ER   L+ ASS   R+S+           + ++  +SK            
Sbjct  1     MFIVGIIKFGERTWVLRSASSEHFRESMLPHPDPGPNYARYMEEYSSKKAEGFKVELGPP  60

Query  1283  -ELIRAE-----GKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKN  1122
              E  +AE      + + D+ +    I+ KAY   +IFK    D         K + +F+N
Sbjct  61    IEAPKAENNSNDARGILDDSIQNAVILNKAYSFFEIFKRLCADLILSFHNIEKSQTFFQN  120

Query  1121  LNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH  942
              N E AFKV+E+EL FMYD  +T+ + V    G       I R +  +L V+V L F F 
Sbjct  121   RNSEQAFKVIEIELGFMYDVFYTRAVLVHSRLG------GILRCISLSLTVSVFLAFLFK  174

Query  941   SKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTV  762
              K      D+ +TY L+ GA++L+  A++ L+ S W  +++                   
Sbjct  175   EKHAYTGEDVAITYVLLVGAIILELYAVVMLLSSDWTTLQLN------------------  216

Query  761   DTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLA  582
                                 K K  ++ L +     I +V +  WS ++ QY+L+   L 
Sbjct  217   --------------------KHKNGVLKLFHTAVSSIPLVKNNRWSNKLGQYNLITFCLK  256

Query  581   GRRLKCADDFLEH-FLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekE  405
              R  KC   F+E    +  +++   +  +  V E+LKNL+F  +K + K+       ++ 
Sbjct  257   NRPAKCI--FVEKDLFINKLLEKYRYQDSEDVSEELKNLIFTQLKEKSKSASNFDACKQL  314

Query  404   TYHR--QEVMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICY-FTA  234
                R  Q + D    + L                   +E +   +L  H+AT++CY F  
Sbjct  315   CARRGAQVLRDAKCLVRLG-------------WTILGVE-FEQSILLWHIATDLCYNFDV  360

Query  233   DKTKGGDDEAGAKLLCIQISQYLAYLLVLEEKITSAVPGSIG-MRFKDICKD  81
              +          K    Q+S Y+ YLLV+       +P  IG +RF+D C +
Sbjct  361   KRNSNVVPNQNCK-NSKQLSNYMLYLLVM---CPFMLPNGIGQIRFQDTCAE  408



>ref|XP_010068526.1| PREDICTED: uncharacterized protein LOC104455429 [Eucalyptus grandis]
Length=797

 Score =   110 bits (274),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 129/239 (54%), Gaps = 11/239 (5%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             MED+ LW RHLL+ + Q+ S + V  Q        L+PT +VFL G++K VER ++L ++
Sbjct  107   MEDSVLWRRHLLSLVCQVGSGIYVFMQIFPKDKSLLIPTILVFLAGVIKNVERTVALNIS  166

Query  1340  SSRFVRK---SIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDH  1170
             S   +R+   S  +  + VA K     E  ++    +++  +V+ AY   Q+F   + D 
Sbjct  167   SLPKLREWPFSQRQDPNEVAFKFDHVLEYPNLKWVNLDETSVVKHAYYLFQMFMVLLGDI  226

Query  1169  SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
              F   E    + +F  ++  DA +V+ +EL F+Y+ + TK +A+   + I SY   I+RF
Sbjct  227   MFTLHERQVSRKYFNKISAMDALRVISVELQFIYEVLHTKTLAI---RSIWSY---IFRF  280

Query  989   VCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
             +     V  A + F H K H  P  D+ +TY L+ G +  D +AL+ L+FS W +V I+
Sbjct  281   IAFT-NVAAAFVLFNHLKRHQLPDLDVEITYSLLFGGIAFDVIALLMLVFSDWTIVGIK  338



>ref|XP_010251680.1| PREDICTED: uncharacterized protein LOC104593502 [Nelumbo nucifera]
Length=710

 Score =   108 bits (271),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 105/488 (22%), Positives = 207/488 (42%), Gaps = 93/488 (19%)
 Frame = -3

Query  1412  LPTGIVFLVGIVKCVERILSLQLASSRFVRKSI----------GKSLDSVASK-------  1284
             +P   +F+ GI+K VER  SL LAS    R+S+           K ++   SK       
Sbjct  150   IPAIPMFIAGIIKYVERTWSLMLASRENFRESMVTEPDPGPNYAKFMEEFTSKKNAGLNA  209

Query  1283  ----------ELIRAEGKDMTDN-----IMNQYEIVRKAYECHQIFKGFIIDHSFLHDEC  1149
                       +L+  +  +  DN     +    E++  AY   + FK  I+D      + 
Sbjct  210   EIIWEREPDIQLLNFQDDNSHDNGNKKDVEVDVELLSDAYRFFKTFKRLIVDLILTFHDR  269

Query  1148  GKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLV  969
              + + +F       A+KV+E+EL ++YD ++TK   +   +G      CI R    + ++
Sbjct  270   NESQSYFLKQTWSRAYKVIEVELGYLYDVLYTKAAVIHTLQG------CILRMFSLSSIL  323

Query  968   TVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVA  789
             +  LIF F  K      DI +TY L+GGA+ L+  +LI L+ S W +V ++  +      
Sbjct  324   SAFLIFPFMEKHWFSKIDIAITYVLLGGAIALEIWSLIRLLLSDWTIVWMKQHS------  377

Query  788   RKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQ  609
             + L       + + RK  + +                                WS  + Q
Sbjct  378   KSLSDFLLNASSIYRKPDRSR--------------------------------WSNSMAQ  405

Query  608   YSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekake  429
             Y+L+ + L   +       L+   ++ ++D   +    +V + LK  +F+D+ R+  +  
Sbjct  406   YNLINYCLREEKHPILKTILKFIKIEDMVDKYWYRTYIEVTDDLKRFIFDDLNRKLHSIS  465

Query  428   aaaepekETYHRQEVMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEI  249
             + +     T   +  ++++ ++   P      + ++  S++ + +     +L  H+AT+I
Sbjct  466   STSYKHFSTCRGESALEEVNQL---PNYDRVFAKELNRSIEVEFDES---ILRWHIATDI  519

Query  248   CYFTADKTKGGDDEAGA---------KLLCIQISQYLAYLLVLEEKITSAVPGSIGMRFK  96
             C++  ++++   +E  +         K +C ++S Y+ YLL+    + +A  G I  RF 
Sbjct  520   CFYLDEESRNSHEETNSPSAKIIGNKKKMCREVSNYMLYLLISRPFMLTAGIGQI--RFG  577

Query  95    DICKDQIK  72
             D C +  K
Sbjct  578   DTCAEAKK  585



>ref|XP_010039366.1| PREDICTED: uncharacterized protein LOC104428060 [Eucalyptus grandis]
Length=610

 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/252 (29%), Positives = 136/252 (54%), Gaps = 18/252 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL+ + Q+ + + V  Q  IF S+    +PT +VF  G++K VER+ +L 
Sbjct  54    LEDSSLWRRHLLSLIFQVSAAIYVFGQ--IFPSDKSLAIPTMLVFFTGVIKNVERLSALY  111

Query  1346  LASSRFVRKSIGKSLDSVASK-----ELIRAEGKDMTDN---IMNQYEIVRKAYECHQIF  1191
             L+S   +R+ +    +S   K     E +  +G + ++     + +  +V+ AY  HQIF
Sbjct  112   LSSLPTLREKMILQYNSTVDKDNELIEELNVQGDEYSNEEKAKLAESIVVKHAYYYHQIF  171

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             K F+ +      E    ++ F+ ++  DA +++ ++L F+Y+ ++TK +A+   K   SY
Sbjct  172   KFFLGELIVPDGERKMTRECFQKVSAMDALRIISVQLQFIYEVLYTKALAIHSKK---SY  228

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                I+RF+    +V   ++F   +K      D+ +T+ L+ G + LD + +  LIFS W 
Sbjct  229   ---IFRFIAFTNVVLALVLFNCLNKHRFTKLDVEITHMLLFGGIALDVIGVFKLIFSDWT  285

Query  830   MVKIEMETVDTP  795
             + KI+     +P
Sbjct  286   VAKIKWHKTGSP  297



>ref|XP_006437480.1| hypothetical protein CICLE_v10030709mg [Citrus clementina]
 gb|ESR50720.1| hypothetical protein CICLE_v10030709mg [Citrus clementina]
Length=831

 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/350 (24%), Positives = 157/350 (45%), Gaps = 51/350 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q  S + V +   + +++ L+P+ ++F+ G++K  ER  +L L 
Sbjct  112   LEDNELWLRHSLGLITQAASAVYV-FLLSLPKNKVLVPSILMFVAGVIKYFERSRALYLG  170

Query  1340  SSRFVRKSI----------GKSLDSVASKELIRAEGKDMT-------------DNIMNQY  1230
             S    R+S+           K ++   SK   +   + +T                +   
Sbjct  171   SVDRFRESMLSDADPGPNYAKLMEEYESKIKAQLPARIITIPEAEKKLKVELKKRALTNL  230

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             ++V  A+    IFKG ++D  +   E    +++F+ L+ ED+ K++E+EL+F+Y+  +TK
Sbjct  231   DVVHYAHHYFSIFKGLLVDIIYSFRERDDSRNFFRTLHAEDSLKIIEVELNFIYEVFYTK  290

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLL  873
             +     W G+      I+R   +  +      F+F  K H   G D+G+TY L  GA+ L
Sbjct  291   VNVTHSWWGV------IFRLTASGSVAAALCYFYFRVKKHEYEGFDVGITYTLFWGAIAL  344

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKT-----------VDTPVARKLKQKK  726
             D +A    IFS W +  +  +       R +K  K+             +P  +    ++
Sbjct  345   DVVAFFMFIFSDWTLAALTRDRDSNSGFRIIKMVKSFFAKILQLFLYFKSPWWQDYHWEE  404

Query  725   TVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR  576
              V      KLK ++++         T    + WSG +  ++L++  L  R
Sbjct  405   KVTDKSNVKLKHQLLA---------TPTLFRRWSGYVSGHNLIRFCLRRR  445



>ref|XP_010529242.1| PREDICTED: uncharacterized protein LOC104806182 [Tarenaya hassleriana]
Length=832

 Score =   107 bits (268),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 93/329 (28%), Positives = 153/329 (47%), Gaps = 48/329 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL   + Q I +V V+L       +  LLPT ++ + G++K  ER +SL  
Sbjct  117   LEDNELWLRHLFGLICQAIATVYVILLSTP---NTLLLPTILMLVSGLIKYFERTISLYS  173

Query  1343  AS------------------SRFVRKSIGKSLDSVASKELIRAEGKDMTDNI-------M  1239
             AS                  ++ + +   K    + +K  +    KD   ++       +
Sbjct  174   ASLEKFKDLMLQEPNPGPNYAKLMEEYEAKKDMRIPTKVEMGEADKDQKADVPVRPNKEL  233

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                E+V+ AY+   IFKG ++D  F   +  + K +F +L  E+A +++E+ELSF+YDA+
Sbjct  234   THLEVVQYAYKYFNIFKGLVVDLFFSFQQRDESKKFFDSLTPEEALRILEVELSFIYDAL  293

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             FTK   +    G       ++RFV    LV+  +IF    K   +  DIG+TY L+ G +
Sbjct  294   FTKAKILHTGAG------ELFRFVSLGSLVSSLVIFMVKKKDAYEGFDIGLTYALLVGGI  347

Query  878   LLDQMALIHLIFSHWAMVKI-----EMETVDTPV----ARKLKQKKTVDTPVARKLKQKK  726
              LD +A++    S W   ++     E++  DT +     R L  ++    P     K K+
Sbjct  348   ALDSIAILMFCLSDWTFARLSKLKEELDQKDTLIDEFLNRLLSFRRLNWRPYPCFNKNKE  407

Query  725   TVDTPVARKLKQKII----SLIYYGHKLI  651
              V+      L +K I    S   YG+ LI
Sbjct  408   NVEQVEHHVLDRKFIFRRWSEYVYGYNLI  436



>emb|CAE04180.2| OSJNBa0029C04.11 [Oryza sativa Japonica Group]
Length=682

 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 99/324 (31%), Positives = 155/324 (48%), Gaps = 46/324 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL---PTGIVFLVGIVKCVERILSL  1350
             +EDN LW RH L  + Q+     V+Y++ I + E  +    TG++  VG+VK  ER  +L
Sbjct  94    LEDNKLWLRHALNLIFQVIGACYVVYKHIIVRREATILRVATGLISAVGVVKYCERTWAL  153

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEG---KDMTDNIMNQYEIVRKAYECHQIFKGFI  1179
                 S F   SIG SL+ +   +L   +G    +  +N  N++ ++++A+    I K  I
Sbjct  154   Y--RSNF--SSIGSSLEELQGNQLHWYQGYLHNEDHNNTNNEF-LLQRAHSLFHICKRGI  208

Query  1178  IDHSFLHD----ECGKEKDWFKNLNVEDA--FKVMEMELSFMYDAMFTKMIAVQQWKGIA  1017
             +D     D    E    K+   NL+ E    +KVMEMELS MYD ++TK   V  W G  
Sbjct  209   VDSVINEDTENAEAETTKEIINNLSEEPQRMYKVMEMELSLMYDILYTKAAVVHTWIG--  266

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCLVGGAVLLDQMALIHL  849
                +CI R +    + T  L+F+F     +K G    D  VTY L+GGA+L++  +L+  
Sbjct  267   ---YCI-RALSPFAIATSFLLFYFCGS-EVKDGQNGVDTAVTYVLLGGALLMETTSLLSA  321

Query  848   IFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIY  669
             + S W        T+    AR+    + V   V R  + ++ V     RK    +   + 
Sbjct  322   LGSSW--------TLSFLCARRWSWLQHVALCVGRWYQLRRAV--LAVRKRVAALTGGLL  371

Query  668   YGHKLITVVNSKSWSGEIIQYSLL  597
              G        S++WSG I Q++LL
Sbjct  372   GG--------SRNWSGTIGQFNLL  387



>ref|XP_002863469.1| hypothetical protein ARALYDRAFT_494429 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39728.1| hypothetical protein ARALYDRAFT_494429 [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/278 (28%), Positives = 130/278 (47%), Gaps = 39/278 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL + + Q + +V V+L       +  L PT I+F+ G++K VER  +L  
Sbjct  111   LEDNELWDRHLFSLLCQGVATVYVILLS---IPNRLLTPTLIMFVGGVIKYVERTAALFS  167

Query  1343  AS-SRF----------------------VRKSIGKSLDSVASKELIRAEGKDM-TDNIMN  1236
             AS  +F                       +K++    D V   E  R     +  DN + 
Sbjct  168   ASLGKFKDSMLHDPDPGANYAKLMKEYEAKKNMNMPTDVVKDPEKGREGNTPIRPDNTLT  227

Query  1235  QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
               ++++ AY+   IFKG I+D  F + +  + + +F  L  E+A +++E+EL  +YD +F
Sbjct  228   ALQVIQYAYKYFNIFKGLIVDLIFTNQQRDESRKFFDKLTAEEALRIIEVELGLIYDCLF  287

Query  1055  TKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVL  876
             TK   +  W G       ++RF+    LV    +F  + K      D+ +TY L+   + 
Sbjct  288   TKAEILHNWTG------AVFRFIALGCLVASLCLFKMNKKDQYDGFDVVLTYALLICGIA  341

Query  875   LDQMALIHLIFSHWAMVKI-----EMETVDTPVARKLK  777
             LD +AL+    S W + ++     ++E  DT   R L 
Sbjct  342   LDSIALLMFCVSDWTIARLRKLKEDLEEKDTRTDRVLN  379



>ref|XP_010063749.1| PREDICTED: uncharacterized protein LOC104450757 [Eucalyptus grandis]
Length=673

 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 130/246 (53%), Gaps = 19/246 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL     Q+ + + V  Q        + PT +VFL G++K VERIL+L L+
Sbjct  54    LEDNTLWRRHLFNLTFQVGTAIHVFVQIIPNNKSLVFPTMLVFLAGVIKNVERILALNLS  113

Query  1340  S-SRFVRKSIGK--SLDSVASK------ELIRAEGKDMTDNIMNQYEIVRKAYECHQIFK  1188
             +  RF    + +  SLD   +       +L+    +   D  + +  +V+ AY   QI K
Sbjct  114   NLPRFKEWVLSQQESLDDTGNDSIVEFIDLLDGYSRGEEDAKLAESTVVKHAYYFFQISK  173

Query  1187  GFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK-MIAVQQWKGIASY  1011
              F+ D  F   +    +++F+ ++  DA +V+ +EL F+Y+ + TK ++   +W    SY
Sbjct  174   VFLTDLIFTRRQRLISQEYFRAISAIDALRVISVELHFIYEVLHTKALVKRTKW----SY  229

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                I+RFV    +V +AL+ F   K H  P  D+ +TY L+ G + LD ++++ L+FS W
Sbjct  230   ---IFRFVAFTNVV-MALVLFNRLKEHQLPKLDVKITYILLFGGIALDVISVLMLVFSDW  285

Query  833   AMVKIE  816
              +  ++
Sbjct  286   TVAGVK  291



>gb|EMT20379.1| hypothetical protein F775_22833 [Aegilops tauschii]
Length=738

 Score =   107 bits (266),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 98/364 (27%), Positives = 167/364 (46%), Gaps = 65/364 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLLT  VQ   V  VLY++   +   ++   ++F+VG +K +ER  +L+ A
Sbjct  197   LEDNQLWPRHLLTLGVQTVGVCYVLYKHMTHEPAMVVAASLMFIVGFLKYLERTWALKRA  256

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             +   +R SI     +  S++ +    KD T +I ++ E++  A+         + D+S  
Sbjct  257   TLDNIRSSI----KAQPSRD-VPVGSKDSTRDI-DEEELLLFAHHVLPTCMAALTDYS--  308

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
              ++ GK  + +K  ++    KV+E+ELS MYD ++TK   +  W G   YF    R +  
Sbjct  309   -EDSGKVSENWKGQHIG---KVVELELSLMYDILYTKATMIHHWYG---YF---LRVISP  358

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
                +   L+F F+ K      D+ +TY L GGA+LLD ++L+   FS W        T D
Sbjct  359   LATIVAFLLFHFYGKQGQSKIDVIITYILFGGALLLDMVSLVKAAFSTW--------TCD  410

Query  800   TPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSG  621
                   L  K      + ++L+  + +    A +                  + S+ WSG
Sbjct  411   L-----LDNKGGWGATLCKRLQSSRRLVKAAACR-----------------PICSRGWSG  448

Query  620   EIIQYSLLK---HSLAGRRLKC-----ADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLV  465
              I QY+L       +A R ++       DD+ + +  KG         T  ++  +K L+
Sbjct  449   SIGQYNLFDVCCRDMAKRSIRVLKKIKLDDWWKRYQYKG---------TLVIQSDVKKLL  499

Query  464   FEDI  453
             F+ I
Sbjct  500   FQRI  503



>ref|XP_010064817.1| PREDICTED: uncharacterized protein LOC104451970 [Eucalyptus grandis]
Length=760

 Score =   107 bits (266),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 136/257 (53%), Gaps = 28/257 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW RH+L+ + Q+ + + V     +     ++PT +VFL  ++K VER LSL L+
Sbjct  168   LEDSSLWLRHMLSLIFQVVTAIYVFVHIYLSDKSLVIPTMLVFLAAVIKNVERTLSLNLS  227

Query  1340  SSRFVRKSI------GKSLD---------SVASKELIRAEGKDMTDNIMNQYE--IVRKA  1212
             S + +RKS+      G+ +D             KEL  A G +  +      E  +V+ A
Sbjct  228   SLKRLRKSMLTFNTDGEVVDFPIHGYEAYDGLVKEL-NALGHEYPNKEAKLPETIVVKHA  286

Query  1211  YECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAV-Q  1035
             +   QIFK  I D  F  D+    +++F  ++  DA +V+ +EL F+Y+ + TK + +  
Sbjct  287   HSFFQIFKVIIGDLMFKRDQRDISREYFNKISAVDALRVISVELHFIYEVLHTKALVIHS  346

Query  1034  QWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMAL  858
             +W    SY   I+RF+  +  + +AL+ F   K H  P   + +TY L+ G + LD +AL
Sbjct  347   KW----SY---IFRFIAFS-NIAIALVLFNRLKKHQLPELTVEITYILLFGGIALDVIAL  398

Query  857   IHLIFSHWAMVKIEMET  807
             + LIFS W +   E ++
Sbjct  399   LMLIFSDWTVAGKEQDS  415



>gb|EEE60448.1| hypothetical protein OsJ_13680 [Oryza sativa Japonica Group]
Length=809

 Score =   107 bits (266),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 99/324 (31%), Positives = 155/324 (48%), Gaps = 46/324 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL---PTGIVFLVGIVKCVERILSL  1350
             +EDN LW RH L  + Q+     V+Y++ I + E  +    TG++  VG+VK  ER  +L
Sbjct  118   LEDNKLWLRHALNLIFQVIGACYVVYKHIIVRREATILRVATGLISAVGVVKYCERTWAL  177

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEG---KDMTDNIMNQYEIVRKAYECHQIFKGFI  1179
                 S F   SIG SL+ +   +L   +G    +  +N  N++ ++++A+    I K  I
Sbjct  178   Y--RSNF--SSIGSSLEELQGNQLHWYQGYLHNEDHNNTNNEF-LLQRAHSLFHICKRGI  232

Query  1178  IDHSFLHD----ECGKEKDWFKNLNVEDA--FKVMEMELSFMYDAMFTKMIAVQQWKGIA  1017
             +D     D    E    K+   NL+ E    +KVMEMELS MYD ++TK   V  W G  
Sbjct  233   VDSVINEDTENAEAETTKEIINNLSEEPQRMYKVMEMELSLMYDILYTKAAVVHTWIG--  290

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCLVGGAVLLDQMALIHL  849
                +CI R +    + T  L+F+F     +K G    D  VTY L+GGA+L++  +L+  
Sbjct  291   ---YCI-RALSPFAIATSFLLFYFCGS-EVKDGQNGVDTAVTYVLLGGALLMETTSLLSA  345

Query  848   IFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIY  669
             + S W        T+    AR+    + V   V R  + ++ V     RK    +   + 
Sbjct  346   LGSSW--------TLSFLCARRWSWLQHVALCVGRWYQLRRAV--LAVRKRVAALTGGLL  395

Query  668   YGHKLITVVNSKSWSGEIIQYSLL  597
              G        S++WSG I Q++LL
Sbjct  396   GG--------SRNWSGTIGQFNLL  411



>emb|CDY39431.1| BnaAnng05620D [Brassica napus]
Length=699

 Score =   106 bits (264),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 117/498 (23%), Positives = 217/498 (44%), Gaps = 43/498 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   + Q  + +  + Q     +    P  ++F+  ++K  ER  +L  A
Sbjct  110   LEDNALWARHLFGLVSQALAGVYAVVQS--MDNPLWPPIALLFITAVIKYTERTRALYTA  167

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             S    +  + K  D+  +   +  E     D+ +   +I    +     FKG ++D  F 
Sbjct  168   SLDKFKDQMRKPADTGPNYAKLMEEYDSRKDSNLPT-DIY--GFRFFNTFKGLVVDLIFS  224

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E  + +D+FK L  EDA +++E EL F+Y++M+TK   +  +KG       ++R +  
Sbjct  225   FRERDESRDFFKELTPEDALRIIESELGFLYESMYTKTAILHTYKG------TVFRVIAF  278

Query  980   ALLVTVALIFFFHSK--LHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMET  807
               L+   L+F F  +  +     D+ +TY L    + L+  +L   + S W M  +  + 
Sbjct  279   GSLLGSFLVFHFRPEKSVDFHGADVVITYTLFIVGIALELSSLAMFLLSDW-MFAVSSKL  337

Query  806   VDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSW  627
              D  V    K K  +D+ +   L  +K   TP+                 L T +  + W
Sbjct  338   NDDQV----KDKSCIDSFLNCLLAFRKPQWTPMDACKTMHACKGNRTREVLSTPLLLRRW  393

Query  626   SGEIIQYSLLKHSLAGR--RLKCADDFLEHF-LLKGVIDSCLHTQTAKVEEKLKNLVFED  456
             SG I  ++ + + L  +  R+    +F+  F ++K  ID      +  +       +F +
Sbjct  394   SGVIYGFNFIGYCLKAKVSRINRRSEFVWEFVVVKSHIDQIRFVSSEPLTRNQWEFIFSE  453

Query  455   IkrrekakeaaaepekETYHRQEVM---DKIKKIHLAPKvvdsssddvvvsvddDIENYA  285
             +K++ +  E     +K +  R E      K+K++    + V +              +Y 
Sbjct  454   LKQKSEFAETPERAKKVSSARGEWALHDSKLKEVERLMRYVANV-------------DYD  500

Query  284   NFVLTLHVATEICYFTADKTKGGDDEAGA----KLLCIQISQYLAYLLVLEEKITSAVPG  117
               +L  H+ATE+C F  +K +  ++ +G     +     IS Y+ YLL+++ K+ S V G
Sbjct  501   QSLLLWHIATELC-FQDEKDEEVENRSGESCDDREFSKIISDYMMYLLIMQPKLMSEVAG  559

Query  116   SIGMRFKDICKDQIKNTF  63
                +RF+D   D+ K  F
Sbjct  560   IGTIRFRDTL-DEAKRFF  576



>gb|AAU44568.1| hypothetical protein AT5G45540 [Arabidopsis thaliana]
Length=702

 Score =   105 bits (263),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 131/279 (47%), Gaps = 41/279 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL + + Q + +V V+L       +  L PT I+F+ G++K VER  +L  
Sbjct  111   LEDNELWDRHLFSLVCQAVATVYVILLS---IPNRLLTPTLIMFVGGVIKYVERTAALFS  167

Query  1343  AS-SRF----------------------VRKSIGKSLDSVASKELIRA-EGKD--MTDNI  1242
             AS  +F                       RK +    D +  K+  +  EG      DN 
Sbjct  168   ASLDKFKDSMLDDPDPGANYAKLMEEYEARKKMNMPTDVIVVKDPEKGREGNTPVRPDNE  227

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
             +   ++++ AY+   IFKG I+D  F + E  + + +F  L  E+A +++E+EL  +YD 
Sbjct  228   LTALQVIQYAYKYFNIFKGLIVDLIFTNQERDESRKFFDKLTAEEALRIIEVELGLIYDC  287

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             +FTK   +  W G       ++RF+    LV    +F  + K      D+ +TY L+   
Sbjct  288   LFTKAEILHNWTG------AVFRFIALGCLVASLCLFKMNKKDQYDGFDVVLTYALLICG  341

Query  881   VLLDQMALIHLIFSHWAMVKI-----EMETVDTPVARKL  780
             + LD +AL+    S W + ++     ++E  DT   R L
Sbjct  342   IALDSIALLMFCVSDWTIARLRKLKEDLEEKDTLTDRVL  380



>gb|KDO53052.1| hypothetical protein CISIN_1g040228mg [Citrus sinensis]
Length=831

 Score =   105 bits (263),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 155/350 (44%), Gaps = 51/350 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q  S + V +   +  ++ L+P+ ++F+ G++K  ER  +L L 
Sbjct  112   LEDNELWLRHSLGLITQAASAVYV-FLLSLPNNKVLVPSILMFIAGVIKYFERSRALYLG  170

Query  1340  SSRFVRKSI----------GKSLDSVASKELIRAEGKDMT-------------DNIMNQY  1230
             S    R+S+           K ++   SK   +   + +T                +   
Sbjct  171   SVDRFRESMLSDADPGPNYAKLMEEYESKIKAQLPARIITIPEAEKKLKVELKKRALTNL  230

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             ++V  A+    IFKG ++D  +   E    +++F+ L+ ED+ K++E+EL+F+Y+  +TK
Sbjct  231   DVVHYAHHYFSIFKGLLVDIIYSFRERDDSRNFFRTLHAEDSLKIIEVELNFIYEVFYTK  290

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLL  873
             +     W G+      I+R   +  +      F+F  K     G D+G+TY L  GA+ L
Sbjct  291   VNVTHSWWGV------IFRLTASGSVAAALCYFYFRVKKDEYEGFDVGITYTLFWGAIAL  344

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKT-----------VDTPVARKLKQKK  726
             D +A    IFS W +  +  +       R +K  K+             +P  +    ++
Sbjct  345   DVVAFFMFIFSDWTLAALTRDRDSNSGFRIIKMVKSFFAKILQLFLYFKSPWWQDYHWEE  404

Query  725   TVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR  576
              V      KLK ++++         T    + WSG +  ++L++  L  R
Sbjct  405   NVTDKSNVKLKHQLLA---------TPTLFRRWSGYVSGHNLIRFCLRRR  445



>ref|XP_010034372.1| PREDICTED: uncharacterized protein LOC104423603 [Eucalyptus grandis]
Length=698

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 95/367 (26%), Positives = 172/367 (47%), Gaps = 45/367 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +   V YQ  +  ++ ++PT  VF+ G +K +ER  +L LA
Sbjct  113   LEDNELWGRHLLNLLFQLGTACYVFYQ-SLPSNKLIVPTIFVFIGGTIKYIERTCALYLA  171

Query  1340  SSRFVRKSIGKSL----DSVASKELIRAE-------GKDMTDNIMNQYEIVRKAYECHQI  1194
                 +R S+  SL    DS A  ++I          GK    ++ ++ E+++ A      
Sbjct  172   RFSKLRGSLLPSLGAIRDSDALTDMISEHNIKSQDVGKQHKTDLGDR-EVIKAASFYFTT  230

Query  1193  FKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIAS  1014
             FKG +++   +  +  +   +F++   +DAF+V+E EL+F YD ++TK   V    G   
Sbjct  231   FKGLLVELPLIPIQMNRSWKFFRSTTAKDAFRVIEAELNFFYDVLYTKAAVVHCPTGY--  288

Query  1013  YFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                 ++R +    +VT + +F+   K      DI +TY L+ GAV L+ + L  LI S  
Sbjct  289   ----LFRAISVGSIVTASALFYVLDKRGFHEYDIKITYTLLLGAVGLEFVVLSMLICSDR  344

Query  833   AMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKL  654
                K+         ++K  +         + L + K+  +P A                 
Sbjct  345   TFAKVG-------TSQKHFRSLFTGCIFIKFLHKFKSESSPFA-----------------  380

Query  653   ITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLK  474
             + +++++ WS  I QY+L+   L+ R  K  +  L+   L+ ++D     +     EKL 
Sbjct  381   LHILHAR-WSRSIFQYNLIDSRLS-RWPKWIEKLLDLISLRELLDDLKPGRRVPYTEKLG  438

Query  473   NLVFEDI  453
              L+F+++
Sbjct  439   ELIFDEL  445



>gb|KFK23934.1| hypothetical protein AALP_AAs69373U000100, partial [Arabis alpina]
Length=458

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 130/262 (50%), Gaps = 38/262 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDNNLW R L      +C  ++ LY + +   +  L+PT ++ + GI+K VERI +L+ 
Sbjct  107   LEDNNLWLRSLFGL---VCQAIITLYIFLLSIPNNLLVPTSLMLVAGIIKYVERIQALRG  163

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEG----------------KDMTDNI  1242
             AS    + S+           + ++  ++++++R                   K   D +
Sbjct  164   ASLETFKDSMLGEPDPGPDYARIMEECSARKMLRERTEVVRIEEAEKGQRPKVKVRPDTV  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLH--DECGKEKDWFKNLNVEDAFKVMEMELSFMY  1068
             +   E+V+ AY+   IFKG ++D  F    ++    K++F +L+ E+A +V+E+ELSF+Y
Sbjct  224   LTHLEVVQYAYKYFNIFKGLVVDLIFSSQSEQWNNSKEFFLSLDAEEALRVLEVELSFIY  283

Query  1067  DAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVG  888
                FTK+  +    G A      +RF+  A LV+   IF    K      D+G+TY L+ 
Sbjct  284   GTFFTKVDILHTRIGFA------FRFIALASLVSSLCIFTKAKKHDYNRFDVGLTYALLI  337

Query  887   GAVLLDQMALIHLIFSHWAMVK  822
             G + L+ +A I    S W + +
Sbjct  338   GGIALEIVAFIIFCVSDWIVAR  359



>ref|NP_199367.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09182.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95266.1| uncharacterized protein AT5G45540 [Arabidopsis thaliana]
Length=803

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 131/280 (47%), Gaps = 41/280 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL + + Q + +V V+L       +  L PT I+F+ G++K VER  +L  
Sbjct  111   LEDNELWDRHLFSLVCQAVATVYVILLS---IPNRLLTPTLIMFVGGVIKYVERTAALFS  167

Query  1343  AS-SRF----------------------VRKSIGKSLDSVASKELIRA-EGKD--MTDNI  1242
             AS  +F                       RK +    D +  K+  +  EG      DN 
Sbjct  168   ASLDKFKDSMLDDPDPGANYAKLMEEYEARKKMNMPTDVIVVKDPEKGREGNTPVRPDNE  227

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
             +   ++++ AY+   IFKG I+D  F + E  + + +F  L  E+A +++E+EL  +YD 
Sbjct  228   LTALQVIQYAYKYFNIFKGLIVDLIFTNQERDESRKFFDKLTAEEALRIIEVELGLIYDC  287

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             +FTK   +  W G       ++RF+    LV    +F  + K      D+ +TY L+   
Sbjct  288   LFTKAEILHNWTG------AVFRFIALGCLVASLCLFKMNKKDQYDGFDVVLTYALLICG  341

Query  881   VLLDQMALIHLIFSHWAMVKI-----EMETVDTPVARKLK  777
             + LD +AL+    S W + ++     ++E  DT   R L 
Sbjct  342   IALDSIALLMFCVSDWTIARLRKLKEDLEEKDTLTDRVLN  381



>emb|CDY39432.1| BnaAnng05630D [Brassica napus]
Length=709

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 108/466 (23%), Positives = 211/466 (45%), Gaps = 59/466 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL + + Q + +V V+L       +  L PT I+   G++K VER  +L  
Sbjct  109   LEDNELWNRHLFSLVCQAVATVYVILLSTP---NRLLTPTVIMLFGGVIKYVERTSALFS  165

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMN---------QYEIVRKAYECHQIF  1191
             AS    + S+ +  D  A+   +  E  +  D  M          +  +V+ A++   IF
Sbjct  166   ASLDKFKDSMLEDPDPGANYAKLMEEYANKRDMNMPTEVIVVEDPEKGLVQYAFKYFTIF  225

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             KG I+D  F + +  + + +F +LN E+A +++E+ELS +Y+++FTK   +  W G    
Sbjct  226   KGLIVDLIFTNKQRDESRKFFDSLNPEEALRIIEVELSLIYESLFTKAEILHNWTG----  281

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                ++R +  A LV+   +F   ++   +  D+ +TY L+   + LD +AL+    S W+
Sbjct  282   --AVFRVIALACLVSSLCLFSLKNEAEYEGFDVALTYALLICGIALDSIALLMFCVSDWS  339

Query  830   MVKIEMETVDTPVARKLKQKKTVDTPVA------------RKLKQKKTV-----DTPVAR  702
             + ++          R LK+      P A            R L+ K+++        + R
Sbjct  340   IARL----------RNLKEDLDEKDPWAWVDRVLNWILGFRTLRWKRSICFMDGHDVLDR  389

Query  701   KLKQKIISLIYYGHKLITV---VNSKSW--SGEIIQYSLLKHSLAGRRLKCADDFLEHFL  537
                 +  S   + + LI     +  K +  +  +I  +LL+H L GR +      LE F 
Sbjct  390   NFMFRRWSEYVHAYNLIGYCLKIRPKRFHPTKGMIHITLLRHQL-GRLISSV---LEFFG  445

Query  536   LKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHL  357
             L  +++    T + ++  +L   +F+ ++ + +  E     +  +  R +       +  
Sbjct  446   LTELVEEIRFTTSDRLTRELWEFIFKQVQHKHRFAEDPESAKSISSARGD----WTLVET  501

Query  356   APKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKG  219
             + K  +   D   +      ++Y   +L  H+ATE+ Y + ++ +G
Sbjct  502   SSKTTEGGPDHAKLLRYVTEKDYDQSILMWHIATELLYQSPEEKEG  547



>ref|XP_010068534.1| PREDICTED: uncharacterized protein LOC104455442 [Eucalyptus grandis]
Length=735

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 135/286 (47%), Gaps = 21/286 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             MED+ LW RHLL  + QI + + V  Q        +LPT +VFL G++K  ERIL+L  +
Sbjct  107   MEDSLLWQRHLLNLIFQISATIYVFAQIFPTNKSLVLPTMLVFLAGVIKNAERILALYFS  166

Query  1340  SSRFVRK--------SIGKSLDSVASKELIRAEGKDMTDNIMNQY----EIVRKAYECH-  1200
             S   +R+        S G S    A K L++     +  N   +      IV K  +C  
Sbjct  167   SLPKLREWALSQTSSSKGTSSSKGAYKNLVQEVNVQLGGNSNKEATLAESIVVKHADCFL  226

Query  1199  QIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
             QI K F+ D  F   E    +++F  ++  DA +V+ +EL F+Y+ + TK  A+    G 
Sbjct  227   QILKVFLADFIFQRQEREISREYFCKVSAMDALRVISVELHFIYEVLHTKAFAIHSNWGY  286

Query  1019  ASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
                   I+R +    +V +A + F   K H +K  D+ +TY L+ G + LD +AL  L+F
Sbjct  287   ------IFRLIAFTNVV-IAFVLFNRVKKHRLKEPDVEITYLLLFGGIALDAIALFMLVF  339

Query  842   SHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVA  705
             S W +VKI+     +     L  K    T   RK +       P A
Sbjct  340   SDWMVVKIKSCNTRSSKLDSLLHKLVSTTDYLRKPRFAPCEAKPNA  385



>ref|XP_010067369.1| PREDICTED: uncharacterized protein LOC104454266 [Eucalyptus grandis]
Length=662

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 129/252 (51%), Gaps = 20/252 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW RHL + + Q+ + + +  Q        ++PT +VFL  ++K VERIL L L+
Sbjct  54    LEDSSLWRRHLFSLIFQVSAAIYIFVQIFPSNKSLVIPTMLVFLAAVIKNVERILVLNLS  113

Query  1340  S-SRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE-------IVRKAYECHQIFKG  1185
             S  RF  +       S  SK  +  E   + D      E       +V+ A     IF  
Sbjct  114   SLPRFRVRVFSHHKHSKNSKIRLVEELNVLGDRYPEGEEAKLAESIVVKHARHFLNIFDI  173

Query  1184  FIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFW  1005
             F+ID  +  +E    +++F+ ++  DA +V+ +EL+F Y+ ++TK + V   +   SY  
Sbjct  174   FLIDLIYSSEERMMSREYFRKVSAMDALRVISVELNFFYEMLYTKALTVHSKR---SY--  228

Query  1004  CIWRFVCNALLVTVALIFFFHSKL--HMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
              I+R +     + VA+ F   ++L  H  P  D+ +TY L+ G + LD +AL+ L+FS W
Sbjct  229   -IFRSIA---FINVAITFILFNRLNKHQLPNLDMKITYSLLFGGIALDVIALLMLVFSDW  284

Query  833   AMVKIEMETVDT  798
              +  I+ +   +
Sbjct  285   TIAGIKWDNTTS  296



>ref|XP_007216290.1| hypothetical protein PRUPE_ppa020495mg [Prunus persica]
 gb|EMJ17489.1| hypothetical protein PRUPE_ppa020495mg [Prunus persica]
Length=644

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 124/513 (24%), Positives = 208/513 (41%), Gaps = 103/513 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+     V ++ +  +    L   + F+VGI+K  ER   L+ +
Sbjct  109   LEDNELWLRHLLGLVAQVLVAFYVCFRARSSKVLNFLAIPM-FIVGIIKFGERTWVLRAS  167

Query  1340  SSRFVRKSIGKSLDS--------------------VASKELIRA----EGKDMTDNIMNQ  1233
             SS   R+S+ K+ D                     V     I A    E   +       
Sbjct  168   SSELFRESMLKNPDPGPNYARYMEEYISKKDEGFRVVPTHFIEASTTAEAFPIPQVTGTT  227

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
                +  +Y   + FK    D      +    + +F+N N E  F+V+E+EL FMYD  FT
Sbjct  228   QPTILTSYNFFKTFKLLCADLILSFHDIVNSQSFFQNTNYEKVFEVIEIELGFMYDLFFT  287

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K + V  W G       I R V  +  V V + F F  K   K  D+ +TY L+ GA++L
Sbjct  288   KAVLVYSWLG------GILRCVSLSFTVAVFVAFLFVEKQAYKGVDVAITYVLLVGAIVL  341

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             +  A+  ++ S W  + +           KL+Q                          K
Sbjct  342   EIHAVAIILSSDWTKLWLS----------KLRQSNH-----------------------K  368

Query  692   QKIISLIYYGHKLIT---VVNSKSWSGEIIQYSLLKHSLAGRRLKC----ADDFLEHFLL  534
               ++ ++ Y HK I+   ++ +  WS  + Q +L+   L  R  KC     D ++   L 
Sbjct  369   SIMVGVVDYLHKAISSIPLIKNDRWSNTVAQCNLITFCLKARPAKCILIHKDLYINQVLE  428

Query  533   KGVIDSCLHTQTAKVE-EKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHL  357
             K         +  KV+ ++LK+L++E ++ R  A                 ++  K++  
Sbjct  429   KH------RYKDLKVDCKELKDLIYEQLQDRASAN----------------LEDCKQL-C  465

Query  356   APKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDDEAGAKLLCIQI  177
             A +V           +   I+ +   ++  H+AT+ICY +    K       + LL    
Sbjct  466   ALRVDKVFEKANCQRLGWTIKEFDQSIILWHIATDICYHSEPNPKSSPSCEASSLL----  521

Query  176   SQYLAYLLVLEEKITSAVPGSIG-MRFKDICKD  81
             S Y+ YLL++       +P  IG +RF+D C +
Sbjct  522   SNYMLYLLLM---CPFMLPDGIGKIRFRDTCAE  551



>ref|XP_010032440.1| PREDICTED: uncharacterized protein LOC104421953 isoform X1 [Eucalyptus 
grandis]
Length=678

 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/244 (30%), Positives = 125/244 (51%), Gaps = 17/244 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +   V YQ  +  ++ ++PT ++F+ G  K +ERI  L +A
Sbjct  110   LEDNELWRRHLLNLLSQLVAAGYVFYQ-SLPSNKLIVPTILMFIGGTTKYIERIRGLYIA  168

Query  1340  S----SRFVRKSIGKSLDSVASKELIRAEGKDMTD------NIMNQYEIVRKAYECHQIF  1191
             S      F+  SI   L+  +S E++     +  D        ++  E+++ A      F
Sbjct  169   SFSKLRDFLLTSIDARLNIRSSMEMMPEPDIESQDVGAEDKTKLDDREVIKAACFYSIYF  228

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
              G ++D  F   E  + +++F+    +DAF+V+E EL++ YD ++TK + V    G  S 
Sbjct  229   IGVLVDLPFNFHERNRSREFFRWRTAKDAFRVIEAELNYFYDVLYTKALVVYYPIGFLS-  287

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                  R +    ++T   +F+  +K      DI +TY L+ GAV L+ +ALI LI S W 
Sbjct  288   -----RTISIGSIITAFALFYVLNKHDFDEYDILITYTLLLGAVGLEFVALIMLICSDWT  342

Query  830   MVKI  819
             +  +
Sbjct  343   IAHL  346



>ref|XP_010040316.1| PREDICTED: uncharacterized protein LOC104429115 [Eucalyptus grandis]
Length=647

 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 134/260 (52%), Gaps = 33/260 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL  + Q+ + + V    +IF S+   ++PT +VFL G +K  ER L+L 
Sbjct  48    LEDSSLWQRHLLNLIFQVGAAIYVY--VRIFPSDKSLVIPTILVFLAGFIKIAERTLALY  105

Query  1346  LASSRFVRKSIGKSLDSVASKELIR----------------AEGKDMTDNIMNQYEIVRK  1215
             L+S   +R+S+    +   + +L +                 EG ++ ++I     +V  
Sbjct  106   LSSFPKLRESMLSDSERKITADLPQLLVEVFVHQDGYGRSNEEGAELAESI-----VVNH  160

Query  1214  AYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ  1035
             AY   QIFK FI+D  +  ++     D+F  ++  DA +V+ +EL+F+Y+ + TK + ++
Sbjct  161   AYLFFQIFKVFIVDLIYTKEQRKMSIDYFDKVSAVDALRVISVELNFIYEELHTKALTIR  220

Query  1034  QWKGIASYFWC-IWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMAL  858
                    + W  I+R +    +V    +F    K  +   D+ +TY L+ G +++D +AL
Sbjct  221   -------HKWIYIFRIIAFTSIVVALGLFNRLKKYQLYELDVKITYILLFGGIIIDGIAL  273

Query  857   IHLIFSHWAMVKIEMETVDT  798
               ++FS W   KI+  T  +
Sbjct  274   FIVVFSDWTAAKIKYNTTGS  293



>gb|EEE60550.1| hypothetical protein OsJ_13900 [Oryza sativa Japonica Group]
Length=806

 Score =   103 bits (258),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 122/243 (50%), Gaps = 27/243 (11%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQLA  1341
             EDN LW RHL T +VQ+     VLY+Y   +   ++   + +F+VGI+K  ERI +L+ A
Sbjct  255   EDNRLWLRHLQTLVVQVMGASYVLYKYMPGKETLVMAAAVLIFVVGILKYGERIWALREA  314

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNI------MNQYEIVRKAYECHQIFKGFI  1179
             +   + + + +  D  +++E    EG D+  ++      M++  ++  A+    I +G  
Sbjct  315   TFDNIARCLDQQEDYASARE---REGDDLLQHVLQGRSSMDEENVLIGAHGLLDICRGLF  371

Query  1178  IDHSFLHDECGKEKDWFKNLNVEDAF-----KVMEMELSFMYDAMFTKMIAVQQWKGIAS  1014
             I         G  + + +++ +         K+ME+ELS MYD ++TK   +  W G   
Sbjct  372   IGSR------GGRRGYLRHVLLSFQMYGRLDKLMELELSLMYDILYTKATVIHTWIG---  422

Query  1013  YFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                C  R +  A  VT   +F   SK      D+ VTY L+ GA+LL+ ++++  +FS W
Sbjct  423   ---CCIRVIALAATVTATFLFLLSSKHGHSRKDLAVTYVLLAGALLLEMISMVRAVFSTW  479

Query  833   AMV  825
              +V
Sbjct  480   TVV  482


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 6/92 (7%)
 Frame = -3

Query  1100  KVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKP  921
             K+ME+ELS MYD ++TK   +  W G      C  R +  A  VT   +F   SK     
Sbjct  524   KLMELELSLMYDILYTKATVIHTWIG------CCIRVIALAATVTATFLFLLSSKHGHSR  577

Query  920   GDIGVTYCLVGGAVLLDQMALIHLIFSHWAMV  825
              D+ VTY L+ GA+LL+ ++++  +FS W +V
Sbjct  578   KDLAVTYVLLAGALLLEMISMVRAVFSTWTVV  609



>ref|XP_006484676.1| PREDICTED: uncharacterized protein LOC102625373 [Citrus sinensis]
Length=831

 Score =   103 bits (258),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 83/350 (24%), Positives = 156/350 (45%), Gaps = 51/350 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  + Q  S + V +   + +++ L+P+ ++F+ G++K  ER  +L L 
Sbjct  112   LEDNELWLRHSLGLITQAASAVYV-FLLSLPKNKVLVPSILMFVAGVIKYFERSRALYLG  170

Query  1340  SSRFVRKSI----------GKSLDSVASKELIRAEGKDMT-------------DNIMNQY  1230
             S    R+S+           K ++   SK   +   + +T                +   
Sbjct  171   SVDRFRESMLSDADPGPNYAKLMEEYESKIKAQLPARIITIPEAEKKLKVELKKRALTNL  230

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             ++V  A+    IFKG +++  +   E    +++F+ L+ ED+ K++E+EL+F+Y+  +TK
Sbjct  231   DVVHYAHHYFSIFKGLLVEIIYSFRERDDSRNFFRTLHAEDSLKIIEVELNFIYEVFYTK  290

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLL  873
             +     W G+      I+R   +  +      F+F  K     G D+G+TY L  GA+ L
Sbjct  291   VNVTHSWWGV------IFRLTASGSVAAALCYFYFRVKKDEYEGFDVGITYTLFWGAIAL  344

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKT-----------VDTPVARKLKQKK  726
             D +A    IFS W +  +  +       R +K  K+             +P  +    ++
Sbjct  345   DVVAFFMFIFSDWTLAALTRDRDSNSGFRIIKMVKSFFAKILQLFLYFKSPWWQDYHWEE  404

Query  725   TVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR  576
              V      KLK ++++         T    + WSG +  ++L++  L  R
Sbjct  405   NVTDKSNVKLKHQLLA---------TPTLFRRWSGYVSGHNLIRFCLRRR  445



>gb|EEC76824.1| hypothetical protein OsI_14965 [Oryza sativa Indica Group]
Length=781

 Score =   103 bits (258),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 122/243 (50%), Gaps = 27/243 (11%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQLA  1341
             EDN LW RHL T +VQ+     VLY+Y   +   ++   + +F+VGI+K  ERI +L+ A
Sbjct  257   EDNRLWLRHLQTLVVQVMGASYVLYKYMPGKETLVMAAAVLIFVVGILKYGERIWALREA  316

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNI------MNQYEIVRKAYECHQIFKGFI  1179
             +   + + + +  D  +++E    EG D+  ++      M++  ++  A+    I +G  
Sbjct  317   TFDNIARCLDQQEDYASARE---REGDDLLQHVLQGRSSMDEENVLIGAHGLLDICRGLF  373

Query  1178  IDHSFLHDECGKEKDWFKNLNVEDAF-----KVMEMELSFMYDAMFTKMIAVQQWKGIAS  1014
             I         G  + + +++ +         K+ME+ELS MYD ++TK   +  W G   
Sbjct  374   IGSR------GGRRGYLRHVLLSFQMYGRLDKLMELELSLMYDILYTKATVIHTWIG---  424

Query  1013  YFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                C  R +  A  VT   +F   SK      D+ VTY L+ GA+LL+ ++++  +FS W
Sbjct  425   ---CCIRVIALAATVTATFLFLLSSKHGHSRKDLAVTYVLLAGALLLEMISMVRAVFSTW  481

Query  833   AMV  825
              +V
Sbjct  482   TVV  484



>emb|CAI44657.1| OSJNBa0061C06.7 [Oryza sativa Japonica Group]
Length=612

 Score =   103 bits (256),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 122/243 (50%), Gaps = 27/243 (11%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQLA  1341
             EDN LW RHL T +VQ+     VLY+Y   +   ++   + +F+VGI+K  ERI +L+ A
Sbjct  103   EDNRLWLRHLQTLVVQVMGASYVLYKYMPGKETLVMAAAVLIFVVGILKYGERIWALREA  162

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNI------MNQYEIVRKAYECHQIFKGFI  1179
             +   + + + +  D  +++E    EG D+  ++      M++  ++  A+    I +G  
Sbjct  163   TFDNIARCLDQQEDYASARE---REGDDLLQHVLQGRSSMDEENVLIGAHGLLDICRGLF  219

Query  1178  IDHSFLHDECGKEKDWFKNLNVEDAF-----KVMEMELSFMYDAMFTKMIAVQQWKGIAS  1014
             I         G  + + +++ +         K+ME+ELS MYD ++TK   +  W G   
Sbjct  220   IGSR------GGRRGYLRHVLLSFQMYGRLDKLMELELSLMYDILYTKATVIHTWIG---  270

Query  1013  YFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                C  R +  A  VT   +F   SK      D+ VTY L+ GA+LL+ ++++  +FS W
Sbjct  271   ---CCIRVIALAATVTATFLFLLSSKHGHSRKDLAVTYVLLAGALLLEMISMVRAVFSTW  327

Query  833   AMV  825
              +V
Sbjct  328   TVV  330



>ref|XP_010494665.1| PREDICTED: uncharacterized protein LOC104771784 [Camelina sativa]
Length=792

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 132/263 (50%), Gaps = 39/263 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL   + Q   +V V+L       +  L PT I+ + G++K VER  +L  
Sbjct  111   LEDNELWNRHLFGLVCQAFATVYVILLS---IPNGLLTPTIIMLVGGVIKYVERTAALFS  167

Query  1343  ASSRFVRKSIGKSLDSVAS-----------------KELIRAE-------GKDMT---DN  1245
             AS    ++S+ K  D  A+                  E+I  E       GK +    ++
Sbjct  168   ASLDKFKESLLKDPDPGANYAKLMEEYEAKRNMNMPTEVIMVEDPEEGREGKTLVRPLND  227

Query  1244  IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
             I+   ++V+ AY+   IFKG ++D  F   E  + +++F +L  EDA +++E+EL  +YD
Sbjct  228   ILTPLQVVQYAYKYFNIFKGVLVDLIFTIQERDESREFFDSLTAEDALRIIEVELGLIYD  287

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVG  888
             +MFTK   +    G+      ++RF+    LV  +L FF  +K +   G DI +TY L+ 
Sbjct  288   SMFTKAEILHNKTGV------VFRFIALGCLVA-SLCFFKMTKKNQYDGFDIALTYALLI  340

Query  887   GAVLLDQMALIHLIFSHWAMVKI  819
               + LD +AL+    S W + ++
Sbjct  341   CGIALDSIALLMFCVSDWTIARL  363



>ref|XP_010039369.1| PREDICTED: uncharacterized protein LOC104428065 [Eucalyptus grandis]
Length=416

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 134/249 (54%), Gaps = 20/249 (8%)
 Frame = -3

Query  1514  DNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQLA  1341
             D+N+W RHL++ + Q+ +V+ V    KIF S+   ++PT +VF    +K VER+ +L L+
Sbjct  55    DSNIWTRHLVSFIFQVGAVVYVFG--KIFPSDKSLVIPTILVFFAAFIKNVERLWALYLS  112

Query  1340  SSRFVRKSIGKS----LDSVASKELIRAEGKDMTDN--IMNQYEIVRKAYECHQIFKGFI  1179
             +   +R+ +             +EL  A      D    + +  +V+ A+   QIFK FI
Sbjct  113   NLPRLREWVVWEKHLYFPFPRHEELTYAADVCFNDEEAKLAESTVVKHAHCFFQIFKIFI  172

Query  1178  IDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASYFWC  1002
              D  +  ++      +F  ++  DA +++ +EL F+Y+ + TK +A++ +W    SY   
Sbjct  173   TDFIYTREQRKMSCKYFHRVSAMDALRIISVELQFIYEVLHTKALAIRSKW----SY---  225

Query  1001  IWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMV  825
             I+RF+   + + +A I F   K H  P  D+G+TYCL+ G + LD ++L+ L+FS W + 
Sbjct  226   IFRFIA-FIDIVMACIMFNRLKKHRLPQLDVGITYCLILGGIALDVISLVMLVFSDWTIA  284

Query  824   KIEMETVDT  798
              I+  T  +
Sbjct  285   GIKYTTTGS  293



>ref|XP_002867956.1| hypothetical protein ARALYDRAFT_914755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44215.1| hypothetical protein ARALYDRAFT_914755 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/283 (28%), Positives = 139/283 (49%), Gaps = 48/283 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW R+L   +   C  +  LY + +   +  L+PT ++ + G++K  ERI +++ 
Sbjct  111   LEDNELWLRNLFGLL---CQFIATLYVFLLSIPNSLLVPTSLMLMAGLIKYTERIQAMRR  167

Query  1343  AS-SRFVRKSIGKSLDSV-------------ASKE---LIRAEGKD--------MTDNIM  1239
             AS  RF    +G+    +              SKE   L+R E ++        +   ++
Sbjct  168   ASLRRFKDSMLGEPEPGIDYSRFMEEYKIRKLSKERSQLVRVEEREKEQGARVPVRPEVI  227

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                ++V+ AY+   I+KG ++D  +   +  + K +F++L+ EDA +++E+ELSF+Y  +
Sbjct  228   THLQVVQYAYKYFNIYKGLVVDFIYSSQQWIESKLFFQSLSAEDALRILEVELSFIYGTL  287

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCLV  891
             FTK+  +  W G AS         C AL    A ++ F  K   K G    D+G+TY L+
Sbjct  288   FTKVDILHTWIGAASR--------CIALGCLFASLYIF--KTSRKDGYDCFDVGLTYALI  337

Query  890   GGAVLLDQMALIHLIFSHWAMVKI-----EMETVDTPVARKLK  777
              G + LD ++++    S W   ++     E++  DT   R L 
Sbjct  338   FGGIALDFISILIYCVSDWTFARLRKLKEEVDKKDTRFERFLN  380



>ref|XP_010040122.1| PREDICTED: uncharacterized protein LOC104428898 [Eucalyptus grandis]
Length=713

 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 132/249 (53%), Gaps = 28/249 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL--PTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL  + Q+ + + V  Q  IF S  LL  PT +VFL G++K  ER L+L 
Sbjct  107   LEDSSLWRRHLLNFIFQVIAAIYVFVQ--IFPSNKLLMIPTILVFLAGVIKSAERTLALY  164

Query  1346  LASSRFVRK--------SIGKSLDSVASKELIRAEGKDMTDN---IMNQYEIVRKAYECH  1200
              +S   +R+        +IG     V     ++ EG   +D     + +  +V+ AY   
Sbjct  165   FSSLPRLRERMDPWWQSNIGPLAGFVYG---LKNEGNKYSDGKEAYLAECILVKHAYVFF  221

Query  1199  QIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKG  1023
              I K F+ D  F   +      +F  ++  DA +V+ +EL FMY+ + TK + ++ +W  
Sbjct  222   HISKVFLGDLIFTRRQREISCTYFHRVSAVDALRVISIELQFMYEMLHTKALTIRSKW--  279

Query  1022  IASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLI  846
               SY   I+RF+    +V VA + F HSK H ++  D+ +TY L+ G ++LD +AL  LI
Sbjct  280   --SY---IFRFISFTNVV-VAFLMFNHSKKHPLRKLDVEITYSLLFGGIVLDVIALFMLI  333

Query  845   FSHWAMVKI  819
              S W + KI
Sbjct  334   SSDWIVAKI  342



>ref|XP_006398229.1| hypothetical protein EUTSA_v10000780mg [Eutrema salsugineum]
 gb|ESQ39682.1| hypothetical protein EUTSA_v10000780mg [Eutrema salsugineum]
Length=812

 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 158/344 (46%), Gaps = 53/344 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL + + Q I +V V+L       +  L PT I+ + G++K VER  +L  
Sbjct  109   LEDNELWNRHLFSLVCQAIATVYVILLSTP---NRLLTPTVIMLVGGVIKYVERTAALFS  165

Query  1343  ASSRFVRKSIGKSLDSVAS-----------------KELIRAEGKD---------MTDNI  1242
             AS    + S+ +  D  A+                  E+I  E  +           +++
Sbjct  166   ASLDKFKDSMLQKPDPGANYAKLMEEYEAKREMNMPTEVIVVEDPEKGREGNTPVRPNDV  225

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
             +   + V+ AY+   IFKG ++D  F + +  + + +F +LN E+A  ++E+ELS +YD+
Sbjct  226   LTPLQEVQYAYKYFDIFKGLVVDLIFTNKQRDESRKFFDSLNPEEALSIIEVELSLLYDS  285

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             +FTK   +  W G+      ++RF+    L     +F    +      D+ +TY L+   
Sbjct  286   LFTKAEILHNWTGV------VFRFIALGCLFASLCLFRMKKEDTYDGFDVALTYALLICG  339

Query  881   VLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVA-  705
             + LD +AL+    S W++ ++          RKLK+         R  +  +  +  +  
Sbjct  340   IALDSIALLMFCVSDWSIARL----------RKLKEDLE-----ERDTRADRVFNWVLGF  384

Query  704   RKLKQKIISLIYYGHKLI-TVVNSKSWSGEIIQYSLLKHSLAGR  576
             R L+ K       GH+++   +  + WS  I  Y+L+ + L  R
Sbjct  385   RTLRWKPSKCFQNGHQVLDRFIMLRRWSEYIHAYNLIGYCLKIR  428



>ref|XP_010042289.1| PREDICTED: uncharacterized protein LOC104431335 [Eucalyptus grandis]
Length=284

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 128/247 (52%), Gaps = 35/247 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQ  1347
             +ED++LW RHLL+   Q+ ++  V  Q  IF S+   + PT +VFL G++K  ER L+L 
Sbjct  54    LEDSSLWRRHLLSLTFQLGAIFYVFVQ--IFPSDKSLVFPTMLVFLTGVIKNAERTLALN  111

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE---------------IVRKA  1212
             L+S   +R+ +    DS      +  EG D +  +++  +               +V+ A
Sbjct  112   LSSLPRLREWMLSEQDS------LDVEGDDFSVKLISPLDGYSHGEEEAKLAESIVVKHA  165

Query  1211  YECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-  1035
             Y   QI K F+ D  F   +      +F  ++  DA +V+ +EL F+Y+ + TK + +  
Sbjct  166   YYFFQISKVFLTDLIFTFRQREMSLGYFHKVSAVDASRVILVELHFIYEVLHTKALTIHS  225

Query  1034  QWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMAL  858
             +W    SY    +RF+   + + VA + F H K H  P  D+ +TY L+ G + LD +A+
Sbjct  226   KW----SY---TFRFIA-FIDIVVAFVLFNHLKKHHLPELDVKITYLLLFGGIALDVIAV  277

Query  857   IHLIFSH  837
             + L+FS+
Sbjct  278   LMLVFSY  284



>ref|XP_010441702.1| PREDICTED: uncharacterized protein LOC104724847 [Camelina sativa]
Length=791

 Score =   100 bits (249),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 130/263 (49%), Gaps = 39/263 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL   + Q   +V V+L       +  L PT I+ + G++K VER  +L  
Sbjct  111   LEDNELWNRHLFGLVCQAFATVYVILLS---IPNGLLTPTIIMLVGGVIKYVERTAALFS  167

Query  1343  ASSRFVRKSIGKSLDSVAS-----------------KELIRAE-------GKDMT---DN  1245
             AS    ++S+ K  D  A+                  E+I  E       GK +    + 
Sbjct  168   ASLDKFKESLLKDPDPGANYAKLMEEYEAKRNMNMPTEVIMVEDPEEGREGKTLVRPINA  227

Query  1244  IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
             I+   ++V+ AY+   IFKG ++D  F   E  + + +F +L  EDA +++E+EL  +YD
Sbjct  228   ILTPLQVVQYAYKYFNIFKGVLVDLIFTIQERDESRAFFDSLTAEDALRIIEVELGLIYD  287

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVG  888
             +MFTK   +    G+      ++RF+    LV  +L FF  +K +   G DI +TY L+ 
Sbjct  288   SMFTKAEILHNKTGV------VFRFIALGCLVA-SLCFFKMTKKNQYDGFDIALTYALLI  340

Query  887   GAVLLDQMALIHLIFSHWAMVKI  819
               + LD +AL+    S W + ++
Sbjct  341   CGIALDSIALLMFCVSDWTIARL  363



>ref|XP_006282348.1| hypothetical protein CARUB_v10028645mg [Capsella rubella]
 gb|EOA15246.1| hypothetical protein CARUB_v10028645mg [Capsella rubella]
Length=787

 Score =   100 bits (249),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 133/262 (51%), Gaps = 29/262 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LWHRH L   +Q  S   V+ Q  +  S W++   ++F+ G +K +ER ++L LA
Sbjct  111   LEDNALWHRHFLGLALQAISGAYVVIQ-SLPNSLWVIIL-LLFIAGTLKYLERTIALYLA  168

Query  1340  SSRFVRKSI--------------GKSLDSVASKELIRAEGKDMTDNIMN--QYEIVRKAY  1209
             SS   R S+              GK  DS+A++   +       +N  N    EI++ A+
Sbjct  169   SSDKFRGSMLEVPDSDSTETRPSGKEDDSMATENYTQYGRPLRLENPGNLTHLEILQFAF  228

Query  1208  ECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQW  1029
                  FK  ++++ F  ++ G+ +++FKNL  E+A +++E+EL F+Y+ ++TK+  +  W
Sbjct  229   WFFNNFKSLVVNNIFSSEQRGESREFFKNLTNEEALRILEVELGFIYEGLYTKVSVLHTW  288

Query  1028  KGIASYFWCIWRFVCNALLVTVALIFFFHSKL--HMKPGDIGVTYCLVGGAVLLDQMALI  855
              G  +      R +    L++   IF + +K        DI +TY L    + LD ++L+
Sbjct  289   VGALT------RTIALGSLLSAFGIFHYRTKKSHEFHGADIVITYILFLVGIALDFVSLL  342

Query  854   HLIFSHWAMV---KIEMETVDT  798
              ++ S W      +I  + VD+
Sbjct  343   MILPSDWTFAVISRINEDEVDS  364



>ref|XP_010481562.1| PREDICTED: uncharacterized protein LOC104760352 [Camelina sativa]
Length=790

 Score =   100 bits (248),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 131/263 (50%), Gaps = 39/263 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL   + Q + +V V+L       +  L PT I+ + G++K VER  +L  
Sbjct  111   LEDNELWNRHLFGLVCQALATVYVILLS---IPNGLLTPTIIMLVGGVIKYVERTAALFS  167

Query  1343  ASSRFVRKSIGKSLDSVAS-----------------KELIRAE-------GKDMT---DN  1245
             AS    ++S+ K  D  A+                  E+I  E       GK +    + 
Sbjct  168   ASLDKFKESLLKDPDPGANYAKLMEEYEARRNMNMPTEVIMVEDPEEGREGKTLVRPINA  227

Query  1244  IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
             I+   ++V+ AY+   IFKG ++D  F   E  + + +F +L  EDA +++E+EL  +YD
Sbjct  228   ILTPLQVVQYAYKYFNIFKGVLVDLIFTIQERDESRAFFDSLTAEDALRIIEVELGLIYD  287

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVG  888
             +MFTK   +    G+      ++RF+    LV  +L FF  +K +   G DI +TY L+ 
Sbjct  288   SMFTKAEILHNKTGV------VFRFIALGCLVA-SLWFFKMTKKNQYDGFDIALTYALLI  340

Query  887   GAVLLDQMALIHLIFSHWAMVKI  819
               + LD +AL+    S W + ++
Sbjct  341   CGIALDSIALLMFCVSDWTIARL  363



>gb|KFK28577.1| hypothetical protein AALP_AA7G014900 [Arabis alpina]
Length=544

 Score = 99.8 bits (247),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 134/283 (47%), Gaps = 48/283 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW R+L   +   C  +  LY + +   +  L+PT ++ + G++K  ERI +++ 
Sbjct  119   LEDNELWLRNLFGLL---CQFIATLYVFLLAIPNSLLVPTSLILVAGVIKYAERIQAMRG  175

Query  1343  AS-SRFVRKSIGKSLDSV----------------ASKELIRAEGKDMTDNI--------M  1239
             AS  RF    +G+    +                   +L+R E  +    +        M
Sbjct  176   ASLKRFKDSMLGEPEPGIDYARFMEEYKIRTISREQSQLVRVEEPEEEQGVRVPARPEAM  235

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                E+V+ AY+   I+KG ++D  +   +  + K +F++L+ ++A +++E+ELSF+Y  +
Sbjct  236   THLEVVQYAYKYFNIYKGLVVDFIYSSQKWRESKQFFQSLSGKEALRILEVELSFIYGTL  295

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCLV  891
             FTK   +  W G +        F C AL    A ++ F  K   K G    D+ +TY L+
Sbjct  296   FTKTDILHTWIGAS--------FRCIALGCLFASLYIF--KTSRKDGYDGFDVALTYALI  345

Query  890   GGAVLLDQMALIHLIFSHWAMVKI-----EMETVDTPVARKLK  777
              G + LD ++++    S W   ++     EM+  DT + R L 
Sbjct  346   FGGIALDFISILIFSVSDWTFARLRKPQEEMDKKDTWLDRFLN  388



>ref|XP_008813358.1| PREDICTED: uncharacterized protein LOC103724015 [Phoenix dactylifera]
Length=676

 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 91/380 (24%), Positives = 159/380 (42%), Gaps = 69/380 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  M Q+ +V   ++   + Q+    P  ++FL GI+K  ER  +L  A
Sbjct  108   LEDNELWMRHLLGLMFQV-AVAFYVFIGSLPQTRLKAPAALMFLAGILKYGERSWALMCA  166

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMT---------------------DNI---MNQ  1233
             S   +R S+    D   +      E   M+                     D +   +N 
Sbjct  167   SMDCLRNSMVTPPDPGPNYAKFMEEYASMSAAGLQAEIEVEKEPETQPRSLDTVVEDINT  226

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
               I+ +A+     FK  I+D      +  + + +F   +   AFKV+E+ELSF+YD ++T
Sbjct  227   VMILSRAHRFFHTFKRLIVDLILSFHDRNESQSFFLKRSPLQAFKVIEIELSFIYDVLYT  286

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   +    G        +R +  + +++  L+F F  K   K  D+ +TY L+GGA++L
Sbjct  287   KSTLIHTVVG------PFFRSITFSSILSALLLFLFTKKHGYKDIDVVITYILLGGALVL  340

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             +  ++  L+FS WA +K+          + LKQ                           
Sbjct  341   ESYSVGLLVFSDWAFLKL----------KDLKQ---------------------------  363

Query  692   QKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSC  513
              ++ ++I+         N   WS  +  Y+L++  L  +        +    +K   D  
Sbjct  364   YRLSNMIFASISFFRPANKPRWSNSMACYNLIRFCLKDKP-STIKRIMALLTVKEAWDRF  422

Query  512   LHTQTAKVEEKLKNLVFEDI  453
              HT    V ++LK  +F++I
Sbjct  423   FHTIYCPVHDELKEFIFKEI  442



>emb|CDY38969.1| BnaC07g18510D [Brassica napus]
Length=663

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 126/244 (52%), Gaps = 19/244 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL + + Q + +V V+L       +  L+PT I+   G++K VER  +L  
Sbjct  109   LEDNELWNRHLFSLVCQAVATVYVILLSTP---NRLLIPTVIMLFGGVIKYVERTSALFS  165

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMN---------QYEIVRKAYECHQIF  1191
             AS    + S+ +  D  A+   +  E  +  D  M          +  +V+ A++  +IF
Sbjct  166   ASLDKFKDSMLEDPDPGANYAKLMEEYANKRDMNMPTEVIVVEDPEKGLVQYAFKYFKIF  225

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             KG I+D  F + +  + + +F +L   DA K++E+ELS +Y+++FTK   +    G    
Sbjct  226   KGLIVDLIFTNKQRDESRKFFDSLKAVDALKIIEVELSLIYESLFTKAEILHNRTG----  281

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                ++R +  A LV+   +F   ++   +  D+ +TY L+   + LD +AL+    S W+
Sbjct  282   --AVFRVIALACLVSSLCLFSLKNEAQYEGFDVALTYALLICGIALDSIALLMFCVSDWS  339

Query  830   MVKI  819
             + ++
Sbjct  340   IARL  343



>gb|EMT18884.1| hypothetical protein F775_16946 [Aegilops tauschii]
Length=680

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 117/236 (50%), Gaps = 25/236 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIV-FLVGIVKCVERILSLQL  1344
             +ED+ LW RHLLT +VQ  +   VLY+Y       LL   I+ F+VG++K  ER  +L+ 
Sbjct  104   LEDSRLWLRHLLTLVVQALAAAYVLYRYIAGSETLLLRAAIMMFIVGVLKYGERTWALKH  163

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYE----CHQIFKGFII  1176
              S   ++    + L  V+  E    +G  + D   N+ E++  AY     C  +F G II
Sbjct  164   GSMGRLQSEC-RRLGFVS--EFAMPDG--LADRTDNEEEVLVAAYMMFPICIHLFGGTII  218

Query  1175  DHSFLHDECGKEKDWFK--NLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWC  1002
                   D C     W     L  ED  K++EMELS MYD ++TK   +  W G      C
Sbjct  219   GP---EDSC----KWLHAYGLGGEDLHKLVEMELSLMYDTLYTKAAVIHTWYG------C  265

Query  1001  IWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
               R +  AL +   ++F F +KL     D+ +TY LV GA++++ +++   + S W
Sbjct  266   CIRIISLALTIAALMLFKFSNKLGYSRADVAITYVLVIGALIVEIISVSGTLGSSW  321



>ref|XP_010058313.1| PREDICTED: uncharacterized protein LOC104446102 [Eucalyptus grandis]
Length=611

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 135/250 (54%), Gaps = 30/250 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN+LW RHLL+ + Q+   + V  Q        ++PT +VFL GI+K +ERIL+L L+
Sbjct  54    LEDNSLWQRHLLSPIFQVSITIYVFVQVFPSDKSLMIPTMLVFLSGIIKNLERILALNLS  113

Query  1340  SSRFVRKSIGKSLDSVASKELIRA-------EGKDMTDNIMNQYE-------IVRKAYEC  1203
             S   +++S+      + +KEL          E K++     N+ E       +V+ AY  
Sbjct  114   SLPRLKESM------LTTKELTLGAYLKPDEELKNLGYVYSNEEEKKIAESIVVKHAYYF  167

Query  1202  HQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWK  1026
              QIF+ FIID  +  +E      +F  ++  DA +V+ +EL+F+Y+ + TK + V+ +W 
Sbjct  168   FQIFRFFIIDSFYTSEERLISCKYFSEVSAVDALRVISVELNFIYEILHTKALTVRSKW-  226

Query  1025  GIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHL  849
                SY   I+RF+   + V +A + F   K H  P  D+ +TY L+ G + LD + L  L
Sbjct  227   ---SY---IFRFIA-FIDVAMAFVLFNGFKKHQLPKLDVEITYILLFGGIALDVINLFIL  279

Query  848   IFSHWAMVKI  819
             IFS W + +I
Sbjct  280   IFSDWTIARI  289



>ref|XP_009101588.1| PREDICTED: uncharacterized protein LOC103827791 [Brassica rapa]
Length=779

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/262 (27%), Positives = 130/262 (50%), Gaps = 38/262 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL + + Q + +V V+L       +  L PT I+   G++K VER  +L  
Sbjct  109   LEDNELWNRHLFSLVCQAVATVYVILLSTP---NRLLTPTVIMLFGGVIKYVERTSALFS  165

Query  1343  ASSRFVRKSIGKSLDSVASKELIR---AEGKDMT------------------------DN  1245
             AS    + S+ +  D  A+   +    A  +DM                         D+
Sbjct  166   ASLDKFKDSMLEDPDPGANYAKLMEEYANKRDMNMPTEVIVVEDPEKGRECITPVRPKDD  225

Query  1244  IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
             + N  ++V+ A++   IFKG I+D  F + +  + + +F +L  E+A +++E+ELS +Y+
Sbjct  226   LTN-LQVVQYAFKYFNIFKGLIVDLIFTNKQRDESRKFFDSLKPEEALRIIEVELSLIYE  284

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGG  885
             ++FTK   +  W G       ++R +  A LV+   +F   ++   +  D+ +TY L+  
Sbjct  285   SLFTKAEILHNWTG------AVFRVIALACLVSSLCLFSLKNEAEYEGFDVALTYALLIC  338

Query  884   AVLLDQMALIHLIFSHWAMVKI  819
              + LD +AL+    S W++ ++
Sbjct  339   GIALDSIALLMFCVSDWSIARL  360



>ref|XP_010449415.1| PREDICTED: uncharacterized protein LOC104731663 [Camelina sativa]
Length=810

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/266 (26%), Positives = 124/266 (47%), Gaps = 32/266 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R L   M Q  + L + +   I    W  PT ++ + G++K VERI  ++ A
Sbjct  111   LEDNELWLRSLFGLMCQFIATLYI-FLLSIPNRLWE-PTTLMLVAGVLKYVERIGGMRAA  168

Query  1340  S-SRFVRKSIGKSLDSV----------------ASKELIRAE-----GKDMTDNIMNQYE  1227
             S  RF +   G+    V                   E +R E      +++  +++ Q  
Sbjct  169   SLERFKKLMPGEPEPGVDYSSFMEEYKIREISREHSEFVRVEEPEERQREVRPHVLTQLH  228

Query  1226  IVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKM  1047
              ++  Y+   I+KG ++D  +  +   + K++F++L   +A  ++E+ELSF+Y  +FTK+
Sbjct  229   AIQYGYKYFNIYKGLVVDFLYSSEHWIESKEFFQSLEAVEALSILEVELSFIYGTLFTKV  288

Query  1046  IAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQ  867
               +  W G+       +RF+    L +   IF    K      D+G+TY L+ G +  D 
Sbjct  289   DILHTWTGVT------FRFISLGCLFSSLSIFKTSRKDEYDGFDVGLTYALILGGIAFDF  342

Query  866   MALIHLIFSHWAMVKIE--METVDTP  795
             ++++    S W   ++    E VD P
Sbjct  343   ISILMFYVSDWTFARMSKPKEEVDDP  368



>gb|KCW53047.1| hypothetical protein EUGRSUZ_J02342, partial [Eucalyptus grandis]
Length=473

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 95/378 (25%), Positives = 164/378 (43%), Gaps = 66/378 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL    VQ+     + +      + W+L  G++ LVG ++  ER L L LA
Sbjct  111   LEDNELWLRHLARLCVQVGLAFYIYFLALWGSTLWILAAGMI-LVGFIRYAERTLCLYLA  169

Query  1340  SSRFVRKSIGKSLD-------SVASKELIRAEG-----------KDMTDNIMNQYE-IVR  1218
             S   ++ S+    D       +VA   L + EG             + D+ +  ++  + 
Sbjct  170   SEGRLQGSMLPRPDFGSVYPRNVARYTLKKEEGYRVGIDELTRIPALEDHSVKDFQATLD  229

Query  1217  KAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVE--DAFKVMEMELSFMYDAMFTKMI  1044
             KAYE   IFK   +  +    + G  +  FK  +++   AF+++E+EL FMYD ++TK  
Sbjct  230   KAYELFNIFKLLFVGLNVSFVDLGVSRPMFKGPDMKAVKAFEIVEIELGFMYDLLYTKAP  289

Query  1043  AVQQWKGIASYFWCIWRFVCNALLVTVALIFF-FHSKLHMKPGDIGVTYCLVGGAVLLDQ  867
              + +        W I R+V +  L    L+FF FH K      DI +T+ L+ GA+LL+ 
Sbjct  290   LLNR-------RWGIIRWVISLFLPCAMLVFFSFHDKKDYSKVDICITFSLISGAILLEI  342

Query  866   MALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQK  687
              +LI  I S W    +    +  P    +    T  +  +R L+  +             
Sbjct  343   FSLILAISSDW----VHHWRIQRPKGSAISSAITFFS-FSRSLRWSRW------------  385

Query  686   IISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLH  507
                                WS  + Q+SLL  S+  R+ K    +    +L  V++   +
Sbjct  386   -----------------SRWSNSVAQFSLLGSSM--RKRKGIFRYPRLAMLGDVVERNFY  426

Query  506   TQTAKVEEKLKNLVFEDI  453
                 +++E++K L+F+ +
Sbjct  427   IDYKELKEEIKELIFKQM  444



>ref|XP_010251959.1| PREDICTED: uncharacterized protein LOC104593692 [Nelumbo nucifera]
Length=699

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 99/475 (21%), Positives = 197/475 (41%), Gaps = 91/475 (19%)
 Frame = -3

Query  1412  LPTGIVFLVGIVKCVERILSLQLASSRFVRKSI----------GKSLDSVASK-------  1284
             +P   +F+ GI+K VER  SL LAS    R+S+           K ++   SK       
Sbjct  150   IPAIPMFIAGIIKYVERTWSLMLASRENFRESMVTEPDPGPNYAKFMEEFTSKKNAGLNA  209

Query  1283  ELI---------------RAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDEC  1149
             E+I                + G     ++    E++  AY     FK  I+D      + 
Sbjct  210   EIIWEREPDIQLLNFQDDNSHGNGNKKDVEVDVELLSDAYRFFNTFKRLIVDLILTFHDR  269

Query  1148  GKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLV  969
              + + +F       A+KV+E+EL ++YD ++TK   +    G      CI R    + ++
Sbjct  270   NESQSYFLKQTWSRAYKVIEVELGYVYDVLYTKAAVIHTLLG------CILRMFSLSSIL  323

Query  968   TVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVA  789
             +   IF F  K      DI +TY L+ GA+ L+  +LI L+ S W +V ++  +      
Sbjct  324   SAFFIFSFMEKHWFSKIDIAITYVLLVGAIALEIWSLIRLLLSDWTIVWMKQHS------  377

Query  788   RKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQ  609
             + L       + + RK  + +                                WS  + Q
Sbjct  378   KSLSDFLLNASSIYRKPDRSR--------------------------------WSNSMAQ  405

Query  608   YSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekake  429
             Y+L+ +SL   +       L+   ++ ++D   +    +V + LK  +F+D+ R+  +  
Sbjct  406   YNLINYSLREEKHPILKTILKFIKIEDMVDKYWYRTYTEVTDGLKRFIFDDLNRKLHSIS  465

Query  428   aaaepekETYHRQEVMDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEI  249
             + +     T   +  ++++ ++   P      + ++  S++ + +     +L  H+AT+I
Sbjct  466   STSYKHFNTCRGESALEEVNQL---PNYDRVFAKELNRSIEVEFDES---ILRWHIATDI  519

Query  248   CYFTADKTKGGDDEAGA---------KLLCIQISQYLAYLLVLEEKITSAVPGSI  111
             C++  ++++   +E  +         K +C ++S Y+ YLL+    + +A  G I
Sbjct  520   CFYLDEESRNSHEETNSPSAKIIGNKKKMCREVSNYMLYLLISRPFMLTAGIGQI  574



>ref|XP_010034672.1| PREDICTED: uncharacterized protein LOC104423941 [Eucalyptus grandis]
Length=487

 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 95/378 (25%), Positives = 164/378 (43%), Gaps = 66/378 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL    VQ+     + +      + W+L  G++ LVG ++  ER L L LA
Sbjct  111   LEDNELWLRHLARLCVQVGLAFYIYFLALWGSTLWILAAGMI-LVGFIRYAERTLCLYLA  169

Query  1340  SSRFVRKSIGKSLD-------SVASKELIRAEG-----------KDMTDNIMNQYE-IVR  1218
             S   ++ S+    D       +VA   L + EG             + D+ +  ++  + 
Sbjct  170   SEGRLQGSMLPRPDFGSVYPRNVARYTLKKEEGYRVGIDELTRIPALEDHSVKDFQATLD  229

Query  1217  KAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVE--DAFKVMEMELSFMYDAMFTKMI  1044
             KAYE   IFK   +  +    + G  +  FK  +++   AF+++E+EL FMYD ++TK  
Sbjct  230   KAYELFNIFKLLFVGLNVSFVDLGVSRPMFKGPDMKAVKAFEIVEIELGFMYDLLYTKAP  289

Query  1043  AVQQWKGIASYFWCIWRFVCNALLVTVALIFF-FHSKLHMKPGDIGVTYCLVGGAVLLDQ  867
              + +        W I R+V +  L    L+FF FH K      DI +T+ L+ GA+LL+ 
Sbjct  290   LLNR-------RWGIIRWVISLFLPCAMLVFFSFHDKKDYSKVDICITFSLISGAILLEI  342

Query  866   MALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQK  687
              +LI  I S W    +    +  P    +    T  +  +R L+  +             
Sbjct  343   FSLILAISSDW----VHHWRIQRPKGSAISSAITFFS-FSRSLRWSRW------------  385

Query  686   IISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLH  507
                                WS  + Q+SLL  S+  R+ K    +    +L  V++   +
Sbjct  386   -----------------SRWSNSVAQFSLLGSSM--RKRKGIFRYPRLAMLGDVVERNFY  426

Query  506   TQTAKVEEKLKNLVFEDI  453
                 +++E++K L+F+ +
Sbjct  427   IDYKELKEEIKELIFKQM  444



>ref|XP_008228365.1| PREDICTED: uncharacterized protein LOC103327776 [Prunus mume]
Length=713

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 101/365 (28%), Positives = 156/365 (43%), Gaps = 80/365 (22%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL----LPTGIVFLVGIVKCVERILSL  1350
             EDN LW RHLL    Q+     +L+  + + SE L    LP   +F+VGI+K  ER   L
Sbjct  134   EDNELWLRHLLRLGSQLLVASNILF--RAWSSEALNFLALP---MFIVGIIKSGERTWVL  188

Query  1349  QLASSRFVRKSI------GKSLD------SVASKELIRAE-----------GKDMT----  1251
             + ASS   R S+      G + D      S    E  R E           G D +    
Sbjct  189   RSASSEQFRDSMLQPPDPGPNYDRYMEDYSSRRDEGFRVELGTFSASKAATGSDQSREPA  248

Query  1250  -DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
              D+  +Q + + KAY   +  K    D      +    +++F+    E+AF V+E+ELSF
Sbjct  249   ADDDSSQNDPINKAYTFFESLKKLCADLILNFHDVDNSQNFFQATTCEEAFDVIEIELSF  308

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD  +TK + V  + G+     C       +L V V LIF F  K   +  D+ +T+ +
Sbjct  309   IYDVFYTKAVLV--YSGLGGILRCF----TFSLTVLVFLIFLFIEKQAYREMDVIITFIM  362

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDT  714
             + GA++L+  ALI L+ S W  + +           K K   TV                
Sbjct  363   LAGAIILEIYALIILLSSDWTKLWLN----------KNKHTNTVAC--------------  398

Query  713   PVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKC----ADDFLE  546
                      ++  ++     + +VN+KSWS  + QY L+K  L  +  KC     D ++ 
Sbjct  399   ---------VVGFLHKTVSYLPLVNNKSWSNSLGQYELIKFCLKTKPAKCILFKKDCYIN  449

Query  545   HFLLK  531
              FL K
Sbjct  450   TFLEK  454



>ref|XP_006362595.1| PREDICTED: uncharacterized protein LOC102603128 [Solanum tuberosum]
Length=656

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 132/270 (49%), Gaps = 21/270 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R+  T +    S   V Y     Q  +L +P  +VFL GI+KC ER      
Sbjct  103   LEDNDLWFRYAFTFVFMFLSSAYVFY-LSFSQVNYLWIPNVLVFLAGIIKCYER------  155

Query  1343  ASSRFVRKSIGKS--LDSVASKELIRAEGKDMTDNI----MNQYEIVRKAYECHQIFKGF  1182
             A +RF+  S+ KS  L +   +++++ +  +   N     ++  E+++ AY   + +KG 
Sbjct  156   ARARFI-GSMDKSITLSNPKYEDVVKRKSSEEPHNFRAGELDDVEVIQLAYTIFRAYKGV  214

Query  1181  IIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIA--SYF  1008
             +++H F  +E G+ +   +N     AF++ + EL  ++D ++TK     +  G +  S +
Sbjct  215   LVEHKFTFEEYGRIQQLLQNRTDLFAFRIAQAELEILHDVLYTKAQIFHESFGNSARSVY  274

Query  1007  WCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
             W +      A L + +L+   + +    P D+G+TY L+ G + LD +A + L++S    
Sbjct  275   WVL----LPAALASFSLLVRNNKQKQFDPFDVGLTYSLLIGGMFLDAIAFVILLYSSTFT  330

Query  827   VKIEMETVDTPVARKLKQKKTVDTPVARKL  738
             +         P+   +K  K +  P  R L
Sbjct  331   IATMSRATSRPITWVVKFLKALKWPRPRAL  360



>gb|KFK31554.1| hypothetical protein AALP_AA6G127000 [Arabis alpina]
Length=794

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 121/270 (45%), Gaps = 37/270 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL+ + Q + +V V+L       +  L PT I+   G++K VER  +L  
Sbjct  111   LEDNELWDRHLLSLVCQAVATVYVILLS---IPNRLLTPTLIMLAGGVIKYVERTAALFS  167

Query  1343  ASSRFVRKSIGKSLDS-----------VASKELIRA--------------EGKDMTDNIM  1239
              S    + S+    D             A KE+                 EG       +
Sbjct  168   GSLDKFKDSMLSKADPGANYAKLMEEYTAKKEMNMPTEVIVVEEDPEKGREGNTPVKRRL  227

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                ++V+ AY+   IFKG I+D  F + +  + + +F +L  E+A +++E+EL  +YD +
Sbjct  228   TALQVVQYAYKYFNIFKGLIVDLIFTNKQRDESRKFFDSLTPEEALRIIEVELGLIYDCL  287

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             FTK   +  W G       ++R      LV    +F  + +      DI +TY L+   +
Sbjct  288   FTKAAILHNWTG------AVFRLTALGCLVASLCLFKMNKEDQYDGFDIALTYALLVCGI  341

Query  878   LLDQMALIHLIFSHWAMVKIEM--ETVDTP  795
              LD +AL+    S W + ++    E +D P
Sbjct  342   ALDSIALLMFCVSDWTIARMRSLKEDLDEP  371



>ref|XP_007040746.1| Uncharacterized protein TCM_016620 [Theobroma cacao]
 gb|EOY25247.1| Uncharacterized protein TCM_016620 [Theobroma cacao]
Length=584

 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 125/258 (48%), Gaps = 30/258 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+L+ ++Q  + L V  Q  + +++  +PT ++ + G++K  ERI +L LA
Sbjct  97    LEDNELWLRHMLSLILQAVAALHVFIQ-SLTKNKLQVPTLLMLVTGVIKYAERIYALFLA  155

Query  1340  SSRFVRKSI------GKSLDSVASKELIRAEGKDMTDNIMNQ----------------YE  1227
             S    R S+      G     +  K     EG   T  IM Q                 E
Sbjct  156   SLDRFRDSMLQKPDPGPDYARLMKKYTSMKEGNLPTRIIMVQEPEKEVKETKQGKLDDLE  215

Query  1226  IVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKM  1047
             +V  AY   + FKG ++D  F      + +D+F     EDA +++E+EL+F+    +TKM
Sbjct  216   VVHYAYHFFETFKGLVVDLMFSIHARKESRDFFLAREPEDALRIIEVELTFINGVFYTKM  275

Query  1046  IAVQQWKGIASYFWCIWRFVC-NALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
                   K + S    ++RF+   ++L  + L +F   +    P ++ +T  L+ GA+ L+
Sbjct  276   ------KVMHSIVGYLFRFIALGSVLAALGLFYFEAEENEYDPFNVKITCILLIGAIALE  329

Query  869   QMALIHLIFSHWAMVKIE  816
              +A + LIFS W    I+
Sbjct  330   VVAFLMLIFSDWTFASIK  347



>ref|XP_006464314.1| PREDICTED: uncharacterized protein LOC102619729 [Citrus sinensis]
Length=690

 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 110/235 (47%), Gaps = 25/235 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R L   + Q      V +   +  ++  +PT +VF+ GI+KC ER L++ LA
Sbjct  108   LEDNELWLRQLFGLIFQAGFTFYV-FLLSLPGNKLFVPTILVFIAGIIKCFERTLAMYLA  166

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             S    R+S             I    KD+  N    Y  ++ A E  QIF+G ++D    
Sbjct  167   SGEKFREST------------IIELAKDVKVNQGGDY--LQVACEYFQIFRGIVVDLFSN  212

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               +   E   F     EDA +++E+EL+ +Y+ + TK+               I RF+C 
Sbjct  213   FTDFPFEGPSFGIFGPEDALRIIEVELNLVYEVLHTKIQVTHS---------VILRFICF  263

Query  980   ALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
               LV    +F+F  + H +   D+GVTY L  GA+ LD ++     FS W  V +
Sbjct  264   GSLVAALSVFYFQVEKHGLNDFDLGVTYTLFLGAIALDVISFFMGNFSEWTFVAL  318



>ref|XP_010535680.1| PREDICTED: uncharacterized protein LOC104810911 [Tarenaya hassleriana]
Length=839

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 124/261 (48%), Gaps = 37/261 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL   + Q I SV V L   +   +    P  ++ L G++K  ER  +L L
Sbjct  128   LEDNELWLRHLFGLLCQAIASVYVFL---QSIPNRLQTPLILMLLSGVIKYFERTRALYL  184

Query  1343  ASS-RFVRKSIGKSLDSVASKEL-------------------------IRAEGKDMTDNI  1242
             AS+ RF    +GK        +L                         ++++GK     +
Sbjct  185   ASTDRFKDSMLGKPDPGPNYAKLMEEYQTKKDMNMPTQIIMMEEPEKGLKSDGKGQRKKL  244

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
              +  E+V+ AY+    FKG ++D  F   +  +   +F +L  EDA K++E+EL+F+Y+A
Sbjct  245   TD-LEVVQYAYKYFNTFKGLVVDLIFTFQQRDESMKFFDSLQEEDALKILEVELNFIYEA  303

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             +FTK+  +    G+ S      R    A L+   ++F   +K      D+G+TY L+ G 
Sbjct  304   LFTKVEVLHSGIGLFS------RLAAFAFLLASLILFKGKTKNGYDGFDVGLTYALLIGG  357

Query  881   VLLDQMALIHLIFSHWAMVKI  819
             + LD +A++    S W  V++
Sbjct  358   IALDVIAILMFCLSDWMFVRL  378



>emb|CDP21223.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 113/243 (47%), Gaps = 37/243 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHLL  ++Q  +V  V  Q    ++ + +PT ++   G +K  ER  +L LA
Sbjct  28    LKDNELWIRHLLGLIIQFSAVAYVFSQS--LRNVFYVPTILLIFAGTIKYAERTRALYLA  85

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                                         +   +  + EIV++     Q       +   L
Sbjct  86    C---------------------------LAAQVPVEIEIVKEHDRGTQTSAN--PEEENL  116

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E   + D  +N +  DAF+VME+EL+F+YD ++TKM  V   KG         R +C+
Sbjct  117   SPEDISDIDIVQNGSAFDAFRVMEVELNFIYDTLYTKMAVVHSKKGYR------LRLICS  170

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
              L+V     F  H K  +   D+  TY L+ GAVLLD +A   LIFS W +VK++  TV 
Sbjct  171   ILIVLSFERFASHHKPDINHFDVATTYILLSGAVLLDFVAFTKLIFSDWTIVKLKNLTVK  230

Query  800   TPV  792
             T V
Sbjct  231   TTV  233



>ref|XP_010039370.1| PREDICTED: uncharacterized protein LOC104428069 [Eucalyptus grandis]
Length=345

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 131/248 (53%), Gaps = 23/248 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE--WLLPTGIVFLVGIVKCVERILSLQ  1347
             +EDN+LW +HLL  + Q+ +   V     IF S+   ++PT +VFL   +K  E+ L+L 
Sbjct  107   LEDNSLWQQHLLNFIFQVGAASYVFVW--IFPSDKSLVIPTILVFLPRFIKIAEKTLALY  164

Query  1346  LASSRFVRKS----IGKSLDSVASKELIRAEG-----KDMTDNIMNQYEIVRKAYECHQI  1194
             L+S   +R+S    +G   DS+   + +  EG      D     +++  +V+ A+   QI
Sbjct  165   LSSFPKLRESMLLELGMEADSLQLLKELNVEGDGYKCSDKEGAKLHESIVVKHAFSLFQI  224

Query  1193  FKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIA  1017
             +K FI D  +   +     D+F  ++  D  +++ +E +F+Y+ + TK++ ++ +W    
Sbjct  225   YKMFIADLMYTKQQRKMSSDYFDKVSAVDPLRLISVEFNFIYEELHTKVLTIRHKW----  280

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFS  840
             +Y + I  F      + VAL  F   K +  P  D+ +TY L+ G +++D +AL  LIFS
Sbjct  281   NYIFRIIAFTS----IVVALGLFNRLKRYQLPELDVKITYILLFGGIVIDGIALFILIFS  336

Query  839   HWAMVKIE  816
              W + +I+
Sbjct  337   DWTVAEIK  344



>ref|XP_003580057.1| PREDICTED: uncharacterized protein LOC100843617 [Brachypodium 
distachyon]
 ref|XP_010239614.1| PREDICTED: uncharacterized protein LOC100843617 [Brachypodium 
distachyon]
Length=639

 Score = 97.4 bits (241),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 116/236 (49%), Gaps = 21/236 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED+ LW RHLLT  VQ+     VLY++   +   +L    +F+VG+VK  ERI +L+ +
Sbjct  99    LEDSKLWKRHLLTVFVQVLGAAYVLYKHIAGRGNLVLAAIFMFVVGVVKYAERIWALRCS  158

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE---IVRKAYECHQIFKGFIIDH  1170
             +   +R S+  S          R +   + + +  ++    ++  A+      K  ++D 
Sbjct  159   TMDSIRSSLNNSRG--------RNDHYTIPNGVKGKFHEQVLLELAHSLFHFCKLKLVDS  210

Query  1169  SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
             S   D     +     L+  D +K++EMELS +YD ++TK   V  W G     +CI RF
Sbjct  211   SVNMDHPNLVRS---RLDWSDIWKLIEMELSLLYDILYTKAAVVHTWYG-----YCI-RF  261

Query  989   VCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMV  825
             +         L+F F + L    G D+ +TY L+GGA+ ++  AL+  I S W + 
Sbjct  262   MTPFATAGALLLFHFSNGLGGLSGVDVAITYALLGGALFMEVTALLGAIGSTWTLA  317



>ref|XP_010068269.1| PREDICTED: uncharacterized protein LOC104455124 [Eucalyptus grandis]
Length=633

 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 128/262 (49%), Gaps = 31/262 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED++LW +HLL  + Q+ + L V  Q          PT +VFL  I+K VE IL+L L+
Sbjct  54    LEDSSLWGQHLLNLIFQVGASLYVFVQIFTSDKSMATPTMLVFLAAIIKNVESILALYLS  113

Query  1340  SSRFVRKSIGKSLDSVASKELIRAE--------GKDMTDN--IMNQYEIVRKAYECHQIF  1191
             S + +RKS+   +D   SK ++R E        G   TD    +++  +V+ AY   QIF
Sbjct  114   SFQTLRKSMISQMDDGLSK-ILRDESNEALIVLGDGYTDEEARLDESIVVKHAYYFFQIF  172

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             K F+ D  F   +C   + +F  ++  DA +V+ +EL F+Y+ + TK +A          
Sbjct  173   KVFLGDLIFTRQKCEISRKYFHKISAIDASRVISVELHFIYEVLHTKSLAT------CCK  226

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                ++RF+    +V   ++F    K  +   D+ +TY ++ G + LD+            
Sbjct  227   LSYMFRFIAFTSIVVAFILFNRFKKHRLFKLDVKITYIILFGGIALDE------------  274

Query  830   MVKIEMETVDTPV-ARKLKQKK  768
              VK   E  D P+  RK+ + +
Sbjct  275   -VKRRSENTDDPIEVRKIYEAR  295



>ref|XP_010067381.1| PREDICTED: uncharacterized protein LOC104454275 [Eucalyptus grandis]
Length=730

 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 123/251 (49%), Gaps = 22/251 (9%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL--PTGIVFLVGIVKCVERILSLQL  1344
             ED++LW RHLL+ + Q+ + + V  Q  IF ++ LL  P  +VFL  ++K V R LSL L
Sbjct  108   EDSSLWRRHLLSFIFQVSATIYVFVQ--IFPNDKLLVIPMMLVFLAALIKNVGRTLSLNL  165

Query  1343  ASSRFVRKSI--------GKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFK  1188
             +S   VR+ +           +  V     +  E     +  + +  +V+ AY     F 
Sbjct  166   SSLPRVRERVLLHHQYSDAPPIKLVEDYNDLEVEYSKGEEAKLAESIVVKHAYHFFNTFD  225

Query  1187  GFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASY  1011
              F+ D  + + E  +   +F  ++  DA +V+  EL F Y+ + TK + +  +W    SY
Sbjct  226   VFLADLVYTNAERNRSHIYFHKVSTLDALRVISFELHFYYEMLHTKALTIHSKW----SY  281

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                I+RF+   + VT+A   F H K    P  D+ +TY L+ G V LD +AL  L+FS W
Sbjct  282   ---IFRFIA-FIDVTIAFTLFNHLKKRKFPYLDVEITYSLLFGGVALDMVALFMLVFSDW  337

Query  833   AMVKIEMETVD  801
              +  I  +   
Sbjct  338   TVAHINWDNTS  348



>ref|XP_010095740.1| hypothetical protein L484_003352 [Morus notabilis]
 gb|EXB62123.1| hypothetical protein L484_003352 [Morus notabilis]
Length=734

 Score = 97.1 bits (240),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 127/265 (48%), Gaps = 36/265 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHL+  ++Q+  V+    Q       WL P   +   GI+K  ER  +L LA
Sbjct  130   LQDNALWVRHLVGLIIQVFVVVYTFIQSLPANKLWL-PISFILAAGIIKYAERTRALYLA  188

Query  1340  SSRFVRKSIG----KSLDSVASKE-----------LIRAEGKDMTD---------NIMNQ  1233
             +    R   G    K +   +++            L R +GK + +          + + 
Sbjct  189   NLDSFRGYPGPNYAKLMQEYSARRQAGIPARIHMVLQRRDGKSVLEKRPSTSQDSTLYDD  248

Query  1232  YEIVRKAYECHQIFKGFIIDH-SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
               +V+ A+     F   I+D    L  +  + + +F  ++ E A KV+ +EL+F Y+ ++
Sbjct  249   VTVVQHAHHFFLTFMNLIVDQLVLLISDRNESRHYFHEISAEQAMKVLSVELNFFYEVLY  308

Query  1055  TKMIAVQQWKGIASYFW-CIWRFVCNALLVTVAL-IFFFHSKLHMKPGDIGVTYCLVGGA  882
             TK + V +  G   YFW C+     +++ + VAL +FF   K   +  D+ +TY L GGA
Sbjct  309   TKAVVVHRKLG---YFWRCV-----SSISIFVALSLFFVAEKQRFRSTDVRITYTLFGGA  360

Query  881   VLLDQMALIHLIFSHWAMVKIEMET  807
             ++LD +A    +FS W +V ++ +T
Sbjct  361   IVLDVLAFFMFVFSDWTVVLLDEKT  385



>ref|XP_010041068.1| PREDICTED: uncharacterized protein LOC104429975, partial [Eucalyptus 
grandis]
Length=594

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 124/220 (56%), Gaps = 21/220 (10%)
 Frame = -3

Query  1436  KIFQSE--WLLPTGIVFLVGIVKCVERILSLQLAS-----SRFVRKSIGKSLDSVASKEL  1278
             +IF S+   +LPT ++FL G++K VER L+L L+S      R + + +    +S+   E 
Sbjct  126   QIFPSDKSLVLPTMLIFLAGVIKKVERTLALNLSSLPRLRERVLSQDVALDDESIFDDED  185

Query  1277  IRAEGKDMT----DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVE  1110
             I AE    +    +  + +  +V+ AY   QI K F+ D  F + +    + +F++++  
Sbjct  186   IVAELDGYSHGEEEAKLPESIVVKHAYYFFQISKLFLTDLIFTYRQRYISRRYFRSVSAV  245

Query  1109  DAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASYFWCIWRFVCNALLVTVALIFFFHSKL  933
             DA +V+ +EL F+Y+ + TK + ++ +W    SY   ++RF+   ++V +A +FF   K 
Sbjct  246   DALRVISVELHFIYEVLHTKALTIRSKW----SY---VFRFIA-FIVVVMAFVFFNRLKK  297

Query  932   HMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
             H  P  D+ +TY L+ G + LD +A++ L+FS W + KI+
Sbjct  298   HQLPKLDVKITYLLLFGGIALDVIAVLMLVFSDWTVAKIQ  337



>ref|XP_004977741.1| PREDICTED: uncharacterized protein LOC101758603 [Setaria italica]
Length=629

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 113/236 (48%), Gaps = 21/236 (9%)
 Frame = -3

Query  1517  EDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTG--IVFLVGIVKCVERILSLQL  1344
             EDN LW RHL T +VQ+     VLY+Y +  SE L+     ++F+VGI+K  ERI +LQ 
Sbjct  101   EDNRLWLRHLQTLVVQVLGSAYVLYKY-MPGSETLMMVAAVLIFVVGILKYGERIWALQS  159

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE-----IVRKAYECHQIFKGFI  1179
             AS   +  S  +S  SV   E      + ++D +  +Y      ++  A+    +  G  
Sbjct  160   ASFDSIWNSFDRSDASVRESE----RNRILSDVLQRRYSLDEETVLMGAHGLLDVCVGLF  215

Query  1178  IDHSFLHDECGKEKDWFKNLNVEDAF-KVMEMELSFMYDAMFTKMIAVQQWKGIASYFWC  1002
             I       +  +E    + LN  D   K+MEMELS MYD ++TK   +  W G      C
Sbjct  216   IGLERRKRDYVREI--MRTLNAVDLLDKLMEMELSLMYDILYTKATVIHTWYG------C  267

Query  1001  IWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
               R +     VT  L+F F SK      DI VTY L  GA+LL+  + +    S W
Sbjct  268   CIRIITLVATVTAFLMFLFSSKHGHSRKDIAVTYVLSVGALLLEMASTVRAFGSTW  323



>ref|XP_010100619.1| hypothetical protein L484_011550 [Morus notabilis]
 gb|EXB83256.1| hypothetical protein L484_011550 [Morus notabilis]
Length=712

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 126/261 (48%), Gaps = 32/261 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   + Q+  V+ V  Q  I  ++ L  T  + L G +K  ER  +L LA
Sbjct  109   LEDNALWLRHLFNLITQVVPVVYVFVQ-SIPSNKLLTTTIPMLLAGTIKYAERTRALYLA  167

Query  1340  SSRFVRKSIGKSLDS----VASKELIRAEGKDM------------------TDNIMNQYE  1227
             S    +KS+    D     VA  E   A  +D                    +  ++   
Sbjct  168   SFDTFQKSMTGEADPGKDYVAFMEDFAARQQDAKAPRFVHLTEPPLYLPTSEEGGVDNIS  227

Query  1226  IVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKM  1047
              V+ A+   ++FKG ++D  F   E  + +++F   N E A +V+ +EL+FMY  ++TK+
Sbjct  228   AVKHAHRFFEVFKGALVDRVFSASERAESQEFFYRKNSEVAMRVISIELNFMYQVLYTKV  287

Query  1046  IAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMK--PGDIGVTYCLVGGAVLL  873
             + V+   G  S      RF+  + +V +AL+ F  S+ HM   P D G+TY L+ GA+ L
Sbjct  288   VVVRSKLGYIS------RFISFSAIV-IALLLFNSSEKHMSLHPVDAGITYSLLYGAISL  340

Query  872   DQMALIHLIFSHWAMVKIEME  810
             + +A + L FS    V +  E
Sbjct  341   EAIAFLMLFFSDLTAVALLSE  361



>dbj|BAK07923.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=682

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 163/359 (45%), Gaps = 45/359 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL+T  +Q+   + VLY++ +  Q  ++L   ++F+VG++K  ER  +L+ 
Sbjct  101   LEDNRLWLRHLVTLGMQVAGAVYVLYKHYVGTQDMFVLAVILMFIVGVLKYGERTAALKG  160

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE-IVRKAYECHQIFKGFIIDHS  1167
             ++   +R S+ K   +     L     K      M++ E ++R A+    I K   +D S
Sbjct  161   SNMDSIRSSLKKEPRAKCHFYLDERPPKGGFKGKMDEEEFLMRHAHSLFHICKHAAVDSS  220

Query  1166  FLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFV  987
                 E  +E    ++L  E  + +ME+ELS MYD ++TK   V    G   Y  CI   V
Sbjct  221   GSMGEDNREIKVLEHLTYEQRYVLMELELSLMYDILYTKAAVVHNLFG---YCVCI---V  274

Query  986   CNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMET  807
               A      L+F F  K      D+ +TY L+G A+LL+  +L+  + S W +  +    
Sbjct  275   SPAAAAASLLVFQFSGKAGHSRVDVLITYILLGSALLLEMRSLLSALGSSWTLPFL----  330

Query  806   VDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVN----  639
                                     Q + +      +L+++I+SL    H+LI V+     
Sbjct  331   ----------------CGTRWSWLQHEVLCGGGWDRLRRRIVSL----HRLIKVMGLSTW  370

Query  638   ---SKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKN  471
                S+ WSG + QY++L   L  R  K     +  F    ++ S  H+ T K  E+LK 
Sbjct  371   LRPSRRWSGTVGQYNMLH--LCTRPSKRNSPLVGRF--AKMLGS--HSWTVKFPEELKQ  423



>gb|EMT20380.1| hypothetical protein F775_22834 [Aegilops tauschii]
Length=645

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 94/364 (26%), Positives = 164/364 (45%), Gaps = 69/364 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLLT  VQ   V  V+Y++   +S  ++   ++F+VG +K +ER  +L+ A
Sbjct  103   LEDNQLWPRHLLTLGVQTVGVCYVMYKHMTHESAMVVAASLMFMVGFLKYLERTWALKRA  162

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             +   +R SI     +  S++      K+ T +  ++ E++  A+         + D+S  
Sbjct  163   TLDNIRSSI----KARPSRDAPVGSKKNHTRD-PDEEELLLFAHHVLPTCMAALTDYS--  215

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
              ++ GK    +K  ++    KV+EMELS MYD ++TK   +  W G   YF  +   +  
Sbjct  216   -EDSGKVSRHWKGGHIG---KVVEMELSLMYDILYTKATMIHCWYG---YFLRVISLI--  266

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
             + L  + L  F+    H K  D+ +TY L GGA+ LD ++L+    S W        T D
Sbjct  267   STLAALRLFHFYGKHGHAKI-DVIITYILFGGALFLDTVSLVKAAMSTW--------TCD  317

Query  800   TPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSG  621
               +  K    KT+                           ++I    +L+   +++ WSG
Sbjct  318   L-LDNKGGWGKTLS--------------------------NVIQSSRRLVKAASTRGWSG  350

Query  620   EIIQYSLL--------KHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKLKNLV  465
              + QY+L         K S+   R+   DD+ + +  KG         T  ++  ++ L+
Sbjct  351   SVGQYNLFHVCSRDTTKTSIRVLRMMKLDDWWKKYQHKG---------TLVIQRDVRELL  401

Query  464   FEDI  453
             +E I
Sbjct  402   YEAI  405



>ref|XP_010675838.1| PREDICTED: uncharacterized protein LOC104891781 [Beta vulgaris 
subsp. vulgaris]
Length=754

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 80/276 (29%), Positives = 136/276 (49%), Gaps = 54/276 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE-----WLLPTGIVFLVGIVKCVERIL  1356
             +EDN LW RHLL    Q    + + Y  K F++       L+   I+++ G VK +ER  
Sbjct  102   LEDNELWLRHLLQLATQSAGTIYLFY--KAFRTNSGDDHLLIAAIIMYVNGCVKYLERTT  159

Query  1355  SLQLASSRFVRKS-----------------------------IGKSLDSVASKELIRAE-  1266
             SL LAS    R+S                             I  +L++VA      A  
Sbjct  160   SLYLASMDTYRESLLGKPDAGPNYAALMEEYASRKAANIPVDIKSNLETVAHISSTNANV  219

Query  1265  -GKDMTDNI-----MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWF--KNLNVE  1110
              G   T ++       + E+V++A+E +  F+G I D  F   E  + +++F  K  N  
Sbjct  220   VGDCETGSVDHCARTKEMELVQQAHELYLKFRGLIADTMFTFKERIESREFFLGKIKNGN  279

Query  1109  DAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVA-LIFFFHSKL  933
              AFK++++EL+F++D  +TK+  +Q+ +GI   F        +++ VT + L+F+F S  
Sbjct  280   QAFKIIQIELNFLFDVFYTKVNTLQRARGITRVF--------SSVSVTASCLLFYFMSTH  331

Query  932   HMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMV  825
             + +  D+ +TY L+GGA+ ++ +A+I L F  WA+V
Sbjct  332   NYRKLDVYITYVLLGGALFMEVIAVIMLSFCDWAVV  367



>ref|XP_010034671.1| PREDICTED: uncharacterized protein LOC104423940 [Eucalyptus grandis]
Length=715

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 95/378 (25%), Positives = 164/378 (43%), Gaps = 69/378 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R L    VQ+     + +      + W+L  G++ LVG ++  ER L L LA
Sbjct  111   LEDNELWLRQLARLCVQVGLAFYIYFLALWGSTLWILAAGMI-LVGFIRYAERTLCLYLA  169

Query  1340  SSRFVRKSIGKSLD-------SVASKELIRAEG-----------KDMTDNIMNQYE-IVR  1218
             S   ++ S+    D       +VA   L + EG             + D+ +  ++  + 
Sbjct  170   SEGRLQGSMLPRPDFGSVYPRNVARYTLKKEEGYRVGIDELTRIPALEDHSVKDFQATLD  229

Query  1217  KAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVE--DAFKVMEMELSFMYDAMFTKMI  1044
             KAYE   IFK   +  +    + G  +  FK  +++   AFK++E+EL FMYD ++TK  
Sbjct  230   KAYELFNIFKLLFVGLNVSFVDLGVSRPMFKGPDMKAVKAFKIVEIELGFMYDLLYTKAP  289

Query  1043  AVQQWKGIASYFWCIWRFVCNALLVTVALIFF-FHSKLHMKPGDIGVTYCLVGGAVLLDQ  867
              + +        W I R+V +  L    L+FF FH K      DI +T+ L+ GA+LL+ 
Sbjct  290   LLNR-------RWGIIRWVISLFLPCAMLVFFSFHDKKDYSKVDICITFSLISGAILLEI  342

Query  866   MALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQK  687
              +LI  I S W    ++   +  P    +    T  +  +R L+  +             
Sbjct  343   FSLILAISSDW----VQHWRIQRPKGSAISSAITFFS-FSRSLRWSR-------------  384

Query  686   IISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLH  507
                                WS  + Q+SLL  S+  R+ K    +    +L  V++   +
Sbjct  385   -------------------WSNSVAQFSLLGSSM--RKRKGIFRYPRLAMLGDVVERNFY  423

Query  506   TQTAKVEEKLKNLVFEDI  453
                 +++E++K L+F+ +
Sbjct  424   IDYKELKEEIKELIFKQM  441



>ref|XP_002863480.1| hypothetical protein ARALYDRAFT_916927 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39739.1| hypothetical protein ARALYDRAFT_916927 [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 123/262 (47%), Gaps = 38/262 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R L      +C  ++ LY + +   +  L+PT ++ + G++K VERI +L+ 
Sbjct  107   IEDNDLWLRSLFGL---VCQAIITLYVFFLSIPNRLLVPTSLMLVAGVIKYVERIKALRG  163

Query  1343  ASSRFVRKSI------GKSLDSVASKELIRAEGKDMTDNI--------------------  1242
             AS    + S+      G     +  +  IR   K+ T  I                    
Sbjct  164   ASLETFKDSMLGEPDPGPDYARLMEEYSIRKVHKEPTRIIRYEEAEKGQRPKVFVRPNTE  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDH--SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMY  1068
             +   E V+ AY+   IFKG ++D   S   +E    K++F     E+A +V+E+ELSF+Y
Sbjct  224   LTDLEAVQYAYKYFNIFKGLVVDLMLSSQSEELNNSKEFFILSTPEEALRVLEVELSFIY  283

Query  1067  DAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVG  888
                +TK+  +  W GI+      +R +  A LV+   IF    K      DIG+TY L+ 
Sbjct  284   GTFYTKVNILHTWIGIS------FRLIALASLVSSLCIFATMKKSEYDQFDIGLTYVLLI  337

Query  887   GAVLLDQMALIHLIFSHWAMVK  822
             G + LD +A+  L  S W   +
Sbjct  338   GGIALDLVAIFILCVSDWTFAR  359



>ref|XP_006281933.1| hypothetical protein CARUB_v10028141mg [Capsella rubella]
 gb|EOA14831.1| hypothetical protein CARUB_v10028141mg [Capsella rubella]
Length=689

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 94/344 (27%), Positives = 151/344 (44%), Gaps = 45/344 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R L      +C  +V  Y + +   +   +PT ++ + GI+K VERI +L+ 
Sbjct  107   IEDNDLWLRSLFAL---VCQAVVTFYVFLLSIPNNIFVPTSLMLVAGIIKYVERIKALRG  163

Query  1343  AS------------------SRF-----VRKSIGKSLDSVASKELIRAEGKDM---TDNI  1242
             AS                  +R      VRK + +    V  +E+ + +   +   + N 
Sbjct  164   ASLETFKDSMLEDPDPGPDYARLMEEYQVRKMLREPTQIVRIEEVEKGQRPKVLVRSPNK  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSF--LHDECGKEKDWFKNLNVEDAFKVMEMELSFMY  1068
             +   E V+ AY    IFKG ++D  F    +E    K++F+ L  E+A  V+E+ELSF+Y
Sbjct  224   LTDLEAVQYAYRYFNIFKGLVVDLMFSSQSEELNNSKEFFQQLEPEEALSVLEVELSFVY  283

Query  1067  DAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVG  888
                +TK+  +  W GI+      +RF+  A LV+   IF    K      D+ +TY L+ 
Sbjct  284   GTFYTKVNILHTWIGIS------FRFMALASLVSSLCIFATAKKSDYNRFDVDLTYVLLI  337

Query  887   GAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPV  708
               + LD +A+     S W   + +    D      L           RKLK K    +  
Sbjct  338   SGIALDLVAIFIFCVSDWTFARFKKPKEDDDGKGSLVGAVFNWILSFRKLKWKPYDCSHR  397

Query  707   ARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR  576
              +  K K   L     K I     + WS  I  Y+L+++SL  R
Sbjct  398   VKGSKTKCEVL---DRKFIF----RRWSEYIYSYNLIEYSLGIR  434



>ref|XP_010034373.1| PREDICTED: uncharacterized protein LOC104423604 [Eucalyptus grandis]
Length=566

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 126/259 (49%), Gaps = 35/259 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL   + + S   V YQ  +  ++ ++P+ ++F+ G +K   R  +L LA
Sbjct  113   LEDNELWGRHLLNFFIHLFSACYVFYQ-SLPGNKLIVPSILMFIGGSIKYGARTRALYLA  171

Query  1340  SSRFVRKSIGKSLDS-----------VASKEL-------------IRAEGKDMTDNIMNQ  1233
             S R +R S+  S D            VA +E              + AEG+   D+    
Sbjct  172   SFRILRGSLLPSPDPGPNYAKIMEGCVAQEEANSQPLIASLPSSDVGAEGEKFLDD----  227

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
               ++++A+   + FKG ++D  F   +  +   +F++   +DAF+V+E+EL+F YD ++T
Sbjct  228   RTVIKEAFFYFKKFKGLLVDLIFSFQDRKESMRFFRSRTAKDAFRVIEVELNFFYDLLYT  287

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   V    G       I+R +  + +V     F+  +K      D+ +TY L+ GA+ L
Sbjct  288   KSGIVHCPSGY------IYRAISVSCIVAAFASFYVLNKHGFHKYDVQITYALLLGAIGL  341

Query  872   DQMALIHLIFSHWAMVKIE  816
             +   L  +I S W + K E
Sbjct  342   ELAILGMIICSDWTIAKTE  360



>gb|KDO39532.1| hypothetical protein CISIN_1g004958mg [Citrus sinensis]
Length=721

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 110/245 (45%), Gaps = 23/245 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL     Q  +V V ++   +  ++ L PT +VF+ G++K  ERI +L LA
Sbjct  111   LEDNELWLRHLFGLAFQAVAV-VYIFLLSLPGNKLLFPTVLVFIAGMIKSFERIRTLHLA  169

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIID--HS  1167
             S    R S  +    V  +  +  EG D  D           A +  Q FKG ++D  H 
Sbjct  170   SQEKFRDSTARKF--VEHRLNVIKEGADYLD----------AASQYFQFFKGIVVDLLHH  217

Query  1166  FLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFV  987
             F           F     E A  ++E+EL+  Y+   TK+  +    GI      I RF 
Sbjct  218   FHAYGLAIRGPSFGTFGPEKALGIIEVELNLFYEIFHTKIQVICSLLGI------ILRFT  271

Query  986   CNALLVTVALIFFFHSKLHMKPG--DIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEM  813
                 +V    IF+F  + H +    D+ VTY L  GA+ LD +A   LIFS W    +  
Sbjct  272   SLGSVVAALSIFYFRVEKHGRFNEFDVRVTYTLFLGAIALDIIAFFMLIFSDWTFTVLRN  331

Query  812   ETVDT  798
             + V +
Sbjct  332   DDVKS  336



>ref|XP_006280549.1| hypothetical protein CARUB_v10026489mg, partial [Capsella rubella]
 gb|EOA13447.1| hypothetical protein CARUB_v10026489mg, partial [Capsella rubella]
Length=415

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 125/286 (44%), Gaps = 51/286 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RH+   + Q I  V VVL       S W++   +VF+ G +K VER  +L  
Sbjct  111   LEDNALWFRHVFGLVFQAIAGVYVVLLSLP--NSLWVI-ILLVFISGTIKYVERTAALYS  167

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTD----------------------------  1248
             AS    R S+ ++LD   +   +  E K   D                            
Sbjct  168   ASFDKFRDSMIQALDPGPNYAKLMEEYKAKKDARLPIKIILIDEPDKEHSPPKLGHPSLA  227

Query  1247  ----NIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLN-VEDAFKVMEME  1083
                   +   EI +  Y+    FKG +++  F   E     + F+NLN  E+A +++E+E
Sbjct  228   LTNRKELTHLEIAQYGYKFFNTFKGLVVNLIFSFRERDGSLEIFENLNSPEEALRIIEIE  287

Query  1082  LSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSK----LHMKPGD  915
             L F+YDA+FTKM  +    G+AS      R V +  L  VA    FH K    +     D
Sbjct  288   LGFLYDALFTKMAVLHSLGGLAS------RIVASGTL--VAAFINFHKKPKKDIQFHGAD  339

Query  914   IGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEM--ETVDTPVARK  783
             + VTY L    + LD ++L+  +FS W  V +    +  D P+  K
Sbjct  340   VVVTYTLFAVGIALDFISLVLFLFSDWTCVTLSSLKDDPDEPLTSK  385



>ref|XP_010904720.1| PREDICTED: uncharacterized protein LOC105032071 [Elaeis guineensis]
Length=676

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/382 (24%), Positives = 159/382 (42%), Gaps = 73/382 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +V + ++   + Q+    P  ++FL GI+K  ER  +L  A
Sbjct  108   LEDNELWMRHLLGLLFQV-AVAIYVFIGSLPQTRLKAPAALMFLAGILKYGERSWALMCA  166

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMT---------------------DNIMNQYE-  1227
             S   +R S+    D   +      E   M+                     D ++     
Sbjct  167   SMDNLRNSMVTPPDPGPNYAKFMEEYASMSAAGLQAEIEVEKEPEAQPRSLDTVVEDIST  226

Query  1226  --IVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
               I+ KA+     FK  I+D      +  + + +F   +   AFKV+E+ELSF+Y+ ++T
Sbjct  227   VMILSKAHRFFHTFKRLIVDLILSFHDRNESQSFFLKRSPLQAFKVIEIELSFIYEVLYT  286

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   +    G         R +  + +++  L+F F  K      D+ +TY L+GGA++L
Sbjct  287   KSTVIHTVVG------PFLRSITFSSILSALLLFLFTKKHGYTDIDVAITYILLGGALVL  340

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             +  A+  L+FS WA +K+          + LKQ                           
Sbjct  341   ESYAVGLLVFSDWAFLKL----------KDLKQ---------------------------  363

Query  692   QKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRR--LKCADDFLEHFLLKGVID  519
              ++ ++I+         N   WS  + Q++L+   L  +   +K    FL    +K   D
Sbjct  364   YRLSNMIFASISFFRPTNRPRWSNSMAQHNLISFCLDDQPSTIKRVMVFLS---VKEAWD  420

Query  518   SCLHTQTAKVEEKLKNLVFEDI  453
                HT    V + LK  +F++I
Sbjct  421   RFFHTIYCPVHDHLKRFIFKEI  442



>gb|KCW51835.1| hypothetical protein EUGRSUZ_J01287 [Eucalyptus grandis]
Length=508

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 126/259 (49%), Gaps = 35/259 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL   + + S   V YQ  +  ++ ++P+ ++F+ G +K   R  +L LA
Sbjct  113   LEDNELWGRHLLNFFIHLFSACYVFYQ-SLPGNKLIVPSILMFIGGSIKYGARTRALYLA  171

Query  1340  SSRFVRKSIGKSLDS-----------VASKEL-------------IRAEGKDMTDNIMNQ  1233
             S R +R S+  S D            VA +E              + AEG+   D+    
Sbjct  172   SFRILRGSLLPSPDPGPNYAKIMEGCVAQEEANSQPLIASLPSSDVGAEGEKFLDD----  227

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
               ++++A+   + FKG ++D  F   +  +   +F++   +DAF+V+E+EL+F YD ++T
Sbjct  228   RTVIKEAFFYFKKFKGLLVDLIFSFQDRKESMRFFRSRTAKDAFRVIEVELNFFYDLLYT  287

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   V    G       I+R +  + +V     F+  +K      D+ +TY L+ GA+ L
Sbjct  288   KSGIVHCPSGY------IYRAISVSCIVAAFASFYVLNKHGFHKYDVQITYALLLGAIGL  341

Query  872   DQMALIHLIFSHWAMVKIE  816
             +   L  +I S W + K E
Sbjct  342   ELAILGMIICSDWTIAKTE  360



>ref|XP_010063694.1| PREDICTED: uncharacterized protein LOC104450714 [Eucalyptus grandis]
Length=713

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 126/245 (51%), Gaps = 23/245 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++D++LW RHLL+   Q+   + V  Q        ++PT ++F  G++K VERIL+L L+
Sbjct  54    LQDSSLWQRHLLSLFFQVSVSIYVFVQTFSSDKSLVIPTILIFFAGVIKNVERILALFLS  113

Query  1340  SSRFVR--KSIGKSLDSVAS--KELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFKG--  1185
             S    R   ++GK   +++   KEL   E     +      E  +V+ AY    IFK   
Sbjct  114   SLPIFRVIGALGKQDVALSELKKELDVLECGHSNEERAKLAESIVVKHAYFFFNIFKASA  173

Query  1184  -FIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQ-QWKGIASY  1011
              F+      H  C     +F  +   DA +++ +EL+FMY+ + TK + ++ +W    SY
Sbjct  174   DFVWLRKNRHVSC----KYFHKVCAIDALRLISVELNFMYEVLHTKALVIRSKW----SY  225

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                I+RF+   + +TVA + F   K H  P  D+ +TY L+ G + LD +AL   +FS W
Sbjct  226   ---IFRFIA-FIEITVAFVLFHRFKKHQLPKFDVTITYILLLGGIALDVIALFIFVFSDW  281

Query  833   AMVKI  819
              + KI
Sbjct  282   TIAKI  286



>gb|EMT32449.1| hypothetical protein F775_04044 [Aegilops tauschii]
Length=738

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/237 (30%), Positives = 118/237 (50%), Gaps = 22/237 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL   +Q+   + VLY++   +   L L + ++F VG VK  E+  +L  
Sbjct  99    LEDNKLWKRHLLHATLQVLGAVYVLYEHVADKGALLRLASALMFTVGAVKYGEKTWALMR  158

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEI-----VRKAYECHQIFKGFI  1179
              +   +R S+ K   ++      R       D + N+ E+     VR+A+    I K  I
Sbjct  159   GNLDTIRGSVKKQPPAMHRHFHPR-------DTVFNKEELDEESLVRRAHSLFHICKRAI  211

Query  1178  IDHSFLHDEC--GKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFW  1005
             +D+  + D+   G+E+   K L     +++ME ELS MYD ++TK   +  W G +   +
Sbjct  212   VDYPVIEDDAADGEERT-TKMLFRVKLWRLMETELSLMYDMLYTKAPVIHTWFGYSVRIF  270

Query  1004  CIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                 F   A L    L+F    K   +  D+ +TY L GGA+L++ M+L++ + S W
Sbjct  271   SP--FAIGASL----LLFNLVGKHAHRGADVNITYVLYGGALLMETMSLLNALGSSW  321



>ref|XP_006280036.1| hypothetical protein CARUB_v10025913mg [Capsella rubella]
 gb|EOA12934.1| hypothetical protein CARUB_v10025913mg [Capsella rubella]
Length=787

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/261 (27%), Positives = 126/261 (48%), Gaps = 36/261 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL   + Q + +V V+L       +  L PT I+ + G++K VER  +L  
Sbjct  109   LEDNELWNRHLFGLVCQALATVYVILLS---IPNRLLTPTIIMLVGGVIKYVERTAALFS  165

Query  1343  ASSRFVRKSIGKSLDSVAS-----------------KELI----RAEGKDMTDNI-----  1242
             AS    ++S+ +  D  A+                  E+I      EG++    +     
Sbjct  166   ASLDKFKESMLQDPDPGANYAKLMEEYEAKRNMNMPTEVIMMEDPEEGREGKTPVRPEAK  225

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
             +   ++V+ AY+ + IFKG ++D  F   E  + +++F +L  E+A +++E+EL  +YD 
Sbjct  226   LTPLQVVQYAYKYYNIFKGLLVDLIFTIQERDESREFFDSLTAEEALRIIEVELGLIYDC  285

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGA  882
             +FTK   +    G+      ++RF+    LV    +F    K      D+ +TY L+   
Sbjct  286   LFTKAEILHNKTGV------VFRFIALGCLVASLCLFMMTKKNQYDGFDVALTYALLICG  339

Query  881   VLLDQMALIHLIFSHWAMVKI  819
             + LD +AL+    S W + ++
Sbjct  340   IALDFIALLMFSVSDWTIARL  360



>ref|XP_006653146.1| PREDICTED: uncharacterized protein LOC102710869 [Oryza brachyantha]
Length=669

 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 89/330 (27%), Positives = 144/330 (44%), Gaps = 56/330 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTG-IVFLVGIVKCVERILSLQ  1347
             +EDN LWHR LL   +Q +     VLY+     S  LLP   ++F VG+ K  ERI +L 
Sbjct  123   LEDNKLWHRKLLVDCIQQVLGAAYVLYKTFPASSGPLLPAAWLIFSVGVAKYAERIWALY  182

Query  1346  LASSRFVRKSIGKSLDSVA---SKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFII  1176
               +   +R ++ K   + A     E  R+          +  +++  A+   Q+ KG ++
Sbjct  183   NGNISTIRSAVDKQDTAAADDGGNEGQRSTQVPTVPGDRSPEDLLIFAHSQFQVCKGAMV  242

Query  1175  DHSFLHDECGK--EKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWC  1002
             D S ++D+  K  E  +      E+ + V +MELS +YD M+TK   +  W G     +C
Sbjct  243   DSSGVNDDTSKLGETIFSVRWKWEEKWTVFQMELSLLYDIMYTKAGVMHTWHG-----YC  297

Query  1001  IWRFVCNALLVTVALIFFFHSKLHMKPG--------------DIGVTYCLVGGAVLLDQM  864
             +  F  + L  T AL+ F  S+     G              D+ +TY L+ GA+LLD +
Sbjct  298   LRVF--SPLATTAALLLFHLSRRTSSMGATATTAMNSPPVLVDVFITYALLVGAILLDIV  355

Query  863   ALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKI  684
             +L+    S WA   +    V  P A     +                      R+L + +
Sbjct  356   SLMSAAGSGWAYAFL---VVGKPSAAMCSGR---------------------WRRLHRWL  391

Query  683   ISLIYYGHKLITVVNSKSWSGEIIQYSLLK  594
              SL     +L+     + WSG I QY++L+
Sbjct  392   ESL----RELVKAAGKRKWSGAIGQYNVLQ  417



>ref|XP_008225847.1| PREDICTED: uncharacterized protein LOC103325459 [Prunus mume]
Length=686

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 103/380 (27%), Positives = 165/380 (43%), Gaps = 70/380 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLY-QYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQ  1347
             +EDN LW RHLL   VQ   V+V LY  ++ + S+ L    I +F+VG++K  ER   L+
Sbjct  109   LEDNELWLRHLLGLFVQ---VVVALYVSFRAWSSKELNFLAIPMFIVGMIKFGERTWVLR  165

Query  1346  LASSRFVRKSIGKSLDS--------------------VASKELIRAEG-KDMTDNIMNQY  1230
              ASS   R S+    D                     V S EL R     D  D+     
Sbjct  166   SASSEHFRDSMLHDPDPGPNYARYMEEYCSKRAQGFRVNSVELGRDNSLVDAVDDGTQNV  225

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
              ++ KAY+  + FK    D      +      + +N N + AF+V+E EL FMYDA +TK
Sbjct  226   AMLDKAYDFFETFKLLCADLILSFHDIVLSHSFLENTNSDQAFEVIEFELGFMYDAFYTK  285

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
              + V    G      CI R V  ++ ++V + F F  K      D+ +TY L+ GA++L+
Sbjct  286   SVLVSSGLG------CILRGVTVSITLSVFIAFLFSKKQAYSGVDVIITYILLIGAIVLE  339

Query  869   QMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQ  690
               A+  L+ S     ++ +      VAR L                           L +
Sbjct  340   SYAVALLLSSD--RTRLWLNKHKNMVARLL--------------------------VLLR  371

Query  689   KIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFL-LKGVIDSC  513
               +S +  G+       +K WS  + QY+L+   L  +  KC    ++ FL +  +++  
Sbjct  372   SAVSSVPLGY-------NKRWSNTLGQYNLITFCLKAKPTKCIS--VQKFLFIYQLLEKY  422

Query  512   LHTQTAKVEEKLKNLVFEDI  453
              + + A +  +LK L+FE +
Sbjct  423   RYKELADIPTELKELIFEQL  442



>ref|XP_010494651.1| PREDICTED: uncharacterized protein LOC104771774 [Camelina sativa]
Length=789

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 131/266 (49%), Gaps = 34/266 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN +WHRH L   +Q  S   V+ Q  +  S W++   ++F+ G  K +ER ++L LA
Sbjct  111   LEDNAIWHRHFLGLALQAVSGAYVVIQ-SLPNSLWVIIL-LLFISGTFKYLERTIALYLA  168

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKD--MTDNIMNQY------------------EIV  1221
             SS   R S+ ++ DS  S E  R   +D  M      QY                  EI+
Sbjct  169   SSDKFRGSMLENPDS-DSNETRRPRKEDDLMPTENYTQYGTQKRPLRLENPGNLTHLEIL  227

Query  1220  RKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIA  1041
             + A+     FK  ++++ F  ++  + +++FKNL  E+A +++E+EL F+Y+ ++TK+  
Sbjct  228   QFAFWFFNNFKSLVVNNIFSSEQRDESREFFKNLEDEEALRILEVELGFIYEGLYTKVSV  287

Query  1040  VQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH--MKPGDIGVTYCLVGGAVLLDQ  867
             +  W G  +      R +    L++   IF + +K        DI +TY L    + LD 
Sbjct  288   LHTWIGALT------RTIALGCLLSAFGIFHYRTKKRHEFHGADIVITYTLFLVGIALDL  341

Query  866   MALIHLIFSHWAMV---KIEMETVDT  798
             ++L+ ++ S W      +I  + VD+
Sbjct  342   VSLLMILPSDWTFAFISRINEDEVDS  367



>ref|XP_010481574.1| PREDICTED: uncharacterized protein LOC104760361 [Camelina sativa]
Length=789

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 73/265 (28%), Positives = 131/265 (49%), Gaps = 32/265 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LWHRH L   +Q  S   V+ Q  +  S W++   ++F+ G  K +ER ++L LA
Sbjct  111   LEDNALWHRHFLGLALQAVSGAYVVIQ-SLPNSLWVIIL-LLFISGTFKYLERTIALYLA  168

Query  1340  SSRFVRKSIGKSLDSVASK-ELIRAEGKDMTDNIMNQY------------------EIVR  1218
             SS   R S+    D+ +++  L R E   M      QY                  EI++
Sbjct  169   SSDKFRGSMLDVPDTDSNETRLPRKEDDLMPTENYTQYGRQKRPLRLENPGNLTHLEILQ  228

Query  1217  KAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAV  1038
              A+     FK  ++++ F  ++  + +++FKNL  E+A +++E+EL F+Y+ ++TK+  +
Sbjct  229   FAFWFFNNFKSLVVNNIFSSEQRDESREFFKNLKDEEALRILEVELGFIYEGLYTKVSVL  288

Query  1037  QQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMK--PGDIGVTYCLVGGAVLLDQM  864
               W G  +      R +    L++   IF + +K   +    DI +TY L    + LD +
Sbjct  289   HTWIGALT------RTIALGSLLSAFGIFHYRTKKRHEFHGADIVITYTLFLVGIALDLV  342

Query  863   ALIHLIFSHWAMV---KIEMETVDT  798
             +L+ ++ S W      +I  + VD+
Sbjct  343   SLLMILPSDWTFAVISRINEDEVDS  367



>ref|XP_002457356.1| hypothetical protein SORBIDRAFT_03g005935 [Sorghum bicolor]
 gb|EES02476.1| hypothetical protein SORBIDRAFT_03g005935 [Sorghum bicolor]
Length=690

 Score = 94.0 bits (232),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 116/242 (48%), Gaps = 20/242 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGI--VKCVERILSLQ  1347
             +EDN LW RH LT + Q+     VLY++ +     L  TG VF++G+  VK  ER  SL+
Sbjct  105   LEDNKLWERHFLTLVAQVLGAGYVLYKH-VSDHGTLFVTGAVFMMGVGAVKFWERTWSLR  163

Query  1346  LASSRFVRKSIGKSLDS--VASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIID  1173
              AS   +R+S+     +  +   E          D    +    R A+    + K  ++D
Sbjct  164   QASFSIIRESVKTEAPARCIFFLEYETPPCGFKGDTAQEEELFKRHAHALFHVCKSAMVD  223

Query  1172  HSF---------LHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
              S           H + G+  + FK  + +  + +ME+ELS MYD ++TK   V  W G 
Sbjct  224   SSIDDDGSNTRSNHGDLGQVLEGFKKQDTKYKWMLMEIELSLMYDILYTKAAMVHTWFG-  282

Query  1019  ASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFS  840
                 +CI R V    + T  L+F+F  K      D+ +TY L GGA+LL+ ++L+  + S
Sbjct  283   ----YCI-RIVSVLTVSTSLLLFWFSVKAGYSRVDVVITYALFGGALLLEIISLLGALLS  337

Query  839   HW  834
              W
Sbjct  338   TW  339



>ref|XP_010434458.1| PREDICTED: uncharacterized protein LOC104718408 [Camelina sativa]
Length=769

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/257 (25%), Positives = 121/257 (47%), Gaps = 32/257 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R L   M Q  + L V +   I    W  PT ++ + G++K  ERI +++ A
Sbjct  111   LEDNELWLRSLFGLMCQFIATLYV-FLLSIPNRLWK-PTYLMLMAGVIKYFERIGAMRAA  168

Query  1340  S------------------SRFVRKSIGKSLDSVASKELIRAE-----GKDMTDNIMNQY  1230
             S                  SRF+ +   + + S    E +R E      +++  +++ Q 
Sbjct  169   SLERFKKLIPGEPEPGIDYSRFMEEYKIRKI-SREHSEFVRVEEPEERQREVRPHVITQL  227

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
               ++  Y+   I++G ++D  +  +   + K++F++L   +A  ++E+ELSF+Y  +FTK
Sbjct  228   HAIQYGYKYFNIYRGLVVDFLYSSEYWTESKEFFQSLEAVEALSILEVELSFIYGTLFTK  287

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
             +  +  W G+       +RF+    L     +F    K      D+G+TY L+ G +  D
Sbjct  288   VDILHTWTGLN------FRFISLGCLFASLYVFKTSRKDEYDGFDVGLTYALILGGIAFD  341

Query  869   QMALIHLIFSHWAMVKI  819
              ++++    S W   ++
Sbjct  342   FISILMFCISDWTFARL  358



>ref|XP_006414015.1| hypothetical protein EUTSA_v10024439mg [Eutrema salsugineum]
 gb|ESQ55468.1| hypothetical protein EUTSA_v10024439mg [Eutrema salsugineum]
Length=812

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 130/283 (46%), Gaps = 46/283 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW R L      +C  +  LY + +   +  L+PT ++ + G++K VERI +++ 
Sbjct  111   LEDNELWLRSLFGL---VCQFIATLYVFLLSIPNSLLVPTSLMLVAGVIKYVERIGAMRG  167

Query  1343  AS-SRFVRKSIGKSLDSVASKEL-----IRAEGKDMTDNI--------------------  1242
             AS  RF    +G+    +          IR   K+ +  +                    
Sbjct  168   ASLERFKDSMLGEPEPGIDYTRFMEEYKIRKISKERSQLVWVPEPKKEQAVKVSVSSEKE  227

Query  1241  -MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
              +   E+V+ AY+   I+KG ++D  +   +  + K +F+ L+ EDA +++E+ELSF+Y 
Sbjct  228   CLTHLEVVQHAYKYFNIYKGLVVDFIYSSHQWIESKQFFQLLSPEDALRILEVELSFIYG  287

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNAL--LVTVALIFFFHSKLHMKPGDIGVTYCLV  891
              +FTK+  +  W G A        F C AL  L T   IF    K      D+ +TY L+
Sbjct  288   TLFTKVDILHTWFGAA--------FRCIALGCLFTSLHIFKASKKDGYDGFDVSLTYALI  339

Query  890   GGAVLLDQMALIHLIFSHWAMVKI-----EMETVDTPVARKLK  777
              G + LD ++++    S W   ++     E++  DT   R L 
Sbjct  340   FGGIALDFISILIFCVSDWTFARLRKPKEELDKKDTMFDRFLN  382



>ref|XP_008362520.1| PREDICTED: uncharacterized protein LOC103426202 [Malus domestica]
Length=706

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 98/382 (26%), Positives = 166/382 (43%), Gaps = 77/382 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQY-KIFQSEWLLPTGI-VFLVGIVKCVERILSLQ  1347
             +EDN LW RHLL  +VQ   V+V LY + + + S+ L    I +F+VGI+K  ER   L+
Sbjct  126   LEDNELWLRHLLGVVVQ---VIVALYVFIRAWSSKVLNFLAIPIFVVGIIKFGERTWVLR  182

Query  1346  LASSRFVRKSI----------GKSLDSVASK--ELIRAEGKDMTDNIMNQY---------  1230
              ASS   R+S+           + ++  +SK  E  R E K   +   +           
Sbjct  183   SASSEHFRESMLPPPDAGPNYARYMEEYSSKKAEGFRVEPKTFIEAPTDHSYAVQADESS  242

Query  1229  -----EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
                   ++ KAY   + FK    D      +    + + K+   E+AF+V+E EL FMYD
Sbjct  243   SAQDAAVLSKAYSLFETFKRLCADLILTFHDIENSQSFLKHKTSEEAFEVIEFELGFMYD  302

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGG  885
               +TK + V  + G+     CI   +   + V +A +     + +MK  D+ +TY L+ G
Sbjct  303   MFYTKSLLV--YSGVGGILRCI--TLSFTVCVFLAFVLITEKQEYMKV-DVIITYILLVG  357

Query  884   AVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVA  705
             A++L+  A++ ++ S W  + +                                      
Sbjct  358   AIVLEFYAVVVILSSDWTRLWLS-------------------------------------  380

Query  704   RKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFL-EHFLLKG  528
              K K   + L++     I ++  K WS  + QY+L+   L  R  KC   F+ E   +  
Sbjct  381   -KHKNTAVDLLHRAVSSIPLIKDKRWSNTLGQYNLITFCLKERPAKCI--FINEDLFINR  437

Query  527   VIDSCLHTQTAKVEEKLKNLVF  462
             +++   +T    V ++LKNL+F
Sbjct  438   LLEKYRYTDLKDVSKELKNLIF  459



>gb|KFK23681.1| hypothetical protein AALP_AAs63807U000200 [Arabis alpina]
Length=784

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 123/255 (48%), Gaps = 31/255 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LWHRH L   +Q  S   V+ Q  +  + W++   ++F+ G  K +ER ++L LA
Sbjct  111   LEDNALWHRHFLGLALQAVSGAYVVIQ-SLPNTLWVIIL-LLFIAGTFKYLERTIALYLA  168

Query  1340  SSRFVRKSIGK------------SLD--SVASKELIRAEG-------KDMTDNIMNQYEI  1224
             SS   R S+ K             +D  S A  E+ R +        K    N M   +I
Sbjct  169   SSDKFRGSVLKVSTSDSDETNRPEMDEGSTAPSEMHRQDNARQQRPLKLEKPNTMTHLDI  228

Query  1223  VRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMI  1044
             ++ A+     FK  ++++ F  ++C + +++F  L+ E+A  ++E+EL F+Y+ ++TK+ 
Sbjct  229   LQFAFWFFNNFKSLLVNNVFNSEQCDESREFFSKLDHEEALTILEVELGFIYEGLYTKVS  288

Query  1043  AVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKL--HMKPGDIGVTYCLVGGAVLLD  870
              +  W G  +      R +    L++   IF F +K        DI +TY L    + LD
Sbjct  289   VLHTWVGAVT------RTIALGSLLSAFCIFHFRTKKSHEFHGADIVITYTLFLVGIALD  342

Query  869   QMALIHLIFSHWAMV  825
               +L+ ++ S W   
Sbjct  343   LASLLMVLPSDWTFA  357



>ref|XP_008349242.1| PREDICTED: uncharacterized protein LOC103412469, partial [Malus 
domestica]
Length=621

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 165/364 (45%), Gaps = 62/364 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQY-KIFQSEWLLPTGI-VFLVGIVKCVERILSLQ  1347
             +EDN LW RHLL  +VQ   V+V LY + + + S+ L    I VF+VGI+K  ER   L+
Sbjct  126   LEDNELWPRHLLGVVVQ---VIVALYVFIRAWSSKMLNFLAIPVFVVGIIKFGERTWVLR  182

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAE-GKDMTDNIM-------NQYEIVRKAYECHQIF  1191
                    +K+ G     V  K  I A  G D +D +            ++ KAY   + F
Sbjct  183   YMEEYSSKKAEGFR---VEPKTFIEAPIGFDHSDAVQANESSSAQNAAVLNKAYSFFETF  239

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             K    D      +    + +F++ + E+A +V+E EL FMYD  +TK + V  + G+   
Sbjct  240   KRLCADLILTFHDIENSQSFFQHRSSEEALEVIEFELGFMYDVFYTKSLLV--YSGLGGI  297

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
               CI   +   + V +A +     + +MK  D+ +TY L+ GA++L+  A++ L+ S W 
Sbjct  298   LRCI--TLSFTVCVFLAFVLITEKQEYMKV-DVIITYILLVGAIVLEFYAVVILLSSDWT  354

Query  830   MVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLI  651
             ++ +             K K T                   A  L  +++S        I
Sbjct  355   LLWLS------------KHKNT-------------------AVDLLLRLVS-------SI  376

Query  650   TVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFL-EHFLLKGVIDSCLHTQTAKVEEKLK  474
              ++ +K WS  + QY L+   L  R  KC   F+ E + +  +++   +     V ++LK
Sbjct  377   ALIKNKRWSNTLAQYDLITFCLKERPAKCI--FINEDWFINRLLEKYRYRDLKDVSKELK  434

Query  473   NLVF  462
             NL+F
Sbjct  435   NLIF  438



>gb|KFK28578.1| hypothetical protein AALP_AA7G015200 [Arabis alpina]
Length=1019

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 120/262 (46%), Gaps = 37/262 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW R L      +C  +V LY + +   +  L+PT ++ + G++K VERI ++  
Sbjct  435   LEDNELWLRSLFGL---VCQFIVTLYVFLLSIPNSLLVPTSLMLVAGVIKYVERIGAMHG  491

Query  1343  AS-SRFVRKSIGKSLDSV----------------ASKELIRAEGKDMTDNI---------  1242
             AS  RF    +G                         +L+R +       +         
Sbjct  492   ASLKRFKDSMLGDPEPGNDYTRFMEEYKIRKILKEPSQLVRIQKPKKEQGVVKVAVRPKR  551

Query  1241  -MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
              +   ++V+ AY+   I+KG ++D  +   +  + K +F +L  EDA +++E+ELSF+Y 
Sbjct  552   CLTPLQVVQHAYKYFNIYKGLVVDFIYTSQQWTESKQFFHSLLSEDALRILEVELSFIYG  611

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGG  885
              +FTK+  +  W  I + F CI        L T   IF    K      D+G+TY L+ G
Sbjct  612   TLFTKVDILHTW--IGATFRCI----ALGCLFTSLYIFKTSRKDGYDRFDVGLTYALIFG  665

Query  884   AVLLDQMALIHLIFSHWAMVKI  819
              + LD ++++    S W   ++
Sbjct  666   GIALDLISILIFSVSDWTFARM  687



>ref|XP_007214073.1| hypothetical protein PRUPE_ppa017743mg [Prunus persica]
 gb|EMJ15272.1| hypothetical protein PRUPE_ppa017743mg [Prunus persica]
Length=686

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 102/383 (27%), Positives = 172/383 (45%), Gaps = 76/383 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLY-QYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQ  1347
             +EDN LW RHLL   VQ   V+V LY  ++ + S+ L    I +F+VG++K  ER   L+
Sbjct  109   LEDNELWLRHLLGLFVQ---VVVALYVAFRAWSSKELNFLAIPMFIVGMIKFGERTWVLR  165

Query  1346  LASSRFVRKSI----------GKSLDSVASKELIRAEG-----------KDMTDNIMNQY  1230
              ASS   R S+           + ++   SK   RA+G             + D +++  
Sbjct  166   SASSEHFRDSMLHDPDPGPNYARYMEEYCSK---RAQGFRVNSVELGGDNSLVDAVVDGT  222

Query  1229  E---IVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             +   I+ KAY+  + FK    D      +      + +N N + AF+V+E EL FMYDA 
Sbjct  223   QNVAILDKAYDFFETFKLLCADLILSFHDIVHSHSFLENTNSDQAFEVIEFELGFMYDAF  282

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             +TK + V    G      CI R +  ++ ++V + F F  K      D+ +TY L+ GA+
Sbjct  283   YTKSVLVSSGLG------CILRGITVSITLSVFIAFLFSKKQAYSGVDVIITYILLIGAI  336

Query  878   LLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARK  699
             +L+  A+  L+ S    + +             KQK      VAR +             
Sbjct  337   VLESYAVALLLSSDRTRLWLN------------KQKNM----VARLM------------V  368

Query  698   LKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFL-LKGVI  522
             L +  +S +  G+       +K WS  + QY+L+   L  +  KC    ++ FL +  ++
Sbjct  369   LLRSAVSSVPLGY-------NKRWSNTLAQYNLITFCLKAKPTKCIS--VQKFLFIYQLL  419

Query  521   DSCLHTQTAKVEEKLKNLVFEDI  453
             +   + +   +  +LK L+FE +
Sbjct  420   EKYRYKELVDIPTELKELIFEQL  442



>ref|XP_006653150.1| PREDICTED: uncharacterized protein LOC102712803 [Oryza brachyantha]
Length=702

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 172/374 (46%), Gaps = 44/374 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQY---KIFQSEWLLPTGIVFLVGIVKCVERILSL  1350
             +ED+ LW RHL+T +VQ+     VLY++       S  L+P   +F+VG+VK  ER  +L
Sbjct  99    LEDSKLWLRHLITVVVQVLGAAYVLYKHFSGSGSGSPLLVPAISMFVVGVVKYGERTWAL  158

Query  1349  QLASSRFVRKSIGKSLDS-----VASKELIRAEGKDMTDNIMNQYE-IVRKAYECHQIFK  1188
             +      +R S+ K L +     +  K   R+  +       ++ E +VR A+    + K
Sbjct  159   RCGDMNTIRSSLKKELHTKCYYHIDDKPERRSFNEGHFKREADEEEFLVRCAHSLFHVCK  218

Query  1187  GFIIDHSFLHDECG-----KEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKG  1023
               I+D S   D+ G     ++K+ F  L  E  + +M +ELS MYD ++TK   +  W  
Sbjct  219   YAIVDSS---DDSGGDTHFRDKEIFNGLTDEQTYALMGIELSLMYDMLYTKTSVISGW--  273

Query  1022  IASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
             I  Y  CI R + +       +IF F+ K      D+ +TY L+ GA L++  +L+  + 
Sbjct  274   IIGY--CI-RVISSLATAGSLVIFQFNGKDGQNRVDVAITYVLLIGAFLMEVTSLLRALG  330

Query  842   SHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYG  663
             S W        T     A   K    V     R  + ++ V   V+ +   K + +  Y 
Sbjct  331   SSW--------TFSFLCATWWKWLNHVAMCSGRWHRFRRNV---VSLRHFLKAMGISRY-  378

Query  662   HKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHF-LLKGVID---SCLHTQTA  495
                   ++S+ WSG + QY++L H    R        +    ++ G+ D   +  ++ T 
Sbjct  379   -----CLSSRRWSGSMGQYNML-HFCTRRGTSFTSRLIGRLAIMLGLEDWWETVHYSGTV  432

Query  494   KVEEKLKNLVFEDI  453
             ++ +K+K +VF+ I
Sbjct  433   EILQKVKEMVFQHI  446



>ref|XP_004983450.1| PREDICTED: uncharacterized protein LOC101760534 [Setaria italica]
Length=686

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 108/472 (23%), Positives = 186/472 (39%), Gaps = 97/472 (21%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE----WLLPTGIVFLVGIVKCVERILS  1353
             +EDN LW RHLL+ + Q     VVL  Y  ++S      ++P  I+F+ G+ K  ER L+
Sbjct  106   VEDNELWLRHLLSLVSQ-----VVLAGYVYWKSRPGVRLMVPAIIMFMAGVTKYGERTLA  160

Query  1352  LQLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIM---------------NQYEIVR  1218
             L+ AS   +R S+    D   +      E +  TD  +                + E+ R
Sbjct  161   LRAASMGSLRSSMLTPPDPGPNYAKFVEECQSRTDAGLVAKIVIVPERPPDGDARVEVRR  220

Query  1217  KAY-----ECHQIFKGF---IIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDA  1062
               Y       H++F  F    +D      +      +F+ L +E AFKV+E+EL  MY++
Sbjct  221   VEYGDLVCSAHRLFHTFRRLFVDLILSFQDRTDSLAFFRRLEMEQAFKVVEIELVLMYES  280

Query  1061  MFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG---DIGVTYCLV  891
             + +K   +  W G           V       V+L+ F  +   M+     D+ ++Y L+
Sbjct  281   LHSKAPVIHGWLGRGLR-------VFTLAAPVVSLVLFARAAGDMRSNARVDVDISYVLL  333

Query  890   GGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTP  711
             GGA+ L+  A++ ++ S W    +       P A                          
Sbjct  334   GGAIFLETYAILLMVISPWTFADLRASERLRPAA--------------------------  367

Query  710   VARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSL--AGRRLKCADDFLE---  546
                         +++  +L        WS  + QY+L+ + L    R  K   + LE   
Sbjct  368   ----------GAVFWLIQLFQPETRPRWSNRMSQYNLISYCLNDEPRWYKGLMERLEWRW  417

Query  545   HFLLKGVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKK  366
             +F +K + DS  +T+   V ++LK LVFE +K +  +        K   HR +   + K 
Sbjct  418   NFRVKTMWDSWRYTKKIAVSKELKQLVFEQLKSKANSTMDPKTYRKLGEHRGQWALQRKG  477

Query  365   IHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYF-TADKTKGGD  213
             ++                       +   +L  H+AT++C++   D   GGD
Sbjct  478   LY-------------QQLGWSVDCEFDKSILLWHIATDLCFYANQDDIIGGD  516



>ref|XP_010494649.1| PREDICTED: uncharacterized protein LOC104771771 [Camelina sativa]
Length=800

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/269 (26%), Positives = 127/269 (47%), Gaps = 38/269 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R L      +C  +V LY + +   +  L PT ++ + G++K VERI +L+ 
Sbjct  107   IEDNDLWLRSLFAL---VCQAVVTLYVFLLSIPNNLLAPTSLMLVAGVIKYVERIQALRG  163

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEGKDM----------------TDNI  1242
             AS    + S+           + ++  + ++++R   + +                  N 
Sbjct  164   ASLETFKNSMLEDPDPGPDYARLMEEFSVRKMLREPTQIVRIEEVEKGQRPKVLVRPPNK  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSF--LHDECGKEKDWFKNLNVEDAFKVMEMELSFMY  1068
             +   E V+ AY+   IFKG ++D  F    ++    K++F +L  ++A +V+E+ELSF+Y
Sbjct  224   LTNLEAVQYAYKYFNIFKGLVVDLMFNSQSEQLNNSKEFFLSLKPKEALRVLEVELSFIY  283

Query  1067  DAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVG  888
                +TK+  +  W GI+      +RF+  A L++   IF    K      D+ +TY L+ 
Sbjct  284   GTFYTKVNILHTWIGIS------FRFMALASLLSSLCIFATAKKSDYNRFDVDLTYVLLI  337

Query  887   GAVLLDQMALIHLIFSHWAMVKIEMETVD  801
               + LD +A+     S W   + +    D
Sbjct  338   SGIALDLVAIFIFCVSDWTFARFKKPKED  366



>ref|XP_004303690.1| PREDICTED: uncharacterized protein LOC101298623 [Fragaria vesca 
subsp. vesca]
Length=703

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 100/388 (26%), Positives = 165/388 (43%), Gaps = 84/388 (22%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL  +VQ+   + V    + + S+ L    I +F+VG++K  ER   L+ 
Sbjct  127   LEDNELWLRHLLGLVVQVSVAVYVFL--RAWSSKMLNFLAIPIFIVGVIKFGERTWVLRS  184

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEG--------------------KDM  1254
             ASS   R S+           + ++  +SK   R+EG                       
Sbjct  185   ASSEHFRDSMLQDPDPGPNYARYMEEYSSK---RSEGFRVELGTFVEAPLVGNHLDPAAA  241

Query  1253  TDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
              D+  N   + R AY+  + FK    D      +    + +F+  + E+AF+V+E EL F
Sbjct  242   IDSNQNASSLSR-AYKFSETFKRLCADLILSFHDIVNSQSFFQTRSSEEAFEVIEFELGF  300

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD  +TK + V  + G+     CI       L V V + F    K   K  D+ +TY L
Sbjct  301   LYDVFYTKAVLV--YSGLGRILRCI----TLILTVVVFVAFLLEKKQAFKGVDVIITYIL  354

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDT  714
             +GGA++L+  +++ L+ S W  + +                                   
Sbjct  355   LGGAIILEMYSVVLLLSSDWTRLWLS----------------------------------  380

Query  713   PVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFL-EHFL  537
                 +     +SL+Y     I +V +KSWS  I QY+L+   L  R   C   FL + F 
Sbjct  381   ----RHHNVAVSLLYRLVSSIPLVKNKSWSNTIAQYNLITFCLKARPANCT--FLKKDFF  434

Query  536   LKGVIDSCLHTQTAKVEEKLKNLVFEDI  453
             L  +++   +     V ++LKN++FE +
Sbjct  435   LNRLLERYRYRDLKGVSKELKNMIFEQL  462



>gb|EMS50308.1| hypothetical protein TRIUR3_05861 [Triticum urartu]
Length=672

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 118/234 (50%), Gaps = 14/234 (6%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             ++DN LW RHL T +VQ+     VLY++      +L L   ++F VG VK  ER  +L+ 
Sbjct  99    LQDNQLWLRHLQTLVVQVLGAAYVLYKHIAGNGNFLVLAATLMFTVGAVKYGERTWALKC  158

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
             ++   +R S+ K   +  +    + +  D  D       ++R+A+    I K  I+D S 
Sbjct  159   SNLDSIRSSLKKERPTRHNHFHPQDQAGDHKDEEF----VLRRAHSLFHICKRAIVDSSV  214

Query  1163  LHDECGKEKDWFKNLN-VEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFV  987
               D   + +D  + L  ++  + +MEMELS MYD ++TK   +  W G     +C+ R +
Sbjct  215   --DGDSEYRDTTEMLGKIDMIWGLMEMELSLMYDILYTKAAVIHTWFG-----YCL-RVI  266

Query  986   CNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMV  825
                 +V   L+F F SK+     DI +TY L+  A+ ++  +L++ + S WA  
Sbjct  267   SPLAIVASLLLFQFSSKVGHSRVDIAITYVLLCSALFMETTSLLNAVGSTWAFA  320



>ref|XP_010317012.1| PREDICTED: uncharacterized protein LOC101243762 [Solanum lycopersicum]
Length=648

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/270 (26%), Positives = 131/270 (49%), Gaps = 21/270 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R+  T +    S   V Y     Q  +L +P  +VFL GI+KC ER      
Sbjct  103   LEDNDLWFRYAFTFVFMFLSSGYVFY-LSFSQVNYLWIPNVLVFLAGIIKCYER------  155

Query  1343  ASSRFVRKSIGKS--LDSVASKELIRAEGKDMTDNI----MNQYEIVRKAYECHQIFKGF  1182
             A +RF+  S+ KS  L     +++++ +  +   N     ++  E+++ AY   + +KG 
Sbjct  156   ARARFI-GSMDKSITLSHRKYEDVVKKKSSEEPHNFRARELDDVEVIQLAYTIFRAYKGV  214

Query  1181  IIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIA--SYF  1008
             +++H F  +E  + +   +N     AF++ + EL  ++D ++TK     +  G +  S +
Sbjct  215   LVEHKFTFEEYSRIQKLLQNRTDLFAFRIAQAELEILHDLLYTKAQIFHESFGNSARSVY  274

Query  1007  WCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
             W +      A L + +L+   +++    P D+G+TY L+ G + LD +A + L++S    
Sbjct  275   WVL----LTAALASFSLLVRNNNQKQFDPFDVGLTYSLLIGGMFLDAVAFVVLLYSSTFT  330

Query  827   VKIEMETVDTPVARKLKQKKTVDTPVARKL  738
             +         P+   +K  K +  P  R L
Sbjct  331   IATMSRAKTRPITWVVKFLKALKWPRPRAL  360



>emb|CAH65940.1| OSIGBa0147M20.2 [Oryza sativa Indica Group]
Length=688

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 98/384 (26%), Positives = 170/384 (44%), Gaps = 66/384 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLY-QYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +ED+ LW RHLLT +VQ+     VLY QY+   S  LL   ++F VG+VK  ER  +L  
Sbjct  99    LEDSKLWLRHLLTVVVQVLGAAYVLYKQYRGSGSPLLLAAVLMFAVGVVKYGERTWALMS  158

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE--------IVRKAYECHQIFK  1188
              +   +R ++ K   +      I  +   M+ +    ++        +VR A+    I K
Sbjct  159   GNIDTIRSTLKKEPHTKCHSH-IEYKPHQMSFSNEGHFKREADEEEFLVRSAHALFHICK  217

Query  1187  GFIIDHSFLHDECG----KEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
               ++D S  +D  G    ++    + L  E  + V E+ELS MYD ++TK+  +  W G 
Sbjct  218   YAVVDDSS-YDNTGDTRARDATILRGLTDEQKYAVTEIELSLMYDMLYTKVSVIHNWIG-  275

Query  1019  ASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFS  840
                 +CI   V         LIF F+ +      D+ +TY L+ GA LL+  +L+  + S
Sbjct  276   ----YCI-GLVSPLATAGSLLIFQFNGRGGQNIVDVAITYVLLLGAFLLEVTSLLRALGS  330

Query  839   HWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGH  660
              W    +         AR +  +  +             + +    + ++K++SL +   
Sbjct  331   SWTFASL-------CAARWIWLRHAI-------------LCSGRWHRFRRKVVSLRHL-F  369

Query  659   KLITV----VNSKSWSGEIIQYSLLK---------HSLAG--RRLKCADDFLEHFLLKGV  525
             K++ +    + S+ WSG + QY++L            L G   +L   +D+ E +   G 
Sbjct  370   KVMGISRYFIPSRRWSGSMGQYNMLHFCTRRDTSYSPLLGWLAKLLRQEDWWETYHYSGA  429

Query  524   IDSCLHTQTAKVEEKLKNLVFEDI  453
                      A++ EK+K LVF+ +
Sbjct  430   ---------AEIPEKVKELVFQHL  444



>emb|CDX83933.1| BnaC08g17120D [Brassica napus]
Length=520

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 103/217 (47%), Gaps = 38/217 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   + Q  S + VL       S   +PTG++ + G++K VERI +L LA
Sbjct  112   LEDNELWRRHLFGLICQAVSTVYVLCLS--IPSGIAVPTGLMIVAGVIKFVERIRALYLA  169

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             SS       GK   SV                       V+ AY+   I KG ++D    
Sbjct  170   SS-------GKFKGSV-----------------------VQYAYKLFNISKGLVLDLRLA  199

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
                  + K +  +L  E+A +V+E+ELSFMYD  FTK   +    G       ++RF+  
Sbjct  200   SRGWDESKRFVDSLTPEEALRVLEVELSFMYDDFFTKASILLTRVG------SVFRFIAF  253

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
               LV+   IFF   K + K  D+ +TY L+ G ++L+
Sbjct  254   GCLVSSLCIFFSKKKENYKRFDVSLTYALLIGGIVLE  290



>ref|XP_010654430.1| PREDICTED: uncharacterized protein LOC100251477 [Vitis vinifera]
 ref|XP_010654431.1| PREDICTED: uncharacterized protein LOC100251477 [Vitis vinifera]
 ref|XP_010654432.1| PREDICTED: uncharacterized protein LOC100251477 [Vitis vinifera]
 ref|XP_010654433.1| PREDICTED: uncharacterized protein LOC100251477 [Vitis vinifera]
 ref|XP_010654434.1| PREDICTED: uncharacterized protein LOC100251477 [Vitis vinifera]
Length=554

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 122/258 (47%), Gaps = 44/258 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL--------LPTGIVFLVGIVKCVE  1365
             +EDN LW RHLL  +VQ+    V  Y   +F   W         +P   +F+ GI+K  E
Sbjct  126   LEDNELWLRHLLGLVVQVG---VAFY---VFLRSWAGTRLTFLSIP---MFVAGIIKYGE  176

Query  1364  RILSLQLASSRFVRKSIGKSLDSVASK-ELIRAEG-----KDMTD-------NIMNQYEI  1224
             R   L  ASS  +R+S+  S D      E++R +      KD  D        I + Y +
Sbjct  177   RTWVLMSASSNHLRESLLPSPDPGPDYVEIMRGDTAIVFHKDKGDITSPDGKYIDDAYSL  236

Query  1223  VRKAYECHQI-FKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKM  1047
               KAY   +  F+    D      +    +   ++L+ E+AF+V+EME+SFMYD ++TK 
Sbjct  237   FDKAYSLFKNQFRHLYADLILSFSDRKNSEPIIRHLSPEEAFQVVEMEISFMYDVLYTKA  296

Query  1046  IAVQQWKGI----ASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
               V    GI    AS+F         + + T+ +  FF  K      DI +TY L+ GA+
Sbjct  297   TVVYSLLGILLRTASFF---------STISTLVIFCFFIDKHEFSNIDINITYLLLLGAI  347

Query  878   LLDQMALIHLIFSHWAMV  825
              L+  A+I LI S W +V
Sbjct  348   FLEIYAIIMLILSDWRIV  365



>ref|XP_006428081.1| hypothetical protein CICLE_v10027077mg [Citrus clementina]
 gb|ESR41321.1| hypothetical protein CICLE_v10027077mg [Citrus clementina]
Length=718

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 111/232 (48%), Gaps = 17/232 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN  W RHL   + Q+ + + V +   +  ++  +PT ++F+ G++K  ERIL+L LA
Sbjct  112   LEDNEFWPRHLFGFIFQVVAAVYV-FLLTLPGNKLFIPTILMFIAGVIKYFERILALYLA  170

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             S    R+S  + L     K  I  +       +  QY          +IFKG +++    
Sbjct  171   SVEKFRESTLRELAEHYQKRDIVIKKDRCYLEVGCQY---------FKIFKGILLELMSN  221

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
                      +F + + EDA  ++E+EL+ +Y+ ++TK+       GI        R +C 
Sbjct  222   FKRVNFAGPFFGDFSPEDALGIIEVELNLVYEVLYTKIQVTHSVLGIT------LRLICF  275

Query  980   ALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
               +V     F+FH + H     D+ VTY L  GA+ LD ++   LIFS W +
Sbjct  276   GSVVAALSFFYFHVEKHGFFEFDVCVTYALFLGAMALDIISFFFLIFSDWTL  327



>ref|XP_010481582.1| PREDICTED: uncharacterized protein LOC104760366 [Camelina sativa]
Length=801

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 89/345 (26%), Positives = 157/345 (46%), Gaps = 52/345 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R L      +C  +V LY + +   +  L PT ++ + G++K +ERI +L+ 
Sbjct  107   IEDNDLWLRSLFAL---VCQAIVTLYVFLLSIPNNLLAPTSLMLVAGVIKYLERIQALRG  163

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEGKDM----------------TDNI  1242
             AS    + S+           + ++  + ++++R   + +                  N 
Sbjct  164   ASLETFKNSMLEDPDPGPDYARLMEEFSVRKMLREPTQIVRIEEVEKGQRPKVLVRPPNK  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSF--LHDECGKEKDWFKNLNV-EDAFKVMEMELSFM  1071
             +   E V+ AY+   IFKG ++D  F    ++    K++F +L+  E+A  V+E+ELSF+
Sbjct  224   LTDLEAVQYAYKYFNIFKGLVVDLMFNSQSEQLNNSKEFFLSLDTPEEALSVLEVELSFI  283

Query  1070  YDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLV  891
             Y   +TK+  +  W GI+      +RF+  A LV+   IF    K      D+ +TY L+
Sbjct  284   YGTFYTKVNILHTWIGIS------FRFMALASLVSCLGIFVTAKKSDYNRFDVDLTYVLL  337

Query  890   GGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVA--RKLKQKKTVD  717
                + LD +A+     S W   + +    D  V RK      V   +   RKLK K    
Sbjct  338   ISGIALDFVAIFIFCVSDWTFARFKKPKED--VERKDTLVDVVFNSILSFRKLKWKACDC  395

Query  716   TPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLA  582
             +   +  K +++       K I     + WS  I  Y+L+++SL 
Sbjct  396   SHRVKGSKCEVLD-----RKFIF----RRWSEYIYSYNLIEYSLG  431



>gb|KFK23680.1| hypothetical protein AALP_AAs63807U000100 [Arabis alpina]
Length=767

 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 94/350 (27%), Positives = 158/350 (45%), Gaps = 59/350 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW R+L       C   V LY + +   +  L+PT ++ + GI+K VERI +L  
Sbjct  74    LEDNGLWLRNLFGLA---CQASVTLYVFLLSIPNNLLVPTSLMLVAGIIKYVERIKALSG  130

Query  1343  AS------------------SRFV-----RKSIGKSLDSVASKELIRAEGKDM---TDNI  1242
             A+                  +R +     RK + +    V  +E+ R +  ++    +  
Sbjct  131   ANLENFKDSMLGEPDPGPDYARLMEEYSTRKRLREPTRIVRIEEVERGQRPNVFMRPNRK  190

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSFLHD--ECGKEKDWFKNLNVEDA---FKVMEMELS  1077
             + + E+V+ AY    IFKG ++D  F  +  +    K++F +L  E+A    +++E+ELS
Sbjct  191   LTELEVVQCAYRYFNIFKGLVVDLVFSSNSEQWNNSKEFFLSLKPEEADEALRILEVELS  250

Query  1076  FMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYC  897
             F+Y   FTK+  +    G+A      +RF   A LV+   IF    K      D+G+TY 
Sbjct  251   FIYGTFFTKVDILHTRIGVA------FRFTALASLVSSLCIFTTAKKQDYNSFDVGLTYA  304

Query  896   LVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVA-----RKLKQ  732
             L+ G + LD +A+     S W   + +      P      Q   V+  +      RKLK 
Sbjct  305   LLTGGIALDFVAIFIFCVSDWTFARFK-----KPKEYVRDQVTRVEGVLNWLLDFRKLKW  359

Query  731   KKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLA  582
             K+  D   +++  QK + L     K I     + WS  I  Y+L+ +S+ 
Sbjct  360   KE-YDCSQSKEFPQKHLVL---DRKFIF----RRWSEYIYAYNLIGYSMG  401



>ref|XP_009347581.1| PREDICTED: uncharacterized protein LOC103939247 [Pyrus x bretschneideri]
 ref|XP_009347583.1| PREDICTED: uncharacterized protein LOC103939247 [Pyrus x bretschneideri]
Length=701

 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 99/385 (26%), Positives = 165/385 (43%), Gaps = 77/385 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQY-KIFQSEWLLPTGI-VFLVGIVKCVERILSLQ  1347
             +EDN LW RHLL  +VQ   V+V LY + + + SE L    I VF+VGI+K  ER   L+
Sbjct  126   LEDNELWLRHLLGLVVQ---VIVALYVFIRAWSSEVLNFLAIPVFVVGIIKFGERTWVLR  182

Query  1346  LASSRFVRKSI----------GKSLDSVASK--ELIRAEGKDMTD--------------N  1245
              ASS   R+S+           + ++  +SK  E  R E K   +              +
Sbjct  183   SASSEHFRESMLPPPDAGPNYARYMEEYSSKKAEGFRVEPKTFIEAPPDHSYAVQPDGSS  242

Query  1244  IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYD  1065
                   ++ KAY   + FK    D      +    + +FK+   + A +V+E+EL FMYD
Sbjct  243   SAQDAAVLSKAYILFETFKRLCADLILTFHDIENSQSFFKSKTFKKALEVIELELGFMYD  302

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGG  885
               +TK + V  + G+     CI   +   + V +A +     + +MK  DI +TY L+ G
Sbjct  303   VFYTKSLLV--YSGVGGILRCI--TLSFTVCVFLAFLLITEKQEYMKV-DIIITYILLVG  357

Query  884   AVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVA  705
             A++L+  A++ ++ S W  + +                                      
Sbjct  358   AIVLEFYAVVVMLSSDWTRLWLS-------------------------------------  380

Query  704   RKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFL-EHFLLKG  528
              K K   + L++     I  +  K WS  + QY+L+   L  R  KC   F+ E   +  
Sbjct  381   -KHKNTAVDLLHRAASSIPWIKDKRWSNTLAQYNLITFCLKERPAKCI--FINEDLFINR  437

Query  527   VIDSCLHTQTAKVEEKLKNLVFEDI  453
             +++   +T    V ++LK L+F  +
Sbjct  438   LLEKYRYTDLKDVSKELKKLIFRQL  462



>ref|XP_010039361.1| PREDICTED: uncharacterized protein LOC104428054 [Eucalyptus grandis]
Length=395

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 113/208 (54%), Gaps = 22/208 (11%)
 Frame = -3

Query  1400  IVFLVGIVKCVERILSLQLASSRFV-------RKSIG-------KSLDSVASKELIRAEG  1263
             +VFLVG++K  ERI++L L+S   +       R+S+G       ++L S   KE    + 
Sbjct  2     LVFLVGVIKNAERIVALNLSSLPRLKEWVLSQRESVGANVVPRIRTLLSTYHKEDEAIDY  61

Query  1262  KDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEME  1083
              +  +   ++  +V  AY   QIFK F+ D  F  +E     ++F++++  +A + M +E
Sbjct  62    SEEDEAKTSESTVVELAYYFFQIFKIFLEDLMFTFEEHNMSLEYFRHISAMEALRPMSLE  121

Query  1082  LSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGV  906
             L F+Y+ ++TK +A+   +   SYF   + FV N + V VA + F   K H +   D+ V
Sbjct  122   LQFIYEVLYTKTLAI---RFKLSYF---FHFV-NFMGVVVAFVLFNRLKKHQLSKLDVKV  174

Query  905   TYCLVGGAVLLDQMALIHLIFSHWAMVK  822
             TY L+ G ++LD +AL  LIFS W + +
Sbjct  175   TYILLFGGIVLDAIALSMLIFSDWTLAE  202



>ref|XP_010654879.1| PREDICTED: uncharacterized protein LOC100246334 [Vitis vinifera]
Length=734

 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 92/319 (29%), Positives = 134/319 (42%), Gaps = 62/319 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIV----FLVGIVKCVERIL  1356
             +EDN LW RHLL  +VQ+    V  Y   +F   W   P   +    F+ GI+K  ER  
Sbjct  109   LEDNELWLRHLLGLVVQVG---VAFY---VFLRSWAGTPLTFLSIPMFVAGIIKYGERTC  162

Query  1355  SLQLASSRFVRKSIGKSLD---------------------------SVASKELIRAEGKD  1257
              L+ AS    R S+    D                           ++  K L    G D
Sbjct  163   VLRSASKNHFRDSLLPVPDPGPDYAEFMKEYGSLKDKMDVARTRNKNIGEKPLQSTAGDD  222

Query  1256  MTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELS  1077
             +T  I     I +  +     FK    D     D+    + + K L+ EDAFKV+EMELS
Sbjct  223   IT--IPGGKYIDKAYFLFENQFKHLYADLILSLDDQKTSERFIKELSFEDAFKVVEMELS  280

Query  1076  FMYDAMFTKMIAVQQWKG----IASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIG  909
             FMYD ++TK   V    G    IAS+          + + T+A   FF  +      DI 
Sbjct  281   FMYDVLYTKATVVYSLLGILLRIASFL---------STISTLAAFCFFIDRHEFSNIDIN  331

Query  908   VTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKL-------KQKKTVDTPV  750
             +TY L+ GA+ L+  ALI LI S W++V   + +   P+A  +       +   T D   
Sbjct  332   ITYLLLFGAIFLEVYALIKLILSDWSIVW--LSSKKNPLADSIYRAITFFRSVLTSDKRW  389

Query  749   ARKLKQKKTVDTPVARKLK  693
             +R + Q   +D+ +  K K
Sbjct  390   SRHMAQNNLIDSCLEDKTK  408



>ref|XP_010068529.1| PREDICTED: uncharacterized protein LOC104455435 [Eucalyptus grandis]
Length=287

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 111/215 (52%), Gaps = 26/215 (12%)
 Frame = -3

Query  1415  LLPTGIVFLVGIVKCVERILSLQLAS-----------SRFVRKSIGKSLDSVASKELIRA  1269
             ++PT +VFL G++K  ERI++L L+S             FV  ++ + +++   + L++ 
Sbjct  1     MIPTILVFLAGVIKNAERIVALNLSSLPRLKEWVLSQREFVSANVARQIET-RFETLVKT  59

Query  1268  EGKDMTDNIMN-----QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDA  1104
               +  T N+ N     +  +V  AY   QI K FI D  F + E    +  F  +   +A
Sbjct  60    PLRQ-TSNLKNVAAPSESTVVEAAYLLFQIMKIFIGDLVFTYKERCNSRSIFYQIPAMEA  118

Query  1103  FKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH-M  927
              +++ +EL F+Y  + TK +A++      S   CI+RF+   + V +A + F   K H +
Sbjct  119   LRLLSVELQFIYQVLHTKTLAIR------SKLSCIFRFI-TFMGVAMAFVLFNRLKRHQL  171

Query  926   KPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVK  822
                D+ +TY L+ G ++LD +AL  LIFS+  + +
Sbjct  172   SKVDVKITYILLFGGIVLDVIALFMLIFSNRTLAE  206



>gb|EMT21234.1| hypothetical protein F775_07197 [Aegilops tauschii]
Length=701

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 152/320 (48%), Gaps = 43/320 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +ED+ LW RHLL+ +VQ+ +  +VL ++ +     L+   I +F+VG  K +ER  +L  
Sbjct  100   LEDSKLWGRHLLSLVVQVLAAAIVLSRHIVGGGTLLMVAAILIFVVGTAKYLERTRALW-  158

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYEC-HQIFKGFIIDHS  1167
              S++F   SI +S   V + ++   +      +  N  E+V +   C   I K  I+D  
Sbjct  159   -SAKF---SILQSSLKVRAHDMHHQQFYTEYQDWYNDGELVLQHAHCLFHICKRGIVDCV  214

Query  1166  FLHDECG--KEKDWFKNL-------NVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIAS  1014
                D+ G   E D+ +N        + E  ++VME+ELS MYD ++TK   +  W G   
Sbjct  215   IAVDDSGSQNEGDYLENTIIQGLLEDREHMWRVMEVELSLMYDILYTKAGVIHSWFG---  271

Query  1013  YFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
               +CI R +    + T  ++F   SK      D+ +TY L+GGA++L+  +L+  + S W
Sbjct  272   --YCI-RVITPPAVATSLVLFQLSSKDDYSLVDVAITYILLGGALVLETKSLLGALGSSW  328

Query  833   AMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLI-YYGHK  657
             A+  +     D                      +   V     R+L++ I SL   +  K
Sbjct  329   ALTFLCATQWD--------------------WLRHSAVCAGGWRQLRRAIFSLRQSWPVK  368

Query  656   LITVVNSKSWSGEIIQYSLL  597
             ++   +S+ WSG + Q+++L
Sbjct  369   VMMTGSSRRWSGTMGQHNML  388



>ref|XP_010529252.1| PREDICTED: uncharacterized protein LOC104806186 [Tarenaya hassleriana]
Length=794

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/237 (28%), Positives = 110/237 (46%), Gaps = 36/237 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  +    + Q  ++   WL P  ++F+ G +K +ER  +L  A
Sbjct  111   IEDNALWQRHLLGLFSQALTGAYAVIQ-SMYNQLWL-PILLLFVTGTIKYLERTRALYSA  168

Query  1340  SSRFVRKSI----------GKSLDSVASKE-------LIRAEGKDM-------TDNIMNQ  1233
             S+   R S+           K ++ + SK+       +++ E  D         D  ++ 
Sbjct  169   STDKFRDSMHQEADPGPNFAKLMEELKSKKDSKLPTKIVKTEDADKFKRPLPKPDRFLSD  228

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
              EIV+  ++  + FKG +++  F   E    +D+F  L  E+A ++ME+EL  +YDA +T
Sbjct  229   LEIVQYGFKFFETFKGLVVNLIFSFRERDLSRDFFFKLTPEEALRIMEVELGLIYDAFYT  288

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCL  894
             K   +  WKG  S      R + +  LV    +F  H K   +      D+ +TY L
Sbjct  289   KTAVLHSWKGTVS------RVIASGSLVAAFSLFHLHYKSQKREEFRKLDLTITYTL  339



>ref|XP_002459209.1| hypothetical protein SORBIDRAFT_02g000570 [Sorghum bicolor]
 gb|EER95730.1| hypothetical protein SORBIDRAFT_02g000570 [Sorghum bicolor]
Length=768

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 127/243 (52%), Gaps = 15/243 (6%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL+  + ++ S  V+ +   +  +  +  T ++F+VGI+K  ER  SL   
Sbjct  143   LEDNELWLRHLIGLLFELFSACVIFF-CSLHGNPMIHATVLMFVVGIIKYAERTFSLYSG  201

Query  1340  SSRFVRKSI---GKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDH  1170
             S    R  I    +  +  A +     E ++ T  +  +  +  +AY+   +F+   ++ 
Sbjct  202   SVDGFRNKILDPPEPANGEAEQAHKEMENQETTRLVSKEKSVEARAYDFFLVFRRLFVNV  261

Query  1169  SFLHDECGKEKDWF---KNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCI  999
                  E  + + +F    N+   +AF+V+E+EL+F+YD ++TK        G     W +
Sbjct  262   ILSFKERRQSQAFFLERDNMKASEAFEVIEVELNFIYDMVYTKAPVAYTRTG-----WVL  316

Query  998   WRFVCNALLVTVALIFFFHSKL--HMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMV  825
              R +C+A LV+  LIFFF  K   H++P D+G+TY L+ G + LD  AL+ + FS+ A V
Sbjct  317   -RCICSACLVSALLIFFFLDKPAHHIQPVDVGITYALLLGGLALDAAALLMIFFSNRAQV  375

Query  824   KIE  816
              +E
Sbjct  376   YLE  378



>ref|XP_010034370.1| PREDICTED: uncharacterized protein LOC104423602 [Eucalyptus grandis]
Length=391

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 124/266 (47%), Gaps = 35/266 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL   + + S   V YQ  +  ++ ++P+ ++F+ G +K   R  +L LA
Sbjct  113   LEDNELWGRHLLNFFIHLFSACYVFYQ-SLPGNKLIVPSILMFIGGSIKYGARTRALYLA  171

Query  1340  SSRFVRKSIGKSLDS-----------VASKEL-------------IRAEGKDMTDNIMNQ  1233
             S R +R S+  S D            VA +E              + AEG+   D+    
Sbjct  172   SFRILRGSLLPSPDPGPNYAKIMEGCVAQEEANSQPLIASLPSSDVGAEGEKFLDD----  227

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
               ++++A+   + FKG ++D  F   +  +   +F++   +DAF+V+E+EL+F YD ++T
Sbjct  228   RTVIKEAFFYFKKFKGLLVDLIFSFQDRKESMRFFRSRTAKDAFRVIEVELNFFYDLLYT  287

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   V    G       I+R +  + +V     F+  +K      D+ +TY L+ GA+ L
Sbjct  288   KSGIVHCPSGY------IYRAISVSCIVAAFASFYVLNKHGFHKYDVQITYALLLGAIGL  341

Query  872   DQMALIHLIFSHWAMVKIEMETVDTP  795
             +   L+    S    V       D P
Sbjct  342   ELAILVTPSASMTPSVGFGGGPCDDP  367



>gb|EMT10076.1| hypothetical protein F775_01397 [Aegilops tauschii]
Length=719

 Score = 90.9 bits (224),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 88/326 (27%), Positives = 155/326 (48%), Gaps = 54/326 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTG--IVFLVGIVKCVERILSLQ  1347
             +ED+ LW RHLLT +VQI     VLY+Y I  S  LL     ++F+VG+ K  ER  +L 
Sbjct  128   LEDSKLWTRHLLTLVVQIAGAGYVLYKY-IAGSGILLTLAAILIFVVGVAKYSERTCALW  186

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHS  1167
              A+      S+  SL      +    + +D  +++ ++  I+++A+    I K  ++D S
Sbjct  187   FATF----SSLQSSLKVPEGDQHFYIQHQDWYNDLADE-RILQRAHSLFYICKRGMVD-S  240

Query  1166  FLHDECG--------KEKDWFKNL--NVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIA  1017
              +  E          +E+   K L  N E  ++VMEMELS MYD ++TK   +  W G  
Sbjct  241   VIELEASDRSRKVNSEERKIIKRLRKNRERMWRVMEMELSLMYDILYTKANVIHSWVGYG  300

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCLVGGAVLLDQMALIHL  849
                      + + L +  +L+ F   +L  K G    D+ VT+ L+GGA++L+  +L+  
Sbjct  301   IR-------IISPLAIVASLVLF---QLSYKDGYSRVDVAVTHTLLGGALVLETKSLLGA  350

Query  848   IFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIY  669
             + S WA+  +     D                      +   + T    +L++ +I+L  
Sbjct  351   LGSSWALGFLCATRWD--------------------WLRHSVLCTGRWHRLRRALIALRR  390

Query  668   -YGHKLITVVNSKSWSGEIIQYSLLK  594
              +  ++I   +S+ WSG + Q+++L+
Sbjct  391   SWPGEMIMTGSSRGWSGTMGQHNMLR  416



>gb|KCW51834.1| hypothetical protein EUGRSUZ_J01284, partial [Eucalyptus grandis]
Length=332

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 118/241 (49%), Gaps = 35/241 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL   + + S   V YQ  +  ++ ++P+ ++F+ G +K   R  +L LA
Sbjct  99    LEDNELWGRHLLNFFIHLFSACYVFYQ-SLPGNKLIVPSILMFIGGSIKYGARTRALYLA  157

Query  1340  SSRFVRKSIGKSLDS-----------VASKEL-------------IRAEGKDMTDNIMNQ  1233
             S R +R S+  S D            VA +E              + AEG+   D+    
Sbjct  158   SFRILRGSLLPSPDPGPNYAKIMEGCVAQEEANSQPLIASLPSSDVGAEGEKFLDD----  213

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
               ++++A+   + FKG ++D  F   +  +   +F++   +DAF+V+E+EL+F YD ++T
Sbjct  214   RTVIKEAFFYFKKFKGLLVDLIFSFQDRKESMRFFRSRTAKDAFRVIEVELNFFYDLLYT  273

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   V    G       I+R +  + +V     F+  +K      D+ +TY L+ GA+ L
Sbjct  274   KSGIVHCPSGY------IYRAISVSCIVAAFASFYVLNKHGFHKYDVQITYALLLGAIGL  327

Query  872   D  870
             +
Sbjct  328   E  328



>gb|EEE60456.1| hypothetical protein OsJ_13705 [Oryza sativa Japonica Group]
Length=693

 Score = 90.5 bits (223),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 93/323 (29%), Positives = 154/323 (48%), Gaps = 38/323 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE---WLLPTGIVFLVGIVKCVERILSL  1350
             ++DN LW RHL   +VQ+     VLY++ I +SE    LL T ++F+VG+VK  ER  +L
Sbjct  99    LQDNELWLRHLQILVVQVLRAGYVLYKHIIIRSEKTVLLLATILMFIVGLVKYSERTWAL  158

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFKGFII  1176
             +   S F   SI  SL  +   +L   +G   +++  N  +  ++++A+    I K  I+
Sbjct  159   R--CSNF--GSIRNSLKELPGNQLRWYKGYLQSEDYQNSSDEFLLQRAHSLFHICKRGIV  214

Query  1175  DH----SFLHDECGKEKDWFKNLNVEDA-FKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             D         D+ G  K   K L  E   +KVME+ELS MYD ++TK   +       S 
Sbjct  215   DSVIDVDADKDDTGTTKI-IKKLRKEPTLWKVMELELSLMYDILYTKAAVIH-----TSI  268

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
              + I      A+  +  L  F  SK + +  DI VTY L+GGA++++  +L+  + S WA
Sbjct  269   GYTIRTLSSIAIATSFLLFHFSGSKDNHRGVDIIVTYVLLGGALVMETTSLLSALGSSWA  328

Query  830   MVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLI  651
             +        D   A +    +       R  + ++ V +       +++I+ +  G+   
Sbjct  329   L--------DFLCAMRWSWLRHAALCTGRWHRLRRMVLS------LRRLITTMTAGY---  371

Query  650   TVVNSKSWSGEIIQYSLLKHSLA  582
              +  S+ WSG I Q +LL    A
Sbjct  372   -LNRSRGWSGTIGQLNLLSFRAA  393



>gb|KDO40246.1| hypothetical protein CISIN_1g004920mg [Citrus sinensis]
Length=723

 Score = 90.5 bits (223),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/233 (30%), Positives = 115/233 (49%), Gaps = 19/233 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R+L   + Q+ +  V ++   I  ++ L+PT ++F+ GI+K  ERIL+L LA
Sbjct  116   LEDNELWPRYLFGFVFQVVAA-VYIFLLTIPGNKLLIPTILIFIAGIIKYFERILALYLA  174

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGK-DMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
             S    R S          +EL++   K D+   I    + +    +  +IFKG ++D   
Sbjct  175   SVDEFRDS--------TLRELVKHYQKCDIV--IKKDTDYLEVGCQYFKIFKGILVDLMS  224

Query  1163  LHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVC  984
                       +F + + EDA  ++E+EL+ +Y+ ++TK+       GI        R +C
Sbjct  225   NFKRVNFVGPFFGDFSPEDALGIIEVELNLVYEVLYTKIQVTHSVLGITL------RLIC  278

Query  983   NALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
                ++    +F+F  + H     D+ VTY L  GA+ LD +A   LIFS W  
Sbjct  279   FGSVLAALSVFYFQVEKHGFIEFDVCVTYTLFLGAIALDIIAFSVLIFSDWTF  331



>ref|XP_010654435.1| PREDICTED: uncharacterized protein LOC100256613 [Vitis vinifera]
Length=690

 Score = 90.5 bits (223),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 86/312 (28%), Positives = 139/312 (45%), Gaps = 49/312 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFL------VGIVKCVERI  1359
             +EDN LW RHLL  +VQ+    V  Y   +F   W   T + FL       GI+KC ER 
Sbjct  90    LEDNELWLRHLLGSVVQVG---VAFY---VFMRSWA-GTRLTFLSIPMLVAGIIKCGERT  142

Query  1358  LSLQLASSRFVRKSI-------------GKSLDSVASKELIRAEGKDMTDN---------  1245
               L+ AS    R S+              K   S   +  +   G+++ +          
Sbjct  143   RVLRSASKNHFRDSLLPVPDPGPDYADFMKGYSSWKDERQVDRTGREIGEKPPQSTVGDG  202

Query  1244  -IMNQYEIVRKAYECHQI-FKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFM  1071
               +     + KAY   +  FK    D     D+    +   + ++ EDAFKV+EMEL+FM
Sbjct  203   ITVPSRNYIDKAYFLFKNQFKHLYADLILSLDDQKTSEGIIRYMSSEDAFKVVEMELNFM  262

Query  1070  YDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLV-TVALIFFFHSKLHMKPGDIGVTYCL  894
             YD ++TK   +    GI      + R    +  + T+A  +FF  K      DI +TY L
Sbjct  263   YDVLYTKATVIYSLLGI------LLRSTSFSFTISTLAAFYFFIDKHEFSNIDIDITYLL  316

Query  893   VGGAVLLDQMALIHLIFSHWAMVKI--EMETVDTPVARKLKQKKTV---DTPVARKLKQK  729
             + GA+ L+  A+  LI S W++V +  +M ++   + R +   ++V   D   +R++ Q 
Sbjct  317   LFGAIFLEVYAVTKLILSDWSIVWLSSKMNSLADSIYRAITSFRSVITSDKRWSRRMAQN  376

Query  728   KTVDTPVARKLK  693
               +D+ +  K K
Sbjct  377   NLIDSCLRDKTK  388



>gb|KDO38886.1| hypothetical protein CISIN_1g039951mg, partial [Citrus sinensis]
Length=585

 Score = 90.1 bits (222),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/232 (29%), Positives = 109/232 (47%), Gaps = 17/232 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN  W RHL   + Q+ +  V ++   +  ++  +PT ++F+ G++K  ERIL+L LA
Sbjct  112   LEDNEFWPRHLFGFIFQVVAT-VYIFLLTLPGNKLFIPTILMFIAGVIKYFERILALYLA  170

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             S    R S  + L     K  I  +       +  QY          +IFKG ++D    
Sbjct  171   SVEKFRDSTLRELAEHYQKHDIVIKKDRCYLEVGCQY---------FKIFKGILLDLMPN  221

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
                      +F + + EDA  ++E+EL+ +Y+ ++TK+       GI        R +C 
Sbjct  222   FKRINFAGPFFGDFSPEDALGIIEVELNLVYEVLYTKIQVTHSVLGIT------LRLICF  275

Query  980   ALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
               ++     F+FH + H     D+ VTY L  GAV LD ++   LIFS W  
Sbjct  276   CSVMAALSFFYFHVEKHGFFEFDVFVTYALFLGAVALDIISFSFLIFSEWTF  327



>ref|XP_006428080.1| hypothetical protein CICLE_v10027546mg [Citrus clementina]
 gb|ESR41320.1| hypothetical protein CICLE_v10027546mg [Citrus clementina]
Length=723

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/233 (30%), Positives = 115/233 (49%), Gaps = 19/233 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R+L   + Q+ +  V ++   I  ++ L+PT ++F+ GI+K  ERIL+L LA
Sbjct  116   LEDNELWPRYLFGFVFQVVAA-VYIFLLTIPGNKLLIPTILIFIAGIIKYFERILALYLA  174

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGK-DMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
             S    R S          +EL++   K D+   I    + +    +  +IFKG ++D   
Sbjct  175   SVDEFRDS--------TLRELVKHYQKCDIV--IKKDTDYLEVGCQYFKIFKGILVDLMS  224

Query  1163  LHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVC  984
                       +F + + EDA  ++E+EL+ +Y+ ++TK+       GI        R +C
Sbjct  225   NFKRVNFVGPFFGDFSPEDALGIIEVELNLVYEVLYTKIQVTHSVLGITL------RLIC  278

Query  983   NALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
                ++    +F+F  + H     D+ VTY L  GA+ LD +A   LIFS W  
Sbjct  279   FGSVLAALSVFYFQVEKHGFIEFDVCVTYTLFLGAIALDIIAFSVLIFSDWTF  331



>emb|CDX87779.1| BnaC02g31700D [Brassica napus]
Length=682

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 111/234 (47%), Gaps = 23/234 (10%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL    Q  + + V  Q         LP G+   +        +L  + A
Sbjct  109   LEDNELWLRHLLGLAFQAIATVYVFLQS--------LPNGLWRPI-------LLLMEEYA  153

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             + + ++  +   +  +   E     G  +  + + +  I++ AY+   IFK  ++D +F 
Sbjct  154   AKKLMK--MPTQIIKIEEPEKDPKAGAKVKPDDLTELNILQYAYKYFNIFKSLVVDLTFT  211

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               +  + K +F  +  ++A ++ E+EL+F+Y+A++TK   +  W G+      I+RF+  
Sbjct  212   FQQRAESKRFFSEIKPDEALRISEVELNFIYEALYTKAKILHNWIGV------IFRFIAL  265

Query  980   ALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
               L+    IF +  K      D+G+TY L+   + LD +ALI    S W  V++
Sbjct  266   GCLIAAIRIFQYKDKKDYGGFDVGLTYSLLIRGITLDCIALIMFCLSDWTFVRL  319



>gb|ABA94980.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ19036.1| hypothetical protein OsJ_34567 [Oryza sativa Japonica Group]
Length=731

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 163/384 (42%), Gaps = 68/384 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L+ + Q+     V ++ +      ++P  I+F+ GI K  ER L+L+ A
Sbjct  106   VEDNELWLRHFLSLLSQVALAGYVYWKSRP-GVRLMIPAIIMFVAGITKYGERTLALRAA  164

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIM----------------------NQY-  1230
             S   +R S+    D   +      E +  TD  +                       +Y 
Sbjct  165   SMGCLRSSMLTPPDPGPNYAKFVEECQSRTDAGLVAKIVIVQERPPDDDHHVEVKQQEYG  224

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             ++V  A+   QIF+   +D      +      +F+ L +E A+KV+E+EL  MY+ + +K
Sbjct  225   DLVYSAHRFFQIFRRLFVDLILSFQDRIDSLSFFRRLEMEQAYKVVEIELVLMYECLHSK  284

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
              + +    G    F+ +   V + +L T AL      + + K  DI +++ L+GGA+ L+
Sbjct  285   ALVIHGRLGRGLRFFTLAAPVVSLVLFTRAL---GDMRGYYKQVDINISFVLLGGAIFLE  341

Query  869   QMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQ  690
               A++ ++ S W    +       PVA                                 
Sbjct  342   TYAILLIVVSSWTYTDMRRTEALRPVA---------------------------------  368

Query  689   KIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRR--LKCADDFLE---HFLLKGV  525
                + +++   L        WS ++ QY+L+ + +  R    K   ++LE   +F +K +
Sbjct  369   ---AAVFWLIGLFQPEKRPRWSNKMSQYNLISYCVKDRSRWYKKPMEWLEWRWNFRVKTM  425

Query  524   IDSCLHTQTAKVEEKLKNLVFEDI  453
              DS  +T +  V E+LK+ +FE +
Sbjct  426   WDSWRYTTSIGVSEQLKSHIFEQL  449



>ref|XP_010034368.1| PREDICTED: uncharacterized protein LOC104423600 [Eucalyptus grandis]
Length=316

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 103/210 (49%), Gaps = 27/210 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +   V YQ  +  ++ ++ T  VF+ G +K +ER  +L LA
Sbjct  113   LEDNELWGRHLLNLLFQLGTACYVFYQ-SLPSNKLIVATIFVFIGGTIKYIERTCALYLA  171

Query  1340  SSRFVRKSIGKSLDS---------------VASKELIRAEGKDMTDNIMNQYEIVRKAYE  1206
                  R S+  SLD+               + S+++ +    D+ D      E+++ A  
Sbjct  172   RFSKFRGSLLPSLDADRDSDALIKMISEHNIKSRDVGKQHETDLGDR-----EVIKAASF  226

Query  1205  CHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWK  1026
                 FKG +++  F   +  +  ++F+    +DAF+V+E EL+F YD ++TK   VQ   
Sbjct  227   YFTTFKGLLVELPFGLSQMNRSWEFFRRTTAKDAFRVIEAELNFFYDVLYTKAAVVQCPT  286

Query  1025  GIASYFWCIWRFVCNALLVTVALIFFFHSK  936
             G       ++R +    +VT   +F+  +K
Sbjct  287   GY------LFRAISVGFIVTAFALFYVLNK  310



>ref|XP_003627290.1| hypothetical protein MTR_8g020780 [Medicago truncatula]
 gb|AET01766.1| DUF594 family protein [Medicago truncatula]
Length=771

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 136/563 (24%), Positives = 219/563 (39%), Gaps = 138/563 (25%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             MEDN LW R L+T + Q+    +   +        +L   I F+ G +K  ERI  L  A
Sbjct  129   MEDNALWSRRLVTYIGQVVVAFLTFLRSWTNADLNILAVPI-FIAGFIKIGERIWVLWCA  187

Query  1340  SSRFVRKSIGKSLDS--------------------VASKELIR--AEGKDMTD-------  1248
             SS+  ++S+    DS                    V  + LI+  A G    D       
Sbjct  188   SSQQFKESLFPDPDSGPNYARYMEAYNSASYEGYDVDVQGLIQTPAAGGTGVDHTHAPSQ  247

Query  1247  ------------NIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDA  1104
                         +I      VRKA++  +I K    D      +  + +    + N +  
Sbjct  248   GDINIPLPETDHDIYGPAITVRKAHKFLKISKLLFADLILSFQDVSESRSSLLSGNGKKG  307

Query  1103  FKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMK  924
             F+VME+EL FMYD  +TK   V    G      C  RFV  +  ++V  +FF   K    
Sbjct  308   FEVMEIELGFMYDVFYTKAATVYSLVG------CFLRFVTLSCTISVLSVFFVMEKNQYP  361

Query  923   PGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVAR  744
               D+ +T  L+ GA++L+  ++I ++FS W ++ + M                       
Sbjct  362   KMDVFITSVLLIGAIILEIYSVILVLFSDWTILWLSMH----------------------  399

Query  743   KLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLL----------K  594
                           K+  K+ISLI       +V   K WS    Q++L+          +
Sbjct  400   ------------KNKVSSKVISLIQ------SVKYKKRWSCSTGQFNLISFCISKARKER  441

Query  593   HSLAGR--RLKCADDFLEHF--------LLKGVIDSCL------HTQTAKVEEKLKNLVF  462
             HS  G+  RLK      + F        L K +  + L      HT T  VE+ LK ++F
Sbjct  442   HSNVGKFLRLKFGSSTGKAFKKRAAKCALAKIITGAWLSYQKYKHTNTKTVEDDLKEIIF  501

Query  461   EDIk------rrekakeaaaepekETYHRQE-VMDKIKKIHLAPKvvdsssddvvvsvdd  303
             ED              E A    +   HR + V++++K    A    +   + ++  +  
Sbjct  502   EDFVDKIKEGINMGEDEFAKNITRFCNHRGDKVLERLKSELKAQIEDEEKVETMIRKLRW  561

Query  302   DIE-NYANFVLTLHVATEICYFTADKTKGGDDEAGAKLLCIQ-------ISQYLAYLLVL  147
              +E  +   ++  H+AT ICY         D+E   K   +        +S+Y+ YLLV+
Sbjct  562   SVEVEFDQSIILWHIATNICY-----NSESDEEVLEKGRVLSYKEASKCLSEYMLYLLVM  616

Query  146   EEKITSAVPGSIG-MRFKDICKD  81
                  S +P  IG +RF+D C +
Sbjct  617   R---PSMLPNGIGEIRFQDTCAE  636



>ref|XP_010034364.1| PREDICTED: uncharacterized protein LOC104423596 [Eucalyptus grandis]
Length=560

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 115/238 (48%), Gaps = 12/238 (5%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED+ LW RHLL  + Q+ +   V YQ  +  ++ ++PT ++F+ G +K +ER  +L LA
Sbjct  75    LEDHELWRRHLLNLLFQLGTACYVFYQ-SLPNNKLIVPTILLFVGGTIKYIERTYALYLA  133

Query  1340  SSRFVRKSIGKSL----DSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIID  1173
             S    R S+  S+    D   ++    A  + M   I     ++  A+     FKG ++D
Sbjct  134   SFSNFRGSLLSSVNARWDITGARWADTAPREMMPGPISESQYVIIAAFSFFTAFKGLLVD  193

Query  1172  HSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWR  993
                  D     K +F+    +DA +V+E +L+F YD ++TK   +    G       ++R
Sbjct  194   LPINADIIPNRK-FFERNTAKDAIRVIEAQLNFFYDVLYTKAAVLHCRLGY------LFR  246

Query  992   FVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
              +    +VT   +F+   K      D  +TY L+ GAV L+ +AL  LI S     KI
Sbjct  247   AISIGSVVTAFALFYTLKKHGFHEYDTRITYTLLLGAVGLEFVALSMLICSDMTFAKI  304



>ref|XP_008228369.1| PREDICTED: uncharacterized protein LOC103327780 [Prunus mume]
Length=681

 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 127/512 (25%), Positives = 212/512 (41%), Gaps = 100/512 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQ-YKIFQSEWLLPTGI-VFLVGIVKCVERILSLQ  1347
             +EDN LW RHLL  + Q   VLV  Y  ++ + S+ L    I +F+VGI+K  ER   L+
Sbjct  109   LEDNELWLRHLLGLVAQ---VLVAFYVCFRAWSSKALNFLAIPMFIVGIIKFGERTWVLR  165

Query  1346  LASSRFVRKSIGKSLDS--------------------VASKELIRA----EGKDMTDNIM  1239
              +SS   R+S+ K+ D                     V     I A    E   +T    
Sbjct  166   ASSSELFRESMLKNPDPGPNYARYMEEYISKKAEGFRVVPTHFIEASTSAEASPITQVNG  225

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
                  +  +Y   + FK    D      +    + +F+N N E+ F+V+E+EL FMYD  
Sbjct  226   TTQPTILTSYNFFKTFKLLCADLILSFHDIVNSQSFFQNTNYEEVFEVIEIELGFMYDLF  285

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAV  879
             FTK + V  W G       I R V  +  V V + F F  K      D+ +TY L+ GA+
Sbjct  286   FTKAVLVYSWLG------GILRCVSLSFTVAVLVAFLFVEKQAYMGVDVAITYALLLGAI  339

Query  878   LLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARK  699
             +L+  A+  ++ S W  + +           KL+  K             K++   V   
Sbjct  340   VLEIYAVAIILSSDWTKLWLS----------KLRPSK------------HKSIMVGVVDY  377

Query  698   LKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKC----ADDFLEHFLLK  531
             L + I S        I ++ ++ WS  + Q +L+   L  R  KC     D ++   L K
Sbjct  378   LDKAISS--------IPLIKNERWSNTVAQCNLITFCLKARPAKCILIHKDLYINQVLEK  429

Query  530   GVIDSCLHTQTAKVE-EKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHLA  354
                      +  KV+ ++LK+L+++ ++ R  A                 ++  K++   
Sbjct  430   H------RYKDLKVDCKELKDLIYKQLQDRASAN----------------LEDCKQLCAL  467

Query  353   PKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDDEAGAKLLCIQIS  174
                      +    +   I+ +   ++  H+AT+ICY +    K       ++LL    S
Sbjct  468   RVDEVFEKANCQEELRWTIKEFDQSIILWHIATDICYHSEPNPKSSPSCETSRLL----S  523

Query  173   QYLAYLLVLEEKITSAVPGSIG-MRFKDICKD  81
              Y+ YLL++       +P  IG +RF+D C +
Sbjct  524   NYMLYLLLM---CPFMLPDGIGQIRFRDTCAE  552



>ref|XP_006663073.1| PREDICTED: uncharacterized protein LOC102709120 [Oryza brachyantha]
Length=745

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 94/385 (24%), Positives = 161/385 (42%), Gaps = 66/385 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L+ + Q+     V ++ +   +  ++P  I+F+ GI K  ER L+L+ A
Sbjct  111   VEDNELWLRHFLSLLSQVALAGYVYWKSRP-GARLVIPAIIMFVAGITKYGERTLALRAA  169

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIM---------------NQYEIVRKAY-  1209
             S   +R S+    D   +      E +  TD  +                  E+ R+ Y 
Sbjct  170   SMGCLRSSMLTPPDPGPNYAKFVEECQSRTDAGLVAQIVIVQERPPHDDRHVEVEREEYG  229

Query  1208  ----ECHQIFKGF---IIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
                   H+ F  F    +D      +      +F+ L +E A+KV+E+EL  MY+ + +K
Sbjct  230   DLVHSAHRFFHTFRRLFVDLILSFQDRIDSLAFFRRLEMEQAYKVVEIELVLMYECLHSK  289

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALI-FFFHSKLHMKPGDIGVTYCLVGGAVLL  873
              + +    G     + +   V + +L   AL     +S  + +  DI +++ L+GGA+ L
Sbjct  290   ALVIHGRLGRGLRLFTLAAPVVSLVLFNRALGDMRGYSYSYKQQVDINISFVLLGGAIFL  349

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             +  A++ +  S W    +    V  P+A  + +  ++  P  R                 
Sbjct  350   EAYAILLIAVSSWTYTDMRGREVLRPLAAAVFRLISLFQPEKR-----------------  392

Query  692   QKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKC--ADDFLE---HFLLKG  528
                                  WS ++ QYSL+ + L  R L C  A ++LE   +F +K 
Sbjct  393   -------------------PRWSNKMSQYSLISYCLKDRSLWCKKAMEWLEWRWNFRVKT  433

Query  527   VIDSCLHTQTAKVEEKLKNLVFEDI  453
               DS  +T    V E+LK  VFE I
Sbjct  434   AWDSWRYTTCIAVSEQLKGHVFEQI  458



>ref|XP_007146453.1| hypothetical protein PHAVU_006G041900g [Phaseolus vulgaris]
 gb|ESW18447.1| hypothetical protein PHAVU_006G041900g [Phaseolus vulgaris]
Length=759

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 122/253 (48%), Gaps = 36/253 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-----------ICSV-LVVLYQYKIFQSEWLLP-TGIVFLVGI  1380
             +EDN LW RH+L  M+Q            CS+ L  L  ++  +S    P TG  +    
Sbjct  109   LEDNELWRRHMLGLMIQYIFDLFIFTERTCSLKLASLSNFR--KSMVNNPDTGPNY----  162

Query  1379  VKCVERILSLQLASSRFV----RKSIGKSLDSVASKE-LIRAEGKDM----TDN--IMNQ  1233
              K VE ++S Q A    V      S  K  +   + + +I ++G ++    TD+   +  
Sbjct  163   AKLVEELISRQEAGLPAVIVNPEPSDAKPDNQPPNTDSMIESDGFELRIPRTDDEAYLLD  222

Query  1232  YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
              E+++ AY+    FKG ++D  F   E    + +       DA +V+E+EL+F Y A +T
Sbjct  223   LEVIKGAYDYFNTFKGLVVDMIFSFQERSNSRTYLLGQTAVDALRVIEVELNFFYQAFYT  282

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   +  W G++      +RFV  + +V   ++F +  K   +P D+ VTY L+ GAV L
Sbjct  283   KTTIINSWLGLS------FRFVSISSVVAALVVFIYEEKRGCEPFDVKVTYILLYGAVAL  336

Query  872   DQMALIHLIFSHW  834
             + M+++   FS +
Sbjct  337   EVMSIVMFFFSDY  349



>gb|EMT12120.1| hypothetical protein F775_22042 [Aegilops tauschii]
Length=956

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 118/239 (49%), Gaps = 33/239 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +EDN LW RHL T +VQ+     VLY+Y       L    I +F+ GIVK  ER  +L+ 
Sbjct  101   LEDNRLWLRHLQTLVVQVLGAAYVLYKYMADSGTLLQLVSISMFVAGIVKYGERTWALKR  160

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
             A+    + S GK++D     EL+R   +DM D+     EI+ +A+    I K    D   
Sbjct  161   ANDN--KSSSGKAVDPY---ELLR---QDMGDD-----EILLRAHSQFAICKSGFDDTKV  207

Query  1163  LHDECGKEKDWFKNLNV--EDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
             +      ++D  +      ED FK++EMELS MYD ++TK   +  W     Y +CI   
Sbjct  208   VMRPKPPDEDSPRLFPFYDEDIFKLVEMELSLMYDTLYTKAAVIHTW-----YGFCIHSI  262

Query  989   VCNALLVTVALIFFFHSKLHMKPG-------DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                +L+ T A +  F  +L +  G       D+ ++Y L+ GA++L+ ++    + S W
Sbjct  263   ---SLVGTSAALCLF--RLRLSRGDHAYNRVDVAISYILLAGALVLEVISACRAVLSSW  316



>ref|XP_010061838.1| PREDICTED: uncharacterized protein LOC104449398 [Eucalyptus grandis]
 ref|XP_010061839.1| PREDICTED: uncharacterized protein LOC104449398 [Eucalyptus grandis]
 ref|XP_010061840.1| PREDICTED: uncharacterized protein LOC104449398 [Eucalyptus grandis]
 gb|KCW68878.1| hypothetical protein EUGRSUZ_F02468 [Eucalyptus grandis]
Length=687

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 109/453 (24%), Positives = 184/453 (41%), Gaps = 104/453 (23%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL   VQ  +   VL+      S  +L   ++ LVG++K  ER     LA
Sbjct  124   LEDNALWLRHLLALGVQAGATAYVLFMAWTSSSLSVLSLVMI-LVGLIKYGERTWVQWLA  182

Query  1340  SSRFVRKSIGKSLDS-------VASKELIRAEGKDMT-DNIMN---------QYEIVRKA  1212
             S   +R+S+    D        +A   L +AEG  +T D ++            +++ KA
Sbjct  183   SKDKLRESMLSPPDPSPNYPRFMAEYSLKQAEGYHVTADEVIEVQVPATPYVTGDLIIKA  242

Query  1211  YECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQ  1032
              E  Q FK   ID    +D+    +  FK ++  DAF+++E+EL FMYD ++TK      
Sbjct  243   DELLQKFKCLFIDLILSYDDRDMSRSIFKGISWNDAFQLIEIELGFMYDLLYTK------  296

Query  1031  WKGIASYFWCIW----RFVCNALLVTVALIFFFHSKL-HMKPGDIGVTYCLVGGAVLLDQ  867
                 A   + +W    RF+  +L + V   F    K  +  P D+ +TY L+   ++ + 
Sbjct  297   ----AMLLYSVWGFLRRFITFSLTLLVLAFFSLTEKYANCSPVDLYITYALLAVIIIFEI  352

Query  866   MALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQK  687
              +++ L+ S W                                      D  +++  K +
Sbjct  353   YSILILLSSDW-------------------------------------TDVWLSKHNKSR  375

Query  686   IISLIYYGHKLITVVN---SKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDS  516
              +      H+ +T V       WS  I Q+SLL+  +    L C    L+   +   +D 
Sbjct  376   AL------HRAVTCVQLPRQPRWSNSIAQFSLLEFCINENPLVC-HGILKRLNINEKLDK  428

Query  515   CLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHLAPKvvds  336
               +T +  VE KLK  +FE                        V +K +K+ + P     
Sbjct  429   YHYTTSENVEPKLKKKIFE-----------------------RVKEKSEKLEM-PTDPGQ  464

Query  335   ssddvvvsvddDIENYANFVLTLHVATEICYFT  237
                +    +      +   +LTLH+ATE+C+++
Sbjct  465   IGREHTDEIWGTEAEFDQIILTLHIATELCFYS  497



>ref|XP_010677076.1| PREDICTED: uncharacterized protein LOC104892776 [Beta vulgaris 
subsp. vulgaris]
Length=711

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 134/285 (47%), Gaps = 57/285 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LWHRH L Q+V    V + ++   I +   L +P  ++F+ G +K VER  +L  
Sbjct  110   LEDNQLWHRHSL-QLVTQVVVTIYVFSVSIRRRNGLWVPIVLIFVDGCIKYVERTCALYS  168

Query  1343  ASSRFVRKSIGKSL----------------------------------------DSVAS-  1287
             A +  +R S+ + +                                        D VAS 
Sbjct  169   ACTEVIRDSLREPVPPNYDKMVNEYHSADNAHIPSNFEVKYGPSEGSTWSNHRRDHVASD  228

Query  1286  KELIRAEGKDMT-----DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKN  1122
             ++     G D       + + +  E++  AY  +Q  KG + D      + G+ +++F +
Sbjct  229   QDESTVNGDDSLSRFRWNTVKDTDELIGYAYFFYQKSKGLLADAFLSLRDDGEIREYFLS  288

Query  1121  LNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFF-F  945
                E+AF+++E+EL+ +YD + TK+    + +G      C+   V + L VTV+L+ F  
Sbjct  289   KPAEEAFRILEIELNLIYDVLHTKVFLTYRRRG------CL--RVVSFLSVTVSLLLFSL  340

Query  944   HSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEME  810
               K + K  D+G+T+ L+ GA+LLD  A+I LI S W +V +  +
Sbjct  341   KDKSNYKRVDVGITFALLVGAILLDIAAIIMLIRSDWWIVMVSQQ  385



>ref|XP_007024692.1| Uncharacterized protein TCM_029186 [Theobroma cacao]
 gb|EOY27314.1| Uncharacterized protein TCM_029186 [Theobroma cacao]
Length=686

 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 87/327 (27%), Positives = 147/327 (45%), Gaps = 59/327 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEW------LLPTGIVFLVGIVKCVERI  1359
             +EDN LW RHLL   +Q          + IF   W      +L T +VF VG+ K VER 
Sbjct  110   LEDNELWLRHLLGLALQTGVA------FNIFLMAWRGSHLSILSTLMVF-VGLSKYVERT  162

Query  1358  LSLQLASSRFVRKSI--GKSLDSVASKELIRA-----------------------EGKDM  1254
               L+ ASS  ++ S+   + L  + +  L++                        E   +
Sbjct  163   WVLRSASSEQIKGSMLARRDLPGLTNPNLLKEYNVKKEEGYICNTNRVIDIQLPMEAFAI  222

Query  1253  TDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
              DN +++   + KAY   QIFK   ++      +       F+NL+ + AF+V+EMEL+F
Sbjct  223   EDNSISKNNELLKAYGLLQIFKRIFVNLLLSSRDRDTSLAVFQNLSFQKAFEVVEMELAF  282

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFF--FHSKLHMKPGDIGVTY  900
             M+D ++TK  AV    G++    CI     N  L  + L+FF     K   K  D+ +T+
Sbjct  283   MFDLLYTKASAVYSRWGLS--LRCI-----NLSLTCIVLVFFSLADDKHKYKKADLVITF  335

Query  899   CLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTP-----------  753
              L+  A++LD  A + ++FS W +V + +    T V R +   +    P           
Sbjct  336   LLLVVAIVLDIYAALVILFSDWTVVWLSLRK-KTSVLRAITSVRLFSNPRWSNSMAQYNL  394

Query  752   VARKLKQKKTVDTPVARKLKQKIISLI  672
             ++  L++K  +  P+  ++K  ++  I
Sbjct  395   LSFALREKPMIYDPILSQVKPHLLHRI  421



>emb|CDX90102.1| BnaA08g18820D [Brassica napus]
Length=740

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 119/239 (50%), Gaps = 23/239 (10%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW+RHL + + Q + +V V+L       +  L+PT I+   G++K VER  +L  
Sbjct  87    LEDNELWNRHLFSLVCQAVATVYVILLSTP---NRLLIPTVIMLFGGVIKYVERTSALFS  143

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIV----RKAYECHQIFKGFII  1176
             AS    + S+ +  D  A+   +  E  +  D  M    IV     K  EC    +    
Sbjct  144   ASLDKFKDSMLEDPDPGANYAKLMEEYANKRDMNMPTEVIVVEDPEKGRECITPVRP---  200

Query  1175  DHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIW  996
                  +D+    + +F +LN E+A +++E+ELS +Y+++FTK   +  W G       ++
Sbjct  201   -----NDDLTNLQ-FFDSLNPEEALRIIEVELSLIYESLFTKAEILHNWTG------AVF  248

Query  995   RFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
             R +  A LV+   +F   ++   +  D+ +TY L+   + LD +AL+    S W++ ++
Sbjct  249   RVIALACLVSSLCLFSLKNEAEYEGFDVALTYALLICGIALDSIALLMFCVSDWSIARL  307



>gb|EAZ02516.1| hypothetical protein OsI_24619 [Oryza sativa Indica Group]
Length=767

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 127/266 (48%), Gaps = 38/266 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHL+  + ++ S LVV +   I  +  +  T ++FLVG++K  ER  SL  +
Sbjct  113   VDDNELWRRHLIGLLFELFSALVV-FSCSIRSNPMIPATALIFLVGVIKYGERTYSLYSS  171

Query  1340  SSRFVRKSIGKSLD------------------------SVASKELIRAEGKDMTDNIMNQ  1233
             S   V   I ++ D                        ++A+ E  +A+      N +  
Sbjct  172   SVDGVIAKILRAPDPGPNYAKLMTVFGGKRNGGLLVEITIANGEASKAKEVLQQGNEVRL  231

Query  1232  YEIVRK----AYECHQIFKGFIIDHSFLHDECGKEKDWF---KNLNVEDAFKVMEMELSF  1074
              E  +     AYE   +F+   +D +  + E    + +F    ++ V+ AF+VME+EL++
Sbjct  232   VETTKSLEAIAYEFFTMFRLLYVDINLSYKERTISQAYFLDRHDMTVDKAFEVMEVELNY  291

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD ++TK        G      C+ RF+C   LV   ++F    K  + P D G+TY L
Sbjct  292   LYDMVYTKAPVSHSSAG------CVLRFICTTCLVVAIVLFVLLDKTGILPVDRGITYAL  345

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIE  816
             + G + LD  A++ L+ S+  +V +E
Sbjct  346   LLGGLALDVAAILMLLCSNRTIVFLE  371



>ref|XP_009392549.1| PREDICTED: uncharacterized protein LOC103978475 [Musa acuminata 
subsp. malaccensis]
Length=679

 Score = 88.2 bits (217),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 96/380 (25%), Positives = 157/380 (41%), Gaps = 69/380 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +V   ++   + Q+    P  ++FL GI+K  ER  SL  A
Sbjct  111   LEDNELWLRHLLGLVFQV-AVAFYVFVGSLPQTRLKSPAAMMFLAGILKYGERSWSLMCA  169

Query  1340  SSRFVRKSIGKSLD------------SVASKELIRAE---------GKDMTDNIMNQYEI  1224
             S   +R S+    D            +  S   +R E              D ++ +   
Sbjct  170   SMDCLRNSMVTPPDPGPNYAKFMEDYAAMSAAGLRTEIEMKKEPESRPRSLDTLVEEIRT  229

Query  1223  VRKAYECHQIFKGF---IIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFT  1053
             V    + HQ F  F   I+D      +  + + +F   +   AFKV+E+ELSF+Y+ ++T
Sbjct  230   VTMVTKAHQFFHTFKRLIVDLILSFHDRNESQSFFLKRSPIQAFKVIEIELSFVYEMLYT  289

Query  1052  KMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLL  873
             K   +    G       + RF     ++T  L+F F  K   K  DI +TY L+ GA+ L
Sbjct  290   KSTVLHTVAG------PVLRFTSFFFILTALLLFLFTEKHGYKEIDIIITYTLLAGALAL  343

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             +  ++  LIFS WA +++                K +  P                    
Sbjct  344   EIYSVGLLIFSDWASLRL----------------KDLGYP--------------------  367

Query  692   QKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSC  513
              ++ +++   +      N   WS  + Q++L+   L   R    + FL    +K   D  
Sbjct  368   -RLSNMVSAINSFFRPPNKPRWSNSMAQHNLISFCLQ-HRPSPFNRFLHFLTVKEAWDRY  425

Query  512   LHTQTAKVEEKLKNLVFEDI  453
              HT    V ++LK  VFED+
Sbjct  426   WHTSYCPVTDELKEFVFEDL  445



>emb|CAE05328.2| OSJNBa0056L23.26 [Oryza sativa Japonica Group]
 gb|EAZ29595.1| hypothetical protein OsJ_13669 [Oryza sativa Japonica Group]
Length=769

 Score = 88.2 bits (217),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 121/243 (50%), Gaps = 26/243 (11%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL---PTGIVFLVGIVKCVERILSL  1350
             +EDN L  R ++   +Q+   + +LY+   F S   +    + ++F++GIVK  ER  +L
Sbjct  106   LEDNILSWRDMIGFFMQVLGTIYILYKNVFFSSGGTIVRVSSSVMFIMGIVKYGERAFAL  165

Query  1349  QLASSRFVRKSIGKSLDSVASKEL------IRAEGKDMTDNIMNQYEIVRKAYECHQIFK  1188
             + A    +R S  K  +     +L      +R  G+   DN     +I+  A++   I K
Sbjct  166   RRAKLEKMRSSSQKEAEQKKPIKLSNSIRNLRRIGRRKMDN---NEQILLAAHDMLHITK  222

Query  1187  GFIIDH-SFLHD----ECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKG  1023
             G  ID+ ++ HD    E  + + W +N   E  + V++MELS MYD ++TK   V  W G
Sbjct  223   GAFIDNMAYEHDVDKQEIVRPETWNEN---EMLYDVVDMELSLMYDILYTKAAMVHTWGG  279

Query  1022  IASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
              A       RF  + +   + L+F+  SK  ++  D+ +TY ++GG V+LD   L+  + 
Sbjct  280   YAI------RFSSHFITSAMFLLFWSQSKEGLQQPDVLITYIVLGGIVILDIKWLLRAVA  333

Query  842   SHW  834
             S W
Sbjct  334   STW  336



>ref|XP_003580068.2| PREDICTED: uncharacterized protein LOC100846771 [Brachypodium 
distachyon]
 ref|XP_010239615.1| PREDICTED: uncharacterized protein LOC100846771 [Brachypodium 
distachyon]
 ref|XP_010239616.1| PREDICTED: uncharacterized protein LOC100846771 [Brachypodium 
distachyon]
Length=685

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 83/322 (26%), Positives = 146/322 (45%), Gaps = 41/322 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEW--LLPTGIVFLVGIVKCVERILSLQ  1347
             ++DN LW RHL   +VQ+     VLY+ +I  + +  +L + ++F VG VK VER  +L+
Sbjct  104   LQDNQLWLRHLQVLVVQVLGAGYVLYK-RIADNGFFVMLASILMFTVGFVKYVERTCALK  162

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE-IVRKAYECHQIFKGFIIDH  1170
               +   +R S+    +    ++  R   + + +   N+ E  VR A+    + K  I+D 
Sbjct  163   RGNMDTIRSSLKN--EPYVQRKQFRTLDQGLREGAANKEEHYVRLAHSMFHVCKRAIVDS  220

Query  1169  SFLHDECGKEKDWFKNLNVE---DAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCI  999
                 D   +  +  +++  E     + +ME+ELS +YD ++TK   +  W G +      
Sbjct  221   WIEKDFENRGGEMLRDIENEKYKGMWMLMEVELSLLYDILYTKAAVIHTWPGYSI-----  275

Query  998   WRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
              R V     V   L+F+F         D+G+TY L+ GA LL+  +L+  + S W     
Sbjct  276   -RIVSPLATVASLLLFYFSDNDGDSKVDVGITYTLLSGAFLLEATSLLSALGSSWTY---  331

Query  818   EMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVN  639
                T       +  +K  + +    +L+Q           L +KI  +   G        
Sbjct  332   ---TFLCTTRWRWLRKTALCSGRWDQLRQ-----------LVKKITRIQVGGQ-------  370

Query  638   SKSWSGEIIQYSLLKHSLAGRR  573
             ++ WSGE+ QY++L+  L  RR
Sbjct  371   ARRWSGEMGQYNMLQ--LCSRR  390



>gb|EMS54784.1| hypothetical protein TRIUR3_29974 [Triticum urartu]
Length=688

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 117/239 (49%), Gaps = 33/239 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL T +VQ+     VLY+Y       L L +  +F+ GIVK  ER  +L+ 
Sbjct  101   LEDNRLWLRHLQTLVVQVLGAAYVLYRYMADSGTLLQLASISMFVAGIVKYGERTWALKR  160

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSF  1164
             A+    + S GK++D     EL+R   +DM D+     E++ +A+    I K    D   
Sbjct  161   ANDN--KSSSGKAVDPY---ELLR---QDMGDD-----EVLLRAHSQFAICKSGFDDTKV  207

Query  1163  L--HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
             +  H    ++         ED FK++EMELS MYD ++TK   +  W G      CI   
Sbjct  208   VMRHKPPDEDSPRLFPFYDEDIFKLVEMELSLMYDTLYTKAAVIHTWYGF-----CIHSI  262

Query  989   VCNALLVTVALIFFFHSKLHMKPG-------DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                +L+ T A +  F  +L +  G       D+ ++Y L+ GA++L+ ++    + S W
Sbjct  263   ---SLVGTSAALCLF--RLRLSRGDHAYNRVDVAISYILLAGALVLEVISACRAVLSSW  316



>ref|XP_010905306.1| PREDICTED: uncharacterized protein LOC105032542 [Elaeis guineensis]
Length=629

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 163/368 (44%), Gaps = 73/368 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +ED+ LW RH L  +VQ+     V  +     +   L    V++ GIVK  ER   L+ +
Sbjct  52    LEDSELWLRHFLGLVVQVGVACYVFLKSSGTNTLTFLAIP-VYIAGIVKYGERTWVLKSS  110

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDN--IMNQYEIVRKAYECHQIFKGFIIDHS  1167
             S+  ++ S    L S A    + A+     D   ++N Y         HQ +  F I   
Sbjct  111   STEHIKNS----LRSAARTPEVEAKLSIPRDPPVVLNNY--------LHQAYYLFKISIY  158

Query  1166  FLHD---ECGKEKDWFK----NLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYF  1008
              L D      + KD  K    + + ++ FK++E+EL F++D ++TK + V    G+    
Sbjct  159   LLQDLILGVPELKDNRKIISSDRSSQEVFKLIEVELGFLFDVLYTKALLVYSQIGV----  214

Query  1007  WCIWRFVCNALLVTVA--LIFFFHSKLHMKP-GDIGVTYCLVGGAVLLDQMALIHLIFSH  837
               I+R V  +LL +VA  L F     +H  P  D+ +TY L+ GA++L+  AL++L  S 
Sbjct  215   --IFRAV--SLLCSVAAFLAFLIFVDVHPYPIVDVAITYILLAGALVLEVYALVYLTLSD  270

Query  836   WAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQKIISLIYYGHK  657
             W MV +                                   P  + +++ + SL    H 
Sbjct  271   WTMVWLTKSA------------------------------NPRTKSIREGVYSL----HT  296

Query  656   LITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVIDSCLHTQTAKVEEKL  477
                +++ K WSG + QYSL+   L   +++ A  +LE   +  +I   ++     V+  L
Sbjct  297   --RLISGKRWSGSMAQYSLIGSCL---KIRLAGKYLELLGIDELIKQ-MYVNLQNVDVNL  350

Query  476   KNLVFEDI  453
             K+L+FE I
Sbjct  351   KDLIFEHI  358



>ref|XP_010237421.1| PREDICTED: uncharacterized protein LOC100828820 [Brachypodium 
distachyon]
 ref|XP_010237422.1| PREDICTED: uncharacterized protein LOC100828820 [Brachypodium 
distachyon]
 ref|XP_010237423.1| PREDICTED: uncharacterized protein LOC100828820 [Brachypodium 
distachyon]
Length=793

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 118/243 (49%), Gaps = 30/243 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL-PTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL T  VQ+     V+Y+Y +    +LL    ++F VG++K  ER  +L+ 
Sbjct  99    LEDNRLWLRHLFTLSVQVMGAAFVIYKYVVGTGTFLLIACTLMFAVGMLKYGERTWALKC  158

Query  1343  ASSRFVRKSIGKSLDS---VASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIID  1173
              +   +R ++  S+D     A    +R    D +D+  ++ E +  A+    + K    D
Sbjct  159   GNMDSIRSTVDMSMDDDYRSAFSAGLRFPFPDGSDDHTDE-EFLLAAHSLFHMCKSLFAD  217

Query  1172  HSFLHDECGKEKDWFKNLNV--------EDAFKVMEMELSFMYDAMFTKMIAVQQWKGIA  1017
              S +          FK  +V         D +K++E+ELS MYD ++TK   +  W G  
Sbjct  218   LSIMLSG-------FKLFSVGVHTKKSKSDLYKLVELELSLMYDILYTKAAVIHTWYG--  268

Query  1016  SYFWCIWRFVCNALLVTVA--LIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
                 C  R V  +LL TVA  L+F F  KL     D+ +TY L+ GA++L+ ++ +    
Sbjct  269   ----CCIRVV--SLLGTVAAVLLFQFSDKLGYNVADVVITYILLVGALVLEFISSLKAAG  322

Query  842   SHW  834
             S W
Sbjct  323   STW  325



>gb|EMT21377.1| hypothetical protein F775_05712 [Aegilops tauschii]
Length=792

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 81/280 (29%), Positives = 131/280 (47%), Gaps = 60/280 (21%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLP-TGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL+  + ++ S  V+ +     +   ++P T ++F+VGI+K  ER  SL  
Sbjct  133   LEDNELWLRHLIGLLFELFSASVIFFCS--LKGNPMIPATVLMFVVGIIKYGERTYSLYS  190

Query  1343  ASSRFVRKSI-----------------------GKSLDSV----------ASKELIRAEG  1263
              S    R++I                       G  +D V          A  +L   E 
Sbjct  191   GSVDGFRENILDPPDPGPNYAKLMTEFDAKEQAGLVVDIVFAGADDEAKKALADLEEGEA  250

Query  1262  KDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVED-------A  1104
               + +N     E   +A++   IF+   ++    + E    + +F  L+ ED       A
Sbjct  251   ARLVNNRSKSLE--SQAFDFFLIFRRLFVNLILSYKERKISQAYF--LDREDVTNSPAKA  306

Query  1103  FKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFH----SK  936
             F+V+E+EL+F+YD ++TK        G      C+ RF+ +A LV+  LIFFFH    S 
Sbjct  307   FQVIEVELNFIYDMVYTKAPVAHSRAG------CVLRFLASACLVSSLLIFFFHGDKGSF  360

Query  935   LHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
             +H+   DI +TY L+ G + LD +AL  L+ SH  +V +E
Sbjct  361   MHV---DIAITYALLLGGIALDGVALAMLLSSHRMLVLLE  397



>ref|NP_001045426.2| Os01g0953100 [Oryza sativa Japonica Group]
 dbj|BAD87859.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC72179.1| hypothetical protein OsI_05234 [Oryza sativa Indica Group]
 dbj|BAF07340.2| Os01g0953100 [Oryza sativa Japonica Group]
Length=712

 Score = 87.8 bits (216),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 98/384 (26%), Positives = 162/384 (42%), Gaps = 70/384 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQ--  1347
             +EDN LW RHLL+ + QI   L V ++ +   +  L+P  ++F+ G+VK  ER  +L+  
Sbjct  106   IEDNELWLRHLLSLVSQIALALYVYWKSRPSAAGLLVPAILMFVSGVVKYGERTWALKSA  165

Query  1346  ----LASSRFVRKSIGK-----------SLDSVASKELIRAEGKDMTDNI------MNQY  1230
                 L SS   R   G            S ++    E++    +   DNI      M   
Sbjct  166   SMSSLRSSMLTRPDPGPNYAKFMEEYHSSKEAGLHAEIVIVPERPPDDNIHVQEEHMEYG  225

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             E+V KA+     F+   +D      +      +F+ L  + A+KV+E+EL  MY+++ +K
Sbjct  226   ELVVKAHRFFHTFRRLFVDLILSFQDRTDSLAFFRRLQRDQAYKVVEIELLLMYESLHSK  285

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
                +    G   Y     R    A  V   ++F    K   KP D+ V+Y L+GGA+ L+
Sbjct  286   SSVIHGPTG--RYL----RIFTLAAPVLSLIVFSGTDKAPYKPVDVTVSYVLLGGAIFLE  339

Query  869   QMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQ  690
               A++ +  S W+   +              +KK    PVA  + +  +   P AR    
Sbjct  340   IYAILLMAISPWSFADL--------------RKKDKCLPVASGVFRAVSYFLPEAR----  381

Query  689   KIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRR--LKCADDFLE---HFLLKGV  525
                                 WS ++ QY+L+ + L  +   L  A + LE   +  +K +
Sbjct  382   ------------------PRWSNQMAQYNLIHYCLKDKPTWLTGALEKLEWDYNVRVKTI  423

Query  524   IDSCLHTQTAKVEEKLKNLVFEDI  453
              DS  +T    V   LK LVF+ +
Sbjct  424   WDSIWYTHHIGVSMVLKQLVFKQL  447



>gb|EEE56017.1| hypothetical protein OsJ_04788 [Oryza sativa Japonica Group]
Length=713

 Score = 87.8 bits (216),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 98/384 (26%), Positives = 162/384 (42%), Gaps = 70/384 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQ--  1347
             +EDN LW RHLL+ + QI   L V ++ +   +  L+P  ++F+ G+VK  ER  +L+  
Sbjct  106   IEDNELWLRHLLSLVSQIALALYVYWKSRPSAAGLLVPAILMFVSGVVKYGERTWALKSA  165

Query  1346  ----LASSRFVRKSIGK-----------SLDSVASKELIRAEGKDMTDNI------MNQY  1230
                 L SS   R   G            S ++    E++    +   DNI      M   
Sbjct  166   SMSSLRSSMLTRPDPGPNYAKFMEEYHSSKEAGLHAEIVIVPERPPDDNIHVQEEHMEYG  225

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             E+V KA+     F+   +D      +      +F+ L  + A+KV+E+EL  MY+++ +K
Sbjct  226   ELVVKAHRFFHTFRRLFVDLILSFQDRTDSLAFFRRLQRDQAYKVVEIELLLMYESLHSK  285

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLD  870
                +    G   Y     R    A  V   ++F    K   KP D+ V+Y L+GGA+ L+
Sbjct  286   SSVIHGPTG--RYL----RIFTLAAPVLSLIVFSGTDKAPYKPVDVTVSYVLLGGAIFLE  339

Query  869   QMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLKQ  690
               A++ +  S W+   +              +KK    PVA  + +  +   P AR    
Sbjct  340   IYAILLMAISPWSFADL--------------RKKDKCLPVASGVFRAVSYFLPEAR----  381

Query  689   KIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRR--LKCADDFLE---HFLLKGV  525
                                 WS ++ QY+L+ + L  +   L  A + LE   +  +K +
Sbjct  382   ------------------PRWSNQMAQYNLIHYCLKDKPTWLTGALEKLEWDYNVRVKTI  423

Query  524   IDSCLHTQTAKVEEKLKNLVFEDI  453
              DS  +T    V   LK LVF+ +
Sbjct  424   WDSIWYTHHIGVSMVLKQLVFKQL  447



>ref|XP_010654882.1| PREDICTED: uncharacterized protein LOC100261798 [Vitis vinifera]
Length=449

 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 131/303 (43%), Gaps = 45/303 (15%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  +VQ+     VL +         L   +V + GI+K  ER   L+ A
Sbjct  126   LEDNELWLRHLLGLVVQVGVAFYVLLRSWAGTPPTFLSIPMV-VAGIIKYGERTWVLRSA  184

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNI----MNQYEIVRKAYEC----------  1203
             S    R S+    D       +  E     D +    + + EIV K  +           
Sbjct  185   SKNHFRDSLLSVPDPGPDYADVMKEYGSWKDKMEVARIRKEEIVEKPLQSTVGDDITIPG  244

Query  1202  -HQIFKG-FIIDHSFLH---------DECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMF  1056
                I+K  F+  + F H         D+    +   K L+ E+AFKV+EMELSF+YD ++
Sbjct  245   GKYIYKAYFLFKNQFRHLYADLILSLDDQQTSERIIKELSFEEAFKVVEMELSFLYDVLY  304

Query  1055  TKMIAVQQWKGI----ASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVG  888
             TK   V    GI    AS       F+C    ++    FFF  K      DI +TY L+ 
Sbjct  305   TKAKVVYSLLGILLRTAS-------FMCT---ISALAAFFFIHKHQFSNIDINITYTLLF  354

Query  887   GAVLLDQMALIHLIFSHWAMVKIEMET--VDTPVARKLKQKKTV---DTPVARKLKQKKT  723
             GA+ L+  A+I LI S W +  +  +   +   + R +   ++V   D    R++ Q   
Sbjct  355   GAIFLEIYAIIMLILSDWTIAWLSSKKCFLTDSICRAITSFRSVLTSDKRWTRRMAQNNF  414

Query  722   VDT  714
             +D+
Sbjct  415   IDS  417



>ref|XP_004977724.1| PREDICTED: uncharacterized protein LOC101782233 [Setaria italica]
Length=649

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 118/243 (49%), Gaps = 39/243 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL--LPTGIVFLVGIVKCVERILSLQ  1347
             +EDN LW RHL T  VQ+ +   +LY+  I  S+ L  L T ++F VG++K  ER+ +L+
Sbjct  101   IEDNQLWLRHLQTLAVQVAAAAYILYESSIITSQSLLRLATVLMFGVGVLKYGERVWALK  160

Query  1346  LASSR--------FVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIF  1191
              A S         F RK+      + A   L   + +D    ++  + ++    +   + 
Sbjct  161   CAGSSPSGSNYRPFNRKT------ASAVGPLPSRQDRDTEAFLLIAHRLLAAPMD---LL  211

Query  1190  KGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             KG     +F+  +CG        +  ED +KV EM++S M+D  +TK      W G+   
Sbjct  212   KG---PSTFVDVQCGT-----STIPGEDLYKVAEMQISLMHDVFYTKAEVTHSWYGL---  260

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMKPG----DIGVTYCLVGGAVLLDQMALIHLIF  843
               CI R + +  L TV ++  FH +   K G    D+ VTY L+ GA++L+  + +  + 
Sbjct  261   --CI-RIISS--LGTVTVLLQFHLQGDRKDGYNRVDVAVTYVLLVGAIILEITSALRAML  315

Query  842   SHW  834
             S W
Sbjct  316   SSW  318



>ref|XP_011013300.1| PREDICTED: uncharacterized protein LOC105117357 [Populus euphratica]
Length=689

 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 126/257 (49%), Gaps = 34/257 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL   +Q  +    L+  K +  + L+   I +F+ GI K  +R+L L L
Sbjct  112   LEDNELWLRHLLQLAIQASTASYSLF--KSWGKDPLIYIAIPIFVAGITKYGDRVLVLWL  169

Query  1343  ASSRFVRKSIGKSLDSVASK---ELIRAEGKDMTDNIMNQ----YEIVRKA---YECH--  1200
             ASS+  R    + +D+  SK   +       DM++  +N+      I+ +A   +E H  
Sbjct  170   ASSKKFRDIENEEVDTFQSKFDNKFPSVGFFDMSEEDLNKGLEFNSIIPEALYLHEAHFL  229

Query  1199  -QIFKGFIIDHSFLHDECGKEKDWFKNLN-VEDAFKVMEMELSFMYDAMFTKMIAVQQWK  1026
              Q+FK F  D +  H    +     ++     DAFKV+E+EL FMYD +FTKM +V    
Sbjct  230   FQMFKIFYADLALSHSSHMESYLILRSKKKATDAFKVIEVELGFMYDVLFTKMTSV----  285

Query  1025  GIASYFWCIWRFVCNA---LLVTVALIFF---FHSKLHMKPGDIGVTYCLVGGAVLLDQM  864
                    C  R +  +   L  T AL+ F     +K      ++ ++Y L+GG V+L+  
Sbjct  286   -------CSTRTILRSISFLSSTSALVAFSMMVANKCAYTETEVIISYILLGGGVVLEIY  338

Query  863   ALIHLIFSHWAMVKIEM  813
               I L+ S WAM ++ +
Sbjct  339   GFIMLLLSEWAMFRLSL  355



>ref|XP_006280006.1| hypothetical protein CARUB_v10025879mg [Capsella rubella]
 gb|EOA12904.1| hypothetical protein CARUB_v10025879mg [Capsella rubella]
Length=838

 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/266 (29%), Positives = 124/266 (47%), Gaps = 45/266 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RH+   + Q I  V VVL       S W++   +VF+ G +K +ER  +L  
Sbjct  111   LEDNALWLRHVFGLVFQAIAGVYVVLQSLP--NSLWVI-ILLVFISGTIKYLERTTALYS  167

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEGK----DMTDN-------------  1245
             AS    R S+           K ++   +K+  R   K    D  D              
Sbjct  168   ASLDKFRDSMIQAPDPGPNYAKLMEEYKAKKEARLPTKIILIDEPDKEHRPKKLEHPSLA  227

Query  1244  -----IMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNL-NVEDAFKVMEME  1083
                  ++   EIV+ AY+    FKG +++  F   E  +  + F+NL + E+A +++E+E
Sbjct  228   LKKTKLLTHLEIVQYAYKFFNTFKGLVVNLIFSFRERDESLEIFENLADSEEALRIIEVE  287

Query  1082  LSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSK--LHMKPGDIG  909
             L F+YDA+FTK+  +  + G  S      R V +  LV   ++F    K  +H +  D+ 
Sbjct  288   LGFLYDALFTKIAVLHTFIGTVS------RIVASGTLVAAFILFDKRPKKDIHFQHSDVV  341

Query  908   VTYCLVGGAVLLDQMALIHLIFSHWA  831
             VTY L    + LD ++++  +FS W 
Sbjct  342   VTYTLFAVGIALDFISILLFLFSDWT  367



>gb|EMT32551.1| hypothetical protein F775_00653 [Aegilops tauschii]
Length=608

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 115/242 (48%), Gaps = 28/242 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             MEDN LW RHLL+ +VQ   V  VLY+Y       +    ++F+ GI+K  ER+ +L+ A
Sbjct  99    MEDNYLWPRHLLSLIVQALGVAYVLYKYTTGSRTLVTGAVLIFVAGILKYAERVWALKSA  158

Query  1340  S---------SRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFK  1188
             +         SR  R++  +  D +      R   +      +   EI++ A++   I  
Sbjct  159   NLENISNLLESRKFREA--RQQDQIGP---YRPRERWGQAEQLGSEEILQGAHDLLPICM  213

Query  1187  GFIIDHSFLHDEC-GKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASY  1011
             G  +D+ F       K   +F +      ++++EM+LS M+D ++TK + +  W G    
Sbjct  214   GQFMDYKFWPSPFQSKAIRFFGDKGY--TYELIEMQLSLMHDVLYTKAVVINTWWG----  267

Query  1010  FWCIWRFVCNALLVTVALIFFFHSKLHMK---PGDIGVTYCLVGGAVLLDQMALIHLIFS  840
               C  R +  +L+  +A  F F S          D+ VTY L+GGA LL+  A++  I S
Sbjct  268   --CFIRAI--SLVAIIATFFLFRSSTSKNVFIRVDVVVTYILLGGAFLLEMTAVLRAIGS  323

Query  839   HW  834
              W
Sbjct  324   TW  325



>gb|EMS65395.1| hypothetical protein TRIUR3_09082 [Triticum urartu]
Length=960

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 116/235 (49%), Gaps = 21/235 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTG--IVFLVGIVKCVERILSLQ  1347
             +ED+ LW RHLL+ +VQ   V  VLY+Y      W L T   ++F+ G++K  ER+ +L+
Sbjct  204   IEDSQLWLRHLLSFVVQTVGVAYVLYKY--VAGSWTLATAALLIFVAGVLKYGERVWALK  261

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHS  1167
              +S   +   +     S A +E    +G+      ++  E+++ A++   I     +D+ 
Sbjct  262   SSSLENMISFLDSRKLSEAKREQHAQQGQ---GGKLDPEEVLQGAHDLLPICMAQFVDYK  318

Query  1166  FLHDEC-GKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
             F   +   K  + F N      F+++EM+LS MYD ++TK   V  W G      C  R 
Sbjct  319   FWPSQFQSKAVELFDNKG--QMFELVEMQLSLMYDFLYTKAAVVFTWYG------CFIRA  370

Query  989   VCNALLVTVALIFFFHS---KLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
             + +A   T++  F F S   K      D  VTY L+ GAVLL+  AL+  + S W
Sbjct  371   MSSA--ATISTFFLFQSSIVKHDFNRVDAIVTYILIAGAVLLEMTALLKAMGSTW  423



>ref|XP_004974407.1| PREDICTED: uncharacterized protein LOC101770604 [Setaria italica]
Length=650

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 117/240 (49%), Gaps = 20/240 (8%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +EDN LW RHLLT  VQI     V+Y+Y + +   LL   I VF+VG+++  ER  +L  
Sbjct  100   LEDNRLWLRHLLTLSVQILGAAFVIYKYIVRRRTLLLLAAILVFVVGVLRYGERTWALWC  159

Query  1343  ASSRFVRKSI----GKSLDSVASKELIRAEG--KDMTDNIMNQYEIVRKAYECHQIFKGF  1182
              ++  +R ++    G++  + +  + +R     +D  D      E++  A+    + K  
Sbjct  160   GNTSSIRSTLKHPKGETAYNRSHWKKLRWPNPRQDDQDKSFGDEELLLGAHSLFHVCKIR  219

Query  1181  IIDHSFLHDECGKE-KDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFW  1005
              +D +    E  +    W+     +D   ++EMELS MYD ++TK   V  W G      
Sbjct  220   FVDATERMSEFDQTCTRWYGG---KDLSGLLEMELSLMYDILYTKAAVVHTWYGYTI---  273

Query  1004  CIWRFVCNALLVTVALIFF-FHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                  V + L  + AL+ F + S  H K   ++G+TY L+ G + L+ +++   I S WA
Sbjct  274   ----LVVSPLATSAALLLFHYSSDKHGKSKVNVGITYTLLSGTLALETISVARAIGSTWA  329



>gb|EMS64125.1| hypothetical protein TRIUR3_19935 [Triticum urartu]
Length=729

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 111/236 (47%), Gaps = 15/236 (6%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL   VQ   V  +LY++    S  L L T ++F++G++K  ERI +L+ 
Sbjct  99    LEDNQLWPRHLLNLGVQAFGVAYILYKHIGHISTSLGLATCLMFVIGLIKYGERIWALKC  158

Query  1343  ASSRFVRKSIGK-SLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDH-  1170
             A+   +R SI K  L      +L    G    +    +  +  +A     + KG II+  
Sbjct  159   ATMDDIRSSIKKCGLLPTYYGDLPPPSGASAEERDEEELLLFAQAML--PLCKGGIINFP  216

Query  1169  ----SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWC  1002
                 S  H+       W  N N +  FKV+EMELS MYD ++TK   +  W G     +C
Sbjct  217   VVLISHPHNS-PSNLSWCWNWNWKATFKVVEMELSLMYDILYTKAAIIHSWYG-----YC  270

Query  1001  IWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
             I  F+    +    L      K      D+ +TY L+ GA LLD  +++  + S W
Sbjct  271   IRVFLPFGTVAAFLLFQVSGDKDGCSRIDVAITYILLVGAFLLDMSSMLSALVSTW  326



>ref|XP_010670792.1| PREDICTED: uncharacterized protein LOC104887761 [Beta vulgaris 
subsp. vulgaris]
Length=744

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/287 (25%), Positives = 126/287 (44%), Gaps = 58/287 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW+RH L    Q+   + V +Q       W+ P  ++F+ G++K  ER  +L  A
Sbjct  106   LEDNELWNRHALQLATQVSITVYVFFQSFRENRLWI-PAVLMFVEGLIKYFERTCALFFA  164

Query  1340  SSRFVRKSIGKSLDSVAS-----KELIRA---------EGKD--------------MTDN  1245
             S+   R S+    +   +     +E   A         EGKD              + +N
Sbjct  165   STDSYRDSLVAEPEPGPNYARLMEEYNSAKGAYIPTDFEGKDGRLEGGARSDERDGLVEN  224

Query  1244  IMNQYEI----------------------VRKAYECHQIFKGFIIDHSFLHDECGKEKDW  1131
               NQ+                        V++A+  +++FK  + D      +    +D+
Sbjct  225   DQNQFAADDGSDPTGVANSDVKLTLDEMNVKEAHRFYEMFKALLADGFLSLKDRKVSRDF  284

Query  1130  FKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIF  951
             F ++ V+DAF+++E+EL+ +YD  +TK+  +Q+ +  A  F       C   ++   LIF
Sbjct  285   FISVPVKDAFRIIEIELNLIYDVFYTKLFLLQRKRAFARVF-------CFIFVIASLLIF  337

Query  950   FFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEME  810
                 K   K  DI +T+ L+ GA+ LD  A +  + S W ++ I  +
Sbjct  338   SIKDKSKYKTVDIVITFVLLLGAIALDICAALMFLLSDWWIIIISFD  384



>ref|XP_002863470.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39729.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=749

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 108/238 (45%), Gaps = 46/238 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL + + Q  + +  + Q    ++    P  ++F+ G +K VER       
Sbjct  110   LEDNALWKRHLFSLVSQALACVYAVVQS--MENVLWPPITLLFITGTIKYVER-------  160

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
                        SL      +L+R + +D+TD      EIV+  Y+    FKG ++D  F 
Sbjct  161   -----------SLIQKGPPKLVRPD-RDLTD-----LEIVQYGYKFFNTFKGLVVDLVFS  203

Query  1160  HDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCN  981
               E  + +D+F  L   +A +++E EL F+Y+ MFTK   +    G       ++R +  
Sbjct  204   SSERDESRDFFNELKPGEALRIIESELDFLYELMFTKNAILHTITG------TLFRLIAF  257

Query  980   ALLVTVALIFFFHSKLHMKP--------GDIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
               L++   +F      H +P         DI +TY L    + LD ++++  +FS W 
Sbjct  258   GSLISSFFVF------HRRPLKSEEFHGADIVITYTLFIVGIALDLLSIVMFLFSDWT  309



>ref|XP_011040249.1| PREDICTED: uncharacterized protein LOC105136553 [Populus euphratica]
Length=684

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 127/257 (49%), Gaps = 34/257 (13%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL    Q  +    L+  K +  + L+   I +F+ GI K  ERIL L L
Sbjct  112   LEDNELWLRHLLRLATQASTASYFLF--KSWGKDPLIYIAIPIFVAGITKFGERILVLWL  169

Query  1343  ASSRFVRKSIGKSLDSVASK--ELIRAEGK-DMTDNIMNQ----YEIVRKA---YECH--  1200
             ASS+  R    + +D+  S+  +  R+ G  DM++  +N+      I+ +A   +E H  
Sbjct  170   ASSKKFRDIENEEVDTFQSQFGKKFRSVGFFDMSEEDLNKGLEFNNIIPEAVYLHEAHFL  229

Query  1199  -QIFKGFIIDHSFLHDE-CGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWK  1026
              Q+FK F  D +  H       +         +AFKV+E+EL FMYD +FTK+ +V    
Sbjct  230   FQMFKIFYADLALSHSSHMASYRILSSKKKATEAFKVIEVELGFMYDVLFTKVTSV----  285

Query  1025  GIASYFWCIWRFVCNA---LLVTVALIFF---FHSKLHMKPGDIGVTYCLVGGAVLLDQM  864
                    C  R +  +   L  T AL+ F     +K      ++ ++Y L+GG V+L+  
Sbjct  286   -------CSTRTILRSISFLSFTSALVAFSLMVANKCAYTGTEVIISYILLGGGVVLEIY  338

Query  863   ALIHLIFSHWAMVKIEM  813
               I L+ S WAM+++ +
Sbjct  339   GFIMLLLSEWAMLRLSL  355



>ref|XP_010441722.1| PREDICTED: uncharacterized protein LOC104724860 isoform X2 [Camelina 
sativa]
Length=432

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 125/270 (46%), Gaps = 39/270 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R L      +C   V LY + +   +  L+PT ++ + G++K VERI +L+ 
Sbjct  107   IEDNDLWLRSLFAL---VCQGTVTLYVFLLSIPNNLLVPTSLMLVAGVIKYVERIQALRG  163

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEGKDM----------------TDNI  1242
             AS    + S+           + ++  + ++++R   + +                  N 
Sbjct  164   ASLETFKNSMLEDPDPGPDYARLMEEFSVRKMLREPTQIVRIEEVEKGQRPKVLVRPPNK  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSF--LHDECGKEKDWFKNLNV-EDAFKVMEMELSFM  1071
             +   E V+ AY+   IFKG ++D  F    ++    K +F +L+  E+   V+E+ELSF+
Sbjct  224   LTDLEAVQYAYKYFNIFKGLVVDLMFNSQSEQLNNSKVFFLSLDTPEETLSVLEVELSFI  283

Query  1070  YDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLV  891
             Y   +TK+  +  W GI+      +RF+  A LV+   IF    K      ++ +TY L+
Sbjct  284   YGTFYTKVNILHTWIGIS------FRFMALASLVSSLCIFVTAKKSEYNRFNVDLTYVLL  337

Query  890   GGAVLLDQMALIHLIFSHWAMVKIEMETVD  801
                + +D +A+     S W   + +    D
Sbjct  338   ISGIAVDFVAIFIFCVSDWTFARFKKPKED  367



>gb|EMS53204.1| hypothetical protein TRIUR3_14023 [Triticum urartu]
Length=689

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 117/236 (50%), Gaps = 23/236 (10%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL  ++Q+ + + VLY++   +   L L + ++F VG VK  E+  +L L
Sbjct  99    LEDNKLWKRHLLHVVLQVLAAVYVLYEHISGRGALLQLASVLMFAVGAVKYGEKTWALML  158

Query  1343  ASSRFVRKSIGKSLDSV-----ASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFI  1179
              +   +R ++ K   ++         +++A G       +++  +VR+A+    I K  I
Sbjct  159   GNLDSIRGAVKKQPPAMHGHFHPQDHVLKAGGH------LDEESLVRRAHSLFHICKRAI  212

Query  1178  IDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCI  999
             +D   + D+     D  K ++    + +ME ELS MYD ++TK   +  W G +      
Sbjct  213   VDCPVIEDDS----DTAKMVDGVKFWPLMETELSLMYDMLYTKAPVIHTWFGYSV-----  263

Query  998   WRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFSHW  834
              R V   ++    L+F    K     G D+ VTY L GGA+ ++  AL++ + S W
Sbjct  264   -RLVSPLVIAASLLLFKLIGKDVAHRGVDVIVTYVLYGGALFMETTALLNALGSSW  318



>gb|EAY92921.1| hypothetical protein OsI_14725 [Oryza sativa Indica Group]
Length=651

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/265 (28%), Positives = 117/265 (44%), Gaps = 19/265 (7%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLLT  VQ+  V  VLY+Y       +    ++F VG+VK  ER+ +   A
Sbjct  101   LEDNQLWLRHLLTFTVQVLGVAYVLYRYIAGSRTLVEAIILMFAVGVVKYGERVWAFMCA  160

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFL  1161
             +   +R S+    DS A    +    K+  +  + Q   +  A+      K   +D   +
Sbjct  161   NVDSIRSSLDFLDDSSAHNPYLEQARKERMNRDLEQ--ALLGAHYMFDFCKSLFVDALSM  218

Query  1160  HD------ECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCI  999
              +      E   + D  K++     ++++EMELS MYD +++K   +  W G      CI
Sbjct  219   SEPQRSAVEQAMQIDGGKHM-----YRLIEMELSLMYDILYSKAAVIHTWYGR-----CI  268

Query  998   WRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
               F   A  V   L+F F  +      D  VTY L+ GA+LL+   L+  + S W    +
Sbjct  269   RVFSLPA-TVAALLLFHFSKRDAYHIVDSAVTYALLIGAILLEITTLLRTVGSSWTCAFL  327

Query  818   EMETVDTPVARKLKQKKTVDTPVAR  744
                  D P    +  ++ V    +R
Sbjct  328   HTRKWDWPCNSVMFTRQIVKAGRSR  352



>gb|EEE60461.1| hypothetical protein OsJ_13711 [Oryza sativa Japonica Group]
Length=717

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 120/246 (49%), Gaps = 24/246 (10%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE---WLLPTGIVFLVGIVKCVERILSL  1350
             ++DN LW RHL   +VQ+     V+Y+  I   E    LL T ++F+VG+VK  ER  +L
Sbjct  99    LQDNQLWLRHLQILVVQVLGAGYVVYKRLIVGGEKTILLLATVLMFMVGLVKYCERTFAL  158

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFKGFII  1176
             +      +R  +      +  K+L    G   +++  N  +  ++++A+    I K  I+
Sbjct  159   KRGDFSSIRSYV----KELPGKQLRWYRGYLQSEDHYNSNDEFLLQRAHSLFHICKRGIV  214

Query  1175  DHSFLHDECGKEKDWFKNL-----NVEDA---FKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
             D     D    E +  + L     N +     +KVMEMELS +YD ++TK   +  W G 
Sbjct  215   DSVINVDMDKTEAEITRKLINQIRNPQQPMVMWKVMEMELSLLYDILYTKAAVIHTWIGY  274

Query  1019  ASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
                   + R +    +V+  L+F F  SK      DI VTY L+GGA++++  +L+  + 
Sbjct  275   ------LIRAMTPVAIVSSFLLFHFSDSKDGQNVVDITVTYILLGGALMMEMTSLLSALG  328

Query  842   SHWAMV  825
             S WA+ 
Sbjct  329   SSWALA  334



>gb|EMT16644.1| hypothetical protein F775_03233 [Aegilops tauschii]
Length=621

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 116/239 (49%), Gaps = 28/239 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLL-PTGIV-FLVGIVKCVERILSLQ  1347
             +EDN LW RHL T  VQ+ +   VLY+  I     LL P  I+ F+VG++K  ER+ +L 
Sbjct  98    VEDNRLWLRHLQTFTVQVLAAGYVLYESSIVARRTLLRPAAILMFVVGVIKYGERVWALN  157

Query  1346  LASSRFVRKSIGKSLDSVASKELIRAE-GKDMTDNIMNQYEIVRKAYECHQIFKGFIIDH  1170
              AS+  +     +S   V  +  +  + G D    ++  ++++R       + KG +   
Sbjct  158   CASTSNLPGKNYQSFGRVHIEHPLSLQCGADRDGQVLVAHQLLRIPM---HLLKGPLPLV  214

Query  1169  SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
             +F        +   ++ N E  ++V E++LS MY+  F+K   +  W+G      CI   
Sbjct  215   AF-------HRSMMEDYNWERMYEVAEVQLSLMYEVFFSKAPVIHTWRGR-----CI---  259

Query  989   VCNALLVTVALIFFFHSKLHMKPG------DIGVTYCLVGGAVLLDQMALIHLIFSHWA  831
                + + TVA    FH +   K G      D+  TY L+ GAV+L+  +L+  +FS WA
Sbjct  260   HVISPMATVAAFMLFH-RFSQKDGDYYNRVDVAATYVLLTGAVVLEITSLLRAMFSSWA  317



>gb|EMS51957.1| hypothetical protein TRIUR3_07227 [Triticum urartu]
Length=723

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 126/272 (46%), Gaps = 45/272 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLP-TGIVFLVGIVKCVERILSLQL  1344
             +EDN +W RHL+  + ++ S  V+ +    F+   ++P T ++F+VGI+K  ER  SL  
Sbjct  120   IEDNEMWLRHLIGFLFELLSASVIFFCS--FKDNPMMPATVLMFVVGIIKYGERTYSLYS  177

Query  1343  ASSRFVRKSI------GKSL------------------------DSVASKELIRAEGKDM  1254
              S    R+SI      G++                         DS A + L   E    
Sbjct  178   GSINGFRESILGPPDPGQNYAKFMTEFDSREQAGLDVEIVISGADSEAKRALADLEEAKA  237

Query  1253  TDNIMN-QYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWF---KNLNVED--AFKVM  1092
                + N    + ++A+    IF+   +D    ++E      +F   +NL+     AF V+
Sbjct  238   ARVLWNTNMSLEQQAFNFFLIFRRLFVDLILNYEENSISHAYFLERENLSYSPTTAFLVI  297

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDI  912
              +EL+F+YD ++TK     +  G      C+ RF+ +A L++  LIF  H K      DI
Sbjct  298   GVELNFIYDMVYTKAPVTYRKAG------CVLRFIASACLISSLLIFIHHDKGGFTHIDI  351

Query  911   GVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
              +TY L+ G V LD  AL  L+FSH  ++ +E
Sbjct  352   AITYALLLGGVGLDIAALAMLLFSHRMLIFLE  383



>emb|CAH65942.1| OSIGBa0147M20.4 [Oryza sativa Indica Group]
Length=697

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/246 (29%), Positives = 121/246 (49%), Gaps = 24/246 (10%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE---WLLPTGIVFLVGIVKCVERILSL  1350
             ++DN LW RHL   ++Q+     V+Y+  I   E    LL T ++F+VG+VK  ER  +L
Sbjct  99    LQDNQLWLRHLQILVIQVLGAGYVVYKRLIVGGEKTILLLATVLMFMVGLVKYCERTFAL  158

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFKGFII  1176
             +  +   +R  +      +  K+L    G   +++  N  +  ++++A+    I K  I+
Sbjct  159   KRGNFSSIRSYV----KELPGKQLRWYRGYLQSEDHYNSNDEFLLQRAHSLFHICKRGIV  214

Query  1175  DHSFLHDECGKEKDWFKNL-----NVEDA---FKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
             D     D    E +  + L     N +     +KVMEMELS +YD ++TK   +  W G 
Sbjct  215   DSVINVDMDKTEAEITRKLINQIRNPQQPMVMWKVMEMELSLLYDILYTKAAVIHTWIGY  274

Query  1019  ASYFWCIWRFVCNALLVTVALIFFFH-SKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIF  843
                   + R +    +V+  L+F F  SK      DI VTY L+GGA++++  +L+  + 
Sbjct  275   ------LIRAMTPVAIVSSFLLFHFSDSKDGQNVVDITVTYILLGGALMMEMTSLLSALG  328

Query  842   SHWAMV  825
             S WA+ 
Sbjct  329   SSWALA  334



>gb|KCW53128.1| hypothetical protein EUGRSUZ_J02420 [Eucalyptus grandis]
Length=686

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 121/525 (23%), Positives = 205/525 (39%), Gaps = 102/525 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R L    VQ+     + +      +  +L  G + LVG +K VER L L LA
Sbjct  113   LEDNELWLRQLARLCVQVGLACYIYFMALSGSTLSILAAGTI-LVGFIKYVERALCLYLA  171

Query  1340  SSRFVRKSIGKSLD------------SVASKELIRAEGKDMTD------------NIMNQ  1233
             S   +R S+    D            S+  +E  R    ++T+              M++
Sbjct  172   SEGRLRDSMLSLPDFGPIYPRIMEQYSLKKEEGYRVSMDEVTEVPAPEDFSVNSGQAMDE  231

Query  1232  YEIVR--KAYECHQIFKGFIIDHSFLHDECGKEKDWFKN--LNVEDAFKVMEMELSFMYD  1065
              +     KAYE  +IFK   +       +    K  F N  +N   AF ++E+EL FMYD
Sbjct  232   EKATALVKAYELFKIFKLLFVGLILNSGDLEASKRMFTNVAMNSVTAFGIVEIELGFMYD  291

Query  1064  AMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFF-FHSKLHMKPGDIGVTYCLVG  888
              ++TK + + +        W I R+V N  +    L+FF    +      DI +T+ L+ 
Sbjct  292   LLYTKALLLNR-------AWGITRWVINLSVPCAVLVFFSLQDRKDYPKVDIYITFLLIS  344

Query  887   GAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPV  708
              A+LL+  +++    S W    ++   +  P      ++  + + VA             
Sbjct  345   AAILLEIYSVLLAFSSDW----VDHWRIQRP------KRSVISSAVA-------------  381

Query  707   ARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGR-RLKCADDFLEHFLLK  531
                               + +  +  WS  + Q+SLLK S   R R+   + +     L 
Sbjct  382   -----------------FLRIWPNPRWSNSVAQFSLLKLSSRKRNRIFSKNPWFAK--LD  422

Query  530   GVIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHLAP  351
               ++   +    + +  +K   F  +++     E  +          EV+ K    HL  
Sbjct  423   DKLEKNFYIDYKEFKSNIKEWTFGHMRKTVVYLEGKSGLAGLKLQASEVLKKSNNGHLIW  482

Query  350   KvvdsssddvvvsvddDIENYANFVLTLHVATEICYFT---ADKTKGGDDEAGAKLLCIQ  180
              V                  +   +L  H+ATE+CY+    A + KG +D    K+  + 
Sbjct  483   SVDGM--------------EFDQSILIWHIATELCYYKDHDARQGKGPEDITNYKMSKL-  527

Query  179   ISQYLAYLLVLEEKITSAVPGSIG-MRFKDICKDQIKNTFDHLCD  48
             +S+Y+ YLLVL     S +P   G +R++D   D  K   D L  
Sbjct  528   VSRYMLYLLVLH---PSMLPTGTGVLRYEDTSVDAQKFFEDKLAS  569



>ref|XP_003632780.2| PREDICTED: uncharacterized protein LOC100854005 [Vitis vinifera]
Length=777

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 140/316 (44%), Gaps = 56/316 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWL-LPTGIV----FLVGIVKCVERIL  1356
             +EDN LW RHLL  +VQ+    V  Y   +F   W   P   +    F+ GI+K  ER  
Sbjct  109   LEDNELWLRHLLGLVVQVG---VAFY---VFLRSWAGTPLTFLSIPMFVAGIIKYGERTW  162

Query  1355  SLQLASSRFVRKSI------------------GKSLDSVASKELIRAE-----------G  1263
              L+ AS    R S+                   ++ D+ A  E IR E           G
Sbjct  163   VLRSASKNHFRDSLLLVPDPGPDYAHFMEKYSSRNYDTQA--ERIRKEKTGENPLQSTVG  220

Query  1262  KDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEME  1083
              D+T  + ++  I +  +     FK    D     D+    +   + ++ EDAFKV+EME
Sbjct  221   DDIT--VPSRKYIDKAYFLFKNQFKHLYADLILSLDDQKTSEGIIRYMSSEDAFKVVEME  278

Query  1082  LSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLV-TVALIFFFHSKLHMKPGDIGV  906
             L+FMYD ++TK   +    GI      + R    +  + T+A   FF  K      DI +
Sbjct  279   LNFMYDVLYTKATVIYSLLGI------LLRSTSFSFTISTLAAFHFFIDKHQFSNIDIDI  332

Query  905   TYCLVGGAVLLDQMALIHLIFSHWAMVKIEMET--VDTPVARKLKQKKTV---DTPVARK  741
             TY L+ GA+ L+  AL  LI S W++V +  +T  +   + R +   ++V   D   +R+
Sbjct  333   TYLLLFGAIFLEVYALTKLILSDWSIVWLSSKTNSLADSIYRAITSFRSVITSDKRWSRR  392

Query  740   LKQKKTVDTPVARKLK  693
             + Q   +D+ +  K K
Sbjct  393   MAQNNLIDSCLRDKTK  408



>emb|CAE04417.2| OSJNBb0040D15.7 [Oryza sativa Japonica Group]
Length=637

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 118/245 (48%), Gaps = 22/245 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE---WLLPTGIVFLVGIVKCVERILSL  1350
             ++DN LW RHL   +VQ+     V+Y+  I   E    LL T ++F+VG+VK  ER  +L
Sbjct  99    LQDNQLWLRHLQILVVQVLGAGYVVYKRLIVGGEKTILLLATVLMFMVGLVKYCERTFAL  158

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFKGFII  1176
             +      +R  +      +  K+L    G   +++  N  +  ++++A+    I K  I+
Sbjct  159   KRGDFSSIRSYV----KELPGKQLRWYRGYLQSEDHYNSNDEFLLQRAHSLFHICKRGIV  214

Query  1175  DHSFLHDECGKEKDWFKNL-----NVEDA---FKVMEMELSFMYDAMFTKMIAVQQWKGI  1020
             D     D    E +  + L     N +     +KVMEMELS +YD ++TK   +  W G 
Sbjct  215   DSVINVDMDKTEAEITRKLINQIRNPQQPMVMWKVMEMELSLLYDILYTKAAVIHTWIG-  273

Query  1019  ASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFS  840
                 + I      A++ +  L  F  SK      DI VTY L+GGA++++  +L+  + S
Sbjct  274   ----YLIRDMTPVAIVSSFLLFHFSDSKDGQNVVDITVTYILLGGALMMEMTSLLSALGS  329

Query  839   HWAMV  825
              WA+ 
Sbjct  330   SWALA  334



>ref|XP_006663434.1| PREDICTED: uncharacterized protein LOC102709123 [Oryza brachyantha]
Length=643

 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/243 (28%), Positives = 107/243 (44%), Gaps = 23/243 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             MEDNNLW RHLL  + Q+   L V ++    Q  +LL +GI  F+ GI+K  ER  SL  
Sbjct  106   MEDNNLWLRHLLNLVTQVMLALYVFWKSIGRQDVYLLVSGIFAFVAGIIKYGERTWSLNW  165

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKG-FIIDHS  1167
              S++    S G        K++        T  +      +R     H +F    + D+S
Sbjct  166   GSTKSFESSTGDLYKKQMPKQIYGGASYSGTVCVA-----LRSMSYVHGVFSARTLFDNS  220

Query  1166  -FLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
               + D  G         ++E   KV+ +EL  +YD ++TK + ++   GI      I R 
Sbjct  221   PLIEDTLG---------DLEKTLKVVRLELGMIYDDLYTKSLVLRTRSGI------ILRC  265

Query  989   VCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEME  810
             +     +   ++F  H+K      DI +TY L  G   LD  A++  + S W    ++ +
Sbjct  266   ISQISAIIAFVLFLTHNKHGYGKADIAITYSLFTGGFFLDIFAILFSMMSPWTWAWLKAQ  325

Query  809   TVD  801
               D
Sbjct  326   KCD  328



>ref|XP_008224933.1| PREDICTED: uncharacterized protein LOC103324630 [Prunus mume]
Length=675

 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 120/263 (46%), Gaps = 38/263 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN  W RHL+  ++Q+ +     Y   +F+++   PT +VF+VG +K  ER  +L LA
Sbjct  108   LEDNEFWLRHLIQLILQVLAAAYSFYM-TLFENKLWFPTVLVFVVGTIKFGERTCALYLA  166

Query  1340  SSRFVRKS----------------IGKSLDSVASKELIRAEGKDMT-----------DNI  1242
             S     ++                I  ++ SV     +    + M            D +
Sbjct  167   SLDHFGETVLPEPEPGPDYEEAVEIYSTMRSVEVPTQVELPVRPMNIGNYKNPKFTVDGV  226

Query  1241  ----MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSF  1074
                 ++  +++++AY   + FKG I+          + +D+F       AF+++E ELSF
Sbjct  227   PKESLDDVQLLQEAYRFFESFKGLIVGFLLSSKVRERSRDFFLKRTHVSAFQLIEYELSF  286

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             MY+ + TK++  +   G       I R +     V   ++F    K      DI +TY L
Sbjct  287   MYEVLHTKVVVARHKVGY------ILRLITFCSTVGALMLFALVEKHKFDKFDIALTYAL  340

Query  893   VGGAVLLDQMALIHLIFSHWAMV  825
             + GA++LD ++++ LI S W ++
Sbjct  341   LNGAIILDTLSVLKLICSDWTVI  363



>gb|EAZ38443.1| hypothetical protein OsJ_22821 [Oryza sativa Japonica Group]
Length=764

 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 125/266 (47%), Gaps = 38/266 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHL+  + ++ S LVV +   I  +  +  T ++F+VG++K  ER  SL   
Sbjct  79    VDDNELWRRHLIGLLFELFSALVV-FSCSIRSNPMIPATALIFVVGVIKYGERTYSLYSG  137

Query  1340  SSRFVRKSIGKSLDSVASK-----------------ELIRAEGK-DMTDNIMNQYEIVRK  1215
             S   V   I ++ D   +                  E+  A G+      ++ Q   VR 
Sbjct  138   SVDGVIAKIFRAPDPGPNYAKLMTVFGGKRNGGLLVEITIANGEASKAKEVLQQGSEVRL  197

Query  1214  ----------AYECHQIFKGFIIDHSFLHDECGKEKDWF---KNLNVEDAFKVMEMELSF  1074
                       AYE   +F+   +D +  + E    + +F   +++  + AF+VME+EL++
Sbjct  198   VETTKSLEAIAYEFFTMFRVLYVDINLSYKERRISQAYFLDRRDMTADKAFEVMEIELNY  257

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD ++TK        G      C+ RF+C   LV   ++F    K  + P D G+TY L
Sbjct  258   LYDMVYTKAPVSHSSAG------CVLRFICTTCLVVAIVLFVLLDKTGILPVDRGITYAL  311

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIE  816
             + G + LD  A++ L+ S+  +V +E
Sbjct  312   LLGGLALDVAAILMLLCSNRMIVFLE  337



>ref|XP_006398228.1| hypothetical protein EUTSA_v10001216mg [Eutrema salsugineum]
 gb|ESQ39681.1| hypothetical protein EUTSA_v10001216mg [Eutrema salsugineum]
Length=813

 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 149/355 (42%), Gaps = 71/355 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSL---  1350
             +EDN LW RHL   + Q  + +  + Q    ++E   P  ++F+ G++K  ER  +L   
Sbjct  110   LEDNALWARHLFGLVSQALAGVYAVVQS--MENELWPPILLLFITGVIKYTERTRALYAA  167

Query  1349  --------------------QLASSRFVRKSIGKSLDSVASKE---------LIRAEGKD  1257
                                 +L      RK      D V  KE         L+R + K 
Sbjct  168   CLDKFKDRMLKPPDTGPNYAKLMEEYASRKDSNLPTDIVLIKEPDKHERPPKLVRPDRKY  227

Query  1256  MTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELS  1077
             +T+      EIV+  ++    FKG ++D  F   E  + +D+FK L  E+A +++E EL 
Sbjct  228   LTN-----LEIVQYGFKFFNTFKGLVVDLIFSFRERDESRDFFKELQPEEALRIIESELG  282

Query  1076  FMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSK----LHMKPGDIG  909
             F+Y++M+TK   +Q   G  S      R +    L++    F FH +    +     D+ 
Sbjct  283   FLYESMYTKTAILQTTPGTLS------RIIAFGSLLSS--FFVFHRRPLKSVEFHGADVV  334

Query  908   VTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQK  729
             +TY L    + L+  +++  + S W             V RKLK     D PV +K    
Sbjct  335   ITYTLFIIGIALELASIVMFLLSDWTFA----------VLRKLK-----DDPVEKKSYID  379

Query  728   KTVDTPVARKLKQKIISLIYYGHKLITVVNS----KSWSGEIIQYSLLKHSLAGR  576
               +D  +A + K +       G++   V+ +    + WSG I  ++ + + L  +
Sbjct  380   SFLDRLLAFR-KPRWTEHKCEGNRTHEVLTTPFLLRRWSGAIYGFNFIGYCLKAK  433



>ref|NP_001058721.1| Os07g0109100 [Oryza sativa Japonica Group]
 dbj|BAC06937.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30637.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20635.1| Os07g0109100 [Oryza sativa Japonica Group]
Length=799

 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 125/266 (47%), Gaps = 38/266 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHL+  + ++ S LVV +   I  +  +  T ++F+VG++K  ER  SL   
Sbjct  114   VDDNELWRRHLIGLLFELFSALVV-FSCSIRSNPMIPATALIFVVGVIKYGERTYSLYSG  172

Query  1340  SSRFVRKSIGKSLDSVASK-----------------ELIRAEGK-DMTDNIMNQYEIVRK  1215
             S   V   I ++ D   +                  E+  A G+      ++ Q   VR 
Sbjct  173   SVDGVIAKIFRAPDPGPNYAKLMTVFGGKRNGGLLVEITIANGEASKAKEVLQQGSEVRL  232

Query  1214  ----------AYECHQIFKGFIIDHSFLHDECGKEKDWF---KNLNVEDAFKVMEMELSF  1074
                       AYE   +F+   +D +  + E    + +F   +++  + AF+VME+EL++
Sbjct  233   VETTKSLEAIAYEFFTMFRVLYVDINLSYKERRISQAYFLDRRDMTADKAFEVMEIELNY  292

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD ++TK        G      C+ RF+C   LV   ++F    K  + P D G+TY L
Sbjct  293   LYDMVYTKAPVSHSSAG------CVLRFICTTCLVVAIVLFVLLDKTGILPVDRGITYAL  346

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIE  816
             + G + LD  A++ L+ S+  +V +E
Sbjct  347   LLGGLALDVAAILMLLCSNRMIVFLE  372



>gb|EMT09518.1| hypothetical protein F775_22766 [Aegilops tauschii]
Length=713

 Score = 85.1 bits (209),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 75/272 (28%), Positives = 124/272 (46%), Gaps = 45/272 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIV-FLVGIVKCVERILSLQL  1344
             +EDN +W RHL+  + ++ S  V+ +    F+   ++P  I+ F+VGI+K  ER  SL  
Sbjct  120   IEDNEMWLRHLIGFLFELLSASVIFFCS--FKDNPMMPATILMFVVGIIKYGERTYSLYS  177

Query  1343  AS------------------SRFV-----RKSIG-------KSLDSVASKELIRAEGKDM  1254
              S                  ++F+     R+  G          DS A + L+  E    
Sbjct  178   GSISGFHESILGPPDPGQNYAKFMTEFDSREQAGLDVEIVISGADSEAKRALVDLEEAKA  237

Query  1253  TDNIMNQ-YEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWF-----KNLNVEDAFKVM  1092
                + N    + ++A+    IF+   +D    ++E      +F      + +   AF VM
Sbjct  238   ARVVGNTTMSLEQQAFNFFLIFQRLFVDLILNYEENSISHAYFLEREEVSYSPTKAFLVM  297

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDI  912
              +EL+F+YD ++TK     +  G      C+ RF+ +A L++  LIF  H K      DI
Sbjct  298   GVELNFIYDMVYTKAPVTYRKAG------CVLRFIASACLISSLLIFIHHDKGGFTHIDI  351

Query  911   GVTYCLVGGAVLLDQMALIHLIFSHWAMVKIE  816
              +TY L+ G V LD  AL  L+FSH  ++ +E
Sbjct  352   AITYPLLLGGVGLDTAALAMLLFSHRILIFLE  383



>ref|XP_006653153.1| PREDICTED: uncharacterized protein LOC102713624 [Oryza brachyantha]
Length=1710

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 72/244 (30%), Positives = 122/244 (50%), Gaps = 23/244 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQS----EWLLPTGIVFLVGIVKCVERILS  1353
             ++DN LW RHL+T +VQ   V  VLY+  I  S      LL T  +F+VG+V   +R  +
Sbjct  318   LQDNQLWLRHLVTLLVQALGVGFVLYKRIIIGSGVATPLLLATVFMFVVGLVMYGDRTWA  377

Query  1352  LQLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYE--IVRKAYECHQIFKGFI  1179
             L+         +I  S+  +  K++   +G   +++  N  +  ++++A+    + K  I
Sbjct  378   LKQGH----LSNIQSSVRELPGKQIRWYKGYLQSEDHYNSIDEFLIQRAHSLFHVCKRGI  433

Query  1178  IDHSFLHD----ECGKEKDWFKNL--NVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIA  1017
             +D     D    E    +    NL    E  +KVMEMELS MYD ++TK   +       
Sbjct  434   VDSVSNVDTEIWETETTRTIINNLRRTPEKMWKVMEMELSLMYDVLYTKAAVIH-----T  488

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHMKPG-DIGVTYCLVGGAVLLDQMALIHLIFS  840
             S  +CI  F   A+  +  L+F F     ++ G ++ VTY L+GGA++++  +L+  + S
Sbjct  489   SIGYCIRVFSPVAIAASF-LLFHFSGSEDLQNGVEVAVTYALLGGALVIETASLLSALGS  547

Query  839   HWAM  828
              WA+
Sbjct  548   SWAL  551


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 110/244 (45%), Gaps = 29/244 (12%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMV-QICSVLVVLYQYKIFQSEWLLPTG-IVFLVGIVKCVERILSLQ  1347
             + DN LW RHL+  +V Q      V+Y+    ++  LL    ++F +G++K  ER  +L+
Sbjct  982   LADNQLWKRHLVFGLVPQALGAANVIYRSFAGRTTTLLSAAMLMFAIGVLKYGERTWALK  1041

Query  1346  LASSRFVRKSIGKSLDSVASKE----------LIRAEGKDMTDNIMNQYEIVRKAYECHQ  1197
              A+   +R S+        +K           L R +G D+     ++ E++  A+    
Sbjct  1042  YANLSSIRSSVNVKTPPPTTKRPLQYYPERSWLPRRDGGDV-----DEEELLLVAHSMFH  1096

Query  1196  IFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIA  1017
             I K  + D S   D    +   F +   ++  +V EMELS MYD ++TK   +  W G  
Sbjct  1097  ICKRAMADSSVEPDSGEYDSKIF-SYGWKEMCRVAEMELSLMYDLLYTKAAVMHTWFGFG  1155

Query  1016  SYFWCIWRFVCNALLVTVALIFFFHSKLHM---KPGDIGVTYCLVGGAVLLDQMALIHLI  846
                    R V  + L  VA +  FH +  +   +  D+ +TY L+  A +L+  +L   I
Sbjct  1156  I------RVV--SPLAVVAALGLFHLENDIGSYRQVDVAITYALLVAAFVLETTSLCRAI  1207

Query  845   FSHW  834
              S W
Sbjct  1208  GSTW  1211



>ref|XP_010441721.1| PREDICTED: uncharacterized protein LOC104724860 isoform X1 [Camelina 
sativa]
Length=586

 Score = 84.7 bits (208),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 151/343 (44%), Gaps = 48/343 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKI-FQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN+LW R L      +C   V LY + +   +  L+PT ++ + G++K VERI +L+ 
Sbjct  107   IEDNDLWLRSLFAL---VCQGTVTLYVFLLSIPNNLLVPTSLMLVAGVIKYVERIQALRG  163

Query  1343  ASSRFVRKSI----------GKSLDSVASKELIRAEGKDM----------------TDNI  1242
             AS    + S+           + ++  + ++++R   + +                  N 
Sbjct  164   ASLETFKNSMLEDPDPGPDYARLMEEFSVRKMLREPTQIVRIEEVEKGQRPKVLVRPPNK  223

Query  1241  MNQYEIVRKAYECHQIFKGFIIDHSF--LHDECGKEKDWFKNLNV-EDAFKVMEMELSFM  1071
             +   E V+ AY+   IFKG ++D  F    ++    K +F +L+  E+   V+E+ELSF+
Sbjct  224   LTDLEAVQYAYKYFNIFKGLVVDLMFNSQSEQLNNSKVFFLSLDTPEETLSVLEVELSFI  283

Query  1070  YDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLV  891
             Y   +TK+  +  W GI+      +RF+  A LV+   IF    K      ++ +TY L+
Sbjct  284   YGTFYTKVNILHTWIGIS------FRFMALASLVSSLCIFVTAKKSEYNRFNVDLTYVLL  337

Query  890   GGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTP  711
                + +D +A+     S W   + +    D      L           RKLK K    + 
Sbjct  338   ISGIAVDFVAIFIFCVSDWTFARFKKPKEDEDRKDTLVDVVFNSILSFRKLKWKACDCSH  397

Query  710   VARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLA  582
               +  K +++       K I     + WS  I  Y+L+++SL 
Sbjct  398   RKKGSKCEVLD-----RKFIF----RRWSEYIYSYNLIEYSLG  431



>ref|XP_007146447.1| hypothetical protein PHAVU_006G041300g [Phaseolus vulgaris]
 gb|ESW18441.1| hypothetical protein PHAVU_006G041300g [Phaseolus vulgaris]
Length=923

 Score = 84.7 bits (208),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 83/151 (55%), Gaps = 8/151 (5%)
 Frame = -3

Query  1271  AEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVM  1092
              +G D+ D  +   E+++ AY+    FKG ++D  F   E    +++       DA +V+
Sbjct  278   PKGDDVED--LLDLEVIKGAYDYFNTFKGLVVDMIFSFQERSNSRNYLLGRTAVDALRVI  335

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDI  912
             E+EL+F+Y A +TK   ++ W GI+      +RF+  + +V   ++F +  K   +P D+
Sbjct  336   EVELNFIYQAFYTKTTIIKSWLGIS------FRFLSISSVVAALVVFIYEQKRGCEPFDV  389

Query  911   GVTYCLVGGAVLLDQMALIHLIFSHWAMVKI  819
              +TY L+ GAV L+ ++++  IFS ++   I
Sbjct  390   KITYILLYGAVALEVLSIVMFIFSDYSFALI  420


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+L  +VQ+C    V        + W+ PT +VF+ G++K  ER  SLQLA
Sbjct  110   LEDNELWLRHMLGLIVQVCLTGYVFLLTLPDNTLWI-PTALVFMAGLIKFAERTRSLQLA  168

Query  1340  SSRFVRKSI  1314
             S    R+S+
Sbjct  169   SLGNFRQSM  177



>emb|CDY38971.1| BnaC07g18490D [Brassica napus]
Length=687

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 108/257 (42%), Gaps = 36/257 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHL   + Q  +    + Q     +    P  ++F+  ++K  ER  +L  A
Sbjct  110   LEDNALWARHLFGLVSQALAGAYAVVQS--MDNPLWPPIALLFITAVIKYTERTRALYTA  167

Query  1340  SSRFVRKSIGKSLDSVASKELIRAEGKDMTD--------------------------NIM  1239
             S    +  + K  D+  +   +  E     D                          + +
Sbjct  168   SLDKFKDQMRKPADTGPNYAKLMEEYDSRKDSNLPTDIVLIDEPDKHDRPPTLKPGPDPL  227

Query  1238  NQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAM  1059
             N  +IV+  +     FKG ++D  F   E  + +D+FK L  EDA +++E EL F+YD+M
Sbjct  228   NHLKIVQYGFRFFNTFKGLVVDLIFSFRERDESRDFFKELAPEDALRIIESELGFLYDSM  287

Query  1058  FTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSK--LHMKPGDIGVTYCLVGG  885
             +TK   +   KG       ++R +    L+   L+F F  +  +     D+ +TY L   
Sbjct  288   YTKTAILHTHKG------TVFRVIAFGSLLASFLVFHFRPEKSVDFHGADVVITYTLFIV  341

Query  884   AVLLDQMALIHLIFSHW  834
              + L+  +L   + S W
Sbjct  342   GIALELSSLAMFLLSDW  358



>gb|KDO70909.1| hypothetical protein CISIN_1g007340mg [Citrus sinensis]
Length=607

 Score = 84.3 bits (207),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 110/230 (48%), Gaps = 11/230 (5%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW R +    VQ  +   + +Q     ++ ++P   VF+ G++KC ERI +  LA
Sbjct  87    LEDNQLWIRQMFGVAVQAVAAGYIFFQTLPGGNQLVIPVVFVFIAGVIKCFERIRAAYLA  146

Query  1340  SSRFVRKSIGKSLDSVAS--KELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHS  1167
             S + VRK I + L    +  KE+ R + K  + +     E V  A    ++F G I D  
Sbjct  147   SEKVVRKQISEELPDSETLEKEVTRIQSKGGSGSASKNKESVELARLYSKLFLGIIFDL-  205

Query  1166  FLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFV  987
              +H +   E+  F   +   A K +E+EL+F+Y+   TK+  V    G+      I RF 
Sbjct  206   IIHFDFNLER--FITQDPSIALKNIEVELNFIYELFHTKINFVLSGLGM------ILRFT  257

Query  986   CNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSH  837
               + +V    +F+  +       ++GVTY L    + L+ +++  ++ S 
Sbjct  258   SFSSVVVALSVFYTQANSSNDAFEVGVTYTLFWATIALELLSIGFILHSR  307



>ref|XP_008670985.1| PREDICTED: uncharacterized protein LOC103648281 [Zea mays]
Length=827

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 98/386 (25%), Positives = 165/386 (43%), Gaps = 104/386 (27%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLP-TGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RHL+  + ++ S  V+ +     +   ++P T ++F+VG++K  ER  SL  
Sbjct  134   LEDNELWLRHLIGLLFELFSACVIFFCS--LRGNPMIPATVLMFVVGVIKYAERTYSLYS  191

Query  1343  ASSRFVRKSIGKSLDSVA-----------------SKELIRAEG----------KDMTDN  1245
              S    R +I    D                    S E+  A G          K M   
Sbjct  192   GSVDGFRSNILDPADPGPNYAKLMTEFDSKKKAGISVEITIANGEAKLAHEEMEKHMNTR  251

Query  1244  IMNQYEIVR-KAYECHQIFKGFIIDHSFLHDECGKEKDWF--------KNLNVEDAFKVM  1092
             +++  + V  +AY+   IF+   ++      E    + +F           ++ +AF+V+
Sbjct  252   LLDTRKSVEARAYDFFLIFRRLFVNVILSFKERRLSQAFFVRDTDTEETTTSIREAFEVI  311

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIW--RFVCNALLVTVALIFFFHSKL--HMK  924
             E+EL+F+YD ++TK           +Y  C W  R +C+  LV   LIFFF  K    + 
Sbjct  312   EVELNFIYDMVYTK--------APVAYTTCGWVLRCICSCCLVAALLIFFFLDKPAHQIL  363

Query  923   PGDIGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVAR  744
             P D+G+TY L+ G + LD +AL+ + FS+ A V +E  T  TP  R L            
Sbjct  364   PVDVGITYALLLGGLALDAVALLMIFFSNRAKVYLETRT-STPRLRWLAS----------  412

Query  743   KLKQKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLA-GR---  576
              L+Q        A++ +                  ++ WSG+  Q +L+ HSL+ G+   
Sbjct  413   -LRQ-------AAKRWQ------------------TRRWSGKTSQLNLISHSLSLGKPDR  446

Query  575   ------------RLKCADDFLEHFLL  534
                         +L C +D ++ F+ 
Sbjct  447   YGKGAALCLWLSKLSCCEDIVDDFVF  472



>ref|XP_009128802.1| PREDICTED: uncharacterized protein LOC103853644 isoform X1 [Brassica 
rapa]
Length=822

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 123/270 (46%), Gaps = 52/270 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RH+   + Q I  V VVL    I  S WL+   +VF+ G +K +ER  +L  
Sbjct  111   LEDNALWLRHVFGLVFQAIAGVYVVLQS--IPNSLWLI-ILLVFISGTIKYLERTTALYS  167

Query  1343  ASSRFVRKSIGKSLDSVAS--------------------------------KELI---RA  1269
             AS    R S+ ++ D   +                                K+L+   +A
Sbjct  168   ASLDKFRDSMIQAPDPGPNYAKLMEEYKAKKEARLPTKIILIDEPDKENRPKKLVHPAQA  227

Query  1268  EGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNL-NVEDAFKVM  1092
               K    + +   EI + AY+    FKG +++  F   E  +  + F+NL + E+A +++
Sbjct  228   SEKRKEKSKLTDLEIAQYAYKFFNTFKGLVVNLIFSFRERDESLEIFENLTDPEEALRII  287

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH----MK  924
             E+EL F+YDA+FTK+  +    G  S      R V +  L  VA    FH K +      
Sbjct  288   EVELGFLYDALFTKVAVLHTVIGTIS------RVVASGTL--VAAFILFHKKPNKGSEFH  339

Query  923   PGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
             P D+ VTY L    + LD ++++  +FS W
Sbjct  340   PADVVVTYTLFAVGLALDLISILLFLFSDW  369



>ref|XP_009128803.1| PREDICTED: uncharacterized protein LOC103853644 isoform X2 [Brassica 
rapa]
Length=680

 Score = 84.3 bits (207),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 123/270 (46%), Gaps = 52/270 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RH+   + Q I  V VVL    I  S WL+   +VF+ G +K +ER  +L  
Sbjct  111   LEDNALWLRHVFGLVFQAIAGVYVVLQS--IPNSLWLI-ILLVFISGTIKYLERTTALYS  167

Query  1343  ASSRFVRKSIGKSLDSVAS--------------------------------KELI---RA  1269
             AS    R S+ ++ D   +                                K+L+   +A
Sbjct  168   ASLDKFRDSMIQAPDPGPNYAKLMEEYKAKKEARLPTKIILIDEPDKENRPKKLVHPAQA  227

Query  1268  EGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNL-NVEDAFKVM  1092
               K    + +   EI + AY+    FKG +++  F   E  +  + F+NL + E+A +++
Sbjct  228   SEKRKEKSKLTDLEIAQYAYKFFNTFKGLVVNLIFSFRERDESLEIFENLTDPEEALRII  287

Query  1091  EMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH----MK  924
             E+EL F+YDA+FTK+  +    G  S      R V +  L  VA    FH K +      
Sbjct  288   EVELGFLYDALFTKVAVLHTVIGTIS------RVVASGTL--VAAFILFHKKPNKGSEFH  339

Query  923   PGDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
             P D+ VTY L    + LD ++++  +FS W
Sbjct  340   PADVVVTYTLFAVGLALDLISILLFLFSDW  369



>ref|XP_010097434.1| hypothetical protein L484_003205 [Morus notabilis]
 gb|EXB68164.1| hypothetical protein L484_003205 [Morus notabilis]
Length=785

 Score = 84.3 bits (207),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 107/478 (22%), Positives = 198/478 (41%), Gaps = 105/478 (22%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN  W RHL    +Q  +    L+   +  ++ L PT +VFLVGIVK  ER  +L LA
Sbjct  120   LEDNEFWVRHLFGLFLQALAAGYSLF-LTLPHNKLLTPTVLVFLVGIVKYAERTRALYLA  178

Query  1340  S-SRFVRKSIGK---------SLDSVASKEL---IRAEGKDMTD----------------  1248
             S  RF   ++ K         +  + AS+ L   I AE   M++                
Sbjct  179   SLDRFGATALPKPEPGPDYEETSTTYASRMLEVPIEAEMTTMSNAAAGSVTGSSHDPDFD  238

Query  1247  ------NIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVED---AFKV  1095
                     M++  ++ +AY   + FKG I+       +    +  F  L + D   AF++
Sbjct  239   PKMVNSEPMDEMMVLLRAYMLFERFKGLIVGFFLTTTDRDSSRKMF--LEITDHKRAFRL  296

Query  1094  MEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGD  915
             +E ELS M+  + TK++  +   G       I R +    L+  ++ F    K      +
Sbjct  297   IEYELSLMFQVLHTKVVVGRNTTGY------ILRGLSFFSLLGASMYFLQVEKKGFGSLE  350

Query  914   IGVTYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLK  735
             I +TY L+ GA++LD ++++ L+FS W++  +  E                         
Sbjct  351   IILTYALLIGAIVLDAISMMKLVFSDWSLAVVPKEKS-----------------------  387

Query  734   QKKTVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADD  555
                                  + G+   T++    WS  + QY+++ + L   R +   +
Sbjct  388   ---------------------WRGYFAGTILKRSKWSRLVFQYNMINYCLDELRHERLYN  426

Query  554   FLEHFLLKGVIDS---CLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEV  384
             F     + G++D      ++ + +V E+LK  +F+++ R+ K      + E+E+  R + 
Sbjct  427   FARRIHVSGILDKIKILWYSSSKEVTEELKKFIFDNLIRKSKKAVTLRDAEQESQQRGD-  485

Query  383   MDKIKKIHLAPKvvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGDD  210
                + +   A ++    S             Y   +L  H+ATEICY   ++++G ++
Sbjct  486   -SALSQSPFATEIKLKWSVSEF--------QYTESLLLWHIATEICYLV-ERSRGDEE  533



>gb|EAZ02517.1| hypothetical protein OsI_24621 [Oryza sativa Indica Group]
Length=799

 Score = 84.3 bits (207),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 126/266 (47%), Gaps = 38/266 (14%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             ++DN LW RHL+  + ++ S LVV +   I  +  +  T ++F+VG++K  ER  SL   
Sbjct  114   VDDNELWRRHLIGLLFELFSALVV-FSCSIRSNPMIPATALIFVVGVIKYGERTYSLYSG  172

Query  1340  SSRFVRKSIGKSLD------------------------SVASKELIRAEGKDMTDNIMNQ  1233
             S   V   I ++ D                        ++A+ E  +A+      + +  
Sbjct  173   SVDGVIAKIFRAPDPGHNYAKLMTVFGGKRNGGLLVEITIANGEASKAKEVLQQGSEVRL  232

Query  1232  YEIVRK----AYECHQIFKGFIIDHSFLHDECGKEKDWF---KNLNVEDAFKVMEMELSF  1074
              E  +     AYE   +F+   +D +  + E    + +F   +++  + AF+VME+EL++
Sbjct  233   VETTKSLEAIAYEFFTMFRVLYVDINLSYKERRISQAYFLDRRDMTADKAFEVMEIELNY  292

Query  1073  MYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCL  894
             +YD ++TK        G      C+ RF+C   LV   ++F    K  + P D G+TY L
Sbjct  293   LYDMVYTKAPVSHSSAG------CVLRFICTTCLVVAIVLFVLLDKTGILPVDRGITYAL  346

Query  893   VGGAVLLDQMALIHLIFSHWAMVKIE  816
             + G + LD  A++ L+ S+  +V +E
Sbjct  347   LLGGLALDVAAILMLLCSNRMIVFLE  372



>ref|XP_003577300.1| PREDICTED: uncharacterized protein LOC100843708 [Brachypodium 
distachyon]
 ref|XP_010237495.1| PREDICTED: uncharacterized protein LOC100843708 [Brachypodium 
distachyon]
Length=684

 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 102/465 (22%), Positives = 182/465 (39%), Gaps = 84/465 (18%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L+ M Q+  + V +Y         + P  I+F+ G++K  ER L+L+ A
Sbjct  106   VEDNELWLRHFLSLMSQV-GLAVYVYWKSSPGIRLIRPAIIMFVAGVLKYGERTLALKAA  164

Query  1340  SSRFVRKSIGKSLDS-------VASKELIRAEGKDMT----------------DNIMNQY  1230
             S   +R S+    D        V   +  R  G D T                D   +  
Sbjct  165   SMGSLRSSMLTLPDPGPNYAKFVEECQSRRDAGLDATIVIVPERPPDDDVHVEDKPEDYG  224

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
              +V  A+   Q F+   +D      +      +F+ L ++ AFKV+E+EL  MY+ + +K
Sbjct  225   SLVYNAHRLFQTFRRLFVDLMLSFQDRVDSLSFFRKLEMDQAFKVVEIELVLMYECLHSK  284

Query  1049  MIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAVLL  873
              + +  W G +        F   A +V++ L       +   K  DI ++Y L+ GA+ L
Sbjct  285   ALVIHGWPGRSVRL-----FTLAAPVVSLVLFTRVVDDMQGYKRVDIIISYVLLAGAIFL  339

Query  872   DQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARKLK  693
             +  A++ +I S W    +       P A+                               
Sbjct  340   EIYAILLIIISPWMYADLRASEKLQPAAK-------------------------------  368

Query  692   QKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSL--AGRRLKCADDFLE---HFLLKG  528
                  ++++  +         WS ++ QY+L  + L    R  K   + LE   +F +K 
Sbjct  369   -----IVFWLIESFQPEKKPRWSNKMSQYNLFSYCLKDESRWYKRCMERLEWKWNFRVKT  423

Query  527   VIDSCLHTQTAKVEEKLKNLVFEDIkrrekakeaaaepekETYHRQEVMDKIKKIHLAPK  348
             + DS  +T++  V  +LK L+FE +K +  + +      K   HR +   + K ++    
Sbjct  424   MWDSWRYTKSIAVSCQLKGLIFEQLKSKANSTKDPKSYRKLGEHRGQWALQRKGLYQELG  483

Query  347   vvdsssddvvvsvddDIENYANFVLTLHVATEICYFTADKTKGGD  213
                                +   +L  H+AT++C++    T   D
Sbjct  484   WSVDC-------------EFDESILLWHIATDLCFYAQYPTDKDD  515



>gb|KFK33780.1| hypothetical protein AALP_AA5G059100 [Arabis alpina]
Length=509

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/272 (27%), Positives = 121/272 (44%), Gaps = 57/272 (21%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH+   + Q  + + V+ Q  +  S W++   +VF+ G +K +ER ++L  A
Sbjct  63    LEDNALWLRHVFGLVFQAIAGIYVVLQ-SLPNSLWVI-ILLVFISGTIKYLERTIALYSA  120

Query  1340  SSRFVRKSIGKSLDS------------------VASKELIRAEGKDMTDNI---------  1242
             S    R S+ ++ D                   + +K ++  E  D              
Sbjct  121   SLDNFRDSMIQAADPGPNYAKLMEEYKAKKEARLPTKIILFGEPSDKEHRPKKLVHPSKA  180

Query  1241  -------MNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLN-VEDAFKVMEM  1086
                    +   EIV+ AY+    FKG +++  F   E  +  + F NLN  E+A +++E+
Sbjct  181   LSGERKELTHLEIVQYAYKFFGTFKGLVVNLIFSFKERDESLEIFDNLNDPEEALRIIEV  240

Query  1085  ELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKP-----  921
             EL F+YD+ FTK   +    G  S      R V +  LV   ++F      HMKP     
Sbjct  241   ELGFLYDSFFTKTAVLHTIIGTLS------RIVASGTLVAAFILF------HMKPNKGRE  288

Query  920   ---GDIGVTYCLVGGAVLLDQMALIHLIFSHW  834
                 D+ VTY L    + LD ++++  +FS W
Sbjct  289   FHRADVVVTYTLFAVGITLDFISILLFMFSDW  320



>ref|XP_010441716.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104724857 
[Camelina sativa]
Length=699

 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 81/290 (28%), Positives = 127/290 (44%), Gaps = 59/290 (20%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQ-ICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQL  1344
             +EDN LW RH+   + Q I  V VVL    +  S W++   +VF+ G +K +ER  +L  
Sbjct  111   LEDNALWFRHVFGLVFQAIAGVYVVLMS--LPNSLWVI-IVLVFISGTIKYMERTAALYS  167

Query  1343  ASSRFVRKSIGKSLDSVASKELIRAEGK--------------DMTD--------------  1248
             AS    R SI ++ D   +   +  E K              D  D              
Sbjct  168   ASLDKFRDSIIEAPDPGPNYAKLMEEYKAKKEARLPITIILIDEPDKEHRAKKLEHPSLA  227

Query  1247  ----NIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNL-NVEDAFKVMEME  1083
                   +   EI + AY+    FKG +++  F   E  +  + F+NL + E+A +++E+E
Sbjct  228   SKNREELTHLEIAQYAYKFFNTFKGLVVNLIFSLRERDESLEVFENLKSPEEALRIIEIE  287

Query  1082  LSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKP------  921
             L F+YDA+FTK+  +    G  S      R V +  L    +IF      H KP      
Sbjct  288   LGFLYDALFTKIAVLHSVSGTVS------RIVASGTLAAAFIIF------HKKPKKDIQF  335

Query  920   --GDIGVTYCLVGGAVLLDQMALIHLIFSHW--AMVKIEMETVDTPVARK  783
                D+ VTY L    + LD ++++  +FS W  A++    +  D PV  K
Sbjct  336   HGADVVVTYTLFAVGIALDFISILLFLFSDWTCAVLSSLKDDPDEPVTLK  385



>ref|XP_010032288.1| PREDICTED: uncharacterized protein LOC104421862 [Eucalyptus grandis]
Length=308

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 90/196 (46%), Gaps = 31/196 (16%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+     V YQ  +  ++ + PT ++F+ GI+K +ER  +L L 
Sbjct  110   LEDNELWRRHLLNLLFQLGVAGYVFYQ-TLPSNKLIGPTILMFIGGIIKYIERTYALWLG  168

Query  1340  SSRFVRKSIGKSLDS------------------------------VASKELIRAEGKDMT  1251
             S    R S+  S D+                              + S+E      K   
Sbjct  169   SFSKFRDSLLASDDAGPNYAKLMEEYYSKKEANIPASIKMTPEPDMESREDEAKSSKAKG  228

Query  1250  DNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFM  1071
                ++  E++++A+     +KG ++D  F   +  +   +F++   EDAF+V+E EL+F 
Sbjct  229   PTTLDDREVIKEAFNYFSTYKGLLVDLIFSFRQRNETMKFFRSRTFEDAFRVIEAELNFF  288

Query  1070  YDAMFTKMIAVQQWKG  1023
             YD ++TK   +    G
Sbjct  289   YDVLYTKAAVIHYLTG  304



>ref|XP_009417395.1| PREDICTED: uncharacterized protein LOC103997790 [Musa acuminata 
subsp. malaccensis]
Length=873

 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 94/382 (25%), Positives = 154/382 (40%), Gaps = 65/382 (17%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RH L  ++++   ++V  +       W +   +VF+ GI+K  ER L+L  A
Sbjct  107   LEDNELWLRHFLGLVLEVSVAILVFLESLPSPHLWKVAI-VVFIAGILKYAERTLALWSA  165

Query  1340  SSRFVRKSI-----------------------GKSLDSVASKELIRAEGKDMTDNIMNQY  1230
             S   +R+S+                       G + D    KE      KD T+   ++ 
Sbjct  166   SMDQLRESMISDPDPGPNYVKFMQEYHSRVTAGLNADIKTEKEPRPPLPKDTTEKRTDK-  224

Query  1229  EIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTK  1050
             EI+  AY      K   +D      +  + + +F  L    AF ++++ELS ++D + TK
Sbjct  225   EIIFGAYRFFPTIKRLTVDLMLSFQDRIESQTFFLTLEATRAFFMVDVELSLLHDILHTK  284

Query  1049  MIAVQQWKGIASYFWCIWRFV--CNALLVTVALIFFFHSKLH-MKPGDIGVTYCLVGGAV  879
              + V    G         R V   +  LV +A + F  S  H     DI +TY L+  AV
Sbjct  285   AVHVHTLGG---------RLVRALSLSLVVLAFVLFHRSGRHNFSEADIIITYILLLAAV  335

Query  878   LLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKKTVDTPVARK  699
              L+ +A + L+FS W +V              L+    ++ P   +LK            
Sbjct  336   GLEAIAAVLLVFSDWTIV-------------ALQDSGKLERPFIARLK------------  370

Query  698   LKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLEHFLLKGVID  519
                KII  +     ++       WS  + Q +LL   L           L    LK + D
Sbjct  371   ---KIIRFLKLDLAIVKFRGGTRWSNSMRQCNLLCICLRDYEQTVFTRILHFLGLKELWD  427

Query  518   SCLHTQTAKVEEKLKNLVFEDI  453
             S  H +   V ++ K L+FE++
Sbjct  428   SYWHVEDTIVGDQQKTLIFEEL  449



>ref|XP_002322521.2| hypothetical protein POPTR_0016s01380g [Populus trichocarpa]
 gb|EEF04282.2| hypothetical protein POPTR_0016s01380g [Populus trichocarpa]
Length=675

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 126/262 (48%), Gaps = 24/262 (9%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGI-VFLVGIVKCVERILSLQL  1344
             +EDN LW RHLL   +Q  +    L+  K +  + L+   I +F+ GI K  +R+L L L
Sbjct  112   LEDNELWLRHLLQLAIQASTTSYSLF--KSWGKDPLIYIAIPIFVAGITKYGDRVLVLWL  169

Query  1343  ASSRFVRKSIGKSLDSVAS---KELIRAEGKDMTDNIMNQ----YEIVRKA---YECH--  1200
             ASS+  R    + +D+  S   K+       DM++  +N+      I+ +A   +E H  
Sbjct  170   ASSKKFRDIQSEEVDTFQSEFGKKFPSVGFFDMSEEDLNKGLEFNNIIPEAVYLHEAHFL  229

Query  1199  -QIFKGFIIDHSFLHDE-CGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWK  1026
              Q+FK F  D +  H       +         +AFKV+E+EL  MYD +FTK+ +V   +
Sbjct  230   FQMFKIFYADLALSHSSHMASYRILSSKKKATEAFKVIEVELGLMYDVLFTKVTSVCSTR  289

Query  1025  GIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGVTYCLVGGAVLLDQMALIHLI  846
              I         F+ +A  + VA      +K      ++ ++Y L+GG V+L+    I L+
Sbjct  290   TILRSI----SFLSSASAL-VAFSLMVANKCAYTETEVIISYILLGGGVVLEIYGFIMLL  344

Query  845   FSHWAMVKIEMETVDTPVARKL  780
              S WAM ++ +  +  P A  L
Sbjct  345   LSEWAMFRLSL--LKNPWANAL  364



>gb|EEC76723.1| hypothetical protein OsI_14744 [Oryza sativa Indica Group]
Length=657

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 113/235 (48%), Gaps = 44/235 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSE---WLLPTGIVFLVGIVKCVERILSL  1350
             ++DN LW RHL   ++Q+     V+Y+  I   E    LL T ++F+VG+VK  ER  +L
Sbjct  99    LQDNQLWLRHLQILVIQVLGAGYVVYKRLIVGGEKTILLLATVLMFMVGLVKYCERTFAL  158

Query  1349  QLASSRFVRKSIGKSLDSVASKELIRAEGKDMTDNIMNQYEIVRKAYECHQIFKGFIIDH  1170
             +  +   +R  + +  DSV + ++ + E  ++T  ++NQ   +R   +   ++K      
Sbjct  159   KRGNFSSIRSYVKELPDSVINVDMDKTEA-EITRKLINQ---IRNPQQPMVMWK------  208

Query  1169  SFLHDECGKEKDWFKNLNVEDAFKVMEMELSFMYDAMFTKMIAVQQWKGIASYFWCIWRF  990
                                     VMEMELS +YD ++TK   +  W G       + R 
Sbjct  209   ------------------------VMEMELSLLYDILYTKAAVIHTWIGY------LIRA  238

Query  989   VCNALLVTVALIFFFH-SKLHMKPGDIGVTYCLVGGAVLLDQMALIHLIFSHWAM  828
             +    +V+  L+F F  SK      DI VTY L+GGA++++  +L+  + S WA+
Sbjct  239   MTPVAIVSSFLLFHFSDSKDGQNVVDITVTYILLGGALMMEMTSLLSALGSSWAL  293



>ref|XP_010034369.1| PREDICTED: uncharacterized protein LOC104423601 [Eucalyptus grandis]
Length=559

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 99/393 (25%), Positives = 174/393 (44%), Gaps = 76/393 (19%)
 Frame = -3

Query  1520  MEDNNLWHRHLLTQMVQICSVLVVLYQYKIFQSEWLLPTGIVFLVGIVKCVERILSLQLA  1341
             +EDN LW RHLL  + Q+ +   V Y+  +  ++ ++ T ++F+ GI K +ER  +L LA
Sbjct  188   LEDNELWLRHLLNLLFQLGAAGYVFYE-SLPSNKLIVLTILMFIGGITKYIERTRALYLA  246

Query  1340  SSRFVRKSIGKSLDS-------------------VASKELIR----------------AE  1266
             S    R S+ KSLD+                     S E +R                ++
Sbjct  247   SFSKFRDSLFKSLDTGPNYAKLMEEYYSMKTANIPVSIETLRQTVLESPDARVEDETNSD  306

Query  1265  GKDMTDNIMNQYEIVRKAYECHQIFKGFIIDHSFLHDECGKEKDWFKNLNVEDAFKVMEM  1086
              K+     ++   ++++A+    I KG ++   F   E  +   +F++    DAF+++E 
Sbjct  307   DKEAKKTCLDNRAVIKEAFGYFTILKGLLVGLIFSFRERNESVRFFRSKTTNDAFRIVEA  366

Query  1085  ELSFMYDAMFTKMIAVQQWKGIASYFWCIWRFVCNALLVTVALIFFFHSKLHMKPGDIGV  906
             EL+F YD ++TK   V +  G       ++R +    ++T   +F+  +K      DI +
Sbjct  367   ELNFFYDVLYTKAAVVHRPVGY------LFRAISIGSIITAFALFYVINKQGFHDYDIRI  420

Query  905   TYCLVGGAVLLDQMALIHLIFSHWAMVKIEMETVDTPVARKLKQKKTVDTPVARKLKQKK  726
             TY L+ GAV L+ +AL  LI S W +  +E        + K  ++ ++ +          
Sbjct  421   TYTLLLGAVGLEFVALSMLICSDWTIALLER-------SEKHGRRSSIGS----------  463

Query  725   TVDTPVARKLKQKIISLIYYGHKLITVVNSKSWSGEIIQYSLLKHSLAGRRLKCADDFLE  546
                T +   LK K I  ++  H L        WS  I QY+L+       RLK    ++E
Sbjct  464   ---TFIMFLLKFKSIGSLFGLHFL-----HGRWSKSIFQYNLIDS-----RLKWWPKWIE  510

Query  545   HFL----LKGVIDSCLHTQTAKVEEKLKNLVFE  459
               L    L+ + D     +  + EE+L  L+F+
Sbjct  511   KHLDFISLRELFDDLKSGRVEQYEEELGQLIFK  543



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4176323861752