BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20736_g1_i2 len=107 path=[5103:0-32 1163:33-70 5192:71-106]

Length=107
                                                                      Score     E

ref|XP_009784361.1|  PREDICTED: uncharacterized protein LOC104232...  46.6    6e-05   
ref|XP_009784354.1|  PREDICTED: uncharacterized protein LOC104232...  46.6    7e-05   
ref|XP_010058516.1|  PREDICTED: uncharacterized protein LOC104446353  47.0    1e-04   
ref|XP_009784370.1|  PREDICTED: uncharacterized protein LOC104232...  44.3    3e-04   
ref|XP_010689341.1|  PREDICTED: uncharacterized protein LOC104903064  45.1    0.001   



>ref|XP_009784361.1| PREDICTED: uncharacterized protein LOC104232777 isoform X2 [Nicotiana 
sylvestris]
Length=194

 Score = 46.6 bits (109),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  104  SVIQDVFPCVEHRNCARHVHANWSKRHQGKVLKD  3
            + ++D+FP  EHRNC RH++ N+  +H+GK LKD
Sbjct  47   AAVRDLFPNAEHRNCVRHMYQNFKTKHKGKALKD  80



>ref|XP_009784354.1| PREDICTED: uncharacterized protein LOC104232777 isoform X1 [Nicotiana 
sylvestris]
Length=201

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  104  SVIQDVFPCVEHRNCARHVHANWSKRHQGKVLKD  3
            + ++D+FP  EHRNC RH++ N+  +H+GK LKD
Sbjct  54   AAVRDLFPNAEHRNCVRHMYQNFKTKHKGKALKD  87



>ref|XP_010058516.1| PREDICTED: uncharacterized protein LOC104446353 [Eucalyptus grandis]
Length=471

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -1

Query  83   PCVEHRNCARHVHANWSKRHQGKVLKD  3
            P  EHRNCARH++ANW K+H+G  LK+
Sbjct  389  PQAEHRNCARHIYANWKKQHKGDALKN  415



>ref|XP_009784370.1| PREDICTED: uncharacterized protein LOC104232777 isoform X3 [Nicotiana 
sylvestris]
Length=178

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  104  SVIQDVFPCVEHRNCARHVHANWSKRHQGKVLKD  3
            + ++D+FP  EHRNC RH++ N+  +H+GK LKD
Sbjct  54   AAVRDLFPNAEHRNCVRHMYQNFKTKHKGKALKD  87



>ref|XP_010689341.1| PREDICTED: uncharacterized protein LOC104903064 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  98    IQDVFPCVEHRNCARHVHANWSKRHQGKVLKD  3
             ++ +FP VEHRNCARH+   W K+H+G  LK+
Sbjct  1007  VKTIFPNVEHRNCARHIWPPWHKKHRGDGLKE  1038



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525703048884