BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20735_g2_i2 len=1077 path=[1:0-554 556:555-585 2647:586-631
2693:632-686 2747:687-745 2058:746-1076]

Length=1077
                                                                      Score     E

ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    405   7e-136   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           402   1e-134   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           396   1e-132   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           396   2e-132   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           395   7e-132   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           394   2e-131   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           393   3e-131   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    392   8e-131   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           390   3e-130   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           390   4e-130   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           390   4e-130   
gb|ABQ95989.1|  phospholipase A1                                        388   3e-129   Capsicum annuum
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           386   1e-128   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           385   5e-128   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   384   1e-127   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           384   1e-127   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           383   2e-127   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              381   1e-126   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           381   1e-126   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    380   5e-126   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           380   5e-126   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    378   2e-125   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           377   6e-125   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           375   5e-124   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              373   3e-123   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              370   2e-122   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           368   2e-121   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   365   5e-120   
emb|CDO96757.1|  unnamed protein product                                361   5e-119   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   363   5e-119   Ricinus communis
gb|KHN08451.1|  Phospholipase A1-IIgamma                                361   8e-119   
gb|KHN18919.1|  Phospholipase A1-IIgamma                                361   1e-118   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           361   2e-118   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           360   4e-118   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              360   7e-118   
ref|XP_002316835.2|  lipase class 3 family protein                      359   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                357   8e-117   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                357   8e-117   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              355   3e-116   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   355   4e-116   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             355   4e-116   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         354   5e-116   
emb|CDO96758.1|  unnamed protein product                                354   6e-116   
ref|XP_002305750.2|  lipase class 3 family protein                      353   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              353   5e-115   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              353   6e-115   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              352   7e-115   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           351   9e-115   
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     347   3e-114   
emb|CBI30665.3|  unnamed protein product                                347   2e-113   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     348   2e-113   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           347   4e-113   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           348   5e-113   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                345   6e-113   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     347   7e-113   Vitis vinifera
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           346   1e-112   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           346   1e-112   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   344   5e-112   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           344   7e-112   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           342   3e-111   
ref|XP_003593747.1|  Lipase                                             342   4e-111   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          342   4e-111   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    341   1e-110   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                341   3e-110   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           341   3e-110   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   339   4e-110   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                340   6e-110   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       340   7e-110   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           339   1e-109   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           335   5e-108   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           333   9e-108   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             332   5e-107   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           332   6e-107   
emb|CDP11819.1|  unnamed protein product                                330   1e-106   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           331   2e-106   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           329   3e-106   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             330   4e-106   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    328   1e-105   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           329   1e-105   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             329   1e-105   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           328   2e-105   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    328   3e-105   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             327   3e-105   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           326   4e-105   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                327   5e-105   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           326   7e-105   
emb|CDY01554.1|  BnaC07g35440D                                          325   3e-104   
ref|XP_002867985.1|  lipase class 3 family protein                      325   3e-104   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                325   4e-104   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                324   6e-104   
emb|CDY53993.1|  BnaA03g58180D                                          321   9e-104   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           322   1e-103   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              322   1e-103   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              323   2e-103   
ref|XP_002525127.1|  triacylglycerol lipase, putative                   322   3e-103   Ricinus communis
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            322   4e-103   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             321   4e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           322   5e-103   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           321   1e-102   
emb|CDM83551.1|  unnamed protein product                                319   3e-102   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    318   6e-102   
gb|EMT15519.1|  Lipase                                                  318   8e-102   
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   317   1e-101   
dbj|BAJ96485.1|  predicted protein                                      317   2e-101   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           317   2e-101   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                319   2e-101   
ref|NP_193590.1|  phospholipase A1-IIgamma                              317   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          316   4e-101   Sorghum bicolor [broomcorn]
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                     313   5e-101   
ref|XP_002525129.1|  triacylglycerol lipase, putative                   315   1e-100   Ricinus communis
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    315   1e-100   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              315   1e-100   
ref|NP_001149813.1|  triacylglycerol lipase                             314   2e-100   Zea mays [maize]
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       313   4e-100   
ref|NP_001151242.1|  triacylglycerol lipase                             313   5e-100   Zea mays [maize]
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   314   7e-100   
ref|NP_001152663.1|  triacylglycerol lipase precursor                   314   7e-100   Zea mays [maize]
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    313   7e-100   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                314   9e-100   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             312   1e-99    Oryza sativa Japonica Group [Japonica rice]
gb|EMT21704.1|  Putative lipase                                         311   6e-99    
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          310   8e-99    Sorghum bicolor [broomcorn]
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              310   1e-98    
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      309   3e-98    
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    309   3e-98    Oryza sativa Indica Group [Indian rice]
gb|EMS63185.1|  Phospholipase A1-II 1                                   320   4e-98    
emb|CDM85400.1|  unnamed protein product                                309   4e-98    
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          308   5e-98    
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          309   8e-98    Sorghum bicolor [broomcorn]
dbj|BAJ90094.1|  predicted protein                                      306   1e-97    
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    309   1e-97    
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    306   2e-97    
ref|NP_001043734.1|  Os01g0651800                                       306   5e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like           305   1e-96    
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             305   1e-96    
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              306   1e-96    
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           305   3e-96    
dbj|BAJ95995.1|  predicted protein                                      305   3e-96    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              304   3e-96    
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              303   5e-96    
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like              304   6e-96    
gb|EEE64775.1|  hypothetical protein OsJ_19631                          302   8e-96    Oryza sativa Japonica Group [Japonica rice]
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             301   2e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           301   4e-95    
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    302   7e-95    
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             300   7e-95    
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    315   8e-95    
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           300   1e-94    
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       315   2e-94    
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              298   8e-94    
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           297   2e-93    
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    296   2e-93    
gb|ABK96341.1|  unknown                                                 296   3e-93    Populus trichocarpa x Populus deltoides
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230          294   6e-93    Sorghum bicolor [broomcorn]
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like              295   6e-93    
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g             295   6e-93    
gb|EPS70940.1|  hypothetical protein M569_03817                         295   8e-93    
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g             295   8e-93    
gb|EMT30117.1|  Mono- and diacylglycerol lipase                         295   1e-92    
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              295   1e-92    
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              295   2e-92    
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           294   2e-92    
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           295   3e-92    
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              293   4e-92    
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           292   4e-92    
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             293   5e-92    Populus trichocarpa [western balsam poplar]
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like           293   6e-92    
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          293   8e-92    Sorghum bicolor [broomcorn]
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              293   8e-92    
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         291   1e-91    
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    290   2e-91    
gb|EEE64776.1|  hypothetical protein OsJ_19632                          286   7e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EMS68153.1|  Phospholipase A1-II 7                                   289   7e-91    
emb|CBI21954.3|  unnamed protein product                                289   1e-90    
ref|NP_001056387.1|  Os05g0574100                                       289   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003608142.1|  Lipase                                             286   5e-90    
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           288   6e-90    
ref|NP_001043730.2|  Os01g0651200                                       287   7e-90    Oryza sativa Japonica Group [Japonica rice]
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             287   7e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          287   8e-90    Sorghum bicolor [broomcorn]
gb|EMS51987.1|  Phospholipase A1-II 3                                   288   9e-90    
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              287   9e-90    
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              286   2e-89    
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    285   4e-89    
gb|EMT11182.1|  hypothetical protein F775_27795                         287   5e-89    
gb|AFK47098.1|  unknown                                                 285   6e-89    
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             285   1e-88    
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              285   1e-88    
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           284   2e-88    
gb|AAB07724.1|  Pn47p                                                   283   3e-88    Ipomoea nil [qian niu]
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           282   5e-88    
gb|EMT15520.1|  Feruloyl esterase A                                     290   6e-88    
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     283   7e-88    Zea mays [maize]
gb|ABK23399.1|  unknown                                                 282   1e-87    Picea sitchensis
gb|ABR18391.1|  unknown                                                 281   2e-87    Picea sitchensis
emb|CDX76515.1|  BnaA08g08850D                                          280   3e-87    
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    280   4e-87    
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           280   6e-87    
gb|EAY99121.1|  hypothetical protein OsI_21080                          279   7e-87    Oryza sativa Indica Group [Indian rice]
gb|EMT05578.1|  hypothetical protein F775_13080                         279   2e-86    
dbj|BAD68802.1|  lipase-like protein                                    277   8e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75192.1|  hypothetical protein OsI_03084                          277   8e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein          277   1e-85    
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein          276   1e-85    
ref|XP_003608120.1|  Lipase                                             276   2e-85    
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              274   2e-84    
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              274   2e-84    
gb|EMS48809.1|  Phospholipase A1-II 6                                   275   2e-84    
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg             272   2e-84    
gb|EMS63790.1|  Phospholipase A1-II 7                                   276   3e-84    
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    273   5e-84    
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like           271   7e-84    
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              273   8e-84    
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              271   2e-83    
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                270   2e-83    
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            269   1e-82    
gb|EMS52156.1|  Phospholipase A1-II 2                                   267   3e-82    
emb|CDX99456.1|  BnaC01g10960D                                          267   4e-82    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             267   6e-82    
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            267   7e-82    
gb|KDP46903.1|  hypothetical protein JCGZ_24112                         266   1e-81    
ref|NP_172115.1|  phospholipase A1-IIalpha                              267   1e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CDY34061.1|  BnaC03g62710D                                          266   1e-81    
gb|AAM61647.1|  lipase-like protein                                     266   1e-81    Arabidopsis thaliana [mouse-ear cress]
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          266   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    266   2e-81    
ref|XP_003608122.1|  Lipase                                             265   3e-81    
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250          265   3e-81    Sorghum bicolor [broomcorn]
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           264   5e-81    
emb|CDX84801.1|  BnaA03g14290D                                          265   6e-81    
ref|XP_002522552.1|  triacylglycerol lipase, putative                   264   7e-81    Ricinus communis
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    264   8e-81    
gb|KDP46901.1|  hypothetical protein JCGZ_24110                         264   8e-81    
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            264   1e-80    
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 264   1e-80    
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             264   1e-80    
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             263   1e-80    
gb|KDP21071.1|  hypothetical protein JCGZ_21542                         263   2e-80    
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                263   4e-80    
emb|CDY10187.1|  BnaC05g04300D                                          261   6e-80    
emb|CDY23963.1|  BnaC03g17280D                                          261   9e-80    
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010        261   1e-79    Sorghum bicolor [broomcorn]
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          261   1e-79    Sorghum bicolor [broomcorn]
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   262   1e-79    
emb|CDY57813.1|  BnaA10g28020D                                          265   2e-79    
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             259   5e-79    
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    259   7e-79    
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                259   8e-79    
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                  257   2e-78    
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              258   3e-78    
gb|EAY75191.1|  hypothetical protein OsI_03083                          254   9e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           256   1e-77    
ref|XP_002522553.1|  triacylglycerol lipase, putative                   257   1e-77    Ricinus communis
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              256   2e-77    
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              256   2e-77    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           255   5e-77    
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           253   8e-77    
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg             252   2e-76    
ref|XP_002881156.1|  hypothetical protein ARALYDRAFT_320861             251   3e-76    
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like           251   3e-76    
gb|AAC63840.1|  putative lipase                                         250   5e-76    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA89335.1|  EEF53                                                  244   7e-76    Solanum melongena [aubergine]
ref|XP_007025428.1|  Alpha/beta-Hydrolases superfamily protein          250   8e-76    
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like           249   3e-75    
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   251   4e-75    
gb|KDP21072.1|  hypothetical protein JCGZ_21543                         249   6e-75    
gb|EMT04701.1|  Lipase                                                  248   6e-75    
emb|CDX86530.1|  BnaC08g01730D                                          248   1e-74    
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           247   4e-74    
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           245   1e-73    
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              242   7e-73    
gb|ABK24664.1|  unknown                                                 244   1e-72    Picea sitchensis
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              244   2e-72    
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    241   3e-72    
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein          240   6e-72    
gb|KDP46905.1|  hypothetical protein JCGZ_24114                         241   7e-72    
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    239   2e-71    
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like           238   2e-71    
dbj|BAJ85084.1|  predicted protein                                      238   2e-70    
gb|EMS50696.1|  Phospholipase A1-II 7                                   233   7e-70    
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like           235   7e-70    
ref|NP_001168256.1|  hypothetical protein                               233   3e-69    
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260          233   8e-69    
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           233   8e-69    
gb|EPS68355.1|  hypothetical protein M569_06415                         226   1e-68    
emb|CDM86668.1|  unnamed protein product                                235   2e-68    
dbj|BAJ99811.1|  predicted protein                                      235   2e-68    
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             233   2e-68    
ref|NP_001044041.1|  Os01g0710700                                       232   5e-68    
ref|XP_010058983.1|  PREDICTED: phospholipase A1-IIgamma-like           229   5e-68    
emb|CDY24728.1|  BnaC04g13330D                                          230   8e-68    
gb|KCW74061.1|  hypothetical protein EUGRSUZ_E02689                     228   3e-67    
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            229   3e-67    
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                     228   3e-67    
gb|EAZ12914.1|  hypothetical protein OsJ_02837                          227   5e-67    
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              229   5e-67    
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           228   1e-66    
gb|EEE55280.1|  hypothetical protein OsJ_03214                          232   3e-66    
ref|XP_001781080.1|  predicted protein                                  226   5e-66    
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    228   5e-66    
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    228   7e-66    
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              223   2e-65    
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    227   2e-65    
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    227   3e-65    
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                223   3e-65    
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              225   4e-65    
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           227   4e-65    
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           224   5e-65    
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    225   9e-65    
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                222   1e-64    
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    224   1e-64    
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             224   1e-64    
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660          223   2e-64    
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             221   2e-64    
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    224   2e-64    
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             224   3e-64    
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    223   3e-64    
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    223   3e-64    
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    223   5e-64    
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           221   6e-64    
gb|ACZ57769.1|  phospholipase A3                                        211   1e-63    
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           219   1e-63    
ref|XP_002303465.1|  lipase family protein                              219   1e-63    
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   220   1e-63    
gb|EPS65213.1|  hypothetical protein M569_09566                         219   2e-63    
gb|EMT07769.1|  hypothetical protein F775_18307                         213   2e-63    
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           221   3e-63    
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                    216   3e-63    
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890    229   3e-63    
emb|CDM83808.1|  unnamed protein product                                219   4e-63    
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         220   4e-63    
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             219   5e-63    
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    220   6e-63    
emb|CDP03693.1|  unnamed protein product                                217   7e-63    
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   219   1e-62    
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           216   1e-62    
gb|KEH23856.1|  phospholipase A1                                        219   1e-62    
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                217   1e-62    
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          219   1e-62    
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           218   1e-62    
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             218   2e-62    
gb|EMS63050.1|  Phospholipase A1-II 5                                   219   2e-62    
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    220   2e-62    
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             219   2e-62    
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           215   3e-62    
gb|ABR16123.1|  unknown                                                 219   3e-62    
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          219   3e-62    
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   3e-62    
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           215   4e-62    
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             218   4e-62    
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             218   4e-62    
emb|CDM86669.1|  unnamed protein product                                219   4e-62    
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2      213   5e-62    
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   5e-62    
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   5e-62    
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    218   5e-62    
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          215   7e-62    
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                216   7e-62    
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             215   8e-62    
ref|XP_002892328.1|  predicted protein                                  213   9e-62    
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    217   1e-61    
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         216   1e-61    
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           214   1e-61    
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   2e-61    
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   2e-61    
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                217   2e-61    
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   215   3e-61    
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    216   3e-61    
gb|ACJ85535.1|  unknown                                                 214   3e-61    
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    216   3e-61    
ref|NP_001056386.2|  Os05g0574000                                       207   3e-61    
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                214   4e-61    
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   4e-61    
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         213   4e-61    
emb|CBI21996.3|  unnamed protein product                                214   5e-61    
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         215   5e-61    
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           213   6e-61    
ref|XP_008343102.1|  PREDICTED: phospholipase A1-IIdelta-like           213   6e-61    
emb|CDY50817.1|  BnaC04g52540D                                          212   6e-61    
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    214   7e-61    
emb|CDY47985.1|  BnaA04g24630D                                          211   8e-61    
emb|CAN74039.1|  hypothetical protein VITISV_012945                     215   8e-61    
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             212   1e-60    
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    215   1e-60    
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    214   1e-60    
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          211   1e-60    
emb|CDP15943.1|  unnamed protein product                                211   1e-60    
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                213   2e-60    
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     214   2e-60    
ref|XP_003607601.1|  Feruloyl esterase A                                212   2e-60    
gb|EMT05279.1|  Lipase                                                  207   2e-60    
emb|CDO98286.1|  unnamed protein product                                211   2e-60    
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    214   3e-60    
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             214   3e-60    
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    213   3e-60    
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    213   3e-60    
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   211   4e-60    
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             211   4e-60    
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           210   4e-60    
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    213   4e-60    
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like           211   4e-60    
ref|XP_008355592.1|  PREDICTED: phospholipase A1-IIgamma-like           206   4e-60    
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    212   6e-60    
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    212   7e-60    
emb|CDY49813.1|  BnaC06g04560D                                          212   8e-60    
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     212   8e-60    
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                209   1e-59    
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             209   1e-59    
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    211   1e-59    
ref|NP_564590.1|  DAD1-like lipase 2                                    211   2e-59    
ref|XP_008355590.1|  PREDICTED: phospholipase A1-IIgamma-like           204   2e-59    
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    209   2e-59    
ref|XP_002518706.1|  triacylglycerol lipase, putative                   208   2e-59    
dbj|BAJ85518.1|  predicted protein                                      211   2e-59    
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    212   3e-59    
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          211   3e-59    
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                208   3e-59    
ref|XP_002891639.1|  lipase class 3 family protein                      211   4e-59    
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    211   4e-59    
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     209   4e-59    
emb|CDY22842.1|  BnaA06g02350D                                          210   5e-59    
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             209   6e-59    
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    208   6e-59    
ref|XP_009389474.1|  PREDICTED: phospholipase A1-II 5-like              206   6e-59    
ref|NP_181797.1|  phospholipase A1-IIdelta                              207   9e-59    
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             209   9e-59    
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    209   1e-58    
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    209   1e-58    
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    209   1e-58    
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             209   1e-58    
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    209   1e-58    
ref|XP_003607369.1|  Lipase                                             209   1e-58    
dbj|BAJ88202.1|  predicted protein                                      207   1e-58    
emb|CDY14851.1|  BnaC04g48480D                                          205   1e-58    
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              208   2e-58    
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    209   2e-58    
dbj|BAJ85876.1|  predicted protein                                      207   2e-58    
gb|KHN32323.1|  Phospholipase A1-Igamma1, chloroplastic                 202   2e-58    
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             209   2e-58    
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             208   3e-58    
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    208   3e-58    
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    208   3e-58    
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642             205   3e-58    
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    206   4e-58    
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           205   4e-58    
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             208   5e-58    
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    207   5e-58    
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             205   5e-58    
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    208   6e-58    
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           204   7e-58    
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    207   7e-58    
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    207   7e-58    
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    206   8e-58    
ref|XP_002513514.1|  triacylglycerol lipase, putative                   206   8e-58    
gb|AAD01804.1|  lipase                                                  205   8e-58    
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                204   1e-57    
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       207   1e-57    
ref|XP_002879267.1|  lipase class 3 family protein                      206   1e-57    
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    206   2e-57    
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     203   2e-57    
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    206   2e-57    
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    206   2e-57    
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    206   2e-57    
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    206   2e-57    
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    206   3e-57    
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    204   3e-57    
emb|CDY29665.1|  BnaA04g17620D                                          205   3e-57    
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          206   3e-57    
emb|CDY10228.1|  BnaC05g04710D                                          205   3e-57    
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             205   3e-57    
emb|CDX97819.1|  BnaC04g41200D                                          204   3e-57    
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    205   4e-57    
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    205   4e-57    
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    204   4e-57    
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    204   4e-57    
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                    212   4e-57    
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          204   5e-57    
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    206   6e-57    
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    205   6e-57    
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    204   6e-57    
emb|CDP09265.1|  unnamed protein product                                204   7e-57    
gb|EPS65211.1|  hypothetical protein M569_09564                         202   7e-57    
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    205   7e-57    
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    204   7e-57    
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          204   8e-57    
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    204   8e-57    
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    203   1e-56    
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    202   1e-56    
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    201   1e-56    
ref|NP_849603.1|  phospholipase A1-Igamma1                              204   1e-56    
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    205   1e-56    
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           201   1e-56    
gb|ACJ76846.1|  chloroplast lipase protein                              203   2e-56    
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    203   2e-56    
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    203   2e-56    
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             203   2e-56    
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    200   3e-56    
gb|KEH23857.1|  phospholipase A1                                        201   4e-56    
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       202   4e-56    
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    202   5e-56    



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   405 bits (1040),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 197/289 (68%), Positives = 229/289 (79%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK ALGRRDI+V WRGT++ LEWV+DL+FL VP P++FG G       P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y++E+P S FN  SARDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTTEDPRSQFNQVSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT FV+ASP+ GD NF  A+    NLH++RI NV DIVP+
Sbjct  230   NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPG++ SWHLLEPYLHG+AGT+G G+L GF+L
Sbjct  290   YPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D LK+EYCIPG WW +K+KGMVQQ DGSW LLD EE
Sbjct  346   EVNRDISLVNKQWDILKDEYCIPGLWWADKHKGMVQQQDGSWLLLDREE  394



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   402 bits (1033),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 230/289 (80%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+D +FLLVPAP++FG G       P
Sbjct  110   FMGYIAVATDEGKVSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S FN    RDQV+ EVKRLVE YKNE+VSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DI  NG N T+ GK FPVT FV+ASP+ GD NF  A+    NLH++RI N+ DIVP+
Sbjct  230   NAVDITFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPGD+ASWHLLEPYLHG+AGT+G G+L GF+L
Sbjct  290   YPP----IGYIDVGKELMIDTTKSPYVKPPGDIASWHLLEPYLHGVAGTQGIGILAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK+ D LK+E+CIPG+WW+EK+KGMVQQ DG+W LLD EE
Sbjct  346   EVNRDISLVNKMGDTLKDEHCIPGHWWVEKHKGMVQQQDGTWLLLDREE  394



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 228/289 (79%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  107   FMGYIAVATDEGKVSLGRRDIVIAWRGTMQKLEWVNDLQFLLVPAPQVFGDGGLLPLFQP  166

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN Y+S +  S FN+ SARDQV+ EVKRLVE YK+EEVSITV GHSLGA+LATL
Sbjct  167   LVHHGFYNAYTSSSSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATL  226

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT F +ASP+ GD  FK A+D    L +++I N+ DIVP+
Sbjct  227   NAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKGLRVLKIHNLLDIVPK  286

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPG+  SWHLLEPYLHG+AGT+G GLL GF+L
Sbjct  287   YPP----IGYFDVGQELMIDTTKSPYVKPPGEPVSWHLLEPYLHGVAGTQGLGLLAGFKL  342

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D LK+EYCIPG WW+EKNKGMVQQ+DGSW +LD +E
Sbjct  343   EVNRDISLVNKQWDVLKDEYCIPGLWWVEKNKGMVQQEDGSWLMLDRDE  391



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 228/289 (79%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  912
             +MGY+AVATDEGK ALGRRDI+V WRGT++ LEWV+DL+FL VP P++FG         P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLPLLKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y++E+  S FN  SARDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTTEDLRSQFNQASARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT FV+ASP+ GD NF  A+    NLH++RI NV DIVP+
Sbjct  230   NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DVG EL ID TKS YVKPPG++ SWHLLEPYLHG+AGT+G G+L GF+L
Sbjct  290   YPP----VGYIDVGEELIIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D +K+EYCIPG WW++K+KGMVQQ DGSW LLD EE
Sbjct  346   EVNRDISLVNKQWDIIKDEYCIPGLWWVDKHKGMVQQQDGSWLLLDREE  394



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   395 bits (1014),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 226/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGYVAVATDEGK +LGRRDI+V WRGT + LEWV+DL+FLLVPAP +FG G       P
Sbjct  110   FMGYVAVATDEGKVSLGRRDIVVAWRGTKQALEWVNDLQFLLVPAPNVFGNGGLLPLFQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S FN  S RDQV+ EVKRLVE YK+EEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTSESARSQFNQTSVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT FV+ASP+ GD NF N +    +LH++RI N+ DIVP+
Sbjct  230   NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDINFLNKFSKLKHLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG E+ ID TKS YVKPPG++ SWHLLEPYLHG+AGT+G GLL GF+L
Sbjct  290   YPP----IGYFDVGQEIMIDTTKSPYVKPPGEIVSWHLLEPYLHGVAGTQGLGLLAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D LK EYC+P  WW EK+KGMVQQ++GSW L+D +E
Sbjct  346   EVNRDISLVNKEWDILKNEYCVPAFWWTEKHKGMVQQENGSWLLMDRDE  394



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 226/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGYVAVATDEGK +LGRRDI++ WRGT++ LEWV+D +FLLVPAP++FG G       P
Sbjct  110   FMGYVAVATDEGKVSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S FN    RDQV+ EVKRLVE YKNE+VSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DI  NG N T+ GK FPVT FV+ASP+ GD NF  A+    NLH++RI NV DIVP+
Sbjct  230   NAVDITFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNVLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPGD+ SWHLLEPYLHG+AGT+G  +L GF+L
Sbjct  290   YPP----IGYIDVGKELMIDTTKSPYVKPPGDIVSWHLLEPYLHGVAGTQGISILAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+R+ISLVNK+ + LK+E+CIPG WW+EK+KGMVQQ DG+W  LD EE
Sbjct  346   EVNRNISLVNKMGNILKDEHCIPGLWWVEKHKGMVQQQDGTWLFLDREE  394



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 226/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI+V WRGTI+ +EWV+DL+FLL+PAP+IFGAG       P
Sbjct  110   FMGYIAVATDEGKASLGRRDIVVNWRGTIQKMEWVNDLQFLLIPAPKIFGAGGLLPLFKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+S +  S FN  S RDQV+ EVKRLVE YK+EEVSITV GHSLGA+LAT+
Sbjct  170   LVHHGFYNVYTSASSRSQFNKTSVRDQVIKEVKRLVEEYKDEEVSITVTGHSLGASLATM  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA N  N  S GK FPVT F +ASP+ GD  FK  +D   +LH++RI N+ DIVP+
Sbjct  230   NAVDIAFNKINKASNGKEFPVTAFAFASPKVGDIQFKATFDKLKHLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPG+  SWHLLEPYLHG+AGT+G GL  GF+L
Sbjct  290   YPP----IGYFDVGKELMIDTTKSPYVKPPGENVSWHLLEPYLHGVAGTQGLGLFAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  + LK+EYCIPG WW+EKNKGMVQQ+DGSW +LD +E
Sbjct  346   EVNRDISLVNKQWNILKDEYCIPGMWWVEKNKGMVQQEDGSWLMLDRDE  394



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   392 bits (1006),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 193/289 (67%), Positives = 225/289 (78%), Gaps = 15/289 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK ALGRRDI+V WRGT++ LEWV+DL+FL VP P++FG G       P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y++E+P S FN      QV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTTEDPRSQFN------QVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  223

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT FV+ASP+ GD NF  A+    NLH++RI NV DIVP+
Sbjct  224   NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK  283

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPG++ SWHLLEPYLHG+AGT+G G+L GF+L
Sbjct  284   YPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKL  339

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D LK+EYCIPG WW +K+KGMVQQ DGSW LLD EE
Sbjct  340   EVNRDISLVNKQWDILKDEYCIPGLWWADKHKGMVQQQDGSWLLLDREE  388



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 227/289 (79%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK ALGRRDI++ WRGTI+TLEWV+DLEFLL+P P++FG G       P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGNGGLVPLFKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFY++Y++ENP S FN  S RDQVL EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYSIYTTENPRSKFNQYSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF+ A+     LH++RI N+ DIVP+
Sbjct  230   NAVDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQMAFSKLKTLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DVG EL ID TKS Y+K PGD+ +WH LE Y+HG+AGT+G GLL GF+L
Sbjct  290   YPP----LGYIDVGEELIIDTTKSPYLKLPGDVLTWHNLECYMHGVAGTQGLGLLTGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RD++L NK    LK+EYCIP NWW EK+KGM+QQ+DG+W LLD E+
Sbjct  346   EVNRDLALANKSSGALKDEYCIPANWWTEKHKGMIQQEDGTWLLLDRED  394



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   390 bits (1002),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 228/288 (79%), Gaps = 9/288 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGT++ +EWV+DL+FL VPAP++FG G       P
Sbjct  107   FMGYIAVATDEGKVSLGRRDIVINWRGTLQKMEWVNDLQFLPVPAPKVFGDGGLLPLFKP  166

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+S +  S FN+ SARDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  167   LVHHGFYNVYTSASSRSQFNLTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  226

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT F +ASP+ GD  FK A+D   +L +++I N+ DIVP+
Sbjct  227   NAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKLKSLRILKIHNLLDIVPK  286

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID  +S YVKPPGD ASWHLLEPYLHG+AGT+G GLL GF+L
Sbjct  287   YPP----IGYFDVGKELMIDTARSPYVKPPGDPASWHLLEPYLHGVAGTQGLGLLAGFKL  342

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              V+RDISLVNK  + LK+EYCIPG WW+EKNKGMVQQ+DGSW  LD++
Sbjct  343   EVNRDISLVNKQWNVLKDEYCIPGFWWVEKNKGMVQQEDGSWLQLDHD  390



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   390 bits (1002),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 226/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AV+TDEGK +LGRRDI++ WRGTI+ +EWV+DL+FLL+PAP+IFG G       P
Sbjct  110   FMGYIAVSTDEGKASLGRRDIVINWRGTIQKMEWVNDLQFLLIPAPKIFGDGGLLHLFKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+S +  S FN  S RDQV+ EVKRLVE YK+EEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNVYTSASSRSQFNQTSVRDQVIKEVKRLVEEYKHEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DI  NG N TS GK FPVT F +ASP+ GD  FK A+D   +LH++RI N+ DIVP+
Sbjct  230   NAVDITFNGINKTSEGKEFPVTAFAFASPKVGDLQFKAAFDKLKHLHVLRIHNLMDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG EL ID TKS YVKPPG+  SWHLLEPYLHG+AGT+G G+  GF+L
Sbjct  290   YPP----IGYFDVGKELMIDTTKSPYVKPPGEPLSWHLLEPYLHGVAGTQGLGIFAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  + LK+EYCIPG WW+EK KGMVQQ+DGSW +LD +E
Sbjct  346   EVNRDISLVNKQWNILKDEYCIPGRWWVEKCKGMVQQEDGSWLMLDRDE  394



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 225/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK ALGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GF+N+Y++ENP S FN    RDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N +S GK FPVT FV+ASP+ GD NF  A+    +LH++RI N+ DIVP+
Sbjct  230   NAVDIAFNGINKSSNGKEFPVTAFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DVG EL ID TKS YVKPPG++ SWHLLEPYLHGIAGT+G G+  GF+L
Sbjct  290   YPP----VGYFDVGQELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK    LK+EYCIP  WW EK+KGMVQQ DGSW L D ++
Sbjct  346   EVNRDISLVNKQWMILKDEYCIPPLWWSEKHKGMVQQQDGSWLLQDRDD  394



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 224/286 (78%), Gaps = 6/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQVH  903
             +MGY+AVATDEGK +LGRRDI++ WRG+++TLEWV+DL+F+LVPAPE+FG G    P VH
Sbjct  111   FMGYIAVATDEGKVSLGRRDIVINWRGSMQTLEWVNDLQFVLVPAPEVFGDGGLLQPLVH  170

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             +GFYN+Y++ +  S FN+ SARDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATLNA+
Sbjct  171   QGFYNVYTASSSRSQFNVTSARDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAV  230

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DIA N  N  S GK FPVT F +A P+ GD  FK A+D    L ++RI N+ DI P+ PP
Sbjct  231   DIAFNKINKASNGKEFPVTAFPFACPKVGDLQFKAAFDKIIGLRILRIDNLLDIAPKYPP  290

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 IGY DVG EL ID TKS YVKPPG   +WH LE YLHGIAGT+G GLL GF L V+
Sbjct  291   ----IGYFDVGQELMIDTTKSPYVKPPGQPVNWHSLESYLHGIAGTQGTGLLAGFNLEVN  346

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDISL+NK LD LK+EYCIP NWW+EKNKGMVQQ+DGSW LLD ++
Sbjct  347   RDISLINKQLDGLKDEYCIPVNWWVEKNKGMVQQEDGSWLLLDRDD  392



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   385 bits (989),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 226/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  111   FMGYIAVATDEGKASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPQVFGDGGLLPLFHP  170

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GF+N+Y++ENP S FN    RDQV+ EVKRLVE YK+EEVSITV GHSLGA+LATL
Sbjct  171   LVHHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATL  230

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA N  N  S GK FPVT FV+ASP+ GD NF NA+    +LH++RI NV DIVP+
Sbjct  231   NAVDIAFNKINKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNVLDIVPK  290

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG E+ ID TKS YVKPPG+  SWHLLEPYLHGIAGT+G G+L GF+L
Sbjct  291   YPP----IGYFDVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMLAGFKL  346

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  + LK+E+CIP  WW EK+KGMVQQ+DG+W L D +E
Sbjct  347   EVNRDISLVNKQWNVLKDEHCIPPLWWSEKHKGMVQQEDGTWLLQDRDE  395



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 222/289 (77%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FLL+P P++FG G       P
Sbjct  110   FMGYIAVATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S FN KSARDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNVYTSESARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA DIA N  N TS GK FPVT FV+ASP+ GD NF NA++   +LH+MRI NV DIVP+
Sbjct  230   NAFDIAYNKINKTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DVG E+ ID TKS Y+  PGD+ +WH LE YLHG+AGT+G GLL GF+L
Sbjct  290   YPP----LGYFDVGQEIIIDTTKSPYLNLPGDILTWHNLECYLHGVAGTQGIGLLAGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              VDRDI+LVNK    LK EY +P NWW  KNKGMVQQ+DG W L D EE
Sbjct  346   EVDRDIALVNKSSGALKSEYLVPANWWTAKNKGMVQQEDGKWVLNDREE  394



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/290 (65%), Positives = 228/290 (79%), Gaps = 10/290 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK ALGRRDI++ WRGTI+TLEWV+DLEFLL+P P++FG G       P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+P S FN  SARDQVL EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTSEDPRSMFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF+ A+    NLH++RI N+ DIVP+
Sbjct  230   NAVDIAFNGFNKTSSGKEFPVTAFVFASPKVGDLNFQKAFSKLKNLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVK-PPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
              PP    IG+ DVG E+ ID TKS Y+K  PGD  + H LE YLHGI GT+G G+L GF+
Sbjct  290   YPP----IGFIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGVLAGFK  345

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             L V+RD++LVN++ D LK+EYCIP  WW EK+KGMVQQ+DG+W LLD E+
Sbjct  346   LEVNRDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLDRED  395



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/290 (64%), Positives = 227/290 (78%), Gaps = 10/290 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK ALGRRDI++ WRGTI+TLEWV+DLEFLL+P P++FG G       P
Sbjct  110   FMGYIAVATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+P S FN  SARDQVL EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTSEDPRSKFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF+  +    NLH++RI N+ DIVP+
Sbjct  230   NAVDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQKTFSKLKNLHILRIHNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVK-PPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
              PP    +GY DVG E+ ID TKS Y+K  PGD  + H LE YLHGI GT+G G+L GF+
Sbjct  290   YPP----VGYIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGILAGFK  345

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             L V+RD++LVN++ D LK+EYCIP  WW EK+KGMVQQ+DG+W LLD E+
Sbjct  346   LEVNRDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLDRED  395



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 227/286 (79%), Gaps = 9/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQVH  903
             +MGY+AVATDEGK +LGRRDI++ WRGT + LE+++DL+FLLVPAP++FG G    P VH
Sbjct  108   FMGYIAVATDEGKVSLGRRDIVINWRGTQQKLEFINDLQFLLVPAPKVFGDGGLLQPLVH  167

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              GFYN+Y+S +  S FN+ SARDQV+ EVKRLVE YK+EEVSITV GHSLGA+LATLNA+
Sbjct  168   NGFYNVYTSASSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAV  227

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DIA NG N TS GK FPVT F +ASP+ GD  FK A+D   +L +++I N+ DI P+ PP
Sbjct  228   DIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKSLRILKIHNLLDIFPKYPP  287

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 IGY DVG EL ID TKS YV+PPG+  SWHLLEPYLHG+AGT+G   L GF+L V+
Sbjct  288   ----IGYFDVGQELMIDTTKSPYVRPPGEPFSWHLLEPYLHGVAGTQG---LAGFKLEVN  340

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDISLVNK  D LK+EYCIPG WW+EKNKGMVQQ+DGSW LLD++E
Sbjct  341   RDISLVNKQWDVLKDEYCIPGFWWVEKNKGMVQQEDGSWLLLDHDE  386



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 224/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  111   FMGYIAVATDEGKASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHP  170

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GF+N+Y++ENP S FN    RDQV+ EVKRLVE YK+EEVSITV GHSLGA+LATL
Sbjct  171   LVHHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKHEEVSITVTGHSLGASLATL  230

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA N  N  S GK FPVT FV+ASP+ GD NF NA+    +LH++RI N+ DIVP+
Sbjct  231   NAVDIAFNKINKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNLLDIVPK  290

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG E+ ID TKS YVKPPG+  SWHLLEPYLHGIAGT+G G+  GF+L
Sbjct  291   YPP----IGYFDVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMFAGFKL  346

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  + LK+E+CIP  WW EK+KGMVQQ+DG W L D +E
Sbjct  347   EVNRDISLVNKQWNILKDEHCIPPLWWSEKHKGMVQQEDGCWLLQDRDE  395



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   380 bits (975),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 220/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  912
             +MGYVAVATDEGK  LGRRDI++ WRGT+  LEWV++ +F  VPAP++FG         P
Sbjct  110   FMGYVAVATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+++NP S FN  S RDQVL EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK F VT F +ASP+ GD  FK A+D   +L  +RI N+ D+VP+
Sbjct  230   NAVDIAFNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
             VPP    IGY DVG EL ID TKS YVKPPG++ SWHLLEPYLHGIAGT+G   L GF+L
Sbjct  290   VPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLIGLIGFKL  345

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D LK+EY IPG WW+EKNKGMVQQ DGSW L+D EE
Sbjct  346   EVNRDISLVNKQWDILKDEYGIPGLWWVEKNKGMVQQQDGSWILMDREE  394



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   380 bits (975),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 220/289 (76%), Gaps = 12/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGYVAVATDEGK  LGRRDI++ WRGT+  LEWV++ +F  VPAP++FG         P
Sbjct  110   FMGYVAVATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDRGLLHLLQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y++ NP S FN  SARDQV+ EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTTNNPRSQFNHTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS G+ FPVT F +ASP+ GD  FK A+D   ++  +RI N+ D+VP+
Sbjct  230   NAVDIAFNGINKTSEGREFPVTAFAFASPKVGDLKFKAAFDKLKSVRTLRIHNLWDVVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
             VPP    IGY DVG EL ID TKS YVKPPG++ SWHLLEPYLHGIAGT+G   L GF+L
Sbjct  290   VPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQG---LRGFKL  342

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              VDRDISLVNK  D LK+EY IPG W +EKNKGMVQQ DGSW L+D EE
Sbjct  343   EVDRDISLVNKQWDILKDEYGIPGRWLVEKNKGMVQQKDGSWLLMDREE  391



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 220/289 (76%), Gaps = 12/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  912
             +MGYVAVATDEGK  LGRRDI++ WRGT+  LEWV++ +F  VPAP++FG         P
Sbjct  110   FMGYVAVATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+++NP S FN  S RDQVL EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK F VT F +ASP+ GD  FK A+D   +L  +RI N+ D+VP+
Sbjct  230   NAVDIAFNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
             VPP    IGY DVG EL ID TKS YVKPPG++ SWHLLEPYLHGIAGT+G   L GF+L
Sbjct  290   VPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQG---LIGFKL  342

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK  D LK+EY IPG WW+EKNKGMVQQ DGSW L+D EE
Sbjct  343   EVNRDISLVNKQWDILKDEYGIPGLWWVEKNKGMVQQQDGSWILMDREE  391



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   377 bits (968),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 219/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGYVAVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FL +P P++FG G       P
Sbjct  107   FMGYVAVATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLPIPGPKVFGDGGLLPLFKP  166

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S FN  SARDQVL EVKRLVE YKNEEVSITV GHSLGA+LATL
Sbjct  167   LVHHGFYNVYTSESARSKFNKTSARDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  226

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA N  N +S GK FPVT FV+ASP+ GD NF NA++    LH+MRI N+ DIVP+
Sbjct  227   NAVDIAYNKINKSSHGKEFPVTAFVFASPKVGDLNFLNAFNKLKYLHVMRIHNILDIVPK  286

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    IGY DVG E+ ID TKS Y+  PGD+ +WH LE Y+HG+AGT+G GLL GF+L
Sbjct  287   YPP----IGYLDVGQEIIIDTTKSPYLNLPGDILTWHNLECYMHGVAGTQGIGLLTGFKL  342

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              VDRDI+LVNK    LK EY +P NWW  KNKGM QQ+DG W L D EE
Sbjct  343   EVDRDIALVNKSSGALKSEYLVPANWWTVKNKGMFQQEDGKWVLNDREE  391



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 184/290 (63%), Positives = 227/290 (78%), Gaps = 10/290 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG-----ASP  912
             +MGY+AVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FLL+PAPE+FG G       P
Sbjct  110   FMGYIAVATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPAPEVFGKGGLLPLTQP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S FN  SARDQVL EVKRLVE YK++EVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNIYTSESERSKFNKTSARDQVLEEVKRLVEEYKDDEVSITVAGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS GK FPVT FV+ASP+ GD NF N ++   NLH+MRI N+ DIVP+
Sbjct  230   NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDVNFVNTFNKLKNLHIMRIDNLLDIVPK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVK-PPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
              PP    IGY DVG E+ ID TKS Y+K  PGD  + H LE YLHGI GT+G G LDGF+
Sbjct  290   YPP----IGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGFK  345

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             L V+RD++LVN++ D LK+E+ +PG WW+EK+ GMVQQ++G W L+D+EE
Sbjct  346   LEVNRDLALVNRIWDILKDEHLVPGAWWVEKHNGMVQQENGKWILMDHEE  395



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 225/295 (76%), Gaps = 15/295 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  915
             +MG+VAVATD+GK  LGRRDI++ WRGTIRTLEWV+DL+FLLVPAP++FGAG S      
Sbjct  110   FMGFVAVATDKGKAVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGAGNSILPLLK  169

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P VH+G+ ++Y+S++P S FN  SARDQVL EVKRLVE YKNE+VSITV GHSLGAALAT
Sbjct  170   PLVHQGWNSVYTSDDPRSPFNKASARDQVLEEVKRLVEKYKNEKVSITVTGHSLGAALAT  229

Query  734   LNAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
             LNA+DI  NG N  S GK FPVT FV+ASP  GD NF+ A+    NLH++RI N+ DIVP
Sbjct  230   LNAVDIVYNGINKKSNGKEFPVTAFVFASPNVGDLNFRAAFSKLKNLHILRIDNLLDIVP  289

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG--  381
             + PP    IGY DVG  L ID  KS YVK PG++ +WH LE Y+HG+AGT+G G+L G  
Sbjct  290   KYPP----IGYIDVGQVLVIDTAKSDYVKSPGNILTWHNLEAYMHGVAGTQGVGILPGEL  345

Query  380   ---FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
                F+L V+RDI+LVNK +D LKEEY +P NWW+EKN GMVQ+ D SW L+D E+
Sbjct  346   LGEFKLEVNRDIALVNKSMDALKEEYGVPANWWVEKNNGMVQRADRSWVLMDRED  400



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 223/295 (76%), Gaps = 15/295 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  915
             +MGYVAVATD+GK  LGRRDI++ WRGTIRTLEWV+DL+FLLVPAP++FG G S      
Sbjct  110   FMGYVAVATDKGKAVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGGGNSILPLFK  169

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P VH+G+ ++Y+S++P S FN  SARDQVL EVK+LVE YKNEEVSITV GHSLGAA+AT
Sbjct  170   PLVHQGWKSIYTSDDPKSPFNKASARDQVLEEVKKLVEKYKNEEVSITVTGHSLGAAVAT  229

Query  734   LNAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
             LNA+DI  NG N TS GK FPVT  V+ASP  GD NF+ A+    NLH++R+ N+ DIVP
Sbjct  230   LNAVDIVYNGFNKTSNGKEFPVTACVFASPNVGDLNFRVAFSKLKNLHILRVDNIVDIVP  289

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG--  381
             + PP    IGY DVG  L ID  KS Y+K PG+L +WH LE YLHG+AGT+G G+L G  
Sbjct  290   KYPP----IGYIDVGEVLVIDTAKSDYLKSPGNLQTWHNLEAYLHGVAGTQGVGILIGEF  345

Query  380   ---FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
                F+L VDRDI+LVNK  D LK EY +P NWW+EKNKGMVQ+ D +W L+D EE
Sbjct  346   FGDFKLEVDRDIALVNKSTDALKGEYGVPANWWVEKNKGMVQKKDKTWVLMDREE  400



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 225/290 (78%), Gaps = 10/290 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FLL+P P++FG G       P
Sbjct  110   FMGYIAVATDEGKASLGRRDILIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKP  169

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
              VH GFYN+Y+SE+  S +N  SARDQV+ EVKRLVE YK++EVSITV GHSLGA+LATL
Sbjct  170   LVHHGFYNVYTSESARSKYNQASARDQVIEEVKRLVEEYKDDEVSITVAGHSLGASLATL  229

Query  731   NAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF NA +   +LH+MRI N+ DIV +
Sbjct  230   NAVDIAYNGINKTSSGKEFPVTAFVFASPKVGDLNFVNAVNKLEHLHIMRIHNLLDIVSK  289

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVK-PPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
              PP    IGY DVG E+ ID TKS Y+K  PGD  + H LE YLHGI GT+G G LDGF+
Sbjct  290   YPP----IGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGFK  345

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             L V+RD+SLVN++ D LK+EY +PG WW+EK+ GMVQQ+DG W L+D E+
Sbjct  346   LEVNRDLSLVNRIWDILKDEYLVPGAWWVEKHNGMVQQEDGKWILMDRED  395



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 177/291 (61%), Positives = 222/291 (76%), Gaps = 10/291 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  903
             WMGYVAVATDEGK  LGRRD++V WRGT++ LEW++DL+F LV A  I G G+S  PQVH
Sbjct  114   WMGYVAVATDEGKKVLGRRDVVVAWRGTVQALEWINDLDFTLVSASAILGKGSSGNPQVH  173

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             RG+ ++Y+S +P S +N  SARDQVL E+ RL+E YK+EE SIT+ GHSLGAALATLNA 
Sbjct  174   RGWLSIYTSNDPRSPYNKDSARDQVLSEIGRLMEEYKDEETSITITGHSLGAALATLNAA  233

Query  722   DIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DIA NG N ++A   K+ PVT FV+ASPR GD +F+ A+   P L L+RIRNVPD+VP  
Sbjct  234   DIASNGLNKSNAHPNKNSPVTAFVFASPRVGDSDFREAFSKIPELRLLRIRNVPDLVPNY  293

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
                 PL+GY DVGVELTID  KS Y+K PG+L+SWH LE YLHG+AGT+G     GF+L 
Sbjct  294   ----PLLGYDDVGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTRGGK--KGFKLE  347

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYV  216
             VDRD++LVNK +D LK+EY +P +W +EKNKGMV+  DG W+L+D+EE  V
Sbjct  348   VDRDVALVNKSMDALKDEYLVPASWRVEKNKGMVKGADGHWRLMDHEEDSV  398



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   361 bits (926),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 224/286 (78%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK ALGRRDI++ WRGT+R+LEWV+DLEF+LV AP+IFG    P+VH+G
Sbjct  90    WMGYVAVATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVLVSAPKIFGENDDPKVHQG  149

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y++++  S FN  SARDQVL EV+RLVE +K+EE+SITV GHSLGAA+ATLNA+DI
Sbjct  150   WYSIYTTDDSRSPFNKTSARDQVLDEVRRLVEEFKDEEISITVTGHSLGAAVATLNAVDI  209

Query  716   AKNGTNTT--SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N +  + GK+ PVT FVYASPR G   FK  +    NL ++RI+N  D+VP    
Sbjct  210   VANGFNKSLENPGKACPVTAFVYASPRVGGQGFKKVFSQQQNLRVLRIQNSLDVVPNY--  267

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY DVG EL ID TKS Y+K PG+L+SWH LE Y+HG+AG +  GL +GF+LVV+
Sbjct  268   --PLLGYADVGEELRIDTTKSKYLKNPGNLSSWHSLECYMHGVAGKQ--GLQEGFKLVVN  323

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RD++L+NK +D LK+E+C+P +WW  +NKGMVQQ DGSW+L D+E+
Sbjct  324   RDVALLNKYMDVLKDEHCVPVSWWCIQNKGMVQQADGSWELEDHED  369



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 222/286 (78%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D +F LVPAP+IFG     +VH+G
Sbjct  137   WMGYVAVATDEGKAVLGRRDIVIAWRGTVQTLEWVNDFQFTLVPAPKIFGESNDRKVHQG  196

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++P S +N  SARDQVL EV+RLVE YK+EE+SITVCGHSLGAA+ATLNA DI
Sbjct  197   WYSVYTSDDPRSPYNKSSARDQVLNEVRRLVEQYKDEEISITVCGHSLGAAVATLNAADI  256

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N + +   K  PVT  V+ASPR GD +FK  +    +L ++R+ N+ D+VP    
Sbjct  257   VANGFNKSKSWPNKPCPVTAIVFASPRVGDSDFKKVFSGYKDLRVLRVHNLLDVVPNY--  314

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PLIGY DVG ELTID TKS Y+K PG+++SWH LE YLHG+AGT+G+    GF+L V+
Sbjct  315   --PLIGYADVGEELTIDTTKSKYLKSPGNVSSWHNLEGYLHGVAGTQGS--TGGFKLEVN  370

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+EY +P +W I+KNKGM+QQ DGSWKL+D+EE
Sbjct  371   RDIALVNKSLDGLKDEYLVPTSWRIQKNKGMIQQADGSWKLMDHEE  416



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   361 bits (927),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 221/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  114   WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  174   WYSIYTSEDPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  233

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  +  + K+ PVT  V+ASPR GD NF+  +    +L  +RIRN  DIVP    
Sbjct  234   VTNGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  KS Y+K PG+ +SWH LE YLHG+AGT+G+    GF L V 
Sbjct  292   --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSK--GGFNLEVH  347

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+E  +P +W IEKNKGM QQ+DGSWKL+D+EE
Sbjct  348   RDIALVNKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEE  393



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/286 (62%), Positives = 222/286 (78%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  114   WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  174   WYSIYTSEDPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  233

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  S  + K+ PVT  V+ASPR GD NF+  +    +L  +RIRN  DIVP    
Sbjct  234   VTNGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  KS Y+K PG+ +SWH LE YLHG+AGT+ +    GF+L V 
Sbjct  292   --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSK--GGFKLEVH  347

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+E+ +P +W  EKNKGMVQQ+DGSWKL+D+E+
Sbjct  348   RDIALVNKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHED  393



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 221/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  139   WIGYVAVATDEGKAALGRRDIVIVWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  198

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  199   WYSIYTSEDPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  258

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  +  + K+ PVT  V+ASPR GD NF+  +    +L  +RIRN  DIVP    
Sbjct  259   VTNGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  316

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  KS Y+K PG+ +SWH LE YLHG+AGT+G+    GF L V 
Sbjct  317   --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSK--GGFNLEVH  372

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+E  +P +W IEKNKGM QQ+DGSWKL+D+EE
Sbjct  373   RDIALVNKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEE  418



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/286 (62%), Positives = 222/286 (78%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  141   WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  200

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  201   WYSIYTSEDPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  260

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  S  + K+ PVT  V+ASPR GD NF+  +    +L  +RIRN  DIVP    
Sbjct  261   VTNGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  318

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  KS Y+K PG+ +SWH LE YLHG+AGT+ +    GF+L V 
Sbjct  319   --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSK--GGFKLEVH  374

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+E+ +P +W  EKNKGMVQQ+DGSWKL+D+E+
Sbjct  375   RDIALVNKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHED  420



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   360 bits (923),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 170/284 (60%), Positives = 218/284 (77%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATDEGK ALGRRDI++ WRG+++T+EW +D +F+ V APEIFG  + P+VH G
Sbjct  139   WVGFVAVATDEGKMALGRRDIVIAWRGSVQTMEWFNDFDFIQVSAPEIFGQKSIPKVHHG  198

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S +  S FN  SARDQVLGEV+RLVE YKNEE++ITV GHS+GAA+ATLNA+DI
Sbjct  199   WYSVYTSSDSRSPFNKASARDQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDI  258

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               N  N     K FPVT F++ASPR GD NFK  +    NL  +R+RN PDIVP      
Sbjct  259   VFNEFN-----KGFPVTAFLFASPRVGDENFKKTFSKLVNLRALRVRNAPDIVPNY----  309

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PL+GY+DVGV+L ID TKS Y+K PGD +SWH ++ YLHG+AGT+G+    GF+L V  D
Sbjct  310   PLLGYSDVGVQLDIDTTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSK--GGFKLEVQHD  367

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             IS+VNK LD LK+EY +P +WW+EKNKGMVQQ DGSW L+D+E+
Sbjct  368   ISVVNKYLDALKDEYGVPASWWVEKNKGMVQQQDGSWILMDHED  411



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/288 (59%), Positives = 216/288 (75%), Gaps = 6/288 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATDEGKT LGRRDI++ WRGTIRTLEWV+D EF  V A +I G    P+VH+G
Sbjct  131   WIGFVAVATDEGKTTLGRRDIVIAWRGTIRTLEWVNDFEFNFVSASKILGESGDPKVHQG  190

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S +N  SARDQVL EV+RLV+ Y NEE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  191   WYSIYTSDDSRSQYNKNSARDQVLNEVRRLVDKYTNEEISITIVGHSLGAAVATLNAVDI  250

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N +   K  PVT  ++ASPR GD NFK  +    +L  +RI NV D+VP      
Sbjct  251   VANGFNQSQKNKRCPVTAMLFASPRVGDSNFKRVFSGYKDLRALRIHNVRDVVPNY----  306

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PLIGY DVG EL ID TKS Y+K PG+L+SWH LE YLHG+AGT+G     GF+L V+RD
Sbjct  307   PLIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPK--GGFKLEVNRD  364

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVP  213
             I+L+NK +D LK+EY +P +W +++NKGMVQQ DGSWKL+D EE ++P
Sbjct  365   IALLNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDLEEDFIP  412



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   357 bits (916),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 217/286 (76%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK+ALGRRDI++ WRGTIRTLEW++D EF  V APEIFG    P VH G
Sbjct  137   WIGYVAVATDEGKSALGRRDILIAWRGTIRTLEWMNDFEFATVSAPEIFGGNDEPNVHLG  196

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++P S FN  SAR+QVL EV+RLVE YKNEE+S+TV GHSLGAA++TLNAIDI
Sbjct  197   WYSIYTSDDPRSPFNKTSARNQVLTEVRRLVEEYKNEEISMTVTGHSLGAAVSTLNAIDI  256

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+ PVT F++ASPR GD+ F+       NLH++R+ N  DIVP    
Sbjct  257   VVNGYNRPRDMPDKACPVTAFLFASPRVGDYKFRKFLSTLQNLHILRVTNARDIVPTY--  314

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               P + Y +VG EL ID  KS Y+K PG+L SWH LE YLHG+AGT+G+    GF+L V+
Sbjct  315   --PFVNYAEVGQELPIDTDKSNYLKSPGNLNSWHNLEAYLHGVAGTQGS--RGGFKLEVN  370

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+EYC+P +WW EK+KGMVQQ+DGSWKL+D+E+
Sbjct  371   RDIALVNKHLDGLKDEYCVPVSWWCEKHKGMVQQEDGSWKLMDHED  416



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   357 bits (916),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 217/288 (75%), Gaps = 6/288 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATDEGKT LGRRDI++ WRGTI+TLEWV+D EF  V A +I G    P+VH+G
Sbjct  131   WIGFVAVATDEGKTTLGRRDIVIAWRGTIQTLEWVNDFEFNFVSASKILGESGDPKVHQG  190

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S +N  SARDQVL E++RLV+ Y NEE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  191   WYSIYTSDDSRSPYNKNSARDQVLNEIRRLVDKYTNEEISITIVGHSLGAAVATLNAVDI  250

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N +   K  PVT  ++ASPR GD NFK  +    +L  +RI NV D+V    P+ 
Sbjct  251   VANGFNQSQKNKRCPVTAILFASPRVGDSNFKKVFSGYKDLRALRIHNVLDVV----PSY  306

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PLIGY DVG EL ID TKS Y+K PG+L+SWH LE YLHG+AGT+G     GF+L V+RD
Sbjct  307   PLIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPK--GGFKLEVNRD  364

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVP  213
             I+LVNK +D LK+EY +P +W +++NKGMVQQ DGSWKL+D EE ++P
Sbjct  365   IALVNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDVEEDFIP  412



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/285 (61%), Positives = 218/285 (76%), Gaps = 9/285 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK+ALGRRDI++ WRGTIR LEWV+D EF LVPAPEIFG    P+VH G
Sbjct  130   WMGYVAVATDEGKSALGRRDILIAWRGTIRNLEWVNDFEFGLVPAPEIFGGNDDPKVHFG  189

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             ++++Y+S++P S F+  SAR QVLGEV+RLVE YKNEE+SITV GHSLGAA++T+NA+DI
Sbjct  190   WHSIYTSDDPKSPFSKNSARHQVLGEVRRLVERYKNEEISITVTGHSLGAAVSTINAVDI  249

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K  PVT FV+A PR GD+NF++      NLH++R+RN  DIVP+   
Sbjct  250   VVNGYNRPQGMLHKHCPVTAFVFACPRVGDNNFRDFVLNLQNLHILRVRNARDIVPKY--  307

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               P I Y DVG EL ID  KS Y+K  G+L+SWH LE YLHG+AGT+G+    GF+L V+
Sbjct  308   --PFIDYVDVGEELAIDTDKSSYLK-EGNLSSWHNLEAYLHGVAGTRGSE--GGFKLEVN  362

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDI+LVNK +D LK+E+C+P +WW EKNKGMVQQ DGSW L+D+E
Sbjct  363   RDIALVNKHMDALKDEFCVPVSWWCEKNKGMVQQADGSWVLMDHE  407



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   355 bits (910),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/291 (60%), Positives = 218/291 (75%), Gaps = 10/291 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  903
             WMGYVAVATDEGK  LGRRD++V WRGT++ LEW++DL+F LV A  I G G S  PQVH
Sbjct  114   WMGYVAVATDEGKKVLGRRDVVVAWRGTVQALEWINDLDFTLVSASGILGKGYSGDPQVH  173

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             RG+ ++Y+S++P S +N  SAR+QVL E+ RL++ Y  EE SITV GHSLGAALATLNA 
Sbjct  174   RGWLSIYTSDDPRSPYNKDSARNQVLREIGRLMDEYNKEETSITVTGHSLGAALATLNAA  233

Query  722   DIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DIA NG N ++A   KS PV  FV+ASPR GD +F+ A+   P L L+RIRNVPD+VP  
Sbjct  234   DIASNGLNKSNARPNKSSPVAAFVFASPRVGDSDFREAFSNIPELRLLRIRNVPDLVPNY  293

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
                 PL+GY D+GVELTID  KS Y+K PG+L+SWH LE YLHG+AGT G      F+L 
Sbjct  294   ----PLLGYDDIGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTNGGK--GRFKLE  347

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYV  216
             VDRD++LVNK LD LK+EY +P +WW+EKNKGMV+  DG W+L+D+EE  V
Sbjct  348   VDRDVALVNKGLDALKDEYLVPASWWVEKNKGMVKGADGHWRLMDHEEDSV  398



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 221/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DLEF+LV AP++FG    P+VH+G
Sbjct  142   WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLEFVLVSAPKVFGKNTDPKVHQG  201

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+SE+P S FN  SAR QVL EVKRLVELYKNEE+SI++ GHSLGAA+ATL+A+DI
Sbjct  202   WYSIYTSEDPLSPFNKSSARSQVLSEVKRLVELYKNEEISISITGHSLGAAIATLSAVDI  261

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  S  + K+ PVT  V+A PR GD NF+  +    +L  +RIRN  DIVP    
Sbjct  262   VANGYNKPSDPSLKASPVTAIVFACPRVGDTNFRKVFSGYKDLKTIRIRNELDIVPNY--  319

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  KS Y+K PG+  SWH LE YLHG+AGT+G+    GF+L V+
Sbjct  320   --PLVGYSDVGEELKIDTRKSMYLKSPGNPLSWHNLEGYLHGVAGTQGSK--GGFKLEVN  375

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+L+NK LD LK+E  +P +W IEKNKGMVQQ+DGSWKL+D+E+
Sbjct  376   RDIALLNKTLDALKDELLVPVSWRIEKNKGMVQQNDGSWKLMDHED  421



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 218/287 (76%), Gaps = 9/287 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  900
             WMGY+AVATDEG   LGRRDI++ WRGT+RTLEWV DLEF+LV A ++ G +G  P+VH+
Sbjct  115   WMGYIAVATDEGTAVLGRRDIVIAWRGTVRTLEWVDDLEFVLVSASDLLGESGNDPKVHQ  174

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G++++Y+S++P S FN  SARDQVL EV+RLVE YKNEE+SITVCGHSLGAALATLNA+D
Sbjct  175   GWHSVYTSDDPLSPFNKSSARDQVLNEVRRLVEKYKNEEISITVCGHSLGAALATLNAVD  234

Query  719   IAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N +     K+ PVT  V+ASPR GD  FK  +     L  +RI N  DIVP   
Sbjct  235   IIANGFNKSKTFPNKACPVTAIVFASPRVGDSGFKKVFSGYKELRALRIHNNLDIVPNY-  293

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                PLIGY +VG EL ID TKS Y+K PG+++SWH LE YLHG+AGT+G+    GF+L +
Sbjct  294   ---PLIGYAEVGEELVIDTTKSNYLKSPGNVSSWHNLEGYLHGVAGTQGSK--GGFKLEI  348

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +RDI+LVNK LD LK+EY +P +W I+KNKGMVQQ DGSWKL+D+EE
Sbjct  349   NRDIALVNKSLDGLKDEYLVPPSWRIQKNKGMVQQSDGSWKLMDHEE  395



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/287 (60%), Positives = 221/287 (77%), Gaps = 9/287 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  900
             WMGYVAVATDEGK ALGRRDI++ WRGT+R+LEWV+DLEF+ V AP+IF      P+VH+
Sbjct  113   WMGYVAVATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVSVSAPKIFTENDDDPKVHQ  172

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y++++  S FN  SARDQVL E++RLVE +K EE+SITV GHSLGAA+ATLNA+D
Sbjct  173   GWYSIYTTDDSRSPFNKISARDQVLDEIRRLVEEFKGEEISITVTGHSLGAAVATLNAVD  232

Query  719   IAKNGTNTT--SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N +  + GK+ PVT FVYASPR GD  F+  +    NL ++RIRN  D+VP   
Sbjct  233   IVANGFNKSVQNPGKACPVTAFVYASPRVGDQGFEKVFSQQQNLKVLRIRNSLDVVPNY-  291

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                PL+GY DVG +L ID TKS Y+K PG+L+SWH LE Y+HGIAGT+  GL  GF+LV 
Sbjct  292   ---PLLGYADVGEQLGIDTTKSKYLKSPGNLSSWHSLECYMHGIAGTQ--GLQGGFKLVA  346

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +RD++LVNK +D LK+E+C+P +WW  +NKGMVQQ DGSWKL D+E+
Sbjct  347   NRDVALVNKHMDALKDEHCVPVSWWCIQNKGMVQQSDGSWKLEDHED  393



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 215/284 (76%), Gaps = 6/284 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMG+VAV+TDEGK ALGRRDI++ WRGTI+ LEWV+D EF LV A +I G   +P+VH+G
Sbjct  114   WMGFVAVSTDEGKVALGRRDIVIAWRGTIQILEWVNDFEFNLVSASKILGESGNPKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S +N  SARDQVL EV RLV+ +KNEE+SIT+ GHSLGAALATLNA+DI
Sbjct  174   WYSIYTSDDSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDI  233

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N +   K  PVT  ++ASPR GD NFK  +    +L  +R+ NV D+VP+     
Sbjct  234   VANGFNKSHENKGCPVTAMLFASPRVGDSNFKKVFSRYMDLKALRVHNVLDVVPKY----  289

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             P IGY DVG EL ID TKS Y+K PG+++SWH LE YLHG+AGT+G+    GFELV +RD
Sbjct  290   PFIGYADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGSK--GGFELVANRD  347

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             I+L+NK  D LK+EY +P +W I++NKGMVQQ DGSWKL+D+EE
Sbjct  348   IALINKTTDGLKDEYLVPASWRIQENKGMVQQADGSWKLVDHEE  391



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 217/284 (76%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W G+VAVATD+GK ALGRRDI++ WRG+++TLEW +D +F+ V A +IFG  + P+VH G
Sbjct  154   WAGFVAVATDKGKIALGRRDIVIVWRGSVQTLEWFNDFDFIQVSATKIFGEKSDPKVHHG  213

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN +SARDQVLGEVKRL+E YK EEVSITV GHS+GA++ATLNA DI
Sbjct  214   WYSIYTSDDSRSLFNKESARDQVLGEVKRLMEQYKTEEVSITVTGHSMGASMATLNAGDI  273

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N     K FPVT F++ASPR GD NFK  +    NL  +RIRN PD+V    P+ 
Sbjct  274   VFNGIN-----KGFPVTAFLFASPRVGDENFKRTFSKLENLRALRIRNAPDLV----PSY  324

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PL GY+DVGVEL ID  KSGY+K PGD +S+H  + YLHGIAGT+G+    GF+L V+RD
Sbjct  325   PLFGYSDVGVELAIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSK--GGFKLEVERD  382

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             ISL+NK LD LK+EY +P +WW+EKN GMVQQ +G+W L+D+E+
Sbjct  383   ISLINKYLDALKDEYGVPTSWWVEKNNGMVQQQNGTWILVDHED  426



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 218/284 (77%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATD+GK ALGRRDI++ WRG+++T+EW +D +F+ V +P+IFG  + P+VH G
Sbjct  156   WVGFVAVATDKGKIALGRRDIVIVWRGSVQTMEWFNDFDFIQVSSPKIFGEKSDPKVHHG  215

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SARDQVLGEV+RL+E YK +EV+ITV GHS+GAA+ATLNA DI
Sbjct  216   WYSIYTSDDSRSPFNKGSARDQVLGEVQRLLEQYKKDEVTITVTGHSMGAAMATLNAGDI  275

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N     K FPVT F++ASPR GD NFK  +    NL  +RIRN PDIVP      
Sbjct  276   VFNGIN-----KGFPVTAFLFASPRVGDENFKKTFSKLENLRALRIRNDPDIVPNY----  326

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PL GY+DVGVEL ID  KSGY+K PGD +S+H  + YLHGIAGT+G+    GF+L V+RD
Sbjct  327   PLFGYSDVGVELVIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSK--GGFKLEVERD  384

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             ISL+NK LD LK+EY +P +WW+EKNKGMVQQ +GSW L+D+E+
Sbjct  385   ISLINKYLDALKDEYGVPTSWWVEKNKGMVQQQNGSWILVDHED  428



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 217/285 (76%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  900
             W+G+VAVATDEGK ALGRRDI++ WRG+++T+EW +D +F+ V APEIFG   S P+VH 
Sbjct  150   WVGFVAVATDEGKVALGRRDIVISWRGSVQTMEWFNDFDFIQVSAPEIFGHQKSIPKVHH  209

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+S +  S F+  SAR+QVLGEV+RLVE YKNEE++ITV GHS+GAA+ATLNA+D
Sbjct  210   GWYSVYTSNDSRSPFSKASARNQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVD  269

Query  719   IAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             +  NG N     K FPVT F++ASPR GD N K  +    NL  +R+RN PDIVP     
Sbjct  270   MVFNGFN-----KGFPVTAFLFASPRVGDENLKKTFSKLENLRTLRVRNAPDIVPNY---  321

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              PL+GY+DVGV+L ID TKS Y+K PGD +SWH ++ YLHG+AGT+G+    GF+L V  
Sbjct  322   -PLLGYSDVGVQLDIDTTKSAYLKSPGDESSWHNMDCYLHGVAGTQGSK--GGFKLQVQH  378

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DIS+VNK L  LK+EY +P +WW+EKNKGMVQQ DGSW L+D+E+
Sbjct  379   DISVVNKYLGALKDEYGVPASWWVEKNKGMVQQQDGSWILMDHED  423



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   351 bits (900),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 215/284 (76%), Gaps = 6/284 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMG+VAV+TDEGK ALGRRDI++ WRGT++TLEWV+D EF LV A +I G   +P+VH+G
Sbjct  114   WMGFVAVSTDEGKVALGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKILGESGNPKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S +N  SARDQVL EV RLV+ +KNEE+SIT+ GHSLGAALATLNA+DI
Sbjct  174   WYSIYTSDDSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDI  233

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N +   K  PVT  ++ASPR GD NFK  +    +L  +RI N  D+VP+     
Sbjct  234   VANGFNMSHENKGCPVTAMLFASPRVGDSNFKKVFSGYMDLKAIRIHNFLDVVPKY----  289

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             P IGY DVG EL ID TKS Y+K PG+++SWH LE YLHG+AGT+  G   GFELVV+RD
Sbjct  290   PFIGYADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQ--GFKGGFELVVNRD  347

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             I+L+NK +D LK+EY +P +W I++NKGMVQ+ DGSWKL D+EE
Sbjct  348   IALINKTIDGLKDEYLVPVSWRIQENKGMVQEADGSWKLEDHEE  391



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 218/285 (76%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  900
             WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G AG  P+VH+
Sbjct  43    WMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQ  102

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+S++P S+F+  SARDQVLGEV+RLVE +KNEE+SI++ GHSLGAA+ATLNA+D
Sbjct  103   GWYSIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVD  162

Query  719   IAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             I  NG N     +  PVT  V+ASPR GD NF   + A  NL ++R+RN  DI+P     
Sbjct  163   IVANGLN-----QGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNY---  214

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              PL+GY+DVG EL +D  KS Y+K PG+L++WH LE +LHG+AGT+G+    GF L V+R
Sbjct  215   -PLLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGS--RGGFRLEVNR  271

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DI+LVNK +D L +EY +P +W  EKNKGMVQQ DGSWKL+D+EE
Sbjct  272   DIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEE  316



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 218/285 (76%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  900
             WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G AG  P+VH+
Sbjct  90    WMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQ  149

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+S++P S+F+  SARDQVLGEV+RLVE +KNEE+SI++ GHSLGAA+ATLNA+D
Sbjct  150   GWYSIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVD  209

Query  719   IAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             I  NG N     +  PVT  V+ASPR GD NF   + A  NL ++R+RN  DI+P     
Sbjct  210   IVANGLN-----QGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNY---  261

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              PL+GY+DVG EL +D  KS Y+K PG+L++WH LE +LHG+AGT+G+    GF L V+R
Sbjct  262   -PLLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGS--RGGFRLEVNR  318

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DI+LVNK +D L +EY +P +W  EKNKGMVQQ DGSWKL+D+EE
Sbjct  319   DIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEE  363



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 216/286 (76%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G    P+VH+G
Sbjct  130   WIGYVAVATDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQG  189

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SARDQVL EVKRLVELYKNEE+SITV GHSLGAA+ATLNA+DI
Sbjct  190   WYSIYTSDDSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDI  249

Query  716   AKNGTNT--TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N      G+  PVT  V+ASP+ GD NF  A+    +L  +RIRN  DIV    P
Sbjct  250   VANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIV----P  305

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
             + P++ YT+VGVEL I+  KS Y+K PG  +SWH LE YLHG+AGT+G+    GF+L ++
Sbjct  306   SYPILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSK--GGFKLEIN  363

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RD+SLVNK LD LK+EY +P +W  EKNKGMVQQ+DGSWKL+D+EE
Sbjct  364   RDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEE  409



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/284 (58%), Positives = 214/284 (75%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G++AV TDEGK ALGRR+I++ WRGT++TL+WV+DL+F  V APEIF     PQ+HRG
Sbjct  122   WIGFIAVCTDEGKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTDPQIHRG  181

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+SE+P S FN  S RDQV+ EVKRLVE YK+E++SIT+ GHS+GAA+ TLNAIDI
Sbjct  182   WYSIYTSEDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDI  241

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N     K   VT  ++ASPR GD +F NA+    NL ++R+ N  DI+P      
Sbjct  242   VVNGFN-----KGCLVTAILFASPRVGDSSFVNAFSKLENLRILRVTNCLDIIPNY----  292

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PLI Y+++GVEL ID TKS Y+K PGD+ SWH LE ++HG+AG +GA    GF+L V RD
Sbjct  293   PLIDYSEIGVELAIDTTKSKYLKVPGDIRSWHSLEAHMHGVAGYQGAN--GGFKLEVRRD  350

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             ISLVNK L+ LK+EYC+P  WW+EKN GMVQQDDGSWKL+D+E+
Sbjct  351   ISLVNKHLNALKDEYCVPTCWWVEKNNGMVQQDDGSWKLMDHED  394



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   348 bits (894),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 216/286 (76%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G    P+VH+G
Sbjct  170   WIGYVAVATDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQG  229

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SARDQVL EVKRLVELYKNEE+SITV GHSLGAA+ATLNA+DI
Sbjct  230   WYSIYTSDDSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDI  289

Query  716   AKNGTNT--TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N      G+  PVT  V+ASP+ GD NF  A+    +L  +RIRN  DIV    P
Sbjct  290   VANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIV----P  345

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
             + P++ YT+VGVEL I+  KS Y+K PG  +SWH LE YLHG+AGT+G+    GF+L ++
Sbjct  346   SYPILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSK--GGFKLEIN  403

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RD+SLVNK LD LK+EY +P +W  EKNKGMVQQ+DGSWKL+D+EE
Sbjct  404   RDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEE  449



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   345 bits (885),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 218/289 (75%), Gaps = 12/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMG+VAVATDEG+ ALGRRDI++ WRGTI+ LEWV+DL+F LV APEIFG     G  P+
Sbjct  77    WMGFVAVATDEGRLALGRRDILISWRGTIQNLEWVNDLQFELVSAPEIFGETNNEGDEPK  136

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH G+ ++Y+S++P S FN  SAR QVL EV+RLVE YKNEE SIT+ GHS+GAA++TLN
Sbjct  137   VHLGWRSIYTSDDPKSPFNKTSARHQVLDEVRRLVEEYKNEETSITITGHSMGAAVSTLN  196

Query  728   AIDIAKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
             A+DI   G N       K+ PVT FV+ASPR G+ +F+  + +  NL ++R+RN  D+V 
Sbjct  197   AVDIVAQGYNKPKDMPNKACPVTAFVFASPRVGNGSFQKFFSSLQNLRILRVRNARDVV-  255

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
                P  PLIGY++VG EL ID  +S Y+K PG+ +SWH LE YLHG+AGT+G+    GF+
Sbjct  256   ---PLYPLIGYSEVGEELVIDTEESSYLKKPGNFSSWHTLEGYLHGVAGTQGSK--GGFK  310

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             L VDRDI+LVNK ++ LK+EYC+P +WW E+NKGMVQ++DGSW L+D+E
Sbjct  311   LEVDRDIALVNKHMNLLKDEYCVPESWWCERNKGMVQKEDGSWLLMDHE  359



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   347 bits (889),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 218/285 (76%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  900
             WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G AG  P+VH+
Sbjct  128   WMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQ  187

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+S++P S+F+  SARDQVLGEV+RLVE +KNEE+SI++ GHSLGAA+ATLNA+D
Sbjct  188   GWYSIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVD  247

Query  719   IAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             I  NG N     +  PVT  V+ASPR GD NF   + A  NL ++R+RN  DI+P     
Sbjct  248   IVANGLN-----QGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNY---  299

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              PL+GY+DVG EL +D  KS Y+K PG+L++WH LE +LHG+AGT+G+    GF L V+R
Sbjct  300   -PLLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGS--RGGFRLEVNR  356

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DI+LVNK +D L +EY +P +W  EKNKGMVQQ DGSWKL+D+EE
Sbjct  357   DIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEE  401



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/288 (60%), Positives = 218/288 (76%), Gaps = 9/288 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  900
             W+GYV V++DEGK  LGRRDI++ WRGTIR+LEWV+DL F+LV AP++FG     P+VH+
Sbjct  132   WIGYVGVSSDEGKDVLGRRDIVIAWRGTIRSLEWVNDLNFVLVSAPKLFGNNIIDPKVHQ  191

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+SE+P S FN  SAR+QVL EV+RLVE YKNEE+SIT+ GHSLGAA+ATLNA+D
Sbjct  192   GWYSIYTSEDPRSPFNKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVD  251

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N    S+ K+ PVT  V+ASPR GD NF+  +    +L  +RIRN  DIVP   
Sbjct  252   IVTNGYNKPNDSSIKASPVTAIVFASPRVGDTNFQKVFSDQKDLSTLRIRNELDIVPNY-  310

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                P IGY+DVG EL ID TKS Y+K PG+  SWH LE YLHG+AGT+G+    GF+L V
Sbjct  311   ---PFIGYSDVGEELKIDTTKSMYLKSPGNPLSWHNLEAYLHGVAGTQGSKR--GFKLEV  365

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEG  222
             +RDISLVNK LD LK+EY +P +W + +NKGMVQQ DGSWKL+D E+G
Sbjct  366   NRDISLVNKTLDVLKDEYLVPISWRVVENKGMVQQPDGSWKLVDPEDG  413



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 210/285 (74%), Gaps = 8/285 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGKTALGRRDI+V WRGT +TLEW+ D EF LV A ++ G    P+VH+G
Sbjct  126   WIGYVAVATDEGKTALGRRDIVVAWRGTKQTLEWIDDFEFNLVSASKVLGEANDPKVHQG  185

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S +P S FN KSAR QVL E++RLV+LYKNEE+SITV GHSLGAA+ATLNA+DI
Sbjct  186   WYSIYNSSDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDI  245

Query  716   AKNGTNTTSAGKS--FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N     ++   PVT   +ASPR GD NF+  +    +L  +R+RN  DIVP    
Sbjct  246   TANAFNKPIGHQTNGCPVTAITFASPRVGDSNFRKVFSELADLRALRVRNALDIVPNY--  303

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PLIGY+DVG EL +D  KS Y+K PG+++SWH LE YLH +AGT+G    DGFEL+VD
Sbjct  304   --PLIGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCVAGTQGTN--DGFELMVD  359

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              D +L+NK LD LK+EY +P +WW  KNKGMVQQ DGSWKL+D E
Sbjct  360   HDATLINKALDALKDEYLVPASWWCPKNKGMVQQADGSWKLMDYE  404



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/284 (58%), Positives = 213/284 (75%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G++AV TDEGK ALGRR+I++ WRGT++TL+WV+DL+F  V APEIF     PQ+HRG
Sbjct  131   WIGFIAVCTDEGKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTEPQIHRG  190

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++P S FN  S RDQV+ EVKRLVE YK+E++SIT+ GHS+GAA+ TLNAIDI
Sbjct  191   WYSIYTSDDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDI  250

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N     K   VT  ++ASPR GD NF NA+    NL ++R+ N  DI+P      
Sbjct  251   VVNGFN-----KGCLVTAILFASPRVGDSNFVNAFSKLENLRILRVTNCLDIIPNY----  301

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             PLI Y+++GVEL ID TKS Y+K PGD+ SWH LE Y+HG+AG +GA    GF+L V RD
Sbjct  302   PLIDYSEIGVELGIDTTKSKYLKVPGDIRSWHSLEAYMHGVAGYQGAN--GGFKLEVGRD  359

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             ISL+NK L+ LK+EYC+P  WW+EKN GMVQQDDG WKL+D+E+
Sbjct  360   ISLLNKHLNALKDEYCVPTCWWVEKNNGMVQQDDGYWKLMDHED  403



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   344 bits (882),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 211/285 (74%), Gaps = 8/285 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRD++V WRGT +TLEWV D EF+LV A ++ G    P+V +G
Sbjct  126   WIGYVAVATDEGKAALGRRDVVVAWRGTKQTLEWVDDFEFILVSASKVLGKANDPKVQKG  185

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S +P S FN KSAR QVL E++RLV+LYKNEE+SITV GHSLGAA+ATLNA+DI
Sbjct  186   WYSIYNSSDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDI  245

Query  716   AKNGTNTTSAGKS--FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N     ++   PVT F +ASPR GD NF+  +    +L ++R+RN  DIVP    
Sbjct  246   VANAFNKPIGHQTNGCPVTAFAFASPRVGDSNFRKLFSELADLRVLRVRNALDIVPNY--  303

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL +D  KS Y+K PG+++SWH LE YLH  AGT+G     GFEL+VD
Sbjct  304   --PLLGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCAAGTQGTN--GGFELMVD  359

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RD++L+NK LD LK EY +P +WW  KNKGMVQQ DGSWKL+D+E
Sbjct  360   RDVALINKSLDALKVEYLVPASWWCPKNKGMVQQADGSWKLMDHE  404



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   342 bits (877),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 213/285 (75%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATDEG+ ALGRRDI++ WR T+  +EW +D EF+ V AP IFG  + P+VH G
Sbjct  117   WIGFVAVATDEGEVALGRRDIVIAWRSTVVPMEWFNDFEFIRVSAPTIFGENSDPKVHHG  176

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S +P S FN  SARDQVLGEV+RL+E YK EEVSITV GHS+GA++ATLNA+D+
Sbjct  177   WYSMYTSNDPRSLFNKASARDQVLGEVERLMEQYKTEEVSITVTGHSMGASIATLNAVDM  236

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPN-LHLMRIRNVPDIVPQVPPA  540
               NG N     K FPVT F++ASPR GD NF   +    N L  +R+RN+PDI+P     
Sbjct  237   VFNGIN-----KGFPVTAFLFASPRVGDENFNKTFSELENQLRALRVRNIPDIIPHY---  288

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              P IGY+DVGVEL +D  KS Y+K  GD  +WH LE YLHG+AGT+G+   +GF+L V+R
Sbjct  289   -PFIGYSDVGVELIMDTRKSDYLKSGGDYWTWHNLECYLHGVAGTQGSK--EGFKLEVER  345

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DISLVNK +D LK+EY +P +WW+ +NKGMVQQ +GSW L+D+E+
Sbjct  346   DISLVNKHMDTLKDEYGVPVSWWVVENKGMVQQQNGSWILMDHED  390



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 221/289 (76%), Gaps = 11/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  906
             W+G+VAVA DEGK  LGRRDI++ WRGTI+TLEWV+DL+FLLV AP++FG   +   P+V
Sbjct  129   WIGFVAVANDEGKDVLGRRDIVIAWRGTIQTLEWVNDLQFLLVSAPKVFGNSNNINDPKV  188

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             H+G+Y++Y+SE+P S F+  SAR+QVL EV+RLVE YKNEE+SIT+ GHSLGAA+ATLNA
Sbjct  189   HQGWYSIYTSEDPRSPFSKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNA  248

Query  725   IDIAKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             +DI  NG N  S  + K+ PVT  V+ASPR GD NF+  + +  +L  +RIRN  DIVP 
Sbjct  249   VDIVTNGFNKPSDPSLKASPVTAIVFASPRVGDTNFQKLFSSYKDLSTLRIRNELDIVPN  308

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                  P IGY+DVG EL ID  KS Y+K PG++ SWH LE YLHG+AGT+G+  +  F+L
Sbjct  309   Y----PFIGYSDVGEELKIDTRKSMYLKSPGNILSWHNLEAYLHGVAGTQGSKRV--FKL  362

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDI+LVNK LD LK+EY +P +W + +NKGMVQQ DGSWKL+D+E+
Sbjct  363   EVNRDIALVNKTLDGLKDEYLVPVSWRVVENKGMVQQLDGSWKLIDHED  411



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 217/286 (76%), Gaps = 9/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             W+GYVAVATDEGK  LGRRDI++ WRGT++TLEW++D+EF LV   +IFG      +VH 
Sbjct  131   WIGYVAVATDEGKDVLGRRDIVIAWRGTVQTLEWINDIEFNLVSPEKIFGHERRDIKVHE  190

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+SE+  S +N  SARDQVL EV+RLV+ +KNEE+SITV GHSLGAALATLNAID
Sbjct  191   GWYSIYTSEDSRSPYNKSSARDQVLNEVRRLVDQFKNEEISITVTGHSLGAALATLNAID  250

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   + + K+ PVT F++ASPR GD +FK A+    +L  +R+ N  D+VP   
Sbjct  251   IVANGYNRPKSQSRKASPVTAFLFASPRVGDSDFKKAFTGFKDLRALRVGNALDVVPNY-  309

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                PL+GY+DVG EL ID  KS Y+  PG+L+SWH LE YLHG+AGT+G+    GF LVV
Sbjct  310   ---PLVGYSDVGEELAIDTRKSKYLNSPGNLSSWHNLEAYLHGVAGTQGSK--GGFALVV  364

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +RDI+LVNK +D LK+EY +P +W IEKNKGMVQQ+DGSWKL+D+E
Sbjct  365   NRDIALVNKSIDGLKDEYLVPVSWRIEKNKGMVQQEDGSWKLMDHE  410



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 212/286 (74%), Gaps = 8/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV TDEG   LGRRDI+V WRG+I+TLEW++D  F+LV A  IFG  +   QVH+
Sbjct  115   WMGYVAVTTDEGTELLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQ  174

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+S +  S FN  SARDQVL EV+RLVE YK+EE+SITVCGHSLGAALATLNA D
Sbjct  175   GWYSIYTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAAD  234

Query  719   IAKNGTNTTSAGKSFP--VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N T      P  VT FV+ASPR G+ +FK  +    +L  +R+RN+PDIVP  P
Sbjct  235   IVANGYNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP  294

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY+DVG ELTID  KS Y+K PGDL S+H LE  LHG+AGT+G    + F+L V
Sbjct  295   P----LGYSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTTTKE-FKLQV  349

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDISL+NK +D LK+EY +PG+W + KNKGMVQQDDGSWKL+D+E
Sbjct  350   KRDISLINKSIDALKDEYMVPGSWRVLKNKGMVQQDDGSWKLMDHE  395



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/285 (56%), Positives = 212/285 (74%), Gaps = 5/285 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV+TDEG   LGRRD+++ WRGT+R+LEW+ D EF LV AP+IFG  +  ++H+G
Sbjct  157   WIGYVAVSTDEGAAELGRRDVVIAWRGTVRSLEWIDDFEFGLVSAPQIFGESSDVKIHQG  216

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S F   S R+QV+GEVKRLVE YKNEE+SI   GHSLGAALATLNA+DI
Sbjct  217   WYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAVDI  276

Query  716   AKNGTNTTSA-GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             A N  N  +A G+++PVT FV+A PR GD  FK A+    ++H++R++N  D+VP  P  
Sbjct  277   AANKLNIAAATGQAYPVTSFVFACPRVGDSEFKRAFSEYKDVHVLRVKNAMDVVPNYP--  334

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
                IGY++VG EL ID  KS Y+K PG L+SWH LE YLHG+AGT+G     GF L ++R
Sbjct  335   -MFIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEGYLHGVAGTQGKN-KGGFRLEIER  392

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DI+L+NK LD LK+EY +P  W   +NKGMVQQ DGSWKL+D+EE
Sbjct  393   DIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQTDGSWKLMDHEE  437



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/285 (56%), Positives = 212/285 (74%), Gaps = 6/285 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG   LGRRD+++ WRGT+R+LEW+ D EF LV AP+IFG  +  ++H+G
Sbjct  151   WIGYVAVGTDEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQG  210

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S F   S R+QV+GEVKRLVE YKNEE+SI   GHSLGAALATLNA D+
Sbjct  211   WYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDM  270

Query  716   AKNGTN-TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             A N  N   + G+++PVT FV+ASPR GD +FK A+    ++H++R++N  D+VP     
Sbjct  271   AANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPNY---  327

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              P+IGY++VG EL ID  KS Y+K PG L+SWH LE YLHG+AGT+G     GF L ++R
Sbjct  328   -PIIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKN-KGGFRLEIER  385

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DI+L+NK LD LK+EY +P  W   +NKGMVQQ DGSWKL+D+EE
Sbjct  386   DIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHEE  430



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/286 (57%), Positives = 212/286 (74%), Gaps = 9/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEG   LGRRD++V WRGT+  LEW++DL+F +VPAPE+ G+ +SP VHRG
Sbjct  114   WMGYVAVATDEGAAQLGRRDVLVAWRGTLLPLEWINDLDFTMVPAPEVLGS-SSPLVHRG  172

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+SE+P S ++  SAR+QVL EV RL+E YK+EE SIT+ GHSLGAA+ATLNA+DI
Sbjct  173   WLSIYTSEDPKSPYSKSSARNQVLKEVGRLIEEYKDEETSITITGHSLGAAVATLNAVDI  232

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N +S  +    PVT FV+ASPR GD  F+  +  TP+L L+R+RN PD+VP    
Sbjct  233   VANSFNRSSNPSSTGCPVTAFVFASPRVGDFEFQKLFSGTPDLRLLRVRNAPDLVPNY--  290

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               P+I Y DVGVEL ID  KS Y+K PGDL +WH LE YLHG AG +G     GF+L +D
Sbjct  291   --PIIPYVDVGVELAIDTRKSEYLKAPGDLTTWHNLECYLHGTAGAQGR--RGGFKLAID  346

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RD++LVNK  D LK+EY +P +WW+EKNKGM++  DG +KL D+EE
Sbjct  347   RDVALVNKSTDALKDEYLVPDSWWVEKNKGMMKGADGHYKLEDHEE  392



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 217/293 (74%), Gaps = 15/293 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA----SPQ  909
             W+GYVAVATDEGK ALGRRDI++ WRGT+RTLEW++D EF LV AP IFGA       P+
Sbjct  136   WIGYVAVATDEGKLALGRRDILIAWRGTVRTLEWINDFEFSLVDAPLIFGAANDGDDQPR  195

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH G+Y++Y+S++P S FN  SAR+QVL EVKRLVE YKNEE SITV GHSLGAA+ TLN
Sbjct  196   VHLGWYSIYTSDDPRSPFNKTSARNQVLEEVKRLVEEYKNEETSITVTGHSLGAAVCTLN  255

Query  728   AIDIAKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFK---NAYDATPNLHLMRIRNVPD  564
             A DI  N  N  +    KS PVT F +ASPR GD  F+   ++     NL+++R+RN  D
Sbjct  256   ASDIVVNKYNKPNDMPDKSCPVTVFAFASPRVGDDKFRKILSSLKTNNNLNILRVRNAKD  315

Query  563   IVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             IVP+     P I Y++VGVEL ID  KS Y+K PG+L+SWH LE YLHG+AGT+G+    
Sbjct  316   IVPKY----PFIDYSEVGVELVIDTDKSSYLKSPGNLSSWHSLEGYLHGVAGTQGS--RG  369

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             GF+L V+R ++LVNK +D LK+EYC+P +WW E+NK MVQ DDGSW+L+D+E+
Sbjct  370   GFKLEVNRSLALVNKHMDGLKDEYCVPVSWWCERNKSMVQSDDGSWELIDHED  422



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 160/285 (56%), Positives = 212/285 (74%), Gaps = 6/285 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG   LGRRD+++ WRGT+R+LEW+ D EF LV AP+IFG  +  ++H+G
Sbjct  157   WIGYVAVGTDEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQG  216

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S F   S R+QV+GEVKRLVE YKNEE+SI   GHSLGAALATLNA D+
Sbjct  217   WYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDM  276

Query  716   AKNGTN-TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             A N  N   + G+++PVT FV+ASPR GD +FK A+    ++H++R++N  D+VP     
Sbjct  277   AANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPNY---  333

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              P+IGY++VG EL ID  KS Y+K PG L+SWH LE YLHG+AGT+G     GF L ++R
Sbjct  334   -PIIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKN-KGGFRLEIER  391

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DI+L+NK LD LK+EY +P  W   +NKGMVQQ DGSWKL+D+EE
Sbjct  392   DIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHEE  436



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 214/287 (75%), Gaps = 9/287 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  900
             WMGYVAVATDEGK  LGRRDI++ WRGT+RTLEW++D EF LV A +I G  A  P+VH+
Sbjct  144   WMGYVAVATDEGKAELGRRDIVIAWRGTVRTLEWINDFEFRLVSASKILGDKAGDPKVHQ  203

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+SE+  S FN  SAR QVL E++RLVE YK+EE+SIT+ GHSLGAA+ATLNA+D
Sbjct  204   GWYSIYTSEDQRSRFNKTSARQQVLSEIERLVEQYKDEEISITITGHSLGAAIATLNAVD  263

Query  719   IAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  N  N       K  PVT  ++ASPR GD +F+N + +  +L  +R+RN  DIVP   
Sbjct  264   IVSNRYNKPKHHPHKPCPVTAIIFASPRVGDSDFRNLFSSYKDLRALRVRNALDIVPNY-  322

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                P+I Y+DVG EL ID +KS Y+K PG+++SWH LE YLHG+AGT+G+    GF+L V
Sbjct  323   ---PIIEYSDVGEELKIDTSKSSYLKSPGNISSWHNLEGYLHGLAGTQGSK--GGFKLEV  377

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              RDI+LVNK +D LK+EY +P +W  EKNKGMVQ +DGSWKL+D+EE
Sbjct  378   HRDIALVNKTMDGLKDEYLVPESWRCEKNKGMVQLEDGSWKLIDHEE  424



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 211/289 (73%), Gaps = 10/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK  LGRRDI++ WRGT+R+LEWV+DL F +V A  I G  A  +VH+G
Sbjct  150   WIGYVAVATDEGKALLGRRDIVIAWRGTVRSLEWVNDLHFSMVSASNILGEEADAKVHQG  209

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SAR+QVL EV RLVE YK+EE+SIT+ GHSLGAA+ATL+A+DI
Sbjct  210   WYSIYTSDDSHSPFNKTSARNQVLAEVSRLVEQYKDEEISITITGHSLGAAIATLSAVDI  269

Query  716   AKNGTN-----TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
               NG N     T +   S PVT FV+A PR GD NFK  + +  NL ++R+ N  DIVP 
Sbjct  270   VANGINKPKDQTANKLSSCPVTAFVFACPRVGDSNFKKLFSSYNNLRVLRVSNALDIVPN  329

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              P    L+GY++VG EL ID  KS Y+K PG + SWH LE YLHG+AGT+G+    GF+L
Sbjct  330   YP---FLVGYSEVGEELGIDSRKSSYLKSPGSVLSWHNLEGYLHGVAGTQGSK--GGFKL  384

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V RDI+LVNK  D LKEEY +P +W  EK+KGMVQ +DGSW+L+D+EE
Sbjct  385   EVKRDIALVNKSHDALKEEYLVPVSWRCEKDKGMVQMEDGSWQLMDHEE  433



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   333 bits (854),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 164/288 (57%), Positives = 207/288 (72%), Gaps = 8/288 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK  LGRRDI+V WRGT+  LEWV D  F LV A EI G    P+VH+G
Sbjct  114   WMGYVAVATDEGKAVLGRRDIVVAWRGTVEDLEWVDDFSFNLVSASEILGGTNDPKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S++P S FN  SARDQVL EV+RLVEL+K+EE+SIT+ GHSLGAAL TLNA DI
Sbjct  174   WLSIYTSDDPRSPFNKASARDQVLSEVRRLVELFKDEEISITITGHSLGAALGTLNAADI  233

Query  716   AKNGTNT--TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               +G N       ++  VT  ++ASPR GD NF+  +    NL L+R+RN  D+VP    
Sbjct  234   VAHGLNKPRNHPHRACLVTAILFASPRVGDDNFQEVFSGLENLRLLRVRNALDVVPNY--  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  KS ++K   + + WH LE YLHG+AGT+GA    GF+L V 
Sbjct  292   --PLLGYSDVGEELAIDFRKSKFIKASANPSLWHNLECYLHGVAGTQGAK--GGFKLEVG  347

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGY  219
             RDI+LVNK  D LK+E+ +P +WW EKNKGMVQ+DDG+WKL+D+EE Y
Sbjct  348   RDIALVNKTTDALKDEHLVPVSWWCEKNKGMVQRDDGTWKLMDHEEDY  395



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 213/289 (74%), Gaps = 11/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  903
             WMGYVAVATDEGK  LGRRDI++ WRG+++TLEWV+DLEF  V A +IFG   +  P+VH
Sbjct  132   WMGYVAVATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVH  191

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             +G+Y++Y+S++  S FN  SARDQV+ E++RLV+ YKNEE+SITV GHSLGAALATLNA+
Sbjct  192   QGWYSIYTSDDQRSPFNKTSARDQVIREIRRLVDQYKNEEISITVTGHSLGAALATLNAV  251

Query  722   DIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DIA NG N       K+ PVT  + ASPR GD  FK       +L ++RIRN  D+VP+ 
Sbjct  252   DIAANGFNKPGGQPNKACPVTAIILASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKY  311

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKP-PGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                 PLIGY DVG ELTID TKS Y+K    + + WH LE YLHG+AGT+G     GF+L
Sbjct  312   ----PLIGYEDVGKELTIDTTKSKYLKNGTANFSGWHNLEVYLHGVAGTQGRK--GGFQL  365

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK +D LK++Y +P +W I KNKGMVQQ DGSWKL+D+E+
Sbjct  366   EVNRDISLVNKTMDNLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEK  414



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   332 bits (850),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 213/289 (74%), Gaps = 11/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  903
             WMGYVAVATDEGK  LGRRDI++ WRG+++TLEWV+DLEF  V A +IFG   +  P+VH
Sbjct  132   WMGYVAVATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVH  191

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             +G+Y++Y+S++  S FN  SARDQV+ E++RLV+ YKNEE+SITV GHSLGAALATLNA+
Sbjct  192   QGWYSIYTSDDQRSPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAV  251

Query  722   DIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DIA NG N       K+ PVT  ++ASPR GD  FK       +L ++RIRN  D+VP+ 
Sbjct  252   DIAANGFNKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKY  311

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKP-PGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                 PLIGY DVG ELTID T S Y+K    + + WH LE YLHG+AGT+G     GF+L
Sbjct  312   ----PLIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRK--GGFQL  365

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V+RDISLVNK +D LK++Y +P +W I KNKGMVQQ DGSWKL+D+E+
Sbjct  366   EVNRDISLVNKTMDSLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEK  414



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/287 (59%), Positives = 206/287 (72%), Gaps = 9/287 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             +MGYVAVATDEGK ALGRRDI+V WRGTIR +E   D +F LVPA  I G   + +VH+G
Sbjct  114   FMGYVAVATDEGKIALGRRDILVAWRGTIRNIELAKDFDFPLVPASMILGKDINAKVHKG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
               ++Y+S +P S +N +SAR QVL  +K LVE +K EEVSIT+ GHSLGAAL+T+NA DI
Sbjct  174   VLSIYTSSDPQSTYNKQSARVQVLEAIKSLVEEFKKEEVSITIAGHSLGAALSTMNAADI  233

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N T     KS  VT F + SPR GD NF+NA+++  +LHL+R+RN+PD+VPQVPP
Sbjct  234   VANGYNKTRGMPNKSCMVTAFAFGSPRVGDSNFRNAFESMNDLHLLRVRNIPDLVPQVPP  293

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLE-PYLHGIAGTKGAGLLDGFELVV  366
                 I Y DVG EL ID  KS Y+K  G+L  WH LE  YLH +AGT+G+    GF L V
Sbjct  294   ----IPYADVGEELLIDSRKSPYLKRIGNLEIWHNLEAAYLHAVAGTQGSK--GGFHLEV  347

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              RDISLVNK+LD +K+EY IP  WW  KNKGMVQQDDGSWKL D++ 
Sbjct  348   KRDISLVNKILDAVKDEYLIPTGWWCLKNKGMVQQDDGSWKLEDHDR  394



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 206/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  145   WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  204

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y +Y S++  S F   +ARDQVL EV RL++ YK+EEVSIT+CGHSLGAALATLNA D
Sbjct  205   GWYLIYMSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAAD  264

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KSFPVT FV+ASPR GD +FK  +    +L ++R RN+PD++P  P
Sbjct  265   IVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYP  324

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG EL ID  KS Y+K PG+LA++H LE YLHG+AGT+G    D F L V
Sbjct  325   P----IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDV  380

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK+E  +PG W + KNKGMVQQDDGSW LLD+E
Sbjct  381   KRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWNLLDHE  426



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 209/290 (72%), Gaps = 8/290 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK ALGRRDI++ WRG+++ LEW+ D  F++V A +I G    P VH+G
Sbjct  113   WMGYVAVATDEGKAALGRRDIVIAWRGSLQALEWIDDFSFIMVSASQILGRTIDPFVHQG  172

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S++P + FN  SARDQVL EV+RLVE YK+EE+SIT+ GHSLGAAL TLNA+DI
Sbjct  173   WLSIYTSDDPRAPFNRTSARDQVLSEVRRLVEEYKDEEISITITGHSLGAALGTLNAVDI  232

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+  VT F++ASPR GD  F+    +  NL L+R+RN  DIVP    
Sbjct  233   VANGFNRPKDRPDKACLVTAFLFASPRVGDDKFQKLLSSLENLRLLRVRNALDIVPNY--  290

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PLIGY+DVG EL ID  KS ++K P +L+  H LE YLHG+AGT+G+    GF+L V+
Sbjct  291   --PLIGYSDVGQELVIDTQKSTFLKSPANLSVSHNLEGYLHGVAGTQGSK--GGFKLEVE  346

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVP  213
             RDI+LVNK +D L++EY +  +W  EKNKGMVQ  DGSWKL+D+EE Y P
Sbjct  347   RDIALVNKSIDGLRDEYLVLASWRCEKNKGMVQGADGSWKLMDHEEDYYP  396



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 206/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWVSD +F LV A +IFG      Q+H+
Sbjct  146   WMGYVAVTDDQGTAILGRRDIVVAWRGSVQPLEWVSDFDFSLVNANKIFGDNNDHVQIHQ  205

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S FN  +ARDQVL E+ RL+E YK EEVSITVCGHSLGAALATLNA D
Sbjct  206   GWYSIYMSQDERSHFNKANARDQVLREIGRLLEKYKEEEVSITVCGHSLGAALATLNATD  265

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +F   +    +L ++RIRN+PD+VP  P
Sbjct  266   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFMKLFYGLQDLRVLRIRNLPDVVPIYP  325

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY +VG EL ID  KS Y+K PG+ A++H LE YLHG+AGT+G    D F L V
Sbjct  326   P----LGYAEVGDELPIDTRKSQYMKSPGNFATFHCLEAYLHGVAGTQGTAKSDLFRLDV  381

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK+E  IPG+W + KNKGMVQQDDGSWKLLD+E
Sbjct  382   KRDIGLVNKSVDGLKDECMIPGHWRVLKNKGMVQQDDGSWKLLDHE  427



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 208/286 (73%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  127   WMGYVAVTDDQGTAVLGRRDIVVSWRGSVQPLEWVNDFEFGLVDAKKIFGEKNDKVQIHQ  186

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S FN  +ARDQVL E+ RL+E YK+EEVSI+VCGHSLGAALATLNA D
Sbjct  187   GWYSIYMSDDQRSPFNKANARDQVLREIGRLLEKYKDEEVSISVCGHSLGAALATLNAAD  246

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N       KS PVT FV+ASPR GD +FK  +    +L ++RIRN+PD+VP  P
Sbjct  247   IVANGYNRPKNRPDKSCPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRIRNLPDVVPIYP  306

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY++VG EL ID  KS Y+K PG+L+++H LE YLHG+AGT+G    D F L V
Sbjct  307   P----LGYSEVGDELQIDNRKSPYMKSPGNLSTFHNLEGYLHGVAGTQGTTKADLFRLDV  362

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK+EY +PG W + KNKGMVQ DDGSWKLLD+E
Sbjct  363   KRDIGLVNKSVDGLKDEYMVPGYWRVLKNKGMVQLDDGSWKLLDHE  408



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 206/287 (72%), Gaps = 7/287 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WM YVAVATDEGK ALGRRDI++ WRGT+++LEWVSDL+F LV A  I      P+VH+G
Sbjct  154   WMAYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVSDLQFNLVSASNILSEEGDPKVHQG  213

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S +  S FN  SAR QV+ EV+RLVE YK+EE+SIT+ GHSLGAA+ATL+AIDI
Sbjct  214   WYSIYTSNDSHSPFNKTSARHQVIEEVRRLVEQYKDEEISITITGHSLGAAIATLSAIDI  273

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+ PVT  ++ASPR G+ NF+  +    +L  +R+RN  D+VP  P 
Sbjct  274   VANGLNRPKDLPNKACPVTAILFASPRVGNSNFEKVFSGYKDLRALRVRNALDVVPNYP-  332

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                  GY+DVG ELTID  KS Y+K PG +ASWH +E YLHG+AGT+G+    GF+L V 
Sbjct  333   --IFFGYSDVGEELTIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSK--RGFKLEVK  388

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEG  222
             RDI+LVNK  D LKEEY IP +W  EKNK M Q +DGSW L+D+E+G
Sbjct  389   RDIALVNKSTDALKEEYLIPASWRCEKNKCMTQLEDGSWVLMDHEDG  435



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 207/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  150   WMGYVAVTDDQGTALLGRRDIVVVWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  209

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S F   +AR+QVL EV RL++ YK+EEVSIT+CGHSLGAALATLNA D
Sbjct  210   GWYSIYMSQDDRSPFTKANAREQVLREVGRLLDRYKDEEVSITICGHSLGAALATLNAAD  269

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   K+ PVT FV+ASPR GD +FK  +    NL ++R RN+PD++P  P
Sbjct  270   IVANGYNRPKSRPDKACPVTAFVFASPRVGDSDFKKLFYGLENLRVLRTRNLPDVIPIYP  329

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG EL ID  KS Y+K PG+LAS+H LE YLHG+AGT+G    D F L V
Sbjct  330   P----IGYSEVGDELPIDTRKSQYMKSPGNLASYHCLEAYLHGVAGTQGTAKADIFRLDV  385

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK+E  +PG W + KNKGMVQQDDGSWKLLD+E
Sbjct  386   KRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWKLLDHE  431



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 208/286 (73%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI++ WRG+++ LEWVSD +F LV A +IFG   +  Q+H+
Sbjct  145   WMGYVAVTDDQGTAVLGRRDIVIAWRGSVQPLEWVSDFDFSLVNAKKIFGEKYNQVQIHQ  204

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G++++Y SE+  S FN  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGAALATLNA D
Sbjct  205   GWHSIYMSEDERSHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATD  264

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +  GKS PVT FV+ASPR G+  +K  +    ++ ++R+RN+PD+VP  P
Sbjct  265   IVANGYNRPKSRLGKSCPVTAFVFASPRVGNSEYKKLFSGLEDIRVLRVRNLPDVVPIYP  324

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY +VG E  ID  KS Y+K PG+ A++H LE YLHG+AGT+G    D F L V
Sbjct  325   P----LGYAEVGDEFPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSADLFRLDV  380

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK++Y IPG+W + KNKGMVQQDDGSW LLD+E
Sbjct  381   KRDIGLVNKSVDGLKDQYMIPGHWRVLKNKGMVQQDDGSWVLLDHE  426



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 206/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  145   WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  204

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S F   +ARDQVL EV RL++ YK+EEVSIT+CGHSLGAALATLNA D
Sbjct  205   GWYSIYMSQDERSPFTKVNARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAAD  264

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KSFPVT FV+ASPR GD +FK  +    +L ++R RN+PD++P  P
Sbjct  265   IVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYP  324

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG E+ ID  KS Y+K PG+LA++H LE YLHG+AGT+G    D F L V
Sbjct  325   P----IGYSEVGDEIPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDV  380

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RD+ LVNK +D L  E  +PG W + KNKGMVQQDDGSWKLLD+E
Sbjct  381   KRDVGLVNKSVDGLNVECMVPGKWRVLKNKGMVQQDDGSWKLLDHE  426



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 211/292 (72%), Gaps = 12/292 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI+V WRGTI+  EWV D  F L PAPEIFG  AS ++H G
Sbjct  113   WIGYVAVATDEGKEALGRRDIVVAWRGTIQAAEWVKDFHFHLDPAPEIFGDAASAELHHG  172

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY+LY+S+NP S F   SAR+QVL EV RLVE YKNEE+SI+V GHSLGAALATLNA+DI
Sbjct  173   FYSLYTSKNPGSKFTNTSARNQVLEEVGRLVEEYKNEEISISVTGHSLGAALATLNAVDI  232

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             A  G N       K+ PVT F YASPR GD +F++A++   +L  +RIRN  DIV    P
Sbjct  233   AAQGLNKPKGQPQKACPVTAFAYASPRVGDSSFEDAFNGYKDLRALRIRNETDIV----P  288

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
              + L+G++DVG EL ID  KS ++K      S H LE YLHG+AGT+G     GF L V+
Sbjct  289   VSLLLGFSDVGEELLIDTRKSKFLKEG---VSAHNLEAYLHGVAGTQGKK--GGFNLEVN  343

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD-NEEGYVPL  210
             RDI+L+NK +D LK+EY +P  W +++NKGMVQQ DG+WKL++ NE+G+  +
Sbjct  344   RDIALLNKGMDALKDEYLVPVEWRVQENKGMVQQLDGTWKLIEKNEDGFQSI  395



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 202/286 (71%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATD GK ALGRRDI+V WRGTI+  EWV D  F L  APEIFG  +S QVH G
Sbjct  114   WIGYVAVATDAGKEALGRRDIVVAWRGTIQAAEWVKDFHFHLDLAPEIFGGDSSAQVHHG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             FY+LY+S NP S F   SAR+QVLGEV RLVE Y  KNEE+SI+V GHSLGAALATLNA+
Sbjct  174   FYSLYTSSNPGSKFTDTSARNQVLGEVGRLVEEYTSKNEEISISVTGHSLGAALATLNAV  233

Query  722   DIAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DIA  G N       K+FPVT F YA PR GD +F+  ++   +L  +RIRNV DIV   
Sbjct  234   DIAAQGLNIPKNQPQKAFPVTAFAYACPRVGDSSFEETFNGYKDLRSLRIRNVTDIV---  290

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
              P TP +G++DVG EL ID  KS Y+K      S H LE YLHG+AGT+G     GF L 
Sbjct  291   -PITPFLGFSDVGEELVIDTRKSKYLKSG---VSAHNLEAYLHGVAGTQGEK--GGFNLE  344

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDN  231
             V+RDI+LVNK +D LK+EY +P  W +++NKGMVQQ DGSWK++D 
Sbjct  345   VNRDIALVNKSMDALKDEYLVPVAWRVQENKGMVQQSDGSWKIVDQ  390



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 209/286 (73%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             W+GYVAV  D+G  ALGRRDI+V WRG+++ LEWV+D EF  V A +IFG      Q+H+
Sbjct  144   WIGYVAVTDDQGTAALGRRDIVVAWRGSVQPLEWVNDFEFGFVNAKKIFGEKNDQVQIHQ  203

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S FN  +ARDQVL E+ RL+E YK+E++SI++CGH LGAA+ATLNA D
Sbjct  204   GWYSIYMSKDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHILGAAIATLNAAD  263

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +FK  +    +L ++R+RN+PD+VP  P
Sbjct  264   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVPIYP  323

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY +VG EL ID  KS Y+K PGDLA++H LE YLHG+AGT+G    D F L V
Sbjct  324   P----LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDV  379

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK+EY +PG+W I KNKGMVQQ+DGSWKL+D+E
Sbjct  380   KRDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQNDGSWKLMDHE  425



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   326 bits (836),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 208/288 (72%), Gaps = 11/288 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG---AGASPQV  906
             ++GYVAVA DE   ALGRRDI++ WRGTI++LEWV+DL+FL V A  I G       P+V
Sbjct  118   FIGYVAVAEDESVAALGRRDIVISWRGTIQSLEWVNDLQFLQVSASSIVGKSDGNDDPKV  177

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             H+G+Y++Y+S++P S FN  SAR QVL E++ LVE YK+EE+SIT+ GHSLGAALATLNA
Sbjct  178   HQGWYSVYTSDDPKSPFNKTSARYQVLQEIENLVEQYKDEEISITITGHSLGAALATLNA  237

Query  725   IDIAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             IDI  N  N    +  K   VT  ++ASPR GD NFK  +    NL L+R+ N  DIVP 
Sbjct  238   IDIVVNNKNKPKDNPQKQCLVTAIIFASPRVGDSNFKKIFPKYDNLKLLRVHNTLDIVPN  297

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                  PL+GY+DVG EL ID TKS Y+K PG  ++WH +E YLHG+AGT+G+   +GF+L
Sbjct  298   Y----PLLGYSDVGQELLIDTTKSPYLKVPGTFSNWHNMEAYLHGVAGTQGSK--NGFKL  351

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             VVDRDI+LVNK +D LK+EY IP  WW  KNKGMVQQ DGSW L+DNE
Sbjct  352   VVDRDIALVNKSMDNLKDEYLIPVAWWSLKNKGMVQQSDGSWLLMDNE  399



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 206/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  ++G   LGRRDI+V WRG+++ LEWV+D EF LV A  IFG      Q+H+
Sbjct  143   WMGYVAVTDNQGTAVLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQVQIHQ  202

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y SE+  S FN  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGAALATLNA D
Sbjct  203   GWYSIYMSEDERSPFNKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNATD  262

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +++  +    +L ++R++N+PDIVP  P
Sbjct  263   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGFEDLRVLRVKNLPDIVPIYP  322

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY +VG EL+ID  KS Y+K PG+ A++H LE YLHG+AGT+G    D F L V
Sbjct  323   P----LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKNDIFRLDV  378

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D L +E  +PGNW + KNKGMVQQDDGSW LLD+E
Sbjct  379   KRDIGLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVLLDHE  424



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  128   WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  187

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S F   +ARDQVL E+ RL+E YK+EEVSIT+CGHSLGAALATLNA D
Sbjct  188   GWYSIYMSQDERSPFTKANARDQVLRELGRLLEKYKDEEVSITICGHSLGAALATLNATD  247

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +FK       ++ ++R RN+PD++P  P
Sbjct  248   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLLSILEDMRVLRTRNLPDVIPIYP  307

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG EL ID  KS Y+K PG+LA++H LE YLHG+AGT+G    D F L V
Sbjct  308   P----IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDV  363

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              R I LVNK +D LK+E  +PG W + KNKGMVQQDDGSWKLLD+E
Sbjct  364   KRAIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWKLLDHE  409



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 204/281 (73%), Gaps = 7/281 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK ALGRRDI++ WRGT+++LEWV+DL+F LV A ++ G    P+VH G
Sbjct  145   WMGYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSASKLLGEDGDPKVHEG  204

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SAR QV+ EV+RLVE +K+EE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  205   WYSIYTSDDSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDI  264

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+ PVT  V+ASPR GD NF+  +    ++  +R+RN  D+VP  P 
Sbjct  265   VANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRALRVRNALDVVPNYP-  323

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL GY++VG EL ID  KS Y+K PG LASWH LE YLHG+AGT+G+    GF+L V 
Sbjct  324   -IPL-GYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSK--GGFKLEVK  379

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             RDI+LVNK  D LKEEY IP +W  EKNK M Q DDGSW L
Sbjct  380   RDIALVNKSADDLKEEYLIPASWRCEKNKCMTQLDDGSWVL  420



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   324 bits (831),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WM Y+AVATDEGK  LGRRDI++ WRGT+++LEWV+DL+F LV A  I G    P+VH+G
Sbjct  145   WMAYIAVATDEGKAVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQG  204

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SAR QV+ EV RL+E YK+EE+SIT+ GHSLGAA+ATL+AIDI
Sbjct  205   WYSIYTSDDSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDI  264

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+ PVT  V+ASPR G+ NF+  +    +L  +RIRN  D+VP  P 
Sbjct  265   VANGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP-  323

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                L+GY+DVG EL ID  KS Y+K PG + SWH +E YLHG+AGT+G+    GF+L V 
Sbjct  324   --ILLGYSDVGEELKIDTQKSKYLKSPGGVVSWHNMEGYLHGVAGTQGSK--GGFKLEVK  379

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK +D LKEEY IP +W  EKNK M Q +DGSW L D+EE
Sbjct  380   RDIALVNKSVDALKEEYLIPASWRCEKNKCMTQLEDGSWVLKDHEE  425



>emb|CDY53993.1| BnaA03g58180D [Brassica napus]
Length=351

 Score =   321 bits (823),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A  IFG      Q+H+
Sbjct  61    WMGYVAVTDDQGTAVLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAQNIFGEKNDQVQIHQ  120

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
              +Y++Y SE+  S F+  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGAALATLNA D
Sbjct  121   DWYSIYMSEDERSPFSKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNASD  180

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +++  +    +L ++R++N+PD+VP  P
Sbjct  181   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGLEDLRVLRVKNLPDVVPIYP  240

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY +VG EL+ID  KS Y+K PG+ A++H LE YLHG+AGT+G    D F L V
Sbjct  241   P----LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKSDIFRLDV  296

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D L +E  +PGNW + KNKGMVQQDDGSW LLD+E
Sbjct  297   KRDIGLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVLLDHE  342



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 202/285 (71%), Gaps = 8/285 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK  LGRRDI++ WRG+++ LEW++D  F+LV A  I G    P VH+G
Sbjct  114   WMGYVAVATDEGKAVLGRRDILIAWRGSVQALEWINDFNFILVSASGILGTKNDPNVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S++P SA+N  SAR QVL EVKRLVE +K+EE+SITV GHSLGAAL TLNA+DI
Sbjct  174   WLSIYTSDDPRSAYNTTSARQQVLEEVKRLVEEFKDEEISITVTGHSLGAALGTLNAVDI  233

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+  VT F++  PR GD NF+    +  NL L+R+RN  D+VP    
Sbjct  234   VANGVNKPKDHPEKACLVTAFLFGCPRVGDANFQKVVSSLENLRLLRVRNSLDLVPNY--  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL+GY+DVG EL ID  +S ++K   D  +WH +E YLHG+AGT+G     GF+L V 
Sbjct  292   --PLVGYSDVGQELVIDTRQSSFLKSSVDPGNWHNMEGYLHGVAGTQGTK--GGFKLEVG  347

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDISLVNK  D LK+EY +P  WW EKNKGM+Q +DGSWKL+D+E
Sbjct  348   RDISLVNKSTDALKDEYLVPMMWWCEKNKGMIQGEDGSWKLVDHE  392



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 210/286 (73%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+  +P VH
Sbjct  117   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSAINPCVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y++ +P S +N +SAR QVL EVKR+ +LYKNEE SIT+ GHSLGAALAT+NAI
Sbjct  177   GGWLSVYTTADPGSQYNQESARHQVLNEVKRIQDLYKNEETSITITGHSLGAALATINAI  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     KS PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP+ P 
Sbjct  237   DIVSNGYN-----KSCPVSAFVFGSPRVGNPDFQKAFDSAADLRLLRVRNSPDVVPKWPK  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY DVG EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GF+L+VD
Sbjct  292   ----LGYNDVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSS--GGFKLLVD  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  346   RDIALVNKHEDALKNEYSIPTSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 202/294 (69%), Gaps = 8/294 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVATD G   LGRRD++V WRGT R +EW +DL+  LVPA  + G G   + P V
Sbjct  134   WMGYVAVATDAGAARLGRRDVVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAV  193

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S N  S FN +SAR+QVL E+KRL++ YK E  SIT+ GHSLGAAL+TL A
Sbjct  194   HRGFLSVYASSNSTSRFNKQSAREQVLAEIKRLLDAYKGENCSITITGHSLGAALSTLTA  253

Query  725   IDIAKNGTNTT-SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             IDI  NG N   S   + PV   V+ SPR GD   K A+D+TP   L+R+RN PDIVP +
Sbjct  254   IDIVSNGVNVRGSTNDTVPVAAIVFGSPRVGDEQLKKAFDSTPGARLLRVRNAPDIVPTI  313

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPG-DLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PA     Y DVGVEL +D  KS ++K PG   A+WH LE YLHG+AGT+GAG   GF L
Sbjct  314   LPAA---FYKDVGVELLVDTRKSPHLKQPGPGPAAWHNLECYLHGVAGTQGAGDGAGFGL  370

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
             VVDRD++LVNK +D L +EY +P  WW+E NKGMV+   G W L D+EEG + +
Sbjct  371   VVDRDLALVNKEVDALDDEYPVPAGWWVEGNKGMVKDGSGRWVLQDHEEGNLAM  424



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 203/286 (71%), Gaps = 6/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GY+AVATD+GK ALGRRDI + WRGTI+ LEW+ D +F L  A +I G     QVH+G
Sbjct  115   WIGYIAVATDQGKQALGRRDITIAWRGTIQPLEWIKDFDFPLTSASDIVGVEKDAQVHQG  174

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F ++Y+S+NP S FN  S R+Q+   +K LV+ Y+NE++S+TV GHSLGAALATL+A+DI
Sbjct  175   FLSIYTSDNPQSQFNKTSVREQIFETLKELVDKYENEDISVTVTGHSLGAALATLSAVDI  234

Query  716   AKNGTNTT--SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N +   A K+ PVT FV+A PRTGD  F+   D+  +L ++R+ N PDI+P+VPP
Sbjct  235   VANGLNRSDDQASKACPVTAFVFACPRTGDLAFREVSDSFSDLRILRVTNTPDIIPKVPP  294

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 IGY DVG  L +D  KS Y+KP G   +WH LE Y+H IAGT+G      F L V+
Sbjct  295   LA--IGYRDVGQNLELDSRKSTYLKPTGAFITWHNLEAYMHCIAGTQGGK--PDFHLEVN  350

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK L+ LK+ Y +P  WW EK+KGMVQQ+DGSWKL D+E+
Sbjct  351   RDIALVNKKLNSLKDIYLVPSAWWQEKHKGMVQQEDGSWKLDDHED  396



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/281 (57%), Positives = 203/281 (72%), Gaps = 7/281 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK ALGRRDI++ WRGT+++LEWV+DL+F LV   ++ G    P+VH G
Sbjct  116   WMGYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSVSKLLGEDGDPKVHEG  175

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SAR QV+ EV+RLVE +K+EE+SIT+ GHSLGAA+ATLNA+DI
Sbjct  176   WYSIYTSDDSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDI  235

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+ PVT  V+ASPR GD NF+  +    ++  +R+RN  D+VP  P 
Sbjct  236   VANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRTLRVRNALDVVPNYP-  294

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL GY++VG EL ID  KS Y+K PG LASWH LE YLHG+AGT+G+    GF+L V 
Sbjct  295   -IPL-GYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSK--GGFKLEVK  350

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             RDI+LVNK  D L+EEY IP +W  EKNK M Q DDGSW L
Sbjct  351   RDIALVNKSADDLEEEYLIPASWRCEKNKCMTQLDDGSWVL  391



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   321 bits (822),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 208/286 (73%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+   P VH
Sbjct  117   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P+S +N +SAR QVL E+KRL ++Y++EE SIT+ GHSLGAALAT+NA 
Sbjct  177   GGWLSVYTSADPESQYNKQSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINAT  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     KS PV+ FV+ SPR G+ +F+ A+D+ P+L L+RIRN PD+VP  P 
Sbjct  237   DIVSNGYN-----KSCPVSAFVFGSPRVGNPDFQKAFDSAPDLRLLRIRNSPDVVPNWPK  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+D G EL ID  KS Y+K PG+  +WH +E Y+HG+AGT+G+    GF+L +D
Sbjct  292   ----LGYSDAGTELMIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSN--GGFKLEID  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  346   RDIALVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHED  391



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 206/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WM Y+AVATDEGK  LGRRDI++ WRGT+++LEWV+DL+F LV A  I G    P+VH+G
Sbjct  145   WMAYIAVATDEGKAVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQG  204

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y+S++  S FN  SAR QV+ EV RL+E YK+EE+SIT+ GHSLGAA+ATL+AIDI
Sbjct  205   WYSIYTSDDSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDI  264

Query  716   AKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N       K+ PVT  V+ASPR G+ NF+  +    +L  +RIRN  D+VP  P 
Sbjct  265   VANGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP-  323

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                L+GY+DVG EL ID  KS Y+K PG +ASWH +E YLHG+AGT+G+    GF+L V 
Sbjct  324   --ILLGYSDVGEELKIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSK--GGFKLEVK  379

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK +D LKEEY IP +W  E+NK M Q +DGSW L D+E+
Sbjct  380   RDIALVNKSVDALKEEYLIPASWRCEENKCMTQLEDGSWVLKDHED  425



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 210/286 (73%), Gaps = 9/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  900
             W+GYVAVATD+GK  LGRRDI+V WRGTI+TLEW++D +F  + A +IFG  G    VH+
Sbjct  137   WIGYVAVATDQGKQVLGRRDIVVAWRGTIQTLEWINDFDFGTINAKKIFGDNGDGVGVHQ  196

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+SE+  S FN  SARDQVL E++RLVE YK+EE+SIT+CGHSLGAAL+TL+A D
Sbjct  197   GWYSIYTSEDERSPFNKASARDQVLREIRRLVEKYKDEEISITICGHSLGAALSTLSAAD  256

Query  719   IAKNGTNTTS--AGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N       KS PVT F +ASPR GD +FK  +    +L  +RIRN+PD+VP  P
Sbjct  257   IVANGYNRPKNLPDKSCPVTVFAFASPRVGDSDFKRLFSGLDDLRALRIRNLPDVVPIYP  316

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG EL +D  KS Y+K PG+   +H +E YLHGIAGT+G      F+L +
Sbjct  317   P----IGYSEVGEELVMDTRKSPYLKSPGNPTLFHTMEVYLHGIAGTRGTK--SDFKLEI  370

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +RDI+LVNK +D LK+E+ +PG+W   KNKGM QQ+DGSWKL+D+E
Sbjct  371   ERDIALVNKPIDGLKDEFMVPGSWRALKNKGMAQQNDGSWKLMDHE  416



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 207/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  LVPA EI   G+   P+VH
Sbjct  117   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSANDPRVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL EV+RL +LYK EE SIT+ GHSLGAALAT++A 
Sbjct  177   GGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISAT  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     K+ PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP  P 
Sbjct  237   DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+D G EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GFEL VD
Sbjct  292   ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LKEEY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  346   RDIALVNKHEDALKEEYSIPPSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 208/286 (73%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+   P VH
Sbjct  120   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVH  179

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P+S +N +SAR QVL E+KRL ++Y++EE SIT+ GHSLGAALAT++A 
Sbjct  180   GGWLSVYTSADPESQYNKQSARYQVLNEIKRLQDVYEHEETSITITGHSLGAALATISAT  239

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     KS PV+ FV+ SPR G+ +F+ A+D+ P+L L+RIRN PD+VP  P 
Sbjct  240   DIVSNGYN-----KSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWPK  294

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+D G EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GF+L +D
Sbjct  295   ----LGYSDAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSN--GGFKLEID  348

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDISLVNK  D LK EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  349   RDISLVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHED  394



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 206/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  L PA EI   G+   P+VH
Sbjct  117   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLAPASEIVRPGSANDPRVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL EVKRL +LYK EE SIT+ GHSLGAALAT++A 
Sbjct  177   GGWLSVYTSTDPGSRYNEQSARYQVLDEVKRLQDLYKQEETSITITGHSLGAALATISAT  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     K+ PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP  P 
Sbjct  237   DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFRKAFDSAEDLRLLRVRNSPDVVPNWPK  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+D G EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GFEL VD
Sbjct  292   ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK+EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  346   RDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 208/286 (73%), Gaps = 12/286 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR +EWV DL+  LVPA EI   G+ A+P VH
Sbjct  117   WMGFVAVATDEGKELLGRRDVVVAWRGTIRMVEWVDDLDISLVPASEIVLPGSAANPCVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL EVKR+ +LYK EE SIT+ GHSLGAALAT+NA 
Sbjct  177   GGWLSVYTSADPGSQYNKESARHQVLNEVKRIQDLYKPEETSITITGHSLGAALATINAT  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N +      PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP+ P 
Sbjct  237   DIVSNGYNRSCC----PVSAFVFGSPRVGNLDFQKAFDSAADLRLLRVRNSPDVVPKWPK  292

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+DVG EL ID  +S Y+K PG+  +WH +E Y+HG+AG +G+    GFEL+VD
Sbjct  293   ----LGYSDVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGAQGSS--GGFELLVD  346

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RD++LVNK  D L+ E+ +P +WW+ +NKGMV+  DG W L D+EE
Sbjct  347   RDVALVNKHEDALRNEFAVPPSWWVVQNKGMVKGKDGRWHLADHEE  392



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 206/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  L PA EI   G+   P+VH
Sbjct  117   WMGFVAVATDEGKEVLGRRDVMVAWRGTIRVLEWMDDLDISLAPASEIVRPGSADDPRVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL EV+RL +LYK EE SIT+ GHSLGAALAT++A 
Sbjct  177   GGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISAT  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     K+ PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP  P 
Sbjct  237   DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+D G EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GFEL VD
Sbjct  292   ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK+EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  346   RDIALVNKHEDALKKEYSIPSSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 198/285 (69%), Gaps = 8/285 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GY+AVATDEGK ALGRRDI++ WRGTI+ LEWV+D EF LVPA ++FGA    +VH+G
Sbjct  114   WIGYIAVATDEGKAALGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLFGASNDSKVHKG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S++  S FN  SAR QVL E+++L+E +++E++SIT+ GHSLGAAL TLNA DI
Sbjct  174   WLSIYTSQDARSPFNTNSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDI  233

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N       K  PVT F++ SP  GD NF+  +++   LHL+R RN  DIVP    
Sbjct  234   IANQINRGKKQPQKPCPVTVFLFGSPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDY--  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL GY  VG EL ID  KS Y+K PG   SWH LE YLHG+AGT+G     GF L V 
Sbjct  292   --PLTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNE--GGFTLEVK  347

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDI+ VNK L+ LKEEY +P +WW  +NKGMVQ  DG WKL D+E
Sbjct  348   RDIARVNKALNALKEEYLVPESWWCAQNKGMVQDADGFWKLDDHE  392



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 199/285 (70%), Gaps = 8/285 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GY+AVATDEGK ALGRRDI++ WRGT++ LEWV+D EF LVPA ++FGA    +VH+G
Sbjct  195   WIGYIAVATDEGKAALGRRDIVIAWRGTVQALEWVNDFEFPLVPADKLFGAANDSKVHKG  254

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S++  S FNI SAR QVL E+++L+E +++E++SIT+ GHSLGAAL TLNA DI
Sbjct  255   WLSIYTSQDARSPFNINSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDI  314

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N       K  PVT F++  P  GD NF+  +++   LHL+R RN  DIVP    
Sbjct  315   IANRINKGKKQPQKPCPVTAFLFGCPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDY--  372

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL GY  VG EL ID  KS Y+K PG   SWH LE YLHG+AGT+G     GF L V 
Sbjct  373   --PLTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNE--GGFMLEVK  428

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDI+ VNK L+ LKEEY +PG+WW  +NKGMVQ  DG WKL D+E
Sbjct  429   RDIARVNKALNALKEEYLVPGSWWCAQNKGMVQDADGFWKLDDHE  473



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA-GASPQVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV D EF LV A +IFG      Q+H+
Sbjct  129   WMGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQ  188

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S F   +ARDQVL EV RL+E YK+EEVSIT+CGHSLGAALATL+A D
Sbjct  189   GWYSIYMSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATD  248

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +F+  +    ++ ++R RN+PD++P  P
Sbjct  249   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP  308

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG E  ID  KS Y+K PG+LA++H LE YLHG+AGT+G    D F L V
Sbjct  309   P----IGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDV  364

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +R I LVNK +D LK+E  +PG W + KNKGM QQDDGSW+L+D+E
Sbjct  365   ERAIGLVNKSVDGLKDECMVPGKWRVLKNKGMAQQDDGSWELVDHE  410



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/286 (54%), Positives = 207/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+  +P VH
Sbjct  117   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSATNPCVH  176

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL EVKR+ +LYK EE SI++ GHSLGAALAT+NAI
Sbjct  177   GGWLSVYTSADPGSQYNKESARHQVLNEVKRIQDLYKTEETSISITGHSLGAALATINAI  236

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     +S PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP+ P 
Sbjct  237   DIVSNGYN-----RSCPVSAFVFGSPRVGNPDFQEAFDSAADLRLLRVRNSPDVVPKWPK  291

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+DVG EL ID  +S Y+K PG+  +WH +E Y+HG+AG +G+    GFEL VD
Sbjct  292   ----LGYSDVGTELRIDTGESPYLKSPGNPLTWHDMECYMHGVAGAQGSS--GGFELAVD  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK E+ +P +WW+ +NK MV+  DG W L D+E+
Sbjct  346   RDIALVNKHEDALKNEFAVPSSWWVVQNKDMVKGKDGRWHLADHED  391



>gb|KCW89613.1| hypothetical protein EUGRSUZ_A01896, partial [Eucalyptus grandis]
Length=330

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 209/305 (69%), Gaps = 28/305 (9%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  915
             W+GYVAVATD+GK ALGRRDI++ WRGTI+ LEW SD  F L PA +I G          
Sbjct  22    WIGYVAVATDKGKAALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADT  81

Query  914   -------------PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSI  774
                          P+VH GF ++Y+S++P S FN  SAR+QVL EV+RLV+ YK+EE+SI
Sbjct  82    AADAAADDVDDIIPKVHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISI  141

Query  773   TVCGHSLGAALATLNAIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDAT  603
             TV GHSLGAALA+LNA+DIA NG N +   +S    PVT FVYASPR G+  F N  ++ 
Sbjct  142   TVAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSI  201

Query  602   PNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYL  423
             P+L L+R  N+ D+VP+VP A    GY+D G EL I+   S Y+K PG+++ WH +E YL
Sbjct  202   PSLRLLRTANLLDVVPKVPGA----GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYL  257

Query  422   HGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWK  243
             HG+AGT+G     GF+L V RD++LVNK   ++++EY +P  WW+ KN+GMVQ +DGSW+
Sbjct  258   HGLAGTQGTK--GGFKLEVKRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDGSWQ  315

Query  242   LLDNE  228
             L D+E
Sbjct  316   LEDHE  320



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 196/286 (69%), Gaps = 6/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GY+AVATD+ K  LGRRDI V WRGT++ LEW+ D +F L  A ++ G     QVH+G
Sbjct  118   WIGYIAVATDQAKEKLGRRDIAVAWRGTLQPLEWIKDFDFPLTSASDVLGGHNDAQVHQG  177

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F+++Y+S+NP S  +  SAR QVL  ++ LV  Y+NEE+S+TV GHSLGAALATL+A DI
Sbjct  178   FHSVYTSDNPQSQTSKTSARQQVLDGLRELVNKYENEEISVTVVGHSLGAALATLSAADI  237

Query  716   AKNGTNTT--SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N T   A KS PVT F +A PRTG+  FK   D+  +L ++RI N PD+VP+VPP
Sbjct  238   VANGFNRTDKQANKSCPVTAFAFACPRTGNRGFKQVCDSLEDLRILRITNTPDMVPKVPP  297

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                + GY++VG  L ID  KS Y+KP G   SWH LE YLH IAGT+G      F L   
Sbjct  298   L--IAGYSEVGENLEIDSRKSMYLKPTGGFISWHNLETYLHTIAGTQGK--RSAFRLECQ  353

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDISLVNK LD LKE+Y +PGNWW   N GM+QQ+DG WKL D ++
Sbjct  354   RDISLVNKNLDALKEKYMVPGNWWCGLNNGMIQQEDGLWKLFDRDK  399



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/287 (54%), Positives = 208/287 (72%), Gaps = 14/287 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+   P VH
Sbjct  120   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVH  179

Query  902   RGFYNLYSSENPDSAFNIKSAR-DQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
              G+ ++Y+S +P+S +N +SAR  QVL E+KRL ++Y++EE SIT+ GHSLGAALAT++A
Sbjct  180   GGWLSVYTSADPESQYNKQSARYQQVLNEIKRLQDVYEHEETSITITGHSLGAALATISA  239

Query  725   IDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
              DI  NG N     KS PV+ FV+ SPR G+ +F+ A+D+ P+L L+RIRN PD+VP  P
Sbjct  240   TDIVSNGYN-----KSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWP  294

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                  +GY+D G EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GF+L +
Sbjct  295   K----LGYSDAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSN--GGFKLEI  348

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DRDISLVNK  D LK EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  349   DRDISLVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHED  395



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 202/294 (69%), Gaps = 8/294 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATD    ALGRRD++V WRGT R +EW SDL+ +LVPA  + G G    VHRG
Sbjct  128   WMGYVAVATDGAARALGRRDVVVAWRGTKRMVEWASDLDIVLVPAAGVVGPGGRGSVHRG  187

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F +LY+S+N  S FN +SAR+QVL EV+RL++ YK+E  S+T+ GHSLGAAL+TLNAIDI
Sbjct  188   FLSLYTSKNSTSRFNKQSAREQVLTEVRRLLDTYKDENCSVTLTGHSLGAALSTLNAIDI  247

Query  716   AKNGTNT--TSAGK--SFPVTGFVYASPRTGDHNFKNAYDATPN-LHLMRIRNVPDIVPQ  552
               NG N   +S+G   + PVT  ++ SPR GD  FK A D+    + L+R+RN PDIVP 
Sbjct  248   VANGINALRSSSGDNITVPVTAILFGSPRVGDEQFKKALDSMAGAVSLLRVRNAPDIVPT  307

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
             + P TP   Y DVGVEL +D  KS Y+K P   A WH LE YLH +AGT+G G   GF L
Sbjct  308   ILP-TPF--YRDVGVELLVDTLKSPYLKTPAGPAQWHNLECYLHAVAGTQGPGDDAGFSL  364

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
              VDRD++LVNK  D LK EY +P +WW E NKGMV+   G W L D+EEG + L
Sbjct  365   EVDRDVALVNKEEDALKGEYPVPASWWAENNKGMVKNATGHWVLEDHEEGNLAL  418



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 197/281 (70%), Gaps = 8/281 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRD++V WRGT+R LEW  DLEF +VP   + G G    VHRG
Sbjct  118   WIGYVAVATDEGKAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLGDG-DAMVHRG  176

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S +P S+ N  SAR Q LGEV+RLV+ Y+ EE+SITV GHSLGAALATLNA DI
Sbjct  177   WLSMYTSSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDI  236

Query  716   AKNGTNTTSAG-KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             A NG N T+ G  + PVT F +ASPR G   FK  +DA P L L+R+RN  D+VP+    
Sbjct  237   AANGYNVTATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKY---  293

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              P++ Y DVG EL ID  +S Y++ PG   +WH LE YLHG+AGT+GA    GFEL V R
Sbjct  294   -PVVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGA--RGGFELAVAR  350

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLL  237
             D++LVNK  D L++ + +P  WW+  N+GMV+  DG W L+
Sbjct  351   DVALVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGRWSLV  391



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 200/291 (69%), Gaps = 13/291 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATD+G  ALGRRDI+V WRGT+R LEWV+D +F  V A  + G  A+      
Sbjct  117   WMGYVAVATDDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFAL  176

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y+S NPDS +N  SARDQVL EV RLV LYK+E  SITVCGHSLGA+LATLN
Sbjct  177   VHRGFLSVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLN  236

Query  728   AIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             A+D+A NG N   AG S    PVT  V+ASPR GD NFK A  + P+L  + ++N  DIV
Sbjct  237   AVDLAANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIV  296

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P  PP    +GY DV V+L I   +S Y++ PG +A+ H LE YLHG+AG +G+    GF
Sbjct  297   PTYPP----LGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSA--GGF  350

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              L VDRD++LVNK  D LK++Y +P  WW+ KNK MV+  DG + L D E+
Sbjct  351   RLEVDRDVALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYALQDFEQ  401



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 200/291 (69%), Gaps = 13/291 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATD+G  ALGRRDI+V WRGT+R LEWV+D +F  V A  + G  A+      
Sbjct  117   WMGYVAVATDDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFAL  176

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y+S NPDS +N  SARDQVL EV RLV LYK+E  SITVCGHSLGA+LATLN
Sbjct  177   VHRGFLSVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLN  236

Query  728   AIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             A+D+A NG N   AG S    PVT  V+ASPR GD NFK A  + P+L  + ++N  DIV
Sbjct  237   AVDLAANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIV  296

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P  PP    +GY DV V+L I   +S Y++ PG +A+ H LE YLHG+AG +G+    GF
Sbjct  297   PTYPP----LGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSA--GGF  350

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              L VDRD++LVNK  D LK++Y +P  WW+ KNK MV+  DG + L D E+
Sbjct  351   RLEVDRDVALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYALQDFEQ  401



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 209/305 (69%), Gaps = 28/305 (9%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  915
             W+GYVAVATD+GK ALGRRDI++ WRGTI+ LEW SD  F L PA +I G          
Sbjct  114   WIGYVAVATDKGKAALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADT  173

Query  914   -------------PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSI  774
                          P+VH GF ++Y+S++P S FN  SAR+QVL EV+RLV+ YK+EE+SI
Sbjct  174   AADAAADDVDDIIPKVHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISI  233

Query  773   TVCGHSLGAALATLNAIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDAT  603
             TV GHSLGAALA+LNA+DIA NG N +   +S    PVT FVYASPR G+  F N  ++ 
Sbjct  234   TVAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSI  293

Query  602   PNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYL  423
             P+L L+R  N+ D+VP+VP A    GY+D G EL I+   S Y+K PG+++ WH +E YL
Sbjct  294   PSLRLLRTANLLDVVPKVPGA----GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYL  349

Query  422   HGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWK  243
             HG+AGT+G     GF+L V RD++LVNK   ++++EY +P  WW+ KN+GMVQ +DGSW+
Sbjct  350   HGLAGTQGTK--GGFKLEVKRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDGSWQ  407

Query  242   LLDNE  228
             L D+E
Sbjct  408   LEDHE  412



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 158/294 (54%), Positives = 199/294 (68%), Gaps = 8/294 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVATD G   LGRRDI+V WRGT R +EW +DL+  LVPA  + G G   + P V
Sbjct  140   WMGYVAVATDAGVARLGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAV  199

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S N  S FN +SAR+QVL E++RL++ YK E  SIT+ GHSLGAAL+TL A
Sbjct  200   HRGFLSVYASRNSTSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTA  259

Query  725   IDIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             IDI  NG N       + PV   V+ SPR GD  FK A+D+TP   L+R+RN PD+VP V
Sbjct  260   IDIVANGLNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTV  319

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPG-DLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                 P   Y DVGVEL +D  KS ++K PG   A+WH LE YLHG+AGT+GAG   GF L
Sbjct  320   ---LPNAFYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSL  376

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
              VDRD++LVNK +D L ++Y +P  WW+E NKGM +   G W L D+EEG + +
Sbjct  377   EVDRDVALVNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVLQDHEEGNLAM  430



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   313 bits (802),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 196/281 (70%), Gaps = 8/281 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRD++V WRGT+R LEW  DLEF +VP   + G G    VHRG
Sbjct  118   WIGYVAVATDEGKAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLGDG-DAMVHRG  176

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S +P S+ N  SAR Q LGEV+RLV+ Y+ EE+SITV GHSLGAALATLNA DI
Sbjct  177   WLSMYTSSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDI  236

Query  716   AKNGTNTTSAG-KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             A NG N  + G  + PVT F +ASPR G   FK  +DA P L L+R+RN  D+VP+    
Sbjct  237   AANGYNVAATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKY---  293

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
              P++ Y DVG EL ID  +S Y++ PG   +WH LE YLHG+AGT+GA    GFEL V R
Sbjct  294   -PVVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGA--RGGFELAVAR  350

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLL  237
             D++LVNK  D L++ + +P  WW+  N+GMV+  DG W L+
Sbjct  351   DVALVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGRWSLV  391



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  145   WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  204

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S F   +ARDQVL EV RL++ YK+EEVSIT+CGHSLGAALATLNA D
Sbjct  205   GWYSIYMSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAAD  264

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KSFPVT FV+ASPR GD +FK  +    +L ++R RN+P     + 
Sbjct  265   IVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLP----DII  320

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P  P IGY++VG EL ID  KS Y+K PG+LA++H LE YLHG+AGT+G    D F L V
Sbjct  321   PIYPPIGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDV  380

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI LVNK +D LK+E  +PG W + KNKGMVQQDDGSW LLD+E
Sbjct  381   KRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWNLLDHE  426



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 204/286 (71%), Gaps = 12/286 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA---SPQV  906
             WMGYVAVATD G  ALGRRD++V WRGT+R +EW++DL+F LV A  + GAG    +P+V
Sbjct  112   WMGYVAVATDAGVAALGRRDVVVAWRGTVRPMEWLNDLDFTLVSAAGVLGAGGRSPAPRV  171

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRG+ ++Y++ +P S ++  SAR+Q+  E+KRL++ YK+EE SITV GHSLGAA+ATLNA
Sbjct  172   HRGWLSIYTASDPASKYSKLSAREQISDEIKRLMDKYKDEETSITVVGHSLGAAVATLNA  231

Query  725   IDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
              DI  NG N   A    PVT   +A PR GD  F+  +D  P L L+R+ N PD+VP+ P
Sbjct  232   ADIVSNGLNQHGA---CPVTAVAFACPRVGDSGFRKLFDELPGLRLLRVCNSPDVVPKYP  288

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY DVGVEL +D  +S Y+K PG+ A WH LE Y+HG+AG +G     GF+L V
Sbjct  289   P----MGYADVGVELPVDTRRSPYLKSPGNQAVWHSLECYMHGVAGAQGK--RGGFKLEV  342

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             DRD++LVNK +D LKEEY +P +W ++++KGMV+  DG WKL+D E
Sbjct  343   DRDVALVNKNVDALKEEYHVPPSWSVQRDKGMVRGADGHWKLMDYE  388



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 203/286 (71%), Gaps = 11/286 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG  ALGRRDI+V WRGTI+ LEWV+DL+F  VPA  + G+ AS      
Sbjct  150   WMGYVAVATDEGAAALGRRDIVVAWRGTIKNLEWVNDLDFTPVPAAPVLGSAASQNRFAV  209

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y+S N  S F   SA++QVL EV+RLVELYK+EEVSITVCGHSLGA+LATLN
Sbjct  210   VHRGFLSVYTSSNKSSEFTKTSAKEQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLN  269

Query  728   AIDIAKNGTNT-TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             A+D+  +G N   S+ KSFPVT  V+ASP  GD  F++A+++ P+L  + ++N  DIVP 
Sbjct  270   AVDLVSSGANKPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPM  329

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DV VELTI   +S Y++ P  + + H LE YLHG+AG +G+    GF+L
Sbjct  330   YPP----LGYVDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSA--GGFKL  383

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
              V+RD++LVNK +D L  E+ +P  WW+ K+K MV+  DG W L D
Sbjct  384   EVERDVALVNKGVDALTNEHPVPAEWWVPKHKFMVKGKDGRWTLQD  429



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 195/284 (69%), Gaps = 9/284 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP---QV  906
             W+GYVAVATDEGK ALGRRD++V WRGT++ LEW  DLEF +V    + G G +     V
Sbjct  123   WIGYVAVATDEGKAALGRRDVVVVWRGTMQKLEWADDLEFPMVSTKGLLGDGQAACDAMV  182

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRG+ ++Y+S +P S+ N  SAR Q L EV+RLV+ Y +EE SITV GHSLGAALATLNA
Sbjct  183   HRGWLSMYTSIDPASSHNQDSARHQALSEVRRLVDAYSDEERSITVVGHSLGAALATLNA  242

Query  725   IDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
              DIA NG N  +   + PVT F +ASPR G   FK  +DA P L L+R+RN  D+VP+  
Sbjct  243   FDIAANGYNVATGAAACPVTAFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKY-  301

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                P++ Y DVG EL ID  +S Y++ PG   +WH LE YLHG+AGT+GA    GFEL V
Sbjct  302   ---PIVFYHDVGAELAIDTGESPYLRSPGREHTWHNLEVYLHGVAGTRGA--RGGFELAV  356

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
              RD++LVNKL D L ++Y +P  WW+  NKGMV+  DG W L+D
Sbjct  357   ARDVALVNKLYDVLWDDYGVPPGWWVPLNKGMVEGADGRWSLMD  400



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 201/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA-GASPQVHR  900
             W GYVAV  D+G   LGRRDI+V WRG+++ LEWV D EF LV A +IFG      Q+H+
Sbjct  129   WXGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQ  188

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y S++  S F   +ARDQVL EV RL+E YK+EEVSIT+CGHSLGAALATL+A D
Sbjct  189   GWYSIYXSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATD  248

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N   +   KS PVT FV+ASPR GD +F+  +    ++ ++R RN+PD++P  P
Sbjct  249   IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP  308

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    IGY++VG E  ID  KS Y K PG+LA++H LE YLHG+AGT+G    D F L V
Sbjct  309   P----IGYSEVGDEFPIDTRKSPYXKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDV  364

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +R I LVNK +D LK+E  +PG W + KNKG  QQDDGSW+L+D+E
Sbjct  365   ERAIGLVNKSVDGLKDECXVPGKWRVLKNKGXAQQDDGSWELVDHE  410



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 204/284 (72%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GA--GASPQV  906
             WMGY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L PA E+F GA  G  PQ+
Sbjct  114   WMGYIAVATDEGKEKLGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHKPQI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+  LY++++P S FN  SAR+QVLGEV RL+E YK+EEVSIT+ GHSLGA ++TL A
Sbjct  174   ASGWLALYTTDDPRSPFNKTSAREQVLGEVNRLLEQYKDEEVSITLTGHSLGATMSTLCA  233

Query  725   IDIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
              DIA NG     +   K F VT F +ASPR GD NFK   D+  NL+++RI NVPD+VP+
Sbjct  234   TDIAYNGHKKMKSLQHKPFYVTAFAFASPRVGDKNFKMLVDSIENLNILRITNVPDVVPR  293

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                  PL+GY D G  LTI+  KS Y+K   +L ++H ++ YLHG+AGT+G+  L GF+L
Sbjct  294   Y----PLLGYDDAGEVLTINTLKSKYLKQSLNLRNYHNIDIYLHGVAGTQGS--LGGFKL  347

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              +++DIS VNK LD L +EY IPG+WW  +NKGMVQ DDGSWKL
Sbjct  348   EIEKDISSVNKRLDALDDEYLIPGSWWCVENKGMVQMDDGSWKL  391



>sp|A2WTA0.1|PLA3_ORYSI RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|EAY75196.1| hypothetical protein OsI_03088 [Oryza sativa Indica Group]
Length=420

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/293 (55%), Positives = 199/293 (68%), Gaps = 7/293 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVA D      GRRDI+V WRGT R +EW +DL+  LVPA  + G G     P V
Sbjct  131   WMGYVAVAADGVAANAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSV  190

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S++  S FN  SAR+QVL E+ RL+  YKNE  SIT+ GHSLGAAL+TLNA
Sbjct  191   HRGFLSVYTSKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNA  250

Query  725   IDIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             IDI  NG N   + +   PVT    ASPR GD  FK A+D+TPNL L+R+RN PDIVP +
Sbjct  251   IDIVANGYNVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTPNLSLLRVRNAPDIVPTI  310

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
              P+     + DVG EL +D  +S Y+K P   A WH LE YLH +AGT+GAG   GF LV
Sbjct  311   LPSA---FFKDVGAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLV  367

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
             VDRD++LVNK +D L++EY +P  WW+EKNKGMVQ   G W L D+EEG + +
Sbjct  368   VDRDLALVNKEVDALRDEYQVPAAWWVEKNKGMVQNASGRWVLQDHEEGNLAM  420



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   320 bits (820),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 207/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  LVPA EI   G+   P+VH
Sbjct  520   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAHDPRVH  579

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL EV+RL +LYK EE SIT+ GHSLGAALAT++A 
Sbjct  580   GGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISAT  639

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     K+ PV+ FV+ SPR G+ +F+ A+D+  +L L+R+RN PD+VP  P 
Sbjct  640   DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK  694

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY+D G EL ID  +S Y+K PG+  +WH +E Y+HG+AGT+G+    GFEL VD
Sbjct  695   ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  748

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK+EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  749   RDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHED  794



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 197/293 (67%), Gaps = 7/293 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVATD G  ALGRRDI+V WR T R  EW SDL+F LVPA  I G G   + P V
Sbjct  127   WMGYVAVATDRGAAALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYV  186

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S+N  S FN +SAR+ VL EV+ L++ YKNE+ SI++ GHSLG AL TLNA
Sbjct  187   HRGFLSVYTSKNSTSRFNRRSARELVLTEVRGLLDTYKNEDCSISITGHSLGGALTTLNA  246

Query  725   IDIAKNGTNTTSAGKS-FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             ID+  NG N     +S  PVT   + +PR GD  FK A+ +   L L+R+RNVPDIVP +
Sbjct  247   IDLVANGFNVRGPSRSPVPVTAIHFGAPRVGDEQFKKAFHSMAGLSLLRVRNVPDIVPTI  306

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
              P  P+I Y DVGVEL +D  KS Y+K     A WH LE YLHG+AGT GA    GF + 
Sbjct  307   LP--PVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGARDSAGFGME  363

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
             VDRD++L+NK  D L++EY +P  WW E NKGMV+   G W L D+EEG + L
Sbjct  364   VDRDLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVLHDHEEGNLAL  416



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 200/290 (69%), Gaps = 10/290 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMG+VAVATD GK  LGRRD+++ WRGTI  LEWV D +   V A  I G G   +VHRG
Sbjct  115   WMGFVAVATDNGKKQLGRRDVVIAWRGTIEALEWVEDFDIGQVSAAPISGGGDDAKVHRG  174

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             ++++Y+S++  S +N  SAR+QV+ EV+RLVE YK+EE+SIT+ GHSLGAAL TLNAIDI
Sbjct  175   WFSIYTSDDSKSPYNNTSAREQVMSEVRRLVEAYKDEEMSITITGHSLGAALTTLNAIDI  234

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NGTN      G   PVTG V+ASPR G+  FK  ++ +  L L+R+ N  DIVP    
Sbjct  235   VANGTNIPKGRPGTQIPVTGIVFASPRVGNTEFKKRFEGSQGLKLLRVTNALDIVPNY--  292

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PLI Y DVGV L ID  KS ++K P   +  H LE YLHG+AGT+G     GF+L + 
Sbjct  293   --PLISYDDVGVNLGIDTRKSDFLKSPVGPSGVHNLEIYLHGVAGTQGKK--GGFKLEIP  348

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD--NEEGY  219
             RDI+LVNK LD LK +Y +P +W +EKNKGMVQ  DGSWKL+D  NE+G+
Sbjct  349   RDIALVNKSLDVLKVDYTVPASWKVEKNKGMVQLPDGSWKLMDHENEDGF  398



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 202/300 (67%), Gaps = 14/300 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVATD G   LGRRDI+V WRGT R +EW  DL+  LVPA  + G G   + P V
Sbjct  144   WMGYVAVATDAGAARLGRRDIVVAWRGTKRAVEWADDLDITLVPATGVVGPGPGWSQPAV  203

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S N  S FN +SAR+QVL EV+RL++ YK E  SIT+ GHSLGAALATL A
Sbjct  204   HRGFLSVYASRNSTSRFNKQSAREQVLSEVRRLLDAYKGENCSITLTGHSLGAALATLTA  263

Query  725   IDIAKNGTNT---TSAGKSFPVTGFVYASPRTGDHNFKNAYDA--TPN--LHLMRIRNVP  567
             IDI  NG N    +++  + PV   V+ SPR GD  FK A+++  TP     L+R+RN P
Sbjct  264   IDIVANGLNVRGGSNSNDTVPVAAIVFGSPRVGDDQFKKAFESPSTPGGGARLLRVRNAP  323

Query  566   DIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPG-DLASWHLLEPYLHGIAGTKGAGL  390
             DIVP + PA     Y DVGVEL +D  KS ++K PG   A+WH LE YLHG+AGT+GAG 
Sbjct  324   DIVPTILPAA---FYRDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGD  380

Query  389   LDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
               GF L VDRD++LVNK +D L +EY +P  WW+E NKGM +   G W L D+EEG + +
Sbjct  381   GAGFRLEVDRDVALVNKEVDALSDEYPVPAAWWVEGNKGMTRDKSGRWVLQDHEEGNLAM  440



>dbj|BAJ90094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 201/286 (70%), Gaps = 11/286 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG   LGRRDI+V WRGT++ +EWV+DL+F+ VPA  + G+ AS      
Sbjct  76    WMGYVAVATDEGAAKLGRRDIVVAWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAV  135

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF ++Y+S N  S F   SARDQV+ EVKRLVELYK+EEVSITVCGHSLGA++ATLN
Sbjct  136   VHHGFLSMYTSSNKSSEFTKTSARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLN  195

Query  728   AIDIAKNGTNT-TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             A+D+  +G N    A KSFPVT  V+ASP  G   F++A+ + P+L  + ++NV D+VP 
Sbjct  196   AVDMVSSGINKPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPL  255

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DV V+LTI   +S Y++ P  + + H LE YLHG+AG +G+    GF+L
Sbjct  256   YPP----LGYVDVAVQLTITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSA--GGFKL  309

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
              VDRDI+LVNK  D L +E+ +P +WW+ K+K MV+  DG W L D
Sbjct  310   EVDRDIALVNKGADALADEHPVPASWWVPKHKFMVKGGDGRWTLQD  355



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 209/336 (62%), Gaps = 56/336 (17%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK  LGRRDI++ WRG+++ LEW+ D EF LV A EI  A    +VH+G
Sbjct  114   WMGYVAVATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             + ++Y+S++P S +N  SAR QVL EVKRLVE +K+EE++IT+ GHSLGAAL  LNA+DI
Sbjct  174   WLSIYTSDDPRSPYNTTSARQQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDI  233

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAY---DATPNLHLMRIRNVPDIVPQ  552
               NG N  T    K+  VT F++  P  GD NF+N +   ++T +L L+RIRN  D+VP 
Sbjct  234   VANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPN  293

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG---  381
              P   P+IGYT VG EL I+   S ++K   +  SWH LE YLHGIAGT+G+ +L     
Sbjct  294   YP---PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLPATTN  350

Query  380   ---------------------------------------------FELVVDRDISLVNKL  336
                                                          F+LVV RDI+LVNK+
Sbjct  351   KTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNKV  410

Query  335   LDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +D LK+E+ +P  WW EKNKGMVQ+DDGSWKL+D+E
Sbjct  411   MDALKDEFHVPAKWWCEKNKGMVQEDDGSWKLMDHE  446



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 209/289 (72%), Gaps = 8/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEGK  LGRRDI++CWRGT+R LE ++D++  LV A +I G    P+VH G
Sbjct  114   WIGYVAVTTDEGKAVLGRRDILICWRGTMRNLEVINDIKADLVSAADILGDNGDPKVHHG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             ++++Y++++  S +N  SAR+QVL EV+RLV+LY++EE+SIT+ GHSLG A+ATLNA+DI
Sbjct  174   WHSIYTAKDSKSVYNQASAREQVLSEVRRLVDLYQDEEISITLTGHSLGGAVATLNAVDI  233

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  TT   K + VT FV+ASPR GD  FK  +    NLH++RI+N  D+VP +P 
Sbjct  234   IANGYNKSTTKPDKEYLVTAFVFASPRVGDSGFKKVFSGLKNLHVLRIKNELDMVPSLPI  293

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLAS----WHLLEPYLHGIAGTKGAGLLDGFE  375
               PL+ YT VG +L ID  KS Y+K   D++      H LEPYLHG+AG++GA     F+
Sbjct  294   PLPLLHYTHVGEKLLIDSHKSPYMKSHLDISENLVIAHQLEPYLHGVAGSQGAK--GEFK  351

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             L V+RDI+L+NK LD LK+EY +P  WWIEKNKGM QQDDGSW L D+E
Sbjct  352   LEVNRDIALLNKSLDALKDEYKVPVEWWIEKNKGMAQQDDGSWILDDHE  400



>ref|NP_001043734.1| Os01g0651800 [Oryza sativa Japonica Group]
 sp|Q8RZ40.1|PLA3_ORYSJ RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB89211.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05648.1| Os01g0651800 [Oryza sativa Japonica Group]
Length=420

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 198/293 (68%), Gaps = 7/293 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVA D      GRRDI+V WRGT R +EW +DL+  LVPA  + G G     P V
Sbjct  131   WMGYVAVAADGVAAKAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSV  190

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S++  S FN  SAR+QVL E+ RL+  YKNE  SIT+ GHSLGAAL+TLNA
Sbjct  191   HRGFLSVYTSKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNA  250

Query  725   IDIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             IDI  NG N   + +   PVT    ASPR GD  FK A+D+T NL L+R+RN PDIVP +
Sbjct  251   IDIVANGYNVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTSNLSLLRVRNAPDIVPTI  310

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
              P+     + DVG EL +D  +S Y+K P   A WH LE YLH +AGT+GAG   GF LV
Sbjct  311   LPSA---FFKDVGAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLV  367

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
             VDRD++LVNK +D L++EY +P  WW+EKNKGMVQ   G W L D+EEG + +
Sbjct  368   VDRDLALVNKEVDALRDEYQVPAAWWVEKNKGMVQNASGRWVLQDHEEGNLAM  420



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 205/295 (69%), Gaps = 13/295 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW  D +F L PA +IFGA  +P+VH G
Sbjct  106   WVGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHG  165

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             F+N+Y +++  S +N  SAR+QVL EV+RLV++Y    EEVSITV GHSLGAALATLN +
Sbjct  166   FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGV  225

Query  722   DIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDA-TPNLHLMRIRNVPDIVPQV  549
             D+  NG N  S     FPVT F YASPR GD  F++ ++  T +LH++RI+N  DI+P++
Sbjct  226   DMVANGFNKPSGSDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRL  285

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
             PP   L+GY DVG +L ID  KS Y+K P   A  H LE YLH IAG +G    + F+LV
Sbjct  286   PPVF-LLGYQDVGEKLEIDSIKSPYLKDPK--AQPHNLELYLHTIAGYQGQE--EEFKLV  340

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             VDRDI+L+NK LD + ++Y IP  WW  KN GM+Q D+G WKL D    YVP PP
Sbjct  341   VDRDIALLNKSLDLVLDKYNIPPTWWNVKNNGMIQIDNGFWKLND----YVPDPP  391



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/290 (55%), Positives = 199/290 (69%), Gaps = 13/290 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI+V WRGT++  EWV DL   L PAP IF   A  ++H G
Sbjct  115   WIGYVAVATDEGKAALGRRDIVVAWRGTVQGSEWVQDLHIPLDPAPLIF-RDARAELHNG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY++Y+S NPDS     SAR+QVL EV+RLVE YKNEE+SI+V GHSLGAALATLNA+DI
Sbjct  174   FYSVYTSNNPDSHITQTSARNQVLEEVRRLVEKYKNEEISISVTGHSLGAALATLNAVDI  233

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             A  G N       + FPVT F++ASPR G+ +F   +    +L  +RIRN  D VP++P 
Sbjct  234   AAQGLNKPKDQPHRVFPVTAFLFASPRVGNSHFGKIFSEYKHLRALRIRNKKDQVPKLP-  292

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 IG   VG EL ID  KS Y+K   +  S H LE YLHG+AGT+G     GF L V+
Sbjct  293   ----IGLAVVGQELVIDTRKSKYLK---EGVSAHNLEAYLHGVAGTQGKK--GGFNLEVN  343

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVP  213
             RDI+L+NK +D LK+EY +P  W + +NKGMVQQ DG+WKL D+ E  +P
Sbjct  344   RDIALLNKGMDALKDEYLVPVEWRVHENKGMVQQSDGTWKLFDHNEDVIP  393



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 198/293 (68%), Gaps = 17/293 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ-VHR  900
             W+GYVAVAT+ GK ALGRRDI+V WRGT+ +LEWV DLEF +V    I   G     VHR
Sbjct  141   WIGYVAVATEAGKAALGRRDIVVAWRGTVESLEWVDDLEFAMVAPRGIVKDGCEDALVHR  200

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+ ++Y+S +P S+ N  SARDQVLGEV+RLVE+YK EEVSITV GHSLGAALATLNA D
Sbjct  201   GWLSMYTSTHPASSHNKDSARDQVLGEVRRLVEMYKEEEVSITVTGHSLGAALATLNAFD  260

Query  719   IAKNGTNTT-SAGK-------SFPVTGFVYASPRTGDHNFKNAYDATP---NLHLMRIRN  573
             IA+NG NT   AG        +FPV  F +ASPR G   FK  + A      L ++RIRN
Sbjct  261   IAENGYNTAIRAGAAPGPRATTFPVAVFAFASPRIGGAGFKKRFAAAAIASPLRVLRIRN  320

Query  572   VPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAG  393
               DIVP+ P     + Y DVG ELTID   S Y+K PG+   WH LE YLHG+AG   +G
Sbjct  321   ARDIVPKYPA----LLYHDVGCELTIDTGASPYLKAPGNERVWHNLESYLHGVAGVPASG  376

Query  392   L-LDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLL  237
                 GFELVV RD++LVNK  D L+EE+ +P  WW+ +NKGM + DDG W+LL
Sbjct  377   APSSGFELVVARDVALVNKAYDALREEHGVPAGWWVPQNKGMAKGDDGRWRLL  429



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 201/286 (70%), Gaps = 9/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             W+GYVAVAT++G   LGRRDI+V WRGTI T EW+ D +F LV   +IF   + P +VHR
Sbjct  151   WIGYVAVATNDGTAVLGRRDIVVAWRGTIETTEWIDDFDFGLVDGSKIFAGKSKPIKVHR  210

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+ ++Y+S +  S FN   ARDQ+L E+ RLVELYK+E++SITVCGHSLGAALATL+A D
Sbjct  211   GWLSIYTSYDTRSKFNKICARDQLLQEISRLVELYKDEDISITVCGHSLGAALATLSATD  270

Query  719   IAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N       K+ PVT F +A PR G  +FKN +    NL  +R +N+PD+V    
Sbjct  271   IVFNGYNKPKGRPDKACPVTAFPFACPRVGASDFKNLFSGLDNLRALRTKNLPDVV----  326

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
              A P++GY+DVG EL ID  KS Y+K PG++ ++H +E Y+HG+AGT G      F L +
Sbjct  327   CAYPMVGYSDVGDELAIDTRKSPYLKSPGNVTTFHSMEHYMHGVAGTHGTK--GEFRLEI  384

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +RDISLVNK  D LK+E+ +P +W + KNKGMVQQ DGSWKL+D+E
Sbjct  385   NRDISLVNKNTDSLKDEHMVPDHWRVLKNKGMVQQGDGSWKLMDHE  430



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 201/286 (70%), Gaps = 11/286 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG   LGRRDI+V WRGT++ +EWV+DL+F+ VPA  + G+ AS      
Sbjct  151   WMGYVAVATDEGAAKLGRRDIVVAWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAV  210

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF ++Y+S N  S F   SARDQV+ EVKRLVELYK+EEVSITVCGHSLGA++ATLN
Sbjct  211   VHHGFLSMYTSSNKSSEFTKTSARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLN  270

Query  728   AIDIAKNGTNT-TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             A+D+  +G N    A KSFPVT  V+ASP  G   F++A+ + P+L  + ++NV D+VP 
Sbjct  271   AVDMVSSGINKPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPL  330

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DV V+LTI   +S Y++ P  + + H LE YLHG+AG +G+    GF+L
Sbjct  331   YPP----LGYVDVAVQLTITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSA--GGFKL  384

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
              VDRDI+LVNK  D L +E+ +P +WW+ K+K MV+  DG W L D
Sbjct  385   EVDRDIALVNKGADALADEHPVPASWWVPKHKFMVKGGDGRWTLQD  430



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 197/292 (67%), Gaps = 12/292 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  900
             W+GYVAVATD+GKTALGRRDI+V WRGT + LEW++D+EF++ P   + G  AS   VHR
Sbjct  116   WIGYVAVATDDGKTALGRRDIVVAWRGTTQALEWINDMEFVMAPPRSLLGDEASEATVHR  175

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+ ++Y+S +P+S+ N  SARDQVL EV RLV +Y  EE+SITV GHSLGAAL TLNA D
Sbjct  176   GWLSMYTSSDPESSHNKDSARDQVLSEVARLVSMYDGEELSITVTGHSLGAALGTLNAFD  235

Query  719   IAKNGTNTT-----SAGKSFPVTGFVYASPRTGDHNFKNAYDAT--PNLHLMRIRNVPDI  561
             IA NG N +     +     PVT F +ASPR G H F+  +D      L L+R+RN  DI
Sbjct  236   IAANGYNRSPRAAAATATGCPVTAFAFASPRVGGHGFRRRFDGARGAGLRLLRVRNARDI  295

Query  560   VPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG  381
             VP+ P A   + Y DVG EL ID  +S Y++ PG+   WH LE YLHG+AG +G G    
Sbjct  296   VPRYPTA---LLYHDVGAELAIDTGESPYLRNPGNELLWHNLESYLHGVAGARG-GEAGR  351

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             FEL V+RD++L NK    L++E+ +P  WWI  N+GMV+  DG W L+D EE
Sbjct  352   FELAVERDVALTNKFYGALRDEHPVPAGWWIPSNRGMVRGADGRWTLMDCEE  403



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 199/290 (69%), Gaps = 12/290 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATD G  ALGRRDI+V WRGT+R LEWV+D +F  V A  + G+ A+      
Sbjct  122   WMGYVAVATDAGVAALGRRDILVAWRGTMRNLEWVNDFDFTPVSAAPVLGSAAAANPAAL  181

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y S NPDS +N  SARDQV  EV+RL+ LYK+E  SITV GHSLGA+LATLN
Sbjct  182   VHRGFLSVYRSSNPDSKYNQSSARDQVFEEVRRLMALYKDEVTSITVTGHSLGASLATLN  241

Query  728   AIDIAKNGTNTT--SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
             A+D+A NG N    S+    PVT FVYASPR GD NFKNA+ + P+L  + ++N  D+VP
Sbjct  242   AVDLAANGLNAPADSSQPPCPVTAFVYASPRVGDANFKNAFASFPDLRALHVKNAGDVVP  301

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
               PP    +GY DV V L ID  +S Y++ PG + + H LE YLHG+AG +G+    GF+
Sbjct  302   LYPP----LGYVDVAVPLPIDTGRSPYLRQPGTIPTRHNLECYLHGVAGEQGSA--GGFK  355

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             L VDRD++L NK    LK++Y +P +WW+ KNK MV+  DG W L D ++
Sbjct  356   LEVDRDVALANKEEGALKDQYPVPADWWVAKNKFMVKGADGHWALQDFQQ  405



>ref|XP_011047800.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=448

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 205/295 (69%), Gaps = 13/295 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW  D +F L PA +IFGA  +P+VH G
Sbjct  143   WIGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHG  202

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             F+N+Y +++  S +N  SAR+QVL EV+RLV++Y    EEVSITV GHSLGAALATLN +
Sbjct  203   FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGM  262

Query  722   DIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDA-TPNLHLMRIRNVPDIVPQV  549
             D+  NG N  S     FPVT F YASPR GD  F++ ++  T +LH++RI+N  DI+P++
Sbjct  263   DMVANGFNKPSGSDIGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRL  322

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
             PP   L+GY DVG +L ID  KS Y+K P   A  H LE YLH IAG +G    + F+LV
Sbjct  323   PPVF-LLGYQDVGEKLEIDSIKSPYLKDPK--AQPHNLELYLHTIAGYQGQE--EEFKLV  377

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             VDRDI+L+NK LD + ++Y IP  WW  KN GM+Q D+G WKL D    YVP PP
Sbjct  378   VDRDIALLNKSLDLVLDKYNIPPTWWNVKNNGMIQIDNGFWKLND----YVPDPP  428



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/291 (52%), Positives = 199/291 (68%), Gaps = 11/291 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  900
             W+GYVAVATDEGK ALGRRDI+V WRGT+++LEW+ D++F++VP   +    AS   VHR
Sbjct  95    WIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHR  154

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+ ++Y+S + +S+ N  SARDQVL EV +LV +Y++EE+SITV GHSLGAALATLNA D
Sbjct  155   GWLSMYTSRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFD  214

Query  719   IAKNGTNTTSAGKSF----PVTGFVYASPRTGDHNFKNAYDATP--NLHLMRIRNVPDIV  558
             I +NG N      +     PVT FV+ASPR G H FK  +D      L L+R+RN  D+V
Sbjct  215   IVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVV  274

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P+ PPA P   Y  VG EL ID  +S Y++ PG+   WH LE YLHG+AG +G G    F
Sbjct  275   PRYPPAPP---YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARG-GEAGRF  330

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +L V+RD++L NK    L++E+ +P  WWI  N+GMV+  DG W L+D EE
Sbjct  331   KLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREE  381



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/291 (52%), Positives = 199/291 (68%), Gaps = 11/291 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  900
             W+GYVAVATDEGK ALGRRDI+V WRGT+++LEW+ D++F++VP   +    AS   VHR
Sbjct  119   WIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHR  178

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+ ++Y+S + +S+ N  SARDQVL EV +LV +Y++EE+SITV GHSLGAALATLNA D
Sbjct  179   GWLSMYTSRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFD  238

Query  719   IAKNGTNTTSAGKSF----PVTGFVYASPRTGDHNFKNAYDATP--NLHLMRIRNVPDIV  558
             I +NG N      +     PVT FV+ASPR G H FK  +D      L L+R+RN  D+V
Sbjct  239   IVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVV  298

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P+ PPA P   Y  VG EL ID  +S Y++ PG+   WH LE YLHG+AG +G G    F
Sbjct  299   PRYPPAPP---YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARG-GEAGRF  354

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +L V+RD++L NK    L++E+ +P  WWI  N+GMV+  DG W L+D EE
Sbjct  355   KLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREE  405



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 198/284 (70%), Gaps = 7/284 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W  YVAVAT+EGK  LGRRDI+V WRGT+ ++EW+ D +  L+ APEIF    + ++H+G
Sbjct  113   WSAYVAVATNEGKALLGRRDIVVSWRGTLLSVEWLKDFDAELISAPEIFRNDVA-KMHKG  171

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F++LY++++  S ++  SARDQVL  V +LVE YK+EE+SITV GHSLGAA+ATLNA+DI
Sbjct  172   FHSLYTAKDDKSTYSKTSARDQVLAAVSKLVEQYKDEEISITVTGHSLGAAIATLNALDI  231

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP-  546
                G N T+    K+FPVT  V+ASPR GD NFK   +   +LH++R+ N  DIVP +P 
Sbjct  232   VVKGCNKTTGEQNKAFPVTAIVFASPRVGDANFKKLCEGQEDLHVLRVTNERDIVPNLPL  291

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                P   +  VG EL ID  KS YVK   DL  +H LE Y+HG+AGT+G+    GF L V
Sbjct  292   DMPPYFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSE--GGFNLEV  349

Query  365   DRDISLVNKLLDYLKEEYCIPGNWW-IEKNKGMVQQDDGSWKLL  237
             DRDI+LVNK LD LK+EY IP  WW IE NKGMV  DDG WKLL
Sbjct  350   DRDIALVNKDLDGLKDEYKIPAGWWGIEDNKGMVLGDDGRWKLL  393



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 160/343 (47%), Positives = 209/343 (61%), Gaps = 63/343 (18%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEGK  LGRRDI++ WRG+++ LEW+ D EF LV A EI  A    +VH+G
Sbjct  114   WMGYVAVATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQG  173

Query  896   FYNLYSSENPDSAFNIKSARD-------QVLGEVKRLVELYKNEEVSITVCGHSLGAALA  738
             + ++Y+S++P S +N  SAR        QVL EVKRLVE +K+EE++IT+ GHSLGAAL 
Sbjct  174   WLSIYTSDDPRSPYNTTSARQQSITVKFQVLEEVKRLVEEFKDEEINITITGHSLGAALG  233

Query  737   TLNAIDIAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAY---DATPNLHLMRIRN  573
              LNA+DI  NG N  T    K+  VT F++  P  GD NF+N +   ++T +L L+RIRN
Sbjct  234   ILNAVDIVANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRN  293

Query  572   VPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAG  393
               D+VP  P   P+IGYT VG EL I+   S ++K   +  SWH LE YLHGIAGT+G+ 
Sbjct  294   AIDVVPNYP---PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSS  350

Query  392   LLDG------------------------------------------------FELVVDRD  357
             +L                                                  F+LVV RD
Sbjct  351   VLPATTNKTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRD  410

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             I+LVNK++D LK+E+ +P  WW EKNKGMVQ+DDGSWKL+D+E
Sbjct  411   ITLVNKVMDALKDEFHVPAKWWCEKNKGMVQEDDGSWKLMDHE  453



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 197/300 (66%), Gaps = 15/300 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  903
             W+GYVAVATDEGKT LGRRDI++ WRGT    EW  D +F L PA ++FG     +P VH
Sbjct  106   WIGYVAVATDEGKTLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVH  165

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              GF++LY   NPDS +   SA+DQV   V+ LV+ Y +EE+SITV GHSLG+ALATLNA 
Sbjct  166   LGFHSLYVQSNPDSTYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAA  225

Query  722   DIAKNGTNTTSAGKSFP---VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             D+A NG N  +   +     VT  V+ASPR GD  FK A++    L L+RI N  DIVP 
Sbjct  226   DLAANGYNKPTGSDTASGCMVTTIVFASPRVGDSAFKTAFEDQKLLRLLRITNKNDIVPN  285

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVK---PPGDLAS-WHLLEPYLHGIAGTKGAGLLD  384
             VPP     GY DVG EL +D TKS YVK   PP  L S  H LE YLHGIAGT      D
Sbjct  286   VPPV--FSGYVDVGRELKVDTTKSTYVKTVIPPLSLPSVLHNLENYLHGIAGTSQGDDDD  343

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
              FEL +DRDI+L+NK LD LK+EY +P NWW  KNKGMVQ D+G WKL    E YVP PP
Sbjct  344   DFELAIDRDIALLNKGLDLLKDEYGVPPNWWTVKNKGMVQLDNGFWKL----EDYVPDPP  399



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   315 bits (807),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 206/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  903
             WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  LVPA EI   G++  P VH
Sbjct  714   WMGFVAVATDEGKEVLGRRDVVVAWRGTIRILEWMDDLDISLVPASEIVRPGSADDPCVH  773

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              G+ ++Y+S +P S +N +SAR QVL E+KRL ++YK EE SIT+ GHSLGAALAT++A 
Sbjct  774   GGWLSVYTSTDPGSRYNKQSARYQVLDEIKRLQDVYKQEETSITITGHSLGAALATISAT  833

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  NG N     +S PV+ FV+ SPR G+ +F+ A+D+  +L L+R+ N PD+VP+ P 
Sbjct  834   DIVSNGYN-----QSCPVSAFVFGSPRVGNSDFQKAFDSADDLRLLRVENSPDVVPKWPK  888

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY++ G EL ID  +S Y+K PG+  +WH +E Y+HGIAGT+G+    GFEL VD
Sbjct  889   ----LGYSEAGTELMIDTGESPYIKTPGNPLTWHDMECYMHGIAGTQGSN--GGFELEVD  942

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK  D LK EY IP +WW+ +NKGMV+  DG W L D+E+
Sbjct  943   RDIALVNKHEDALKNEYSIPSSWWVMQNKGMVKGKDGRWHLADHED  988



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 197/300 (66%), Gaps = 15/300 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  903
             W+GYVAVATDEGKT LGRRDI++ WRGT    EW  D +F L PA ++FG     +P VH
Sbjct  106   WIGYVAVATDEGKTLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVH  165

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              GF++LY   NPDS +   SA+DQV   V+ LV+ Y +EE+SITV GHSLG+ALATLNA 
Sbjct  166   LGFHSLYVQSNPDSTYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAA  225

Query  722   DIAKNGTNTTSAGKSFP---VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             D+A NG N  +   +     VT  V+ASPR GD  FK A++    L L+R+ N  DIVP 
Sbjct  226   DLAANGYNKPTGSDTASGCMVTTIVFASPRVGDSAFKTAFEDQKLLRLLRVTNKNDIVPN  285

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVK---PPGDLAS-WHLLEPYLHGIAGTKGAGLLD  384
             VPP     GY DVG EL +D TKS YVK   PP  L S  H LE YLHGIAGT      D
Sbjct  286   VPPV--FSGYVDVGRELKVDATKSTYVKTVIPPLSLPSVLHNLENYLHGIAGTSQGDDDD  343

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
              FEL +DRDI+L+NK LD LK+EY +P NWW  KNKGMVQ D+G WKL    E YVP PP
Sbjct  344   DFELAIDRDIALLNKGLDLLKDEYGVPPNWWTVKNKGMVQLDNGFWKL----EDYVPDPP  399



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   315 bits (807),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 158/294 (54%), Positives = 199/294 (68%), Gaps = 8/294 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVATD G   LGRRDI+V WRGT R +EW +DL+  LVPA  + G G   + P V
Sbjct  777   WMGYVAVATDAGVARLGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAV  836

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S N  S FN +SAR+QVL E++RL++ YK E  SIT+ GHSLGAAL+TL A
Sbjct  837   HRGFLSVYASRNSTSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTA  896

Query  725   IDIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             IDI  NG N       + PV   V+ SPR GD  FK A+D+TP   L+R+RN PD+VP V
Sbjct  897   IDIVANGLNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTV  956

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPG-DLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              P      Y DVGVEL +D  KS ++K PG   A+WH LE YLHG+AGT+GAG   GF L
Sbjct  957   LPNA---FYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSL  1013

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
              VDRD++LVNK +D L ++Y +P  WW+E NKGM +   G W L D+EEG + +
Sbjct  1014  EVDRDVALVNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVLQDHEEGNLAM  1067



>ref|XP_006644445.1| PREDICTED: phospholipase A1-II 3-like [Oryza brachyantha]
Length=426

 Score =   298 bits (763),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 195/293 (67%), Gaps = 7/293 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVA D    A GRRDI+V WRGT R +EW +DL+  LVPA  I G G   + P V
Sbjct  137   WMGYVAVAADGVAAAAGRRDIVVAWRGTKRAVEWANDLDITLVPADGIIGPGPGWSQPSV  196

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S++  S FN  SAR+QVL E+ RL+  YKNE  SIT+ GHSLGAAL+TLNA
Sbjct  197   HRGFLSVYTSKSFSSRFNKLSAREQVLAEIARLLRAYKNENCSITITGHSLGAALSTLNA  256

Query  725   IDIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             +DI  NG N     +   PVT    ASPR GD  FK A+D+   + L+R+RN PDIVP +
Sbjct  257   VDIVANGYNVRGPSRVPVPVTAIALASPRVGDDQFKRAFDSMAGVSLLRVRNAPDIVPTI  316

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
              P+     + DVG EL +D  +S Y+K P   A WH LE YLH +AGT+GAG   GF L 
Sbjct  317   LPSA---FFKDVGAELLVDTRRSPYLKSPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLA  373

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPL  210
             VDRD++LVNK +D L++EY +P  WW EKNKGMVQ   G W L D+EEG + +
Sbjct  374   VDRDVALVNKEVDALRDEYQVPAAWWGEKNKGMVQNASGRWVLQDHEEGNLAM  426



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 204/295 (69%), Gaps = 20/295 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG-------A  918
             ++GYVAVA D    +LGRRDI++ WRG+I++LEWV++L+FL V A ++ G G       A
Sbjct  136   FIGYVAVAEDTAVASLGRRDIVIAWRGSIQSLEWVNNLQFLQVSASDVVGDGDVADHDKA  195

Query  917   SPQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALA  738
               +VH+G+Y++Y+S++P S FN  SARDQVL E++ L+E YKNEE+SIT+ GHS+GAALA
Sbjct  196   KAKVHQGWYSIYTSDDPRSPFNKTSARDQVLLEIQSLMEQYKNEEISITITGHSMGAALA  255

Query  737   TLNAIDIAKNGTNTTSAGKSFP--VTGFVYASPRTGDHNFKN---AYDATPNLHLMRIRN  573
             TLNA+D+  N  N   +    P  VT  ++ASPR GD NFKN    YD +  L L+R+ N
Sbjct  256   TLNAVDLVANNINIPKSSPKNPCLVTAILFASPRVGDFNFKNIISKYDHS--LKLLRVCN  313

Query  572   VPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAG  393
               D+V   PP    IGY  VG EL+ID  +S Y+K PG+  +WH  E YLHGIAG  G G
Sbjct  314   ALDVVLHYPP----IGYCHVGKELSIDTIRSPYLKFPGNFWTWHNSEAYLHGIAG--GQG  367

Query  392   LLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
               + F+LVVDRD+SL+NK  D LK+EY IP  WW  +NKGMVQQ DGSW L+D+E
Sbjct  368   SEEEFKLVVDRDLSLLNKHWDNLKDEYLIPAFWWTLRNKGMVQQSDGSWLLMDHE  422



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 197/289 (68%), Gaps = 11/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK +LGRRDI+V WRGTI+  EW+ D  F L  AP IFG  +  Q+H G
Sbjct  114   WIGYVAVATDEGKVSLGRRDIVVAWRGTIQGSEWIKDFHFHLDSAPLIFGLQSPVQIHNG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY+LY+S+NP       SAR+QVL E+ RLVE YKNEE+SIT+ GHSLGAALA +N++DI
Sbjct  174   FYSLYTSDNPGFQSANSSARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDI  233

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N +     KS PVT F +ASPR G+ +F N +    +L+ + IRN  DIV    P
Sbjct  234   VANKFNISKEQPQKSCPVTTFAFASPRVGNSSFGNIFSNYKDLNALLIRNQTDIV----P  289

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
              +  +GY++VG EL ID  KS Y+K      S H LE YLHG+AGT+G+    GF L V+
Sbjct  290   ISLFLGYSEVGEELLIDTKKSKYLKSG---VSSHNLEVYLHGVAGTQGSK--GGFNLEVN  344

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYV  216
             RDI+LVNK  D LK+EY +P  W + +NKGMVQQ DG+WKL+D+ E  V
Sbjct  345   RDIALVNKSNDGLKDEYRVPNAWRVVENKGMVQQFDGTWKLMDDNEDVV  393



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 196/284 (69%), Gaps = 7/284 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W  YVAVAT+EGK  LGRRDI+V WRGT  ++EW+ D +  L+  PEIFG   + ++H+G
Sbjct  113   WSAYVAVATNEGKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPEIFGNDVA-KMHKG  171

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F++LY++++  S ++  SARDQ L  V +LV+ YK+EE+SITV GHSLGAA+ATLNA+DI
Sbjct  172   FHSLYTAKDDKSTYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDI  231

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP-  546
                G N T+    K+FPVT  V+ASPR GD NFK   +   +LH++R+ N  DIVP +P 
Sbjct  232   VVKGYNKTTGEQNKAFPVTAIVFASPRVGDTNFKKLCEGLEDLHVLRVTNEKDIVPNLPF  291

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                P   +  VG EL ID  KS YVK   DL  +H LE Y+HG+AGT+G+    GF L V
Sbjct  292   DIPPSFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSE--GGFNLEV  349

Query  365   DRDISLVNKLLDYLKEEYCIPGNWW-IEKNKGMVQQDDGSWKLL  237
             DRDI+LVNK LD LK+EY IP  WW IE NKGMV  DDG WKLL
Sbjct  350   DRDIALVNKDLDGLKDEYNIPAGWWGIEDNKGMVLGDDGRWKLL  393



>ref|XP_002441554.1| hypothetical protein SORBIDRAFT_09g029230 [Sorghum bicolor]
 gb|EES19984.1| hypothetical protein SORBIDRAFT_09g029230 [Sorghum bicolor]
Length=361

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 196/289 (68%), Gaps = 13/289 (4%)
 Frame = -2

Query  1070  GYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----VH  903
             G   VATD+G  ALGRRDI+V WRGT+R+LEWV+D +F  V A  + G+ A+      VH
Sbjct  78    GNYTVATDDGVAALGRRDILVAWRGTMRSLEWVNDFDFTPVSAAPVLGSAAAANPAALVH  137

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             RGF ++Y+S NPDS +N  SARDQVL EV RL+ LYK+E  SITV GHSLGA+LATLNA+
Sbjct  138   RGFLSVYTSSNPDSKYNQTSARDQVLAEVSRLMALYKDEVTSITVTGHSLGASLATLNAV  197

Query  722   DIAKNGTNTTSAGK---SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             D+A NG N   AG    + PVT FV+ASPR GD NFK A+ + P+L  + ++N  D+VP 
Sbjct  198   DLAANGVNAPPAGSAQPACPVTAFVFASPRVGDGNFKRAFASFPDLRALHVKNAGDVVPT  257

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DV V+L I   +S Y+K PG + + H LE YLHG+AG +G+    GF+L
Sbjct  258   YPP----LGYVDVAVQLPIATGRSPYLKQPGTILTLHNLECYLHGVAGEQGSA--GGFKL  311

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              VDRD++L NK  D LK +Y +P +WW+ KN  MV+  DG W L D E+
Sbjct  312   EVDRDVALANKGEDALKNQYPVPVSWWVAKNNFMVKGTDGHWALQDFEQ  360



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score =   295 bits (756),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 208/313 (66%), Gaps = 16/313 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG T LGRRDI+VCWRGTI   EW  +L+F LV A EI G   +P++H G
Sbjct  106   WIGYVAVTTDEGNTVLGRRDILVCWRGTILGSEWAKNLQFDLVSAAEILGGAHNPKMHHG  165

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKN--EEVSITVCGHSLGAALATLNAI  723
             F+++Y +++  S +N  SAR+QVL EV+RLV+ Y +  E+VSITV GHSLGAALATLNA+
Sbjct  166   FHSVYLAKSSSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAM  225

Query  722   DIAKNGTNTTSAGKS-FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             DI  NG N  +   + F VT F YASPR GD  F++ ++   NLH++RI+N  DI+P +P
Sbjct  226   DIVSNGYNKPAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLANLHVLRIKNEKDIIPNLP  285

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             PA     Y D+G EL ID +KS Y+K P   A  H L+ YLH IAG +G   L  F LV+
Sbjct  286   PAF-YNTYKDIGEELEIDSSKSPYLKDPN--AEPHNLDIYLHTIAGYQGK--LGEFRLVI  340

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP*LFYTQ  186
             DRDI+LVNK  D L E+Y +P NW    NKGM+Q D+G WKL D    YVP PP    ++
Sbjct  341   DRDIALVNKSADVLPEKYKVPPNWRTVMNKGMIQLDNGFWKLND----YVPDPP----SE  392

Query  185   NCFGVCVFVIFFK  147
             +  G  +  IF K
Sbjct  393   DDIGGNITAIFLK  405



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score =   295 bits (756),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 201/295 (68%), Gaps = 17/295 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW+ D  F+L+PA +IFGA  +P+VH G
Sbjct  121   WIGYVAVTTDEGQRVLGRRDILVCWRGTILPAEWLKDFLFVLIPASDIFGATNNPKVHSG  180

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             F+N+Y +++  S +N  SAR+QVL EV+RLV+ Y    EEVSITV GHSLGAALATLNA+
Sbjct  181   FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDRYALNGEEVSITVAGHSLGAALATLNAM  240

Query  722   DIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDA-TPNLHLMRIRNVPDIVPQV  549
             DI  NG N  S     FPVT F YA PR GD  F++ ++  T +LH++RI+N  D VP+ 
Sbjct  241   DIVANGYNKPSGSDIGFPVTVFAYACPRVGDQGFQDVFNGLTNDLHVLRIKNSKDPVPR-  299

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
                 P++ Y DVG EL ID  KS Y   P D    H LE YLH IAG +G    + F+LV
Sbjct  300   ---HPVLLYQDVGKELEIDSIKSPY---PKDPTKPHDLELYLHTIAGYQGKE--EEFKLV  351

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             VDRDI+L+NK LD L ++Y IP NWW  KN GM+Q D+G WKL D    YVP PP
Sbjct  352   VDRDIALLNKGLDLLPDKYKIPPNWWNVKNNGMIQTDNGFWKLND----YVPDPP  402



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 150/286 (52%), Positives = 197/286 (69%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRD++V WRGTI  +EWV+DLEF LVPA E+FG      VH+G
Sbjct  117   WIGYVAVATDEGKVALGRRDVVVAWRGTIMPMEWVNDLEFPLVPASELFGESGVANVHQG  176

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F +LY+S N   + +  SARDQVL EV++ V+L+++EE+SITV GHSLG +L+TLNA+DI
Sbjct  177   FLSLYTSTNESVSVSRTSARDQVLSEVRKQVDLHQDEEISITVVGHSLGGSLSTLNAMDI  236

Query  716   AKNGTNT-TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
               NG N  +S  K  PV  F +A PR+GD NF++   +  +LH++RI N  DIVP++PP 
Sbjct  237   TYNGVNKPSSREKGCPVAAFAFACPRSGDINFRSVMRSLHDLHILRISNATDIVPRIPP-  295

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLE-PYLHGIAGTKGAGLLDGFELVVD  363
                  Y DVGVELT+D TKS ++K   D ++ H LE  YLH +A   G       +  + 
Sbjct  296   ---FLYVDVGVELTVDSTKSKFLKVFSDFSNHHNLEVAYLHPLAIANG-------DEDIR  345

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+L NK  D L+ +Y I  NWW ++N GMVQQ+DGSWKL D+E 
Sbjct  346   RDIALANKNSDALRSKYLIKTNWWCQQNHGMVQQEDGSWKLEDHEH  391



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 206/313 (66%), Gaps = 15/313 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG T LGRRDI+VCWRGTI   EW  +L+F LV A EI G   +P++H G
Sbjct  106   WIGYVAVTTDEGNTVLGRRDILVCWRGTILASEWAKNLQFDLVSAAEILGGAHNPKMHHG  165

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKN--EEVSITVCGHSLGAALATLNAI  723
             F+++Y +++  S +N  SAR+QVL EV+RLV+ Y +  E+VSITV GHSLGAALATLNA+
Sbjct  166   FHSVYLAKSSSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAM  225

Query  722   DIAKNGTNTTSAGKS-FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             DI  NG N  +   + F VT F YASPR GD  F++ ++   NLH++RI+N  DI+P +P
Sbjct  226   DIVSNGYNKPAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLANLHVLRIKNENDIIPSLP  285

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             PA     Y D+G EL ID +KS Y+K P   A  H L+ YLH IAG +G   L  F LV+
Sbjct  286   PAF-YNTYKDIGEELEIDSSKSPYLKDPN--AEPHNLDIYLHAIAGYQGK--LGEFRLVI  340

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP*LFYTQ  186
             DRDI+LVNK  D L E+Y +P NW    NKGM+Q D+G WKL D    YVP PP      
Sbjct  341   DRDIALVNKSADVLPEKYKVPPNWRTVMNKGMIQMDNGFWKLND----YVPDPP---SED  393

Query  185   NCFGVCVFVIFFK  147
             +  G  +  IF K
Sbjct  394   DIEGNIITAIFLK  406



>gb|EMT30117.1| Mono- and diacylglycerol lipase [Aegilops tauschii]
Length=419

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 193/289 (67%), Gaps = 11/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  903
             W+GYVAVATD GK  L RRD++V WRGTI+ LEWV DLEF +V    I G  AGA   VH
Sbjct  124   WIGYVAVATDAGKAVLSRRDVVVAWRGTIQALEWVDDLEFAMVHPKGILGDAAGADAMVH  183

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             RG++++Y+S +P S  N  +AR QVL EV++LV++YK+EEVSITV GHSLGAALATLNA 
Sbjct  184   RGWFSIYTSTDPASTHNKDNARSQVLAEVRKLVDMYKDEEVSITVTGHSLGAALATLNAF  243

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATP---NLHLMRIRNVPDIVPQ  552
             DI +NG N   A  +FPVT F +ASPR G   FK  +DA      L ++R+RN  DIVP+
Sbjct  244   DIVENGYNCM-ASATFPVTAFAFASPRVGGAGFKKRFDAAAAAVGLRVLRVRNARDIVPK  302

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              P     + Y DVG EL ID   S Y++  GD   WH LE YLH             FE+
Sbjct  303   YPA----LLYHDVGSELAIDTGASPYLRATGDKRVWHNLECYLH-GVAGAPTAAGGAFEI  357

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             VV+RD++LVNKL D L+EE+ +P  WW+  NKGMV+ DDG W+L+D E+
Sbjct  358   VVERDVALVNKLYDALREEHGVPAGWWVPWNKGMVKGDDGRWRLVDCED  406



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 197/289 (68%), Gaps = 14/289 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             W+GYVAVATDEG  ALGRRDI+V WRGT++ LEWV+DL+F  V A  + G+ A       
Sbjct  152   WIGYVAVATDEGAEALGRRDIVVAWRGTVKNLEWVNDLDFTPVSAAPVLGSAAGKNRLAV  211

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y+S N  S F   SARDQVL EV+RLVEL+K+EE SITV GHSLGA+LATLN
Sbjct  212   VHRGFLSVYTSSNKSSKFTKTSARDQVLEEVRRLVELHKDEETSITVTGHSLGASLATLN  271

Query  728   AIDIAKNGTNTTSAG----KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDI  561
             A+D+  +GTN  S+     K FPVT  V+ASP  GD  F++A+ + P+L  + ++NV DI
Sbjct  272   AVDLVSSGTNKPSSSDGDKKPFPVTAIVFASPHVGDRFFRSAFGSFPDLKALHVQNVGDI  331

Query  560   VPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG  381
             VP  PP    +GY DV  ELTI   +S Y+  PG   + H LE YLHG+AG +G+    G
Sbjct  332   VPLYPP----LGYVDVATELTIRTIRSPYLSVPGTPVTLHNLECYLHGVAGEQGS--RGG  385

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
             F+L V RD++LVNK +D L +E+ +P  WW  K++ MV+ DDG W L D
Sbjct  386   FKLEVARDVALVNKGVDALTDEHPVPAGWWTPKHRCMVRGDDGRWTLQD  434



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/293 (53%), Positives = 194/293 (66%), Gaps = 13/293 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+  L  A  I G     G+ P 
Sbjct  131   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGADGSDPS  190

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRG+ +LY+S +  S  + KSAR QVL E+ RL++ YK+EE SITV GHSLGA LATLN
Sbjct  191   VHRGYLSLYTSADEGSKLSKKSARMQVLTEIARLMDKYKDEETSITVVGHSLGATLATLN  250

Query  728   AIDIAKNGTNTTSA---GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             A DI  N  N +S    G+  PVT  V+ SPRTGD  F++ +     L ++R+RN PD +
Sbjct  251   AADIVANACNKSSGFDDGRRAPVTAVVFGSPRTGDRAFRDVFHRLRGLRMLRVRNKPDRI  310

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P  PP    +GY DVGVEL ID  +S ++KP G+ +  H LE +LHG+AG +G G   GF
Sbjct  311   PHYPP----VGYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDG--GGF  364

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGY  219
             ELVV+RD++LVNK  D L +EY +P  W +  NK MV+  DG W L D+E  Y
Sbjct  365   ELVVERDVALVNKFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDY  417



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/298 (52%), Positives = 199/298 (67%), Gaps = 23/298 (8%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATDEGKTALGRRDI+V WRG+++ +EW+ D +F L  A  I G   +P  HR 
Sbjct  114   WIGFVAVATDEGKTALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRC  173

Query  896   FYNLYSSENPDSAFNIKSARDQV------------LGEVKRLVELYKNEEVSITVCGHSL  753
             + ++Y+S +P S FN +SARDQV            L EVKRLV+ YK+EE+SIT+ GHSL
Sbjct  174   WVSIYTSHDPKSRFNKQSARDQVIVGICAHKQMRFLSEVKRLVDKYKDEEISITITGHSL  233

Query  752   GAALATLNAIDIAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRI  579
             GAAL TL A DI  N  N       KS PVT F++ SPR GD NF+N   +  NLHL+R+
Sbjct  234   GAALGTLCAADIVANKFNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRV  293

Query  578   RNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKG  399
              NVPDIV  +PP      Y++VG EL ID   S ++K PG   +WH LE +LHG+AGT+G
Sbjct  294   TNVPDIVTTLPPEG---YYSEVGQELVIDTRFSNFLKFPGCYDTWHSLEAHLHGVAGTQG  350

Query  398   AGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +    GF L VDR I+LVNK+LD LK+EY +P +WW  +NKGM     GSW+L D+E+
Sbjct  351   SK--GGFHLEVDRSIALVNKMLDALKDEYPVPASWWCMRNKGM----KGSWELKDHEK  402



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 201/291 (69%), Gaps = 14/291 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  912
             +MGY+AVA D+    LGRR+I+V WRG++  +EW++DL+FL V A +I           P
Sbjct  148   FMGYIAVAEDDAVELLGRREIVVAWRGSVEFMEWLNDLKFLQVSASDILAHEGDDGEPEP  207

Query  911   QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATL  732
             +VH+G++++Y+++N  S F   SAR QVL E+ +LVE YKNEE+SIT+ GHSLGAALATL
Sbjct  208   EVHQGWHSIYTTDNLSSPFEKTSARQQVLTELTKLVEQYKNEEISITITGHSLGAALATL  267

Query  731   NAIDIAKNGTN---TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDI  561
             NA DI  N  N    +   K   VT  V+ASPR GD NFK       +L ++R+RN  D 
Sbjct  268   NAADIVANKINQPKNSPNSKPCKVTAIVFASPRVGDANFKKTLSKYDDLGVLRVRNAQDF  327

Query  560   VPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG  381
             VP      PLI Y+DVG ELTID T+S Y+K PG L+  H LE Y+HG+AGT+G+  ++G
Sbjct  328   VPNY----PLIDYSDVGEELTIDTTQSAYLKNPGLLSVSHNLEVYMHGVAGTQGS--VEG  381

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             F+LVV+RD++L+NK  D+LK++Y +P  WW+ + KGMVQQ DGSW L+D+E
Sbjct  382   FKLVVERDVALLNKFYDFLKDDYLVPVGWWVAQYKGMVQQADGSWLLMDHE  432



>ref|XP_004961148.1| PREDICTED: phospholipase A1-II 6-like [Setaria italica]
Length=409

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 194/289 (67%), Gaps = 9/289 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  903
             W+GYVAVATDEGK ALGRRD++V WRGT++ LEWV DLEF +VP   + G        VH
Sbjct  118   WIGYVAVATDEGKAALGRRDVVVAWRGTVQALEWVEDLEFAMVPPRGLLGDREACDAMVH  177

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             RG+ ++Y+S +P S+ N  SARDQ L EV+RLV+ YK+EE+SITV GHSLGAALATLNA 
Sbjct  178   RGWLSMYTSADPVSSHNQDSARDQALREVRRLVDTYKDEELSITVTGHSLGAALATLNAF  237

Query  722   DIAKNGTNTTSAGKSF---PVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             DIA NG N   A       PVT F +A PR G   FK  +DA   L L+R+RN  DIVP+
Sbjct  238   DIAANGYNVAPAAAGMAACPVTAFAFACPRVGGSGFKKRFDAVSGLRLLRVRNARDIVPR  297

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              P     + Y DVG EL ID   S Y++ PG   +WH LE YLHG+AG +G     GFEL
Sbjct  298   YPA----VFYHDVGAELAIDTGASPYLRSPGHEQTWHNLEVYLHGMAGARGGAGGGGFEL  353

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              V RD++LVNK  D L++++ +P  WW+  N+GMV+  DG W+L+D E+
Sbjct  354   AVARDVALVNKAYDALRDDHGVPPGWWVPHNRGMVKGSDGRWRLMDCED  402



>ref|XP_009333706.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=378

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 193/286 (67%), Gaps = 10/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEGK  LGRRDI+V WRGT    EW  DL F LV A +I G    P+VH G
Sbjct  98    WLGYVAVTTDEGKEVLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHG  157

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
              ++ Y+S +P+S ++  S R QVL  +K +V+ YK+EE+SITVCGHS+G A A LNAIDI
Sbjct  158   IHSYYNSADPESPYSKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNAIDI  217

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  T    K+  VT  V+ASPR GD  F N + +  NLH++R+ N  DIVP +P 
Sbjct  218   VCNGYNKPTDRPDKACLVTSIVFASPRLGDQGFHNVFSSLNNLHVLRVTNSYDIVPYLP-  276

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL  Y DVG EL ID  KS Y+K     A  H LE YLHG+AGT+G    +GF+LV++
Sbjct  277   --PLEKYVDVGKELKIDTLKSPYLKNAKKDA--HRLEIYLHGVAGTQGR---NGFQLVIN  329

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+EY +  NWW EKNK MVQ DDGSW LLD+E+
Sbjct  330   RDIALVNKKLDGLKDEYNVIVNWWTEKNKSMVQMDDGSWVLLDHEK  375



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 153/284 (54%), Positives = 195/284 (69%), Gaps = 7/284 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W  YVAVAT+EGK  LGRRDI+V WRGT  ++EW+ D +  L+  P IFG   + ++H+G
Sbjct  113   WSAYVAVATNEGKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPGIFGNDVA-KMHKG  171

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F++LY++++  S ++  SARDQ L  V +LV+ YK+EE+SITV GHSLGAA+ATLNA+DI
Sbjct  172   FHSLYTAKDDKSTYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDI  231

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP-  546
                G N T+    K+FPVT  V+ASPR GD NFK   +   +LH++R+ N  DIVP +P 
Sbjct  232   VVKGYNKTTGEQNKAFPVTAIVFASPRVGDANFKKLCEGLEDLHVLRVTNEKDIVPNLPL  291

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                P   +  VG EL ID  KS YVK   DL  +H LE Y+HG+AGT+G+    GF L V
Sbjct  292   DIPPSFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSE--GGFNLEV  349

Query  365   DRDISLVNKLLDYLKEEYCIPGNWW-IEKNKGMVQQDDGSWKLL  237
             DRDI+LVNK LD LK+EY IP  WW IE NKGMV  DDG WKLL
Sbjct  350   DRDIALVNKDLDGLKDEYNIPAGWWGIEDNKGMVLGDDGRWKLL  393



>ref|XP_011005461.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   293 bits (750),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 205/295 (69%), Gaps = 13/295 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW  D +F L PA +IFGA  +P+VH G
Sbjct  106   WIGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHG  165

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             F+N+Y +++  S +N  SAR+QVL EV+RLV++Y    EEVSITV GHSLGAALATLN +
Sbjct  166   FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGV  225

Query  722   DIAKNGTNTTSAGK-SFPVTGFVYASPRTGDHNFKNAYDA-TPNLHLMRIRNVPDIVPQV  549
             D+  NG N  S     FPVT F YASPR GD  F++ ++  T +LH++RI+N  DI+P++
Sbjct  226   DMVANGFNKPSGSDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRL  285

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
             PP   L+GY DVG +L ID  KS Y+K P   A  H LE YLH IAG +G    + F+LV
Sbjct  286   PPVF-LLGYQDVGEKLEIDSIKSPYLKDPK--AQPHNLELYLHTIAGYQGQE--EEFKLV  340

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             VDRDI+L+NK LD L ++Y IP  WW  KN GM+Q D+G WKL D    YVP PP
Sbjct  341   VDRDIALLNKSLDLLLDKYNIPPKWWNVKNNGMIQIDNGFWKLND----YVPDPP  391



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   293 bits (751),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 194/292 (66%), Gaps = 12/292 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG----AGASPQ  909
             WMGYVAVATD+G  ALGRRDI+V WRGT R LEWV+DL+  L  A  I G     G+ P 
Sbjct  114   WMGYVAVATDQGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGAGGSDPS  173

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRG+ +LY+S +  S  + +SAR QVL E+ RL++ YK+EE SITV GHSLGA +ATLN
Sbjct  174   VHRGYLSLYTSADEGSNLSKQSARMQVLTEIARLMDKYKDEETSITVVGHSLGATMATLN  233

Query  728   AIDIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
             A DI  N  N T     +  PVT  V+ SPRTGD +F++ +   P+L ++RIRN PD +P
Sbjct  234   AADIVANAYNKTPGYDSRRAPVTAIVFGSPRTGDRDFRDVFHRLPDLRMLRIRNRPDRIP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
               PP    +GY DVGVEL ID  +S ++KP G+ +  H LE +LHG+AG +G     GFE
Sbjct  294   HYPP----VGYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDH--GGFE  347

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGY  219
             LVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W L D+E  Y
Sbjct  348   LVVDRDVALVNKFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDY  399



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 204/296 (69%), Gaps = 21/296 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  900
             W+G+VAVATDEGK ALGRRDI++ WRGTI   EW  D E  +V   EIF     +  VH+
Sbjct  125   WIGFVAVATDEGKVALGRRDILIVWRGTITVSEWNDDFESSMVQPIEIFRENTDNILVHK  184

Query  899   GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             GFY++Y+S N  S FN   SARDQVL EVKRL++ YK EEVSI+V GHSLG++LATL AI
Sbjct  185   GFYSIYTSLNHASNFNRTTSARDQVLEEVKRLMDQYKKEEVSISVTGHSLGSSLATLCAI  244

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DIA +  N     K FPVT F++ASPR G+ NFK A +   NLH++RI N  D++ ++P 
Sbjct  245   DIAVSQVN-----KGFPVTAFLFASPRVGEINFKKACENLKNLHILRITNASDLITKLPD  299

Query  542   ATPLIG-------YTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
                + G       Y DVG EL+ID TKS Y+K      + H+LE YLHGIAGT G    +
Sbjct  300   RGQVEGCETDWRVYEDVGFELSIDTTKSDYLKKE---INGHILEVYLHGIAGTHG---FE  353

Query  383   G-FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGY  219
             G F+L ++RDI+L+NK  D LK+EY +P +WWIEKNKGMVQ ++GSW L+D+E+ +
Sbjct  354   GEFKLEMNRDIALMNKADDVLKDEYGVPASWWIEKNKGMVQHENGSWILMDHEDDH  409



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 194/284 (68%), Gaps = 5/284 (2%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK  LGRRDI++ WRGTI+ +EWV D +  L+ A  I      P+VH+G
Sbjct  88    WIGYVAVATDEGKAMLGRRDIVIAWRGTIQPIEWVKDFQAPLISASNILKWDKDPRVHQG  147

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F +LY++ +  SA++  SAR+QV+ EVKRL++ +K+EE S+TV GHSLGAALATLNAIDI
Sbjct  148   FLSLYNTADFVSAYSKTSAREQVIEEVKRLMQEFKHEETSLTVTGHSLGAALATLNAIDI  207

Query  716   AKNGTNTTSAGKS-FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPA  540
             A NG N     K   PVT FV+ASPR GD NFK   ++  NLH+++I+N+ D+VP  PP 
Sbjct  208   AANGFNIGDESKERSPVTAFVFASPRVGDRNFKELSESVENLHILKIKNLNDLVPLTPPK  267

Query  539   TPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDR  360
                 GY DVG EL ++   S +V  PG   SWH LE YLHG+AGT+G   +  F L V R
Sbjct  268   ES--GYADVGKELLLNTLISPFVNRPGGPLSWHNLEAYLHGVAGTQGDKPV--FHLEVKR  323

Query  359   DISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             DI+L+NK +  L+ +Y IP  W   +N GMV+  DGSW+L D E
Sbjct  324   DIALLNKEISNLQPDYLIPPAWRCPRNTGMVKMKDGSWELRDQE  367



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 190/286 (66%), Gaps = 37/286 (13%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             WMGYVAV TDEG   LGRRDI+V WRG+I+TLEW++D  F+LV A  IFG  +   QVH+
Sbjct  115   WMGYVAVTTDEGTELLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQ  174

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             G+Y++Y+S +  S FN  SARDQVL EV+RLVE YK+EE+SITVCGHSLGAALATLNA D
Sbjct  175   GWYSIYTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAAD  234

Query  719   IAKNGTNTTSAGKSFP--VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  NG N T      P  VT FV+ASPR G+ +FK  +    +L  +R+RN+PDIVP  P
Sbjct  235   IVANGYNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP  294

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY+DVG ELTID  KS Y+K PGDL S+H LE  LHG+AGT+G    + F+L  
Sbjct  295   P----LGYSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTTTKE-FKL--  347

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
                                        +NKGMVQQDDGSWKL+D+E
Sbjct  348   ---------------------------QNKGMVQQDDGSWKLMDHE  366



>gb|EEE64776.1| hypothetical protein OsJ_19632 [Oryza sativa Japonica Group]
Length=287

 Score =   286 bits (731),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 154/292 (53%), Positives = 203/292 (70%), Gaps = 15/292 (5%)
 Frame = -2

Query  1073  MGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQ--V  906
             MGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+D +F  VPA  + GA A  +P+  V
Sbjct  1     MGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAIV  60

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S N DS +N  SARDQVL EV+RL+ELYK+E  SITV GHSLGA+LATLNA
Sbjct  61    HRGFLSVYTSSNKDSKYNKASARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLNA  120

Query  725   IDIAKNGTNT-----TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDI  561
             +DI  NG N      +S+    PVT  V+ASPR GD  FK A+ + P+L  + ++N  D+
Sbjct  121   VDIVANGANCPPASSSSSQPPCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGDV  180

Query  560   VPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG  381
             VP  PP    +GY DV V+L I  ++S Y++ PG + + H LE YLHG+AG +G+    G
Sbjct  181   VPMYPP----LGYVDVAVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSA--GG  234

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             F+L VDRD++L NK +D LK++Y +P  WW+ KN+ MV+  DG W L D E+
Sbjct  235   FKLEVDRDVALANKGVDALKDKYPVPPRWWVSKNRCMVKDADGHWALHDFEQ  286



>gb|EMS68153.1| Phospholipase A1-II 7 [Triticum urartu]
Length=388

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 191/276 (69%), Gaps = 11/276 (4%)
 Frame = -2

Query  1046  EGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----VHRGFYNLYS  879
              G  ALGRRDI+V WRGTI+ LEWV+DL+F  VPA  + G+ AS      VHRGF ++Y+
Sbjct  115   HGAAALGRRDIVVAWRGTIKNLEWVNDLDFTPVPATPVLGSAASQNRFAVVHRGFLSVYT  174

Query  878   SENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDIAKNGTN  699
             S N  S F   SA+DQVL EV+RLVELYK+EEVSITVCGHSLGA+LATLNA+D+  +G N
Sbjct  175   SSNKSSEFTKTSAKDQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLVSSGAN  234

Query  698   T-TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPATPLIGY  522
                S+ KSFPVT  V+ASP  GD  F++A+++ P+L  + ++N  DIVP  PP    +GY
Sbjct  235   KPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPMYPP----LGY  290

Query  521   TDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRDISLVN  342
              DV VELTI   +S Y++ P  + + H LE YLHG+AG +G+    GF+L V+RD++LVN
Sbjct  291   VDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSA--GGFKLEVERDVALVN  348

Query  341   KLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
             K  D L  E+ +P  WW+ K+K MV+  DG W L D
Sbjct  349   KGADALTNEHPVPAEWWVPKHKFMVKGKDGRWALQD  384



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 196/287 (68%), Gaps = 12/287 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+G+VAVATDEGKTALGRRDI+V WRG+++ +EW+ D +F L  A  I G   +P  HR 
Sbjct  114   WIGFVAVATDEGKTALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRC  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEV-KRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             + ++Y+S +P S FN +SARDQV   +  RLV+ YK+EE+SIT+ GHSLGAAL TL A D
Sbjct  174   WVSIYTSHDPKSRFNKQSARDQVYIYIPTRLVDKYKDEEISITITGHSLGAALGTLCAAD  233

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I  N  N       KS PVT F++ SPR GD NF+N   +  NLHL+R+ NVPDIV  +P
Sbjct  234   IVANKFNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRVTNVPDIVTTLP  293

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P      Y++VG EL ID   S ++K PG   +WH LE +LHG+AGT+G+    GF L V
Sbjct  294   PEG---YYSEVGQELVIDTRFSNFLKFPGCYDTWHSLEAHLHGVAGTQGSK--GGFHLEV  348

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DR I+LVNK+LD LK+EY +P +WW  +NKGM     GSW+L D+E+
Sbjct  349   DRSIALVNKMLDALKDEYPVPASWWCMRNKGM----KGSWELKDHEK  391



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 204/293 (70%), Gaps = 15/293 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQ--  909
             WMGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+D +F  VPA  + GA A  +P+  
Sbjct  120   WMGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAI  179

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y+S N DS +N  SARDQVL EV+RL+ELYK+E  SITV GHSLGA+LATLN
Sbjct  180   VHRGFLSVYTSSNKDSKYNKASARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLN  239

Query  728   AIDIAKNGTNT-----TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPD  564
             A+DI  NG N      +S+    PVT  V+ASPR GD  FK A+ + P+L  + ++N  D
Sbjct  240   AVDIVANGANCPPASSSSSQPPCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGD  299

Query  563   IVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             +VP  PP    +GY DV V+L I  ++S Y++ PG + + H LE YLHG+AG +G+    
Sbjct  300   VVPMYPP----LGYVDVAVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSA--G  353

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             GF+L VDRD++L NK +D LK++Y +P  WW+ KN+ MV+  DG W L D E+
Sbjct  354   GFKLEVDRDVALANKGVDALKDKYPVPPRWWVSKNRCMVKDADGHWALHDFEQ  406



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 190/285 (67%), Gaps = 11/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  +  Q+H G
Sbjct  64    WMGYVAVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNG  123

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY+LY+S+N        SAR QVL E+ RLVELYKNEE+SITV GHSLG ALAT++++DI
Sbjct  124   FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  183

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N       K+ PVT F + SPR G+ NF+  +    +L  + IRN  DIV    P
Sbjct  184   VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIV----P  239

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
             ++  + Y+ VG EL ID  KS Y+K      S H +E YLHGIAGT+G+    GF L V+
Sbjct  240   SSLRLAYSKVGEELEIDTEKSKYLKSG---VSAHNMEVYLHGIAGTQGSK--GGFNLEVN  294

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDI+L+NK  D LK+EY IP NW + +NKGMVQQ DG+WKL+D+ 
Sbjct  295   RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDDH  339



>ref|XP_008345355.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=407

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 191/286 (67%), Gaps = 10/286 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV T EGK  LGRRDI+V WRGT    EW  DL F LV A +I G    P+VH G
Sbjct  127   WLGYVAVTTXEGKEVLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHG  186

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F++ Y+S +P+S ++  S R QVL  +K +V+ YK+EE+SITVCGHS+G A A LNA DI
Sbjct  187   FHSYYNSADPESPYSKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDI  246

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N  T    K+  VT  V+ASPR GD  F + + +  NLH++R+ N  DIVP +P 
Sbjct  247   VCNGYNKPTDRPDKACLVTSIVFASPRLGDQGFHDVFSSLKNLHVLRVTNSYDIVPHLP-  305

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
               PL  Y DVG EL ID  KS Y+K     A  H LE YLHG+AGT+G    +GF+LV++
Sbjct  306   --PLEKYVDVGKELKIDTLKSPYLKNAKKDA--HRLEIYLHGVAGTQGR---NGFQLVIN  358

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             RDI+LVNK LD LK+EY +   WW EKNK MVQ DDGSW LLD+E+
Sbjct  359   RDIALVNKKLDGLKDEYNVIVKWWTEKNKSMVQMDDGSWVLLDHEK  404



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 190/291 (65%), Gaps = 14/291 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  113   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  172

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRG+ +LY+SE+  S  N +SAR QVL E+ RL++ YK+EE SITV GHSLGA LATLN
Sbjct  173   VHRGYLSLYTSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLN  232

Query  728   AIDIAKNGTNTTSAGKS----FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDI  561
             A DIA N  NT+S   S     PVT  V+ SPRTGD  F++A+    +L ++R+RN PD 
Sbjct  233   AADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDR  292

Query  560   VPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG  381
             +P  PP    +GY DVGVEL ID   S +++  G  +  H LE +LHG+AG  G     G
Sbjct  293   IPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHR--G  346

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             FELVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W L D+E
Sbjct  347   FELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  397



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 190/291 (65%), Gaps = 14/291 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  108   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  167

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRG+ +LY+SE+  S  N +SAR QVL E+ RL++ YK+EE SITV GHSLGA LATLN
Sbjct  168   VHRGYLSLYTSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLN  227

Query  728   AIDIAKNGTNTTSAGKS----FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDI  561
             A DIA N  NT+S   S     PVT  V+ SPRTGD  F++A+    +L ++R+RN PD 
Sbjct  228   AADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDR  287

Query  560   VPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG  381
             +P  PP    +GY DVGVEL ID   S +++  G  +  H LE +LHG+AG  G     G
Sbjct  288   IPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHR--G  341

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             FELVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W L D+E
Sbjct  342   FELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  392



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 199/292 (68%), Gaps = 14/292 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASP--Q  909
             +MGYVAVATDEG  ALGRRDI+V WRGT+++LEWV+DL F  VPA  + G  A A+P   
Sbjct  122   FMGYVAVATDEGAAALGRRDIVVAWRGTVQSLEWVNDLTFTPVPAAPVLGKKAAANPLAM  181

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF +LY+S +  S FN  SARDQV  EV+RLVELYK+EE+SIT+ GHSLGAA++ LN
Sbjct  182   VHMGFLSLYTSSHAGSKFNKTSARDQVFEEVRRLVELYKDEELSITITGHSLGAAISILN  241

Query  728   AIDIAKNGTNTTSAG---KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             A+DI  NG N  + G    + PVT FV+A P  GD  F+ A+ +  +L  + ++N  D+V
Sbjct  242   AVDIVSNGVNVPAGGGGSAACPVTAFVFACPHVGDRFFRAAFHSFRDLRALHVKNAGDVV  301

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P  PP    + Y DV V L I+  +S Y+K PG + + H LE YLHG+AG +G+    GF
Sbjct  302   PMYPP----LAYVDVAVTLNINTGRSPYLKWPGTVLTLHNLECYLHGVAGEQGSA--GGF  355

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQD-DGSWKLLDNEE  225
             +L V RD++LVNK  D LK+EY +P +WW  +NKGMV+ D DG  KL D ++
Sbjct  356   KLEVKRDVALVNKGADALKDEYPVPASWWALENKGMVKDDADGLLKLNDFQQ  407



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 186/287 (65%), Gaps = 30/287 (10%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  906
             WMGYVAVATD G  ALGRRDI+V WR T R  EW SDL+F LVPA  I G G   + P V
Sbjct  106   WMGYVAVATDRGAAALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYV  165

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
             HRGF ++Y+S+N  S FN +SAR+QVL EV+ L++ YKNE+ SI++ GHSLG AL+TLNA
Sbjct  166   HRGFLSVYTSKNSTSRFNRRSAREQVLTEVRALLDTYKNEDCSISITGHSLGGALSTLNA  225

Query  725   IDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             ID+  NG                         NFK A+ A   L L+R+RNVPDIVP + 
Sbjct  226   IDLVANG------------------------FNFKKAFHAMAGLSLLRVRNVPDIVPTIL  261

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P  P+I Y DVGVEL +D  KS Y+K     A WH LE YLHG+AGT GAG   GF L V
Sbjct  262   P--PVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGAGDSAGFGLEV  318

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             DRD++L+NK  D L++EY +P  WW E NKGMV+   G W L D+E+
Sbjct  319   DRDLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVLHDHEQ  365



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 149/285 (52%), Positives = 188/285 (66%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVA ATDEG   LGRRDI+V WRGT R LEWV+DL+     A  I G     G+ P 
Sbjct  115   WMGYVAAATDEGAARLGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGPEGADGSDPS  174

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRG+ +LY+S +P S  + +SAR QVL E+ RL++ YK+EE SITV GHSLGA LATLN
Sbjct  175   VHRGYLSLYTSADPGSELSKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLN  234

Query  728   AIDIAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
             A+DIA N  N    +  ++ PVT  V+ SPRTGD +F++A+   P L ++R+RN PD +P
Sbjct  235   AVDIAANSYNRFALNGRRATPVTAVVFGSPRTGDRDFRDAFHRVPGLRMLRVRNRPDRIP  294

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
               PP    +GY DVGVEL ID  +S ++KP G  +  H LE +LHGIAG  G      FE
Sbjct  295   LYPP----VGYADVGVELLIDTRRSPFLKPHGSESQSHDLECHLHGIAGWHGEH--GAFE  348

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             LVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W L
Sbjct  349   LVVDRDVALVNKFDDCLADEYPVPVGWKVNHNKNMVKGRDGRWVL  393



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 193/296 (65%), Gaps = 16/296 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--------AG  921
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+  L  A  I G         G
Sbjct  114   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGGGGGSGG  173

Query  920   ASPQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAAL  741
             + P VHRG+ +LY+S+   S  + +SAR QVL E+ RL++ YK EE SITV GHSLGA +
Sbjct  174   SDPSVHRGYLSLYTSDYEGSNLSKQSARMQVLTEIVRLMDKYKGEETSITVVGHSLGATM  233

Query  740   ATLNAIDIAKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVP  567
             ATLNA+DIA N  N       +  PVT  V+ SPRTGD +F++ +  TP+L ++R+RN P
Sbjct  234   ATLNAVDIAANAYNKIPGYDSRRAPVTAIVFGSPRTGDQDFRDVFHRTPDLRMLRVRNRP  293

Query  566   DIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLL  387
             D +P  PP    +GY DVGVEL ID  +S ++K  G  +  H LE +LHGIAG +G    
Sbjct  294   DRIPHYPP----VGYADVGVELLIDTRRSPFLKHHGSESQSHDLEVHLHGIAGWQGD--R  347

Query  386   DGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGY  219
              GFELVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W L D++  Y
Sbjct  348   GGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGGDGRWVLEDHDPDY  403



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 200/294 (68%), Gaps = 22/294 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  900
             W+G+VAVATDEGK ALGRRDI++ WRGT    E   D ++ LV   +IFG    +  VH+
Sbjct  125   WIGFVAVATDEGKVALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHK  184

Query  899   GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             GFY++Y+  N  S FN   SARDQVL E+KRL++ Y  EE+SI+V G S+G++L TL AI
Sbjct  185   GFYSVYTCLNEASNFNRTTSARDQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAI  244

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  N  N     K FPVT F+++SPR G+ NFK AY    NLH++RI NVPD +P++  
Sbjct  245   DIVVNEIN-----KEFPVTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKLME  299

Query  542   ATPLIG--------YTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLL  387
                + G        Y DVG EL ID TKS Y+K   D+ S H LE YLHGIAGT G   +
Sbjct  300   RGQVEGCAITEWRAYEDVGFELVIDTTKSEYLKK--DIFS-HFLEVYLHGIAGTHG---V  353

Query  386   DG-FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             +G F+L ++RDI+LVNK  D+LKEEY +P  WWIEKNKGMVQQ+DGSW L+D+E
Sbjct  354   EGEFKLEINRDIALVNKQGDFLKEEYGVPSAWWIEKNKGMVQQEDGSWILIDHE  407



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 200/326 (61%), Gaps = 51/326 (16%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG  ALGRRDI+V WRGT++ +EWV+DL+F  VPA  + G+ AS      
Sbjct  151   WMGYVAVATDEGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAGPVLGSAASQHRLAV  210

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQ----------------------------------  831
             VH GF ++Y+S N  S F   SARDQ                                  
Sbjct  211   VHHGFLSMYTSSNKSSEFTKTSARDQRGLVCGRLSLRPYARLLAHTQSWQLPCVSAGYMV  270

Query  830   ------VLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDIAKNGTNTTSAG-KSFP  672
                   V+ EV+RLVELYKNEEVSITVCGHSLGA++ATLNA+D+  +G N      KSFP
Sbjct  271   TAIALLVVKEVRRLVELYKNEEVSITVCGHSLGASVATLNAVDLVSSGINKPEGSTKSFP  330

Query  671   VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVELTID  492
             VT  V+ASP  G   F++A+++ P+L  + ++N  D+VP  PP    +GY DV VELTI 
Sbjct  331   VTAIVFASPHVGCRFFRSAFNSFPDLKALHVQNAGDVVPMYPP----LGYVDVAVELTIR  386

Query  491   VTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEY  312
               +S Y++ P  + + H LE YLHG+AG +G+    GF+L VDRDI+LVNK  D L +E+
Sbjct  387   TIRSPYIRKPATVGTLHNLECYLHGVAGEQGSA--GGFKLEVDRDIALVNKGADALTDEH  444

Query  311   CIPGNWWIEKNKGMVQQDDGSWKLLD  234
              +P  WW+ ++K MV+ +DG W L D
Sbjct  445   PVPACWWVPRHKFMVKGEDGRWTLQD  470



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 152/284 (54%), Positives = 190/284 (67%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  +  Q+H G
Sbjct  114   WMGYVAVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY+LY+S+N        SAR QVL E+ RLVELYKNEE+SITV GHSLG ALAT++++DI
Sbjct  174   FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  233

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N       K+ PVT F + SPR G+ NF+  +    +L  + IRN  DIV    P
Sbjct  234   VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIV----P  289

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
             ++  + Y+ VG EL ID  KS Y+K      S H +E YLHGIAGT+G+    GF L V+
Sbjct  290   SSLRLAYSKVGEELEIDTEKSKYLKSG---VSEHNMEVYLHGIAGTQGSK--GGFNLEVN  344

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDN  231
             RDI+L+NK  D LK+EY IP NW + +NKGMVQQ DG+WKL+D+
Sbjct  345   RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDD  388



>ref|XP_006428645.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
 ref|XP_006480462.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|ESR41885.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
Length=410

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/298 (54%), Positives = 193/298 (65%), Gaps = 14/298 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  903
             W+GYVAVATDEGK  LGRRDI++ WRGT    EW  D+EF L  A +IF    G +P+VH
Sbjct  106   WIGYVAVATDEGKAVLGRRDILISWRGTQSAAEWFKDIEFSLTAASDIFEDTYGPTPEVH  165

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
              GF++LY   +  S +N  SA+DQV   V+ LV+ YK EE+SITV GHSLG+ALATLNA 
Sbjct  166   SGFHSLYVKSDSASTYNKSSAKDQVRSAVRTLVDKYKEEEMSITVIGHSLGSALATLNAA  225

Query  722   DIAKNGTNT---TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             D+  NG N    + A     VT  V+ASPR G+  FK  ++   +LHL+RI N  DIVP 
Sbjct  226   DLVANGYNKPTGSDAASGCMVTAIVFASPRVGNSAFKTVFEDLNHLHLLRITNKDDIVPD  285

Query  551   VPPA-TPLI--GYTDVGVELTIDVTKSGYVKPPG-DLASWHLLEPYLHGIAGT-KGAGLL  387
             +PP   P I  GY  VG EL ID TKS YVK     L+  H LE YLHGIAGT KG    
Sbjct  286   LPPRYLPHIAMGYVHVGQELKIDTTKSTYVKKRKPSLSVLHNLENYLHGIAGTPKGDDDD  345

Query  386   DGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVP  213
             D FEL +DRDI+LVNK LD L+ +Y +P NWW  KNK MVQ D+G WKL    E YVP
Sbjct  346   DDFELAIDRDIALVNKGLDLLEVKYGVPPNWWAVKNKSMVQLDNGFWKL----EDYVP  399



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 193/296 (65%), Gaps = 17/296 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATD+G  ALGRRDI+V WRGT+ +LEWV+DL+FL   A  + G  A       
Sbjct  134   WMGYVAVATDDGVAALGRRDIVVAWRGTLESLEWVNDLDFLPASAAPVLGPAAEEHGNAV  193

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF  +Y++ + DS +N  SARDQVL EVKRL+EL+K E  SIT+ GHSLGA+LA LN
Sbjct  194   VHHGFLTVYTASDEDSKYNKTSARDQVLEEVKRLMELHKGEVTSITLTGHSLGASLAILN  253

Query  728   AIDIAKNGTNTTSAGKS-------FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNV  570
             A+DI  NG NT S   S        PVT  V+A P  G+ +FK+A+ +  +L  + + N 
Sbjct  254   AVDIVSNGLNTPSTSSSSSSQLPPCPVTAIVFACPHVGNDDFKSAFASFSDLRALHVINA  313

Query  569   PDIVPQVPPATPLIGYTDVG-VELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAG  393
              DIVP  PP    IGY DV    L ID ++S Y++ PG   +WH LE YLHG+AG +G G
Sbjct  314   RDIVPLYPP----IGYVDVATAALRIDTSRSPYLRSPGTPQTWHNLECYLHGVAGEQG-G  368

Query  392   LLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
                GF L VDRD++LVNK  D LK+EY +P NWW+  NKGMV+   G WKL D EE
Sbjct  369   QGRGFRLEVDRDVALVNKGSDALKDEYPVPANWWVVSNKGMVRGAGGHWKLKDFEE  424



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/298 (53%), Positives = 196/298 (66%), Gaps = 15/298 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI+V WRGTI   EWV DL F L  AP IF   A  +VH G
Sbjct  113   WIGYVAVATDEGKAALGRRDIVVAWRGTINAAEWVQDLHFHLDSAPLIFD-DARAKVHHG  171

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             FY++Y+S  P S FN    R QVL EV+RLVE Y  KNEE+SITV GHSLGAALAT+NA+
Sbjct  172   FYSVYTSNKPGSEFNDTCVRHQVLEEVRRLVEEYNRKNEEISITVIGHSLGAALATINAV  231

Query  722   DIAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DI   G N       K+  VT FV+ASPR G+ +F   +    +L  +RIRN  D+VP++
Sbjct  232   DIVAKGLNIPKDQPEKACSVTTFVFASPRVGNSHFAKIFTGHKHLRALRIRNETDVVPKL  291

Query  548   PPATPLI--GYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAG--LLDG  381
             P        G++DVG EL ID TKS Y+K      S H LE YLHG+AGT+G    + D 
Sbjct  292   PLKHLFFLDGFSDVGEELVIDTTKSKYLKKE---VSAHNLEVYLHGVAGTQGKNGEIFDL  348

Query  380   FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD-NEEGYVPL  210
              E +  RDI+L+NK  D LK+EY  P  W + +NKGMVQQ DG+WKL+D N++G + L
Sbjct  349   DESL--RDIALLNKSKDALKDEYHCPVAWRVHENKGMVQQKDGTWKLMDHNKDGILFL  404



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 190/289 (66%), Gaps = 11/289 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W GYVAVATDEGK ALGRRDI++ WRGTIR  EW  +L F  V AP  FG  + P VH+G
Sbjct  114   WNGYVAVATDEGKVALGRRDILIVWRGTIRKSEWNENLTFWFVKAPLFFGQNSDPLVHKG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y++ N DS  N KSARDQ+  EV RLVELYK+E++SITV GHSLG+++ATLNA+D+
Sbjct  174   WYDMYTTINQDSQLNEKSARDQIREEVARLVELYKDEDISITVTGHSLGSSMATLNAVDL  233

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP--  543
             A N  N     K+  VT F+YASP+ GD NFKN      NL  +RI +V DIV  VPP  
Sbjct  234   AANPINNN---KNILVTAFLYASPKVGDENFKNVISNQQNLRALRISDVNDIVTAVPPFG  290

Query  542   ----ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
                     I Y DVGV L ID  KS Y+KP     S H L  Y+H I G +G+    GFE
Sbjct  291   WKEGDNTAILYGDVGVGLVIDSKKSHYLKPDFPNLSTHDLMLYMHAIDGYQGSQ--GGFE  348

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
                D D++ VNK  DYLK EY IP  W+  K+KGMVQQDDG++ L D+E
Sbjct  349   RQEDFDLAKVNKYGDYLKAEYPIPIGWFNIKDKGMVQQDDGNYILDDHE  397



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score =   282 bits (722),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 192/288 (67%), Gaps = 16/288 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  903
             WMGY+AVATDEGK ALGRRDI++ WRGTI  +EW  D EF LVPA +I G   G++  VH
Sbjct  116   WMGYIAVATDEGKAALGRRDILIAWRGTIMPIEWEKDFEFPLVPASKILGKCGGSNAHVH  175

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             +GF ++Y++ NP S ++  SARDQVL E+K+L+E YK+EE+SIT+ GHSLG AL+TL A 
Sbjct  176   QGFLSIYTATNPRSKYSKTSARDQVLSELKKLIEQYKHEELSITLTGHSLGGALSTLCAT  235

Query  722   DIAKNGTNTTSAG--KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             DI  NG N       K+ PVT F Y +P  GD NFK+  ++  +LH++ I NVPDIVP+ 
Sbjct  236   DIVCNGYNKICHNPYKTCPVTAFRYGAPMVGDSNFKHTAESMNDLHMLSIHNVPDIVPK-  294

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLE-PYLHGIAGTKGAGLLDGFEL  372
              PA P  GYT VG E  +D  KS Y+  PGD  +WH LE  YLH +A   G         
Sbjct  295   SPAMP--GYTRVGQEHFVDSKKSPYLTFPGDTYTWHNLEGAYLHSLAIENGG--------  344

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
                RD++LVNK    LK +Y IP +WW E+NKGMVQ+ DGSW+L D E
Sbjct  345   EPKRDLALVNKGSGALKPKYGIPFSWWCEENKGMVQKSDGSWQLRDYE  392



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   290 bits (742),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 193/285 (68%), Gaps = 13/285 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I GA    G+ P 
Sbjct  317   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGAEGADGSEPS  376

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRG+ +LY+S +  S  + +SAR QVL E+ R+++ YK+E+ SITV GHSLGA LATLN
Sbjct  377   VHRGYLSLYTSADEGSEISKQSARMQVLTEIARMMDKYKDEQTSITVVGHSLGATLATLN  436

Query  728   AIDIAKNGTNTT---SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             A+DIA N  N +   +AG   PVT  V+ SPRTGD +F++ +   P L ++R+RN PD +
Sbjct  437   AVDIAANYYNKSALCTAGSRAPVTAVVFGSPRTGDRDFRDIFHRLPGLRMLRVRNRPDRI  496

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P  PP    +GY DVGVEL ID  +S ++KP G+ +  H LE +LHGIAG +G      F
Sbjct  497   PLYPP----VGYADVGVELLIDTRRSLFLKPHGNESQSHDLECHLHGIAGWQGEH--GEF  550

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWK  243
             ELVVDRDI+LVNK  D L +E+ +P  W +  NK MV+  DGSW+
Sbjct  551   ELVVDRDIALVNKFDDCLTDEHPVPVGWKVHHNKNMVKGTDGSWR  595



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 149/293 (51%), Positives = 191/293 (65%), Gaps = 14/293 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             W+GYVAVATDEG   LGRRD++V WRGT++ LEW +D  F  V A  + G+ A+      
Sbjct  139   WIGYVAVATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAANPLAV  198

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH+GF ++Y+S N DS FN  SARDQVL EV+RL+ELYK E  SITV GHSLGAALATLN
Sbjct  199   VHQGFLSVYTSSNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLN  258

Query  728   AIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDAT-PNLHLMRIRNVPDI  561
             A+DIA NG N  S        PVT  ++A P  GD  F+ A+     +L  + +RN  D+
Sbjct  259   AVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGYFRDLRALHVRNAGDV  318

Query  560   VPQVPPATPLIGYTDVGVE-LTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             VP VPP    + Y DV V  L ID ++S Y++ PG   + H LE YLHG+AG +G+    
Sbjct  319   VPVVPP----LAYVDVAVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAGEQGSA-AG  373

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             GF L VDRD++LVNK  D L++EY +P NWW+ +N+ MV+  DG W L D EE
Sbjct  374   GFRLEVDRDVALVNKGADALRDEYPVPANWWVPENRWMVRGSDGHWVLKDFEE  426



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 193/292 (66%), Gaps = 22/292 (8%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLE----FLLVPAPEIFGAGASP-  912
             WMGYVA  TD GKT  GRRDI V WRGT+++LEWV+D +     L    P+  G      
Sbjct  116   WMGYVAHVTDTGKTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETD  175

Query  911   -------QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEE-VSITVCGHS  756
                    +V RG++++Y+SE+  S FN  SAR+QVL EVKRL+E YK+EE +SIT  GHS
Sbjct  176   KVLRNDVRVQRGWFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHS  235

Query  755   LGAALATLNAIDIAKNGTNTTSAGKSFP--VTGFVYASPRTGDHNFKNAYDATPNLHLMR  582
             LGA LATL A DI  NG N  S G++ P  VT  V+ASPR G+  FK   D  P+L ++R
Sbjct  236   LGATLATLCAFDIVINGLNKPS-GRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLR  294

Query  581   IRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTK  402
             + N PD+VP      P +GY +VGVEL +D  KS Y+K PGD + WH LE YLH +AGT+
Sbjct  295   VTNNPDLVP----LHPFLGYVEVGVELRVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQ  350

Query  401   GAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSW  246
             G      F+L VDRDI+LVNK  D+LK+EY +P +WW+EKNKGMVQ +DG W
Sbjct  351   GKN--GAFKLEVDRDIALVNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHW  400



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/292 (52%), Positives = 193/292 (66%), Gaps = 22/292 (8%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLE----FLLVPAPEIFGAGAS--  915
             WMGYVA  TD GKT  GRRDI V WRGT+++LEWV+D +     L    P+  G      
Sbjct  116   WMGYVAHVTDTGKTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETD  175

Query  914   ------PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEE-VSITVCGHS  756
                    +V RG++++Y+SE+  S FN  SAR+QVL EVKRL+E YK+EE +SIT  GHS
Sbjct  176   KVLRNDARVQRGWFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHS  235

Query  755   LGAALATLNAIDIAKNGTNTTSAGKSFP--VTGFVYASPRTGDHNFKNAYDATPNLHLMR  582
             LGA LATL A DI  NG N  S G++ P  VT  V+ASPR G+  FK   D  P+L ++R
Sbjct  236   LGATLATLCAFDIVINGLNKPS-GRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLR  294

Query  581   IRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTK  402
             + N PD+VP      P +GY +VGVEL +D  KS Y+K PGD + WH LE YLH +AGT+
Sbjct  295   VTNNPDLVP----LHPFLGYVEVGVELPVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQ  350

Query  401   GAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSW  246
             G      F+L VDRDI+LVNK  D+LK+EY +P +WW+EKNKGMVQ +DG W
Sbjct  351   GKN--GAFKLEVDRDIALVNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHW  400



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 187/285 (66%), Gaps = 41/285 (14%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV  D+G  ALGRRDI                                   VH+G
Sbjct  144   WIGYVAVTDDQGTAALGRRDI-----------------------------------VHQG  168

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y S++  S FN  +ARDQVL E+ RL+E YK+E++SI++CGHSLGAA+ATLNA DI
Sbjct  169   WYSIYMSKDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADI  228

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N   +   KS PVT FV+ASPR GD +FK  +    +L ++R+RN+PD+VP  PP
Sbjct  229   VANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVPIYPP  288

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY +VG EL ID  KS Y+K PGDLA++H LE YLHG+AGT+G    D F L V 
Sbjct  289   ----LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDVK  344

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDI LVNK +D LK+EY +PG+W I KNKGMVQQ+DGSWKL+D+E
Sbjct  345   RDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQNDGSWKLMDHE  389



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 200/296 (68%), Gaps = 24/296 (8%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  900
             W+G+VAVATDEGK ALGRRDI++ WRGT    E   D ++ LV   +IFG    +  VH+
Sbjct  125   WIGFVAVATDEGKVALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHK  184

Query  899   GFYNLYSSENPDSAFN-IKSARDQ--VLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             GFY++Y+  N  S FN   SARDQ  VL E+KRL++ Y  EE+SI+V G S+G++L TL 
Sbjct  185   GFYSVYTCLNEASNFNRTTSARDQRQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLC  244

Query  728   AIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             AIDI  N  N     K FPVT F+++SPR G+ NFK AY    NLH++RI NVPD +P++
Sbjct  245   AIDIVVNEIN-----KEFPVTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKL  299

Query  548   PPATPLIG--------YTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAG  393
                  + G        Y DVG EL ID TKS Y+K   D+ S H LE YLHGIAGT G  
Sbjct  300   MERGQVEGCAITEWRAYEDVGFELVIDTTKSEYLKK--DIFS-HFLEVYLHGIAGTHG--  354

Query  392   LLDG-FELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              ++G F+L ++RDI+LVNK  D+LKEEY +P  WWIEKNKGMVQQ+DGSW L+D+E
Sbjct  355   -VEGEFKLEINRDIALVNKQGDFLKEEYGVPSAWWIEKNKGMVQQEDGSWILIDHE  409



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 194/293 (66%), Gaps = 19/293 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  900
             W+G+VAVATD+GK ALGRRDI++ WRGT+   EW  D +++LVP  +IFG       VHR
Sbjct  131   WIGFVAVATDDGKVALGRRDILIAWRGTMSPAEWNDDYDWVLVPPTKIFGENTHDILVHR  190

Query  899   GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             GFY++Y+S N  S FN   SARDQV+ EVKRLVE YK ++VSIT+ GHS+G++LATL A+
Sbjct  191   GFYSVYTSLNEASKFNRTTSARDQVIEEVKRLVEQYKGDKVSITLSGHSIGSSLATLCAV  250

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  N  N     K FPVT F+ ASPRTG+ NFK AY    NL ++RI N  D VP+ P 
Sbjct  251   DIVVNQIN-----KEFPVTAFLLASPRTGEANFKKAYQNLKNLQILRITNALDEVPEKPD  305

Query  542   ATPLIG-------YTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
                + G       Y  VG EL ID TKS Y+K      + H +E YLHGIAGT GA    
Sbjct  306   RGQVEGSETDWRVYEHVGFELKIDTTKSEYLKKD---VNNHTVEVYLHGIAGTHGAE--G  360

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              F+L ++RDI+LVNK  D LK EY +P  W I +NKGMVQQ+DGSW L D E+
Sbjct  361   EFKLEINRDIALVNKEADALKNEYGVPVYWRIVQNKGMVQQEDGSWSLNDRED  413



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/290 (50%), Positives = 189/290 (65%), Gaps = 21/290 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK ALGRRDI+V WRGT+++LEW+ D++F++VP   +            
Sbjct  119   WIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRD---------  169

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
                L +  + +S+ N  SARDQVL EV +LV +Y++EE+SITV GHSLGAALATLNA DI
Sbjct  170   --KLPTPWDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDI  227

Query  716   AKNGTNTTSAGKSF----PVTGFVYASPRTGDHNFKNAYDATP--NLHLMRIRNVPDIVP  555
              +NG N      +     PVT FV+ASPR G H FK  +D      L L+R+RN  D+VP
Sbjct  228   VENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVP  287

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             + PPA P   Y  VG EL ID  +S Y++ PG+   WH LE YLHG+AG +G G    F+
Sbjct  288   RYPPAPP---YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARG-GEAGRFK  343

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             L V+RD++L NK    L++E+ +P  WWI  N+GMV+  DG W L+D EE
Sbjct  344   LAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREE  393



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 192/293 (66%), Gaps = 15/293 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA----SPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+DL+F    A  + G  A    S  
Sbjct  127   WMGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDLDFTPASAEPVLGPAAGDFDSAV  186

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF ++Y+S + DS FN +SARDQV  EV+RL+E +K E  SITV GHSLGA+LATLN
Sbjct  187   VHHGFLSVYTSSDEDSKFNQQSARDQVTEEVRRLMEAHKEEATSITVTGHSLGASLATLN  246

Query  728   AIDIAKNGTNT----TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDI  561
             A+D+  +G N            PVT  ++ASP  GD +FK+A+ + P+L  + +RN  D+
Sbjct  247   AVDMVSHGVNVPPSSPQQQPPCPVTAILFASPHVGDDSFKSAFASFPDLRALHVRNAGDV  306

Query  560   VPQVPPATPLIGYTDVGVE-LTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             VP  PP    +GY D     L +D  +S Y+K PG + + H LE YLHG+AG +GA    
Sbjct  307   VPLYPP----LGYVDAATAVLPVDTGRSPYLKQPGTVQTRHNLECYLHGVAGFQGAS--G  360

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             GF+L VDRD++LVNK  D LK++Y +P NW +  NK MV+  DG WKL D EE
Sbjct  361   GFKLEVDRDVALVNKGADALKDKYPVPPNWHVINNKSMVRDSDGHWKLRDFEE  413



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 190/306 (62%), Gaps = 29/306 (9%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  108   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  167

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQ---------------VLGEVKRLVELYKNEEVSI  774
             VHRG+ +LY+SE+  S  N +SAR Q               VL E+ RL++ YK+EE SI
Sbjct  168   VHRGYLSLYTSEDQCSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSI  227

Query  773   TVCGHSLGAALATLNAIDIAKNGTNTTSAGKS----FPVTGFVYASPRTGDHNFKNAYDA  606
             TV GHSLGA LATLNA DIA N  NT+S   S     PVT  V+ SPRTGD  F++A+  
Sbjct  228   TVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHR  287

Query  605   TPNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPY  426
               +L ++R+RN PD +P  PP    +GY DVGVEL ID   S +++  G  +  H LE +
Sbjct  288   LRDLRMLRVRNRPDRIPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECH  343

Query  425   LHGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSW  246
             LHG+AG  G     GFELVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W
Sbjct  344   LHGVAGWHGDHR--GFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRW  401

Query  245   KLLDNE  228
              L D+E
Sbjct  402   VLQDHE  407



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 190/306 (62%), Gaps = 29/306 (9%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  909
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  108   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  167

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQ---------------VLGEVKRLVELYKNEEVSI  774
             VHRG+ +LY+SE+  S  N +SAR Q               VL E+ RL++ YK+EE SI
Sbjct  168   VHRGYLSLYTSEDQCSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSI  227

Query  773   TVCGHSLGAALATLNAIDIAKNGTNTTSAGKS----FPVTGFVYASPRTGDHNFKNAYDA  606
             TV GHSLGA LATLNA DIA N  NT+S   S     PVT  V+ SPRTGD  F++A+  
Sbjct  228   TVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHR  287

Query  605   TPNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPY  426
               +L ++R+RN PD +P  PP    +GY DVGVEL ID   S +++  G  +  H LE +
Sbjct  288   LRDLRMLRVRNRPDRIPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECH  343

Query  425   LHGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSW  246
             LHG+AG  G     GFELVVDRD++LVNK  D L +EY +P  W +  NK MV+  DG W
Sbjct  344   LHGVAGWHGDHR--GFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRW  401

Query  245   KLLDNE  228
              L D+E
Sbjct  402   VLQDHE  407



>ref|XP_007014120.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY31739.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=428

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 195/295 (66%), Gaps = 14/295 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W GYVAV TD+GK  LGRRDI+V WRGT+   E ++D++F    A E+FG    PQVH G
Sbjct  142   WFGYVAVTTDDGKAVLGRRDILVAWRGTMTDSESINDVQFFPTSASELFGEDNDPQVHSG  201

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F +LY+  + +S ++  SARDQV   V++LV+ Y++E++SITV G+SLGAALATL+A+DI
Sbjct  202   FLSLYTGRSSNSPYSQTSARDQVREAVRKLVDKYQDEDISITVTGYSLGAALATLSAMDI  261

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               +G N  T ++ KS  VT F YA PR G+  FK  ++   +LHL+RI N  DIVP++P 
Sbjct  262   VASGYNKPTGNSEKSCMVTTFTYAGPRVGNEGFKKVFEGLSDLHLLRITNSTDIVPKIP-  320

Query  542   ATPLIG-YTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                L G YT VG EL ID TKS Y+K   D    H L+ YLHG+AG +       F L V
Sbjct  321   --ILFGIYTHVGEELEIDTTKSDYLKSNADA---HNLDVYLHGVAGVQETN--GDFTLEV  373

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKN-KGMVQQDDGSWKLLDNEEGYVPLPP  204
             D DI+L+NK LD LK++Y IP  WW  +N K MVQ DDG WKL+DN   YVP PP
Sbjct  374   DHDIALINKHLDGLKDDYKIPPEWWNNENFKNMVQMDDGHWKLVDN--AYVPDPP  426



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/294 (52%), Positives = 193/294 (66%), Gaps = 15/294 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W GYVAVATDEGKTALGRRDI+V WRGT    EW+ D  F   PA E+FG   + +VH G
Sbjct  97    WFGYVAVATDEGKTALGRRDILVSWRGTGTEPEWIDDARFFTTPAKELFGTDHA-KVHSG  155

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F  +Y+ +  +S +N  SARDQVL  V++LV+ Y+NE++SITV GHSLGAALATLNA DI
Sbjct  156   FLAIYTGKVSNSPYNQTSARDQVLKAVRKLVDKYQNEDISITVVGHSLGAALATLNATDI  215

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             A  G N  T ++ K+  VT F YASP  G+  FK   D    LH++RI N  DI+P++P 
Sbjct  216   AAKGYNKPTDNSNKTCMVTAFAYASPHVGNQEFKEVIDGLIELHILRITNSTDIIPKLP-  274

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                L+GYTDVG  L ID TKS Y++      + H LE +LHG+AG + +G    F+L VD
Sbjct  275   --VLLGYTDVGENLAIDTTKSSYLRQG---INAHNLEVHLHGVAGVQESG---EFKLEVD  326

Query  362   RDISLVNKLLDYLKEEYCIPGNWW-IEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             RDI+L+NK +D L+ +Y IP  WW  EK K MVQ   G W+ +D    YVP PP
Sbjct  327   RDIALINKKIDGLQNKYKIPPEWWNHEKFKNMVQMYTGRWQFVDC--AYVPDPP  378



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 188/284 (66%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  ++ Q+H G
Sbjct  123   WIGYVAVATDEAKEALGRRDIVVVWRGTIQGSEWVQNFNIDLDPAPLIFGPKSNVQIHNG  182

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY+LY+SEN        SAR QVL E+ RLVELYKNEE+SITV GHSLG ALAT++++DI
Sbjct  183   FYSLYTSENSGLPSADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSVDI  242

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N       K+ PVT F + +PR G+  F+  +    +L  + +RN  DIVP+   
Sbjct  243   VANKFNMPKEQPQKACPVTTFAFGAPRVGNSYFQKIFSDHKDLSALFVRNENDIVPK---  299

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
              +    Y  VG EL ID  +S Y+K      S H +E YLHGIAGT+G+    GF L V+
Sbjct  300   -SLTFFYYKVGEELEIDTEESKYLKSG---VSAHNMEVYLHGIAGTQGSK--GGFNLEVN  353

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDN  231
             RDI+L+NK  D LK+EY IP NW + +NKGMVQQ DG+WKL+D+
Sbjct  354   RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDD  397



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/293 (53%), Positives = 192/293 (66%), Gaps = 19/293 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ-VHR  900
             W+G+VAVATDEGK ALGRRDI++ WRGT+   EW  D +++LVP  +IFG       VHR
Sbjct  131   WIGFVAVATDEGKVALGRRDILIAWRGTMCPAEWNDDSDWVLVPPTKIFGENTHDTLVHR  190

Query  899   GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             GFY++Y+S N  S FN   SARDQV+ EVKRLVE YK ++VSIT+ GHS+G++L+TL AI
Sbjct  191   GFYSVYTSLNDASKFNRTASARDQVIEEVKRLVEQYKRDKVSITLSGHSIGSSLSTLCAI  250

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DI  N  N     K FPVT F++ASPRTG+ NFK A+    NL ++RI N  D VP+ P 
Sbjct  251   DIVVNKIN-----KEFPVTAFLFASPRTGEANFKKAHQHLKNLQILRITNALDEVPEKPD  305

Query  542   ATPLIG-------YTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
                + G       Y  VG E+ ID TKS Y+K      + H LE YLHGIAGT G     
Sbjct  306   RGQVEGSDTDWRVYEHVGYEVKIDTTKSEYLKKD---VNNHSLEVYLHGIAGTHGPE--G  360

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
              F+L + RDI+LVNK  D LK EY +P  W   +NKGMVQQ+DGSW L D E+
Sbjct  361   EFKLEITRDIALVNKETDALKNEYGVPVYWRTVQNKGMVQQEDGSWILNDRED  413



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 196/288 (68%), Gaps = 10/288 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             W+GYVAVATDEG   LGRRDI+V WRGT+  LEW +D  F  V A  + G+ A+      
Sbjct  138   WIGYVAVATDEGVAELGRRDIVVAWRGTVTDLEWANDFSFTPVSAAPVLGSSAAANPLAM  197

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH+GF ++Y+S N +S +N  SARDQV  EV+RL++LYK+EE SIT+ GHSLGAALA LN
Sbjct  198   VHQGFLSVYTSSNANSKYNKASARDQVFEEVRRLMQLYKDEETSITITGHSLGAALAVLN  257

Query  728   AIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQV  549
             A+DIA NG N  S+    PVT  V+A P  GD +FK A+D+  +L  + ++N  D+VP V
Sbjct  258   AVDIAANGLNAASSQPPCPVTAVVFACPHVGDRSFKAAFDSFEHLRALHVKNAGDVVPIV  317

Query  548   PPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELV  369
             PP      Y DVGV L ID  +S Y+K PG + + H LE YLHG+AG +G     GF+L 
Sbjct  318   PPVV----YVDVGVLLAIDTGRSPYLKKPGTVQTLHNLECYLHGVAGEQGRA--GGFKLE  371

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             VDRD++LVNK +D L++EY +P NWW+ KNK MV+  DG WKL D +E
Sbjct  372   VDRDVALVNKGVDALEDEYPVPANWWVPKNKWMVRGADGHWKLEDFKE  419



>gb|EMS48809.1| Phospholipase A1-II 6 [Triticum urartu]
Length=454

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 186/282 (66%), Gaps = 33/282 (12%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  903
             W+GYVAVATD GK+ALGRRD++V WRGTI+ L+W +DLEF +V    I G   GA   VH
Sbjct  125   WIGYVAVATDAGKSALGRRDVVVAWRGTIQALQWTNDLEFAMVHPTGIIGDATGADVMVH  184

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             RG+ ++Y+S +P S  N +SAR    G+V++LV  YK+EEVSITV GHSLGAALATL+A 
Sbjct  185   RGWLSIYTSTDPASTHNKESAR----GQVRKLVGTYKDEEVSITVTGHSLGAALATLSAF  240

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DIA+NG N T A  +FPVT F +ASPR G  +FK                      Q  P
Sbjct  241   DIAENGYNCT-ASATFPVTAFAFASPRVGGASFK----------------------QRSP  277

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
             A P   Y DVGVEL ID + S Y+K PGD+  WH LE YLHG+AG   A   +GFE VV+
Sbjct  278   ALP---YHDVGVELVIDTSASPYLKAPGDVNVWHNLECYLHGVAGAPTAS-GEGFEHVVE  333

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLL  237
             RD++LVNK  D LKEE+ +P  WW+  N+GMV+ DDG W LL
Sbjct  334   RDVALVNKSYDALKEEHGVPAAWWVPWNRGMVKGDDGRWSLL  375



>ref|XP_007210039.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
 gb|EMJ11238.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
Length=376

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/283 (50%), Positives = 177/283 (63%), Gaps = 8/283 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAVATDEGK  LGRRDI+V WRGT    EW  D+ F LV A +I G    P+VH G
Sbjct  98    WLGYVAVATDEGKKVLGRRDILVSWRGTELVAEWGIDVVFDLVSASDILGEKHDPKVHHG  157

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F++ Y+  +P S  N  S R Q L  +K +V  YKNE +SITV GHS+GAA+  LNA DI
Sbjct  158   FHSYYTHIDPQSPHNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDI  217

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N        PVT  V+A+PR GD    N +    NLH++R+ N  D++P +P   
Sbjct  218   VYNGYNKPPGHPVCPVTAIVFAAPRLGDQGLSNVFYGLKNLHVLRVTNDYDLIPSLP---  274

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             P   Y  VG EL  D  KS Y+K P    S H LE YLHG+AGT+G    + F+L V RD
Sbjct  275   PFANYLHVGKELRFDTFKSPYLKDPKQ--SLHSLEVYLHGVAGTQGE---NDFKLAVKRD  329

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             ++LVNK LD LK++Y +   WW EKNK M+Q DDGSW L+D+E
Sbjct  330   LALVNKYLDGLKDKYLVVAKWWTEKNKSMLQIDDGSWVLMDHE  372



>gb|EMS63790.1| Phospholipase A1-II 7 [Triticum urartu]
Length=515

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 183/260 (70%), Gaps = 11/260 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG  ALGRRDI+V WRGT++ +EWV+DL+F  VPA  + G+ AS      
Sbjct  151   WMGYVAVATDEGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAAPVLGSAASQHRLAV  210

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF ++Y+S N  S F   SARDQV+ EV+RLVELYK+EEVSIT+CGHSLGA++ATLN
Sbjct  211   VHHGFLSMYTSSNKSSEFTKTSARDQVVKEVRRLVELYKDEEVSITICGHSLGASVATLN  270

Query  728   AIDIAKNGTNTTSAG-KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             A+D+  +G N      KSFPVT  V+ASP  G   F++A+++ P+L  + ++N  D+VP 
Sbjct  271   AVDLVSSGINKPEGSTKSFPVTAIVFASPHVGCRFFRSAFNSFPDLKTLHVQNAGDVVPM  330

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
              PP    +GY DV VELTI   +S Y++ P  + + H LE YLHG+AG +G+    GF+L
Sbjct  331   YPP----LGYVDVAVELTIRTIRSPYMRKPATVGTLHNLECYLHGVAGEQGSA--GGFKL  384

Query  371   VVDRDISLVNKLLDYLKEEY  312
              VDRDI+LVNK  D L +E+
Sbjct  385   EVDRDIALVNKGADALTDEH  404



>ref|XP_006655614.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-II 7-like [Oryza 
brachyantha]
Length=416

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/295 (49%), Positives = 188/295 (64%), Gaps = 17/295 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+DL+F  VPA  + G  A+      
Sbjct  127   WMGYVAVATDEGVAALGRRDIVVAWRGTMESLEWVNDLDFTPVPAAPVLGPAAAANPLAI  186

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF ++Y+S N DS +N  SARDQVL EV+RL+E YK+E  SITV GHSLGA+LATLN
Sbjct  187   VHRGFLSVYTSSNKDSKYNQSSARDQVLEEVRRLMEQYKDEVTSITVIGHSLGASLATLN  246

Query  728   AIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             A+DI  NG N+  AG S    P              +FK A+ + P+L  + ++N  D+V
Sbjct  247   AVDIVANGANSPPAGSSQPPCPXXXXXXXXXXXAPGHFKAAFASFPDLRALHVKNAGDVV  306

Query  557   PQVPPATPLIGYTDVG----VELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGL  390
             P  PP    +GY DV     V+L I   +S Y++ PG + + H LE YLHG+AG +G+  
Sbjct  307   PMYPP----LGYVDVAVKLPVKLPISTGRSPYLRSPGTIETLHNLECYLHGVAGEQGSA-  361

Query  389   LDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
               GF+L VDRD++L NK  D LK++Y +P  WW+ KN  M    DG W L D ++
Sbjct  362   -GGFKLEVDRDVALANKGADALKDQYPVPPGWWVPKNNCMAMGPDGHWSLHDFKQ  415



>ref|XP_008238421.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=376

 Score =   271 bits (693),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/283 (49%), Positives = 176/283 (62%), Gaps = 8/283 (3%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV TDEGK  LGRRDI+V WRGT    EW  D+ F LV A +I G    P+VH G
Sbjct  98    WLGYVAVTTDEGKKVLGRRDILVSWRGTELVEEWGIDIVFDLVSASDILGEKHDPKVHHG  157

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             F++ Y+  +P S  N  S R Q L  +K +V  YKNE +SITV GHS+GAA+  LNA DI
Sbjct  158   FHSYYTHVDPQSPHNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDI  217

Query  716   AKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPAT  537
               NG N        PVT  V+A+PR GD  F N +    NLH++R+ N  D++P +P   
Sbjct  218   VNNGYNKPPGHPVCPVTAIVFAAPRLGDQGFSNVFYGLKNLHVLRVTNDYDLIPSLP---  274

Query  536   PLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRD  357
             P   Y  VG EL  D  KS Y+K P    S H LE YLHG+AGT+G    + F+L V RD
Sbjct  275   PFANYLHVGKELRFDTFKSPYLKDPKQ--SLHSLEVYLHGVAGTQGE---NDFKLAVKRD  329

Query  356   ISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             ++LVNK LD LK++Y +   WW EKNK M+Q  DGSW L+D+E
Sbjct  330   LALVNKYLDGLKDKYLVVAKWWTEKNKSMLQVGDGSWVLMDHE  372



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   273 bits (698),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 191/301 (63%), Gaps = 22/301 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             W+GYVAVATDEG   LGRRD++V WRGT++ LEW +D  F  V A  + G+ A+      
Sbjct  150   WIGYVAVATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVLGSAAAANPLAV  209

Query  908   VHRGFYNLY--------SSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSL  753
             VH+GF ++Y        +S N DS FN  SARDQVL EV+RL+ELYK E  SITV GHSL
Sbjct  210   VHQGFLSVYQLSSLTLTTSCNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSL  269

Query  752   GAALATLNAIDIAKNGTNTTSAGKS---FPVTGFVYASPRTGDHNFKNAYDAT-PNLHLM  585
             GAALATLNA+DIA NG N  S        PVT  ++A P  GD  F+ A+  +  +L  +
Sbjct  270   GAALATLNAVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGSFRDLRAL  329

Query  584   RIRNVPDIVPQVPPATPLIGYTDVGVE-LTIDVTKSGYVKPPGDLASWHLLEPYLHGIAG  408
              +RN  D+VP VPP    + Y DV V  L ID ++S Y++ PG   + H LE YLHG+AG
Sbjct  330   HVRNAGDVVPLVPP----LAYVDVAVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAG  385

Query  407   TKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              K +    GF L VDRD++LVNK  D L++EY +P NWW+ +N+ MV+  +G W L D E
Sbjct  386   -KQSSAAGGFRLEVDRDVALVNKGADALRDEYPVPANWWVPENRWMVRGSEGHWMLKDFE  444

Query  227   E  225
             E
Sbjct  445   E  445



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 192/308 (62%), Gaps = 30/308 (10%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG  ALGRRD++V WRGT+R+LEWV+DL+F  VPA  + G+ A+      
Sbjct  122   WMGYVAVATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAM  181

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VH GF +LY+S N  S +N  SARDQVL EV+RL+ELYK+EE SI+V GHSLGA+LATLN
Sbjct  182   VHGGFLSLYTSSNASSKYNKLSARDQVLEEVRRLMELYKDEETSISVTGHSLGASLATLN  241

Query  728   AIDIAKNGTNTTSAG--------------------KSFPVTGFVYASPRTGDHNFKNAYD  609
             A+D+  NG N   A                        PVT  V+ASPR G   FK A+ 
Sbjct  242   AVDMVANGVNAPGAATATGTSGGSSSSPAQPQPQRAGCPVTAIVFASPRVGGPFFKAAFA  301

Query  608   ATPNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEP  429
             +  +L  + +RN  D+VP  PP    +GY DV V L I   +S +++ PG   + H LE 
Sbjct  302   SFADLRALHVRNKGDVVPLYPP----LGYVDVAVPLPIHTARSPWLRRPGTPQTLHNLEC  357

Query  428   YLHGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGS  249
             YLHG+AG +GA    GF L V RD++LVNK  D L++EY +P  W +  NKGMV+  DG 
Sbjct  358   YLHGVAGEQGAA--GGFRLEVGRDVALVNKGADALRDEYPVPARWRVALNKGMVRGADGR  415

Query  248   WKLLDNEE  225
             W L D E 
Sbjct  416   WALKDFEH  423



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 193/286 (67%), Gaps = 18/286 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP--QVH  903
             WMGYVAV+T+EG  ALGRRDI+V WRGT+  +EW+ D +  L+PA +I G G +   ++H
Sbjct  115   WMGYVAVSTNEGSKALGRRDILVAWRGTVLPVEWMKDADAQLIPATDIMGGGGASGAKLH  174

Query  902   RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAI  723
             +GF+++Y++++  S+FN  SARDQVL EVK+ ++ +K E+VSIT+ GHSLG ALAT+NA 
Sbjct  175   QGFHSIYTAKSASSSFNKTSARDQVLSEVKKQLDKHKGEDVSITITGHSLGGALATINAT  234

Query  722   DIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             DIA NG N     KS PVT   +A+P+ GD  +K   D+T +  ++ +RNVPDIVP+VP 
Sbjct  235   DIAYNGLN-----KSRPVTAITFAAPQVGDRRYKEVLDSTKDCRVLSVRNVPDIVPRVPG  289

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEP-YLHGIAGTKGAGLLDGFELVV  366
             A    GY +VGVE  I+ T++   + PGD  + HLLE  YLH IA  +            
Sbjct  290   AA--AGYKNVGVEYKINSTRAPDTRAPGDPLTGHLLESAYLHTIATARPG--------KN  339

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              RDI+LVNK  D LK E+ +PG WW EKN G VQ++DGSW + D++
Sbjct  340   KRDINLVNKDSDMLKPEFKVPGFWWGEKNGGFVQRNDGSWAMDDHQ  385



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 191/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  906
             W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F        P+V
Sbjct  114   WLGYIAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRV  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ +LY+S +P S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  174   ANGWLSLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSA  233

Query  725   IDIAKN---GTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D   N       +   +   VT F + SPR GD +FK   ++  +LH++R+ NVPD++P
Sbjct  234   ADFLHNELPKITPSLQHRLTCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             +     P+  +TDVG EL I+  KS Y+K   +L  +H LE YLHG+AGT+       F+
Sbjct  294   RY----PVFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFK  347

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             L + RDI+LVNK LD L+++Y +PG+WW+ +NKGMVQ DDG+WKL
Sbjct  348   LEIKRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL  392



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 183/289 (63%), Gaps = 20/289 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  + GA   P   R 
Sbjct  108   WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAFASAARVLGAATGPN-RRC  166

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
                 Y S+            +QVL E+ RL++ YK+E+ SITV GHSLGA LATLNA+DI
Sbjct  167   TAVQYRSK----------LAEQVLTEIARLMDKYKDEQTSITVVGHSLGATLATLNAVDI  216

Query  716   AKNGTNTT---SAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             A N  N +   +AG   PVT  V+ SPRTGDH+F++ +   P L ++R+RN PD +P  P
Sbjct  217   AANYYNKSALCTAGSRAPVTAVVFGSPRTGDHDFRDIFHRLPGLRMLRVRNRPDRIPLYP  276

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
             P    +GY DVGVEL ID  +S ++KP G+ +  H LE +LHG+AG +G      FELVV
Sbjct  277   P----VGYADVGVELLIDTRRSPFLKPHGNESQSHDLECHLHGVAGWQGEH--GEFELVV  330

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGY  219
             DRDI+LVNK  D L +E+ +P  W +  NK MV+  DG W L D+E  Y
Sbjct  331   DRDIALVNKFDDCLTDEHPVPVGWKVHHNKNMVKGPDGRWVLEDHESDY  379



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 182/287 (63%), Gaps = 38/287 (13%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAV  D+G    G +   V                                Q+H+G
Sbjct  145   WMGYVAVTDDQGTAIFGEKYNQV--------------------------------QIHQG  172

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             ++++Y SE+  S FN  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGAALATLNA DI
Sbjct  173   WHSIYMSEDERSHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDI  232

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               NG N   +  GKS PVT FV+ASPR G+  +K  +    ++ ++R+RN+PD+VP  PP
Sbjct  233   VANGYNRPKSRPGKSCPVTAFVFASPRVGNSEYKKLFSRLEDIRVLRVRNLPDVVPIYPP  292

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                 +GY +VG EL ID  KS Y+K PG+ A++H LE YLHG+AGT+G    D F L V 
Sbjct  293   ----LGYAEVGDELPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSGDLFRLDVK  348

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEG  222
             R I LVNK +D LK+EY +PG+W + KNKGMVQQDDGSW LLD+E G
Sbjct  349   RAIGLVNKSVDGLKDEYMVPGHWRVLKNKGMVQQDDGSWILLDHETG  395



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L PA  +F    A A+P++
Sbjct  114   WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVKDAKANPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y++ +  S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLGA ++ L+A
Sbjct  174   GSGWLDIYTASDSRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSA  233

Query  725   IDIA---KNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D      N TN +   K  P+T F + SPR GD +FK   D+   ++++RI NVPD+ P
Sbjct  234   ADFVYGKNNKTNISLPKKQVPITVFAFGSPRIGDQDFKKIVDSLQQINILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKG-AGLLDGF  378
                   PL+ Y ++G  L I+   S Y+K   +  ++H LE YLHG+AG K  AG+   F
Sbjct  294   HY----PLLLYAEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMKDTAGV---F  346

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +L + RDISLVNK LD LK+EY +P  W    NKGMVQ DDG+WKL
Sbjct  347   KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMVQMDDGTWKL  392



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 190/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  906
             W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F        P+V
Sbjct  123   WLGYIAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRV  182

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ +LY+S +P S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  183   ANGWLSLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSA  242

Query  725   IDIAKN---GTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D   N       +   +   VT F   SPR GD +FK   ++  +LH++R+ NVPD++P
Sbjct  243   ADFLHNELPKIRPSLQHRLTCVTVFALGSPRIGDRSFKRLVESLQHLHILRVTNVPDLIP  302

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             +     P+  +TDVG EL I+  KS Y+K   +L  +H LE YLHG+AGT+       F+
Sbjct  303   RY----PVFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFK  356

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             L + RDI+LVNK LD L+++Y +PG+WW+ +NKGMVQ DDG+WKL
Sbjct  357   LEIKRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL  401



>gb|KDP46903.1| hypothetical protein JCGZ_24112 [Jatropha curcas]
Length=402

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 195/299 (65%), Gaps = 16/299 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GAGASPQVHR  900
             W  YVA ATD+GK  LGRRDI+V WRGTI   E ++DLEF+ +PA +IF      P +H 
Sbjct  112   WCAYVAGATDDGKKKLGRRDIVVSWRGTILPGEKLNDLEFIPIPASDIFPNNNNDPLIHF  171

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             GF+ +Y++EN +S +N KSARDQVL  V +LV+ YK+EEVSITV GHSLG+ALATLNA+D
Sbjct  172   GFHRIYTTENDNSIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMD  231

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I   G N  T +A KSFPVT  V+ASP  G+  FK  +D   ++H++R+ N  D VP++P
Sbjct  232   IVYKGINKPTGTANKSFPVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENANDPVPKLP  291

Query  545   PATPLI---GYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             P   LI    Y  VG  L ID T S ++K      + H L  YLHG+AGT+G+    GF 
Sbjct  292   PNDILIPQHRYYHVGESLPIDTTLSPFLKTSD--VNPHDLNVYLHGVAGTQGSK--GGFN  347

Query  374   LVVDRDISLVNKLLDYLKEE--YCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             L    D +L+NK +D L E+  Y IP NWW+E+N GMV QDDG++K     E Y+P  P
Sbjct  348   LDYPLDTALINKTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTYK----AEFYIPDAP  402



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L PA  +F       +P++
Sbjct  114   WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y++ +  S ++  SA++QV GE+KRL+ELYK+EE+SIT  GHSLGA ++ L+A
Sbjct  174   GSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSA  233

Query  725   IDIA---KNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+    KN  N     K  P+T F + SPR GDHNFKN  D+   L+++RI NVPD+ P
Sbjct  234   ADLVYGKKNNININLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG-F  378
                   PL+ Y+++G  L I+   S Y+K   +  ++H LE YLHG+AG +     DG F
Sbjct  294   HY----PLLLYSEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDT---DGVF  346

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +L + RDISLVNK LD LK+EY +P  W    NKGM+Q DDG+WKL
Sbjct  347   KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMLQMDDGTWKL  392



>emb|CDY34061.1| BnaC03g62710D [Brassica napus]
Length=402

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 183/289 (63%), Gaps = 45/289 (16%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+GYVAV  D+G  ALGRRDII                                   H+G
Sbjct  144   WIGYVAVTDDQGTAALGRRDII-----------------------------------HQG  168

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             +Y++Y S++  S FN  +ARDQVL E+ RL+E YK+E++SI++CGHSLGAA+ATLNA DI
Sbjct  169   WYSIYMSKDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADI  228

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLM----RIRNVPDIVP  555
               NG N   +   KS PVT FV+ASP  GD +FK  +     L++      I N+PD+VP
Sbjct  229   VANGYNRPKSRPDKSCPVTAFVFASPHVGDSDFKKLFSGYVLLNIYIYNSFILNLPDVVP  288

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
               PP    +GY +VG EL ID  KS Y+K PGDLA++H LE YLHG+AGT+G    D F 
Sbjct  289   IYPP----LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEAYLHGLAGTQGTSKADLFR  344

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             LVV RDI LVNK +D LK+EY +PG+W I KNKGMVQQ DGSWKL+D+E
Sbjct  345   LVVKRDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQKDGSWKLMDHE  393



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L PA  +F       +P++
Sbjct  114   WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y++ +  S ++  SA++QV GE+KRL+ELYK+EE+SIT  GHSLGA ++ L+A
Sbjct  174   GSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSA  233

Query  725   IDIA---KNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+    KN  N     K  P+T F + SPR GDHNFKN  D+   L+++RI NVPD+ P
Sbjct  234   ADLVYGKKNNININLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDG-F  378
                   PL+ Y+++G  L I+   S Y+K   +  ++H LE YLHG+AG +     DG F
Sbjct  294   HY----PLLLYSEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDT---DGVF  346

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +L + RDISLVNK LD LK+EY +P  W    NKGM+Q DDG+WKL
Sbjct  347   KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMLQMDDGTWKL  392



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/284 (49%), Positives = 195/284 (69%), Gaps = 11/284 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GAGAS--PQV  906
             W+GY+AVATDEGK  LGRR I+V WRGTI+  EW +D +F L  A  +F GA  +  P+V
Sbjct  114   WLGYIAVATDEGKKLLGRRGIVVAWRGTIQLYEWANDFDFPLESAVMVFPGANPNDEPRV  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ +LY+S +P S F+  SA++QV  E+KRL+ELYKNE+V+IT+ GHSLGA ++ L+A
Sbjct  174   ANGWLSLYTSTDPRSRFDKTSAQEQVQEELKRLLELYKNEDVTITLTGHSLGAVMSILSA  233

Query  725   IDIAKNG--TNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
              D   N     T S   S  VT F + SP+ GD +FK   ++  +LH++R+ NVPD++P+
Sbjct  234   ADFLHNEWPKITPSLQHSLCVTVFAFGSPQIGDRSFKRLVESLEHLHILRVTNVPDLIPR  293

Query  551   VPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL  372
                  P+  +TD+G EL I+  KS Y+K   +L  +H LE YLHG+AGT+       F+L
Sbjct  294   Y----PVFRFTDIGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFKL  347

Query  371   VVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              ++RDI+LVNK LD L+++Y +PG+WW+ +NKGMVQ DDG+WKL
Sbjct  348   EINRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL  391



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 191/286 (67%), Gaps = 13/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  915
             W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F           
Sbjct  114   WLGYIAVATDEGKKLLGRRDIVVAWRGTIQLYEWANDFDFPLELAVSVFPRIDPNDPNDP  173

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P+V  G+ +LY+S +P S F+  SAR+QV GE+KRL+ LYK+EEVSIT+ GHSLGA L+ 
Sbjct  174   PRVANGWLSLYTSTDPRSRFDKTSAREQVQGELKRLLALYKDEEVSITLTGHSLGAVLSI  233

Query  734   LNAIDIAKNG-TNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
             L+A D  +N         K   VT F + SPR GD NFK   ++   L+++RI NVPD++
Sbjct  234   LSAADFLQNEWPKIPPQNKVSCVTVFAFGSPRIGDLNFKRLVESFKPLNILRIANVPDLI  293

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P+     P+  +TDVG EL I+  KS Y+K   +L  +H LE YLHG+AGT+       F
Sbjct  294   PRY----PVFRFTDVGEELQINTLKSEYLKRSLNLKHFHNLEAYLHGVAGTQHNQ--TEF  347

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +L ++RDI+LVNK LD L+++Y +PGNWW+ +NKGM+Q+ DG+WKL
Sbjct  348   KLEINRDIALVNKGLDALQDKYLVPGNWWVLENKGMIQKADGTWKL  393



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/285 (51%), Positives = 181/285 (64%), Gaps = 24/285 (8%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             WMGYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  +  Q+H G
Sbjct  114   WMGYVAVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FY+LY+S+N        SAR QVL E+ RLVELYKNEE+SITV GHSLG ALAT++++DI
Sbjct  174   FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  233

Query  716   AKNGTNTTSA--GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
               N  N       K+ PVT F + SPR G+ NF+  +    +L  + IRN  DIVP    
Sbjct  234   VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVPS---  290

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                           ++ +  S Y+K      S H +E YLHGIAGT+G+    GF L V+
Sbjct  291   --------------SLRLAYSKYLKSG---VSEHNMEVYLHGIAGTQGSK--GGFNLEVN  331

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
             RDI+L+NK  D LK+EY IP NW + +NKGMVQQ DG+WKL+D+ 
Sbjct  332   RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDDH  376



>ref|XP_002438517.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
 gb|EER89884.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
Length=396

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 193/291 (66%), Gaps = 19/291 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDL-EFLLVPAPEIFGAGASPQ---  909
             WMGYVAVATDEG  ALGRRDI+V WRG+    EW  D+ EF+  PA  + G+ A+     
Sbjct  115   WMGYVAVATDEGVAALGRRDIVVAWRGSATDAEWAKDIIEFVPAPAESVLGSAAAAYPSA  174

Query  908   -VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNE--EVSITVCGHSLGAALA  738
              VH GF +LY++ N DS     SARDQVL EV RLVELYK+E  E+SITV GHSLGAAL+
Sbjct  175   YVHSGFLSLYTTSNADSELGKTSARDQVLQEVSRLVELYKDEDQEMSITVVGHSLGAALS  234

Query  737   TLNAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
              LNA+D+  NG N      S PV   V+A P  G+++FK+A+D+  +L  + ++N  D+V
Sbjct  235   ILNAVDLVSNGVNN-----SCPVAAVVFACPHVGNNSFKDAFDSFDDLKALHVKNKIDLV  289

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             PQ+    P     D+GV L ID + S Y+K P + A  H LE YLHG+AG +G+    GF
Sbjct  290   PQLMDWLP-----DLGVTLPIDTSLSPYLKDPKNTA--HELECYLHGVAGVQGSDAGGGF  342

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +LVVDRD++L+N+ +D LK+E+ +P +WW+ ++K MV+   G W+L D E+
Sbjct  343   DLVVDRDVALLNRSVDALKDEHPVPASWWVAEHKSMVKNAKGKWELKDFEQ  393



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 182/288 (63%), Gaps = 11/288 (4%)
 Frame = -2

Query  1073  MGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRGF  894
             M YVAVATD+GK ALGRRDI+V WRGT+   EW+ DL+F  V A +I G    P+VH G+
Sbjct  110   MAYVAVATDDGKAALGRRDILVSWRGTMLDPEWIKDLDFASVSASKILGTANDPKVHNGW  169

Query  893   YNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDIA  714
             Y+LY+  NPDS     SARDQ++ E+K+ V  YK+E++SIT  GHS+GAA+ TLNA DI 
Sbjct  170   YSLYTGTNPDSPLTSISARDQIINEIKKQVAAYKDEDLSITFVGHSMGAAIVTLNATDIV  229

Query  713   KNGTNT--TSAGKSFPVTGFVYASPRTGDHNFKNAYDAT--PNLHLMRIRNVPDIVPQVP  546
              NG N       K+ PVT F  A PR GD  F   +      NLH++RI N  DIVP+ P
Sbjct  230   FNGFNKLPDKPDKAIPVTAFCIACPRIGDEGFSKVFTGLIGSNLHVLRINNYLDIVPKYP  289

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFEL-V  369
             P   L  Y+DVG EL +D  +S Y+K    L + H LE +LH +AG +G      F+L  
Sbjct  290   PGYYL--YSDVGQELVVDSLESPYLKKA--LLTLHSLEVHLHTVAGYQGPD--KEFDLKA  343

Query  368   VDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             + RD   +NK  DYL +EY +   WW EKNK M+Q DDG+W+L D+EE
Sbjct  344   IARDKVFLNKYGDYLDDEYRVVAEWWTEKNKSMIQNDDGTWELKDSEE  391



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 191/288 (66%), Gaps = 15/288 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  915
             W+GY AV+TDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F           
Sbjct  114   WLGYTAVSTDEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDP  173

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P++  G+ +LY++ N  S F+  SA++QV GE+KRL+ELYK+EE+SIT  GHSLGA L+ 
Sbjct  174   PRIANGWLSLYTTSNTHSRFDKTSAKEQVQGELKRLLELYKHEEISITFTGHSLGAVLSI  233

Query  734   LNAIDIAKNG--TNTTSAGKSFP-VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPD  564
             L+A D   N     TTS G +   VT F + SPR GD NF+   ++   L+++RI NVPD
Sbjct  234   LSATDFLHNEWPKTTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPD  293

Query  563   IVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             ++P      P+  +TDVG EL I+  KS Y+K   +LA +H LE YLHG+AGT+      
Sbjct  294   LIPHY----PVFRFTDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQA--  347

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              F+L ++RDI+LVNK LD L+++Y +PG+WW+ +N+GMVQ DDG+W L
Sbjct  348   EFKLEINRDIALVNKELDALQDKYLVPGHWWVLENRGMVQADDGTWIL  395



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 185/298 (62%), Gaps = 15/298 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             ++G+VAV+TDEGK  LGRRDIIVCWRGT   +EW  D+    VPA +IF   +   VH G
Sbjct  104   FVGFVAVSTDEGKLVLGRRDIIVCWRGTTLPIEWFQDILCDQVPATDIF-PDSEALVHNG  162

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY----KNEEVSITVCGHSLGAALATLN  729
             FYN+Y++++  S +N  S R+QVL  V+RLV+ +     NE VSITV GHSLGAALATLN
Sbjct  163   FYNMYTAKDSTSTYNKMSVREQVLAAVRRLVDKHYEAGSNEVVSITVIGHSLGAALATLN  222

Query  728   AIDIAKNGTNT-TSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQ  552
             A+DI  N  N  T +    PV  FV+ SPR GD  F + +    NLHL+RIRN  D +P+
Sbjct  223   AVDIVANEYNRPTGSTVELPVASFVFGSPRVGDKGFLDVFSGLKNLHLLRIRNAQDFIPE  282

Query  551   VPPATPL-IGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             +PP   L   Y DVG EL ID + S Y+K        H L  Y HGI+G +G      F+
Sbjct  283   LPPKKILGYSYADVGAELDIDTSLSPYIK-KATFMEPHDLNLYCHGISGYQGKDR--KFK  339

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIE-KNKGMVQQDDGSWKLLDNEEGYVPLPP  204
             L VD D++LVNK  D L E+Y +P  WW    NKGM Q DDGSWKL D    YVP PP
Sbjct  340   LAVDFDLALVNKYNDLLLEDYKVPPKWWSNVMNKGMAQMDDGSWKLHD----YVPDPP  393



>ref|XP_006469038.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-IIbeta-like 
[Citrus sinensis]
Length=395

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 186/286 (65%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             W+ Y+AVAT EGKTALG RD+++ WRGT++T EW  D +F  VPA E+F    S +VHRG
Sbjct  114   WIRYIAVATHEGKTALGGRDMLITWRGTVQTYEWAXDFKFSPVPASEVFPKATSVKVHRG  173

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGAALATLNAI  723
             + ++Y S +       K AR+QVL EV+RL+ +Y  + EEVS T+  H++GAAL+ LNA 
Sbjct  174   WLSVYCSSDE------KCAREQVLDEVERLLGVYDAEEEEVSKTITSHTIGAALSLLNAA  227

Query  722   DIAKNGTNTTSA-GKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             DI  NG        +   VT F + SP  GD  FK   D+  +LH++R+RN+ D +P  P
Sbjct  228   DIVVNGFQQAEGFSQXIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYP  287

Query  545   PATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVV  366
                 L GY  V  EL I+  KS Y+K PG+L SWH +E YLHGIA T+G+    GF+L V
Sbjct  288   ---LLXGYCGVDAELVINTQKSEYLKXPGELRSWHCMEVYLHGIARTQGSK--GGFKLEV  342

Query  365   DRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNE  228
              +DI+LVNK +D LKE+Y +PG W   +N GMVQ +DG+WKL D+E
Sbjct  343   KQDIALVNKRMDILKEDYLVPGKWSCLENTGMVQGEDGNWKLEDHE  388



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 191/297 (64%), Gaps = 17/297 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GAGASPQVHR  900
             W  YVAVATD+GK  LGRRDI+V WRGTI   E + D+EF+ +PA ++F      P +H 
Sbjct  112   WCAYVAVATDDGKKKLGRRDIVVSWRGTILPGEKLEDVEFIPIPASDMFPNNNNDPLIHS  171

Query  899   GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAID  720
             GF+ +Y++E  +S +N KSARDQVL  V +LV+ YK+EEVSITV GHSLG+ALATLNA+D
Sbjct  172   GFHQIYTTEKDNSIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMD  231

Query  719   IAKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVP  546
             I   G N  T +A KSFPVT  V+ASP  G+  FK  +D   ++H++R+ N  D VP +P
Sbjct  232   IVYKGINKPTGTANKSFPVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENAKDPVPTLP  291

Query  545   P----ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P      P   Y  VG  L ID T S ++K      + H L  YLHG+AGT+G+    GF
Sbjct  292   PNKLIVIPQHRYYHVGESLPIDTTLSPFLKTSD--VNPHDLNVYLHGVAGTQGSK--GGF  347

Query  377   ELVVDRDISLVNKLLDYLKEE--YCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVP  213
              L    D +L+NK +D L E+  Y IP NWW+E+N GMV QDDG++K     E Y+P
Sbjct  348   NLDYPLDTALINKTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTYK----AEFYIP  400



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 190/288 (66%), Gaps = 15/288 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  915
             W+GY AV+TDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F           
Sbjct  114   WLGYTAVSTDEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDP  173

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P++  G+ +LY++ N  S F+  SA++QV GE+KRL+ELYK EE+SIT  GHSLGA L+ 
Sbjct  174   PRIANGWLSLYTTSNTHSRFDKTSAQEQVQGELKRLLELYKQEEISITFTGHSLGAVLSI  233

Query  734   LNAIDIAKNG--TNTTSAGKSFP-VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPD  564
             L+A D   N     TTS G +   VT F + SPR GD NF+   ++   L+++RI NVPD
Sbjct  234   LSATDFLHNEWPKTTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPD  293

Query  563   IVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             ++P      P+  +TDVG EL I+  KS Y+K   +LA +H LE YLHG+AGT+      
Sbjct  294   LIPHY----PVFRFTDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQA--  347

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              F+L ++RDI+LVNK LD L+++Y +PG+WW+ +N+GMVQ DDG+W L
Sbjct  348   EFKLEINRDIALVNKELDALQDKYLVPGHWWVLENRGMVQADDGTWIL  395



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 190/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  906
             W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F        P+V
Sbjct  114   WLGYIAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRV  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ +LY+S +P S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  174   ANGWLSLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSA  233

Query  725   IDIAKN---GTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D   N       +   +   VT F + SPR GD +FK   ++  +LH++R+ NVPD++P
Sbjct  234   ADFLHNEFPKITPSLQQRLSCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             +     P+  +TDVG EL I+  KS Y+K   +L  +H LE YLHG+AGT+       F+
Sbjct  294   RY----PVFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFK  347

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             L + RDI+LVNK LD L+++Y +PG+ W+ +NKGMVQ DDG+WKL
Sbjct  348   LEIKRDIALVNKGLDALEDKYLVPGHGWVLENKGMVQSDDGTWKL  392



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 193/288 (67%), Gaps = 15/288 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  915
             W+GY+AVATD+GK  LGRRDI+V WRGTI+  EW +D +F L PA  +F           
Sbjct  114   WLGYIAVATDQGKELLGRRDIVVAWRGTIQLYEWANDFDFPLEPAISVFPKTDPNDPSDP  173

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P++  G+ +LY++ +P S F+  SA++QV GE+KRL+ELYK+EEV+IT+ GHSLGA L+ 
Sbjct  174   PRIANGWLSLYTTADPRSRFDKTSAQEQVQGELKRLLELYKDEEVTITLTGHSLGAVLSI  233

Query  734   LNAIDIAKN---GTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPD  564
             L+A D   N    T T+   +   VT F + SPR GD NFK   ++   L+++RI NVPD
Sbjct  234   LSATDFLHNEWPKTTTSLQDRLSCVTVFAFGSPRIGDLNFKRLVESLKKLNILRISNVPD  293

Query  563   IVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             ++P+     P+  + D+G EL I+  KS Y+K   ++  +H LE YLHG+AGT+      
Sbjct  294   LIPRY----PVFRFADIGEELQINTLKSEYLKRSLNIKHFHNLEAYLHGVAGTQQNQ--G  347

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              F+L ++RDI+LVNK LD L+++Y +P +WW+ +NKGMVQ+DDG+W L
Sbjct  348   EFKLEINRDIALVNKGLDALEDKYLVPDHWWVLENKGMVQRDDGTWML  395



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/285 (47%), Positives = 190/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             W+GYVAVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F       +P++
Sbjct  114   WLGYVAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLETAETVFPQANPNDTPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ +LY+S +  S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  174   ANGWLSLYTSTDQRSRFDKTSAREQVQGELNRLLELYKDEEVTITITGHSLGAVLSILSA  233

Query  725   IDIAKNGT---NTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D   N +     +   +   VT F + SPR GD +FK   ++  +LH++R+ NVPD++P
Sbjct  234   ADFLYNESLKIRPSLQHRLSCVTVFAFGSPRIGDRSFKRLVESLEHLHILRVTNVPDLIP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
                   P+  +TDVG +L I+  KS Y+K   +L  +H LE YLHG+AGT+       F+
Sbjct  294   HY----PVFRFTDVGEDLQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHDQ--GEFK  347

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             L ++RDI+LVNK LD L ++Y +PG+WW+ +NK MVQ DDG+WKL
Sbjct  348   LEINRDIALVNKGLDALDDKYLVPGHWWVLENKRMVQSDDGTWKL  392



>gb|KDP21071.1| hypothetical protein JCGZ_21542 [Jatropha curcas]
Length=407

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/298 (47%), Positives = 193/298 (65%), Gaps = 16/298 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             + G+VAV TDEGK   GRRDI+VCWRGT  T+EW  D + +     ++F      +VH G
Sbjct  104   YFGFVAVTTDEGKIVTGRRDIVVCWRGTSFTIEWFKDFDHIFTSGSDLF-PDTDAKVHNG  162

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRL--VELYKNEEVSITVCGHSLGAALATLNAI  723
             F+++Y++   DS +N +SAR+QVL   +R    ++   E+VSIT+ GHSLG+ALATLNA+
Sbjct  163   FHSVYTTSKSDSTYNKRSAREQVLAAARRNGDKDVALKEDVSITITGHSLGSALATLNAM  222

Query  722   DIAKNGTNTTSAGKS-FPVTGFVYASPRTGDHNFKNAYDATPN---LHLMRIRNVPDIVP  555
             DIA NG N  S   + +PVT FV+ASPR G+  F++ ++   +   LHL+RIRN  DIVP
Sbjct  223   DIAFNGYNKPSGSDTGYPVTAFVFASPRVGNKEFQDVFNGLQDAGTLHLLRIRNYNDIVP  282

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
             ++PP      Y DVGVEL +D TKS Y+K    +   H L  Y+HG+AG +G    + F+
Sbjct  283   ELPPKILDFTYEDVGVELYLDTTKSPYIKGES-ITEAHDLNLYMHGVAGYQGN---EDFK  338

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEK-NKGMVQQDDGSWKLLDNEEGYVPLPP  204
             LV++ DI+L+NK  D LK+ Y +P NWW     +GM+Q DDG+WKL D    YVP PP
Sbjct  339   LVINLDIALLNKYNDLLKDSYGVPPNWWSNVFRQGMIQFDDGTWKLND----YVPDPP  392



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 188/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLL---VPAPEIFGAGASPQV  906
             W+GYVAVATDEGK  LGRRDI+V WRGT++  EW +D +F L   V    +F +   P++
Sbjct  152   WIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRI  211

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y+S +  S ++  SAR+QV GE+KRL+++YKNEEVSIT  GHSLG  ++TL A
Sbjct  212   GSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAA  271

Query  725   IDIAKNGTNTTSAG---KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+     NT S+G   K  P+T F +  PR GD +F    D+   L+++RI NVPD+ P
Sbjct  272   ADLVNGKKNTISSGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAP  331

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTK-GAGLLDGF  378
                   PL+ Y +VG EL I+   S Y+K   +  ++H LE YLHG+AG +  AGL   F
Sbjct  332   HY----PLLLYAEVGQELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGL---F  384

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +LV+ RDISLVNK LD LK+E+ +P  W    NKGMVQ+DDG+W+L
Sbjct  385   KLVIGRDISLVNKGLDALKDEFLVPSTWRCLANKGMVQKDDGTWQL  430



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 188/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             W+GYVAVATDEGK  LGRRDI+V WRGT++  EW +D +F L    ++F    +   P++
Sbjct  114   WIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVIDSKIVPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y+S +  S ++  SAR+QV GE+KRL+++YKNEEVSIT  GHSLG  ++TL A
Sbjct  174   GSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAA  233

Query  725   IDIAKNGTNTTSAG---KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+     NT S+G   K  P+T F +  PR GD +F    D+   L+++RI NVPD+ P
Sbjct  234   ADLVNGKKNTISSGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTK-GAGLLDGF  378
                   PL+ Y +VG EL I+   S Y+K   +  ++H LE YLHG+AG +  AGL   F
Sbjct  294   HY----PLLLYAEVGQELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGL---F  346

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +LV+ RDISLVNK LD LK+E+ +P  W    NKGMVQ+DDG+W+L
Sbjct  347   KLVIGRDISLVNKGLDALKDEFLVPSTWRCLANKGMVQKDDGTWQL  392



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score =   261 bits (668),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 189/288 (66%), Gaps = 15/288 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA------GAS  915
             W+GY AVATDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F +         
Sbjct  114   WLGYTAVATDEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPSTDPNDPNDP  173

Query  914   PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALAT  735
             P++  G+ +LY++ N  S F+  SA++QV GE+KRL+ELYK+EEVSIT  GHSLGA L+ 
Sbjct  174   PRIANGWLSLYTTSNTHSRFDKTSAQEQVQGELKRLLELYKHEEVSITFTGHSLGAVLSI  233

Query  734   LNAIDIAKNG--TNTTSAGKSFP-VTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPD  564
             L+A D   N     TTS G     VT F + SPR GD NF+   ++   L+++RI NVPD
Sbjct  234   LSATDFLHNEWPKTTTSLGDRLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPD  293

Query  563   IVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLD  384
             ++P      P+  + DVG EL I+  KS Y+K   +LA +H LE YLHG+AGT+      
Sbjct  294   LIPHY----PVFRFRDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQA--  347

Query  383   GFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              F+L ++RDI+LVNK LD L+++Y +P +WW+ +N+GMVQ DDG+W L
Sbjct  348   EFKLEINRDIALVNKELDALQDKYLVPSHWWVVENRGMVQADDGTWIL  395



>ref|XP_002488949.1| hypothetical protein SORBIDRAFT_1306s002010 [Sorghum bicolor]
 gb|EES20262.1| hypothetical protein SORBIDRAFT_1306s002010 [Sorghum bicolor]
Length=396

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 191/291 (66%), Gaps = 19/291 (7%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDL-EFLLVPAPEIFGAGASPQ---  909
             WMGYVAVATDEG  ALGRRDI+V WRG+    EW  D+ EF+  PA  + G+ A+     
Sbjct  115   WMGYVAVATDEGVAALGRRDIVVAWRGSATRAEWAKDIFEFVPAPAESVLGSAAAAYPSA  174

Query  908   -VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNE--EVSITVCGHSLGAALA  738
              VH GF +LY++ N DS     SARDQVL EV RLVELYK+E  E+SITV GHSLGAAL+
Sbjct  175   YVHSGFLSLYTTSNADSELGKTSARDQVLQEVSRLVELYKDEDQEMSITVVGHSLGAALS  234

Query  737   TLNAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
              LNA+D+  NG N      S PV   V+A P  G+++FK+A+D+  +L  + ++N  D+V
Sbjct  235   ILNAVDLVSNGVNN-----SCPVAAVVFACPHVGNNSFKDAFDSFDDLKALHVKNKIDLV  289

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGF  378
             P +    P     D+GV L ID + S Y+K P + A  H LE YLHG+AG +G+    GF
Sbjct  290   PLLMDWLP-----DLGVTLPIDTSLSPYLKDPQNTA--HELECYLHGVAGVQGSDAGGGF  342

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +LVVDRD++L+N+  D LK+E+ +P +WW+ ++K MV+   G W+L D E+
Sbjct  343   DLVVDRDVALLNRSADALKDEHPVPASWWVAEHKSMVKNAKGKWELKDFEQ  393



>ref|XP_002465238.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
 gb|EER92236.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
Length=423

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 191/303 (63%), Gaps = 23/303 (8%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG   LGRRD++V WRGT+R+LEWV+DL+F  VPA  + GA A       
Sbjct  124   WMGYVAVATDEGAAELGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGAAADTHPRAM  183

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLN  729
             VHRGF +LY+S N  S +N  SARDQVL E++RL+ELYK+EE SIT+ GHSLGA+LATLN
Sbjct  184   VHRGFLSLYTSSNASSKYNKLSARDQVLEEIRRLMELYKHEETSITITGHSLGASLATLN  243

Query  728   AIDIAKNGTNT-----------TSAGKSFPVTGFVYASPRTGDHNFKNAYDAT-PNLHLM  585
             A+DI  NG N+           +S+ +  PVT  V+ASP  G   FK A+ +    L  +
Sbjct  244   AVDIVANGLNSPAAAAGGHSSSSSSAQPAPVTAIVFASPHVGGPFFKAAFASFGEQLRAL  303

Query  584   RIRNVPDIVPQVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLH---GI  414
              ++N  D+VP  PP    +GY DV V L I   +S +++ PG   + H LE YLH   G 
Sbjct  304   HVKNQGDVVPLYPP----LGYVDVAVPLPIHTARSPWLRQPGTPQTLHNLECYLHGVAGE  359

Query  413   AGTKGAGLLDGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLD  234
              G  GA    GF L VDRD++LVNK  D L++EY +P  W +  NKGMV+  DG W L D
Sbjct  360   QGGGGADDGGGFRLEVDRDVALVNKAADALRDEYPVPVKWRVALNKGMVRGADGRWVLKD  419

Query  233   NEE  225
              E 
Sbjct  420   FEH  422



>ref|XP_009401938.1| PREDICTED: phospholipase A1-II 5 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 189/301 (63%), Gaps = 17/301 (6%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-------  918
             WMGYVAV+TD    A GRR+I V WRGTIRTLEWV  LE  L+P   I  +         
Sbjct  115   WMGYVAVSTDAAARATGRREIYVAWRGTIRTLEWVDVLEPELLPVDSILSSKKEATAEEE  174

Query  917   SPQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALA  738
              P+V +G++ +Y+S NP+S++N +SAR+Q++ ++K LVE+YK+E +SI   GHSLGAALA
Sbjct  175   KPKVMKGWFVIYTSSNPNSSYNTQSAREQLVAKIKELVEVYKDESLSIVCVGHSLGAALA  234

Query  737   TLNAIDIAKNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIV  558
              L+A DI +NG +     + FPV   V+ SP+ G+  F +  +  PNL ++ +RN  D++
Sbjct  235   ILSAFDIVENGLSKVGDKEEFPVCAMVFGSPQIGNKAFNDRLEKLPNLRVLHVRNKIDLI  294

Query  557   PQVPPATPLIGYTDVGVELTIDVTKSGYVKP---PGDLASWHLLEPYLHGIAGTKGAGLL  387
             P  P    L+G+ + G  L ID  KS Y+K    PGD   WH L+  LH +AG  G    
Sbjct  295   PLYPSG--LLGFVNTGTVLEIDTRKSPYLKDSRFPGD---WHNLQGILHVVAGWNGDE--  347

Query  386   DGFELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEEGYVPLP  207
               FEL V R + LVNK  +YLK+EY +PG+WW+EKNKGMV ++DG W L    +   P+P
Sbjct  348   GEFELKVKRSVGLVNKSSEYLKDEYLVPGSWWVEKNKGMVLEEDGEWVLAAPTDEDAPVP  407

Query  206   P  204
             P
Sbjct  408   P  408



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 188/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLL---VPAPEIFGAGASPQV  906
             W+GYVAVATDEGK  LGRRDI+V WRGT++  EW +D +F L   V    +F +   P++
Sbjct  257   WIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRI  316

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y+S +  S ++  SAR+QV GE+KRL+++YKNEEVSIT  GHSLG  ++TL A
Sbjct  317   GSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAA  376

Query  725   IDIAKNGTNTTSAG---KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+     NT SAG   K  P+T F +  PR GD +F    D+   L+++RI NVPD+ P
Sbjct  377   ADLVNGKKNTISAGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAP  436

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTK-GAGLLDGF  378
                   PL+ Y +VG EL I+   S Y+K   +  ++H LE YLHG+AG +  AGL   F
Sbjct  437   HY----PLLLYAEVGQELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGL---F  489

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +LV+ RDISLVNK LD LK+E+ +P  W    NKGMVQ+DDG+W+L
Sbjct  490   KLVIGRDISLVNKGLDALKDEFLVPSTWRCLANKGMVQKDDGTWQL  535



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 185/286 (65%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             WMGY+AVATDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F        P+V
Sbjct  114   WMGYIAVATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVTDPKVVPRV  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y++ + +S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLG  ++TL A
Sbjct  174   GSGWLDVYTASDSNSPYDTTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGGVMSTLAA  233

Query  725   IDIA---KNGTNTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+    KN  NT+      P+T F +  PR GD +FK   D+   L+++RI NVPD+ P
Sbjct  234   ADLVHARKNKNNTSLQRNQVPITVFAFGCPRIGDQDFKKIVDSLQPLNILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKG-AGLLDGF  378
                   PL+ Y +VG  L I+   S Y+K   +  ++H LE YLHGIAG +  AG+   F
Sbjct  294   HY----PLLLYAEVGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDRAGV---F  346

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             +L V RD+SLVNK LD LK+EY +P  W    NKGMVQ DDG+WKL
Sbjct  347   KLEVGRDVSLVNKGLDALKDEYLVPSTWRCLANKGMVQMDDGTWKL  392



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 186/286 (65%), Gaps = 14/286 (5%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             WMGY+AVATDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F        P++
Sbjct  114   WMGYIAVATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAASVFPVTDPKDVPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y++ + +S ++  SA++QV GE+ RL+ELYKNEE+SIT  GHSLG  ++TL A
Sbjct  174   GSGWLDIYTASDSNSPYDTTSAQEQVQGELTRLLELYKNEEISITFTGHSLGGVMSTLAA  233

Query  725   IDIAKNGTNTTSAG---KSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              D+  N  NT + G   K+ P+T F +  PR GD +FK   D+   ++++RI NVPD+ P
Sbjct  234   ADLVHNRKNTINTGLQKKTVPITVFAFGCPRIGDQDFKKLVDSLQQINILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKG-AGLLDGF  378
                   PL+ Y +VG EL I+   S Y+K   +  ++H LE YLHG+AG +  AG+   F
Sbjct  294   HY----PLLLYAEVGEELQINTLNSTYLKRSLNFRNYHNLEIYLHGLAGMQDRAGV---F  346

Query  377   ELVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
              L V RD+SLVNK LD LK+EY +P  W    NKGMVQ DDG+W+L
Sbjct  347   TLQVGRDVSLVNKGLDALKDEYLVPSIWRCLANKGMVQMDDGTWQL  392



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 187/285 (66%), Gaps = 12/285 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  906
             WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L  A  +F       +P++
Sbjct  114   WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDNPRI  173

Query  905   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNA  726
               G+ ++Y++ +P S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLGA ++ L+A
Sbjct  174   GSGWLDIYTASDPRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSA  233

Query  725   IDIA--KNGT-NTTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVP  555
              DI   KN   N +   K  P+T F + SPR GD +FK   D+   L+++RI NVPD+ P
Sbjct  234   ADIVYGKNSNINISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLQPLNILRIVNVPDVAP  293

Query  554   QVPPATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFE  375
                   PL+ Y ++G  L I+   S Y+K   +  ++H LE YLHGIAG + A  +  F+
Sbjct  294   HY----PLLLYAEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDAAGV--FK  347

Query  374   LVVDRDISLVNKLLDYLKEEYCIPGNWWIEKNKGMVQQDDGSWKL  240
             L + RDISLVNK LD LK+EY +P  W    NKGMVQ +DG+WKL
Sbjct  348   LEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMVQMNDGTWKL  392



>gb|KHG20660.1| Phospholipase A1-IIgamma -like protein [Gossypium arboreum]
Length=383

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 182/294 (62%), Gaps = 13/294 (4%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  897
             + GYVAVATDEGK  LGRRDI+V WRGTI   EWVSD       A ++FG G S +VH G
Sbjct  98    YFGYVAVATDEGKVVLGRRDILVSWRGTITISEWVSDANIFRTSAKDLFGTG-SVKVHTG  156

Query  896   FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGAALATLNAIDI  717
             FYN Y + N +S +   SAR Q    VK LV+ Y+NEEVSITV GHSLGAALATLNA+DI
Sbjct  157   FYNTYMNSNANSPYTKTSARQQACKAVKELVDKYQNEEVSITVTGHSLGAALATLNAMDI  216

Query  716   AKNGTN--TTSAGKSFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPP  543
             A NG N  T +  K+F VT F+ ASPR G+  FK   D   N H++RI N  D VP+VP 
Sbjct  217   AHNGFNKPTDNTNKAFMVTCFLAASPRVGNLAFKGVCDRLENFHILRIVNYKDPVPKVPF  276

Query  542   ATPLIGYTDVGVELTIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVD  363
                   Y  VG EL ID TKS Y+K   +  + H LE Y HGIAG +        E  +D
Sbjct  277   GPK---YFHVGEELEIDTTKSPYLK---EKINPHNLEGYQHGIAGMQKDRDFK-LEEELD  329

Query  362   RDISLVNKLLDYLKEEYCIPGNWWIEK-NKGMVQQDDGSWKLLDNEEGYVPLPP  204
              D +++NK  D L ++Y IP NWW ++  K MVQ DDG WK   N+  YVP PP
Sbjct  330   FDNAVINKSSDGLLDKYKIPDNWWTQELFKNMVQTDDGHWKF--NDTAYVPDPP  381



>tpg|DAA45463.1| TPA: hypothetical protein ZEAMMB73_472202 [Zea mays]
Length=448

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 192/332 (58%), Gaps = 54/332 (16%)
 Frame = -2

Query  1076  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  909
             WMGYVAVATDEG  ALGRRD++V WRGT+R+LEWV+DL+F  VPA  + G+ A+      
Sbjct  122   WMGYVAVATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAM  181

Query  908   VHRGFYNLYSSENPDSAFNIKSARDQ------------------------VLGEVKRLVE  801
             VH GF +LY+S N  S +N  SARDQ                        VL EV+RL+E
Sbjct  182   VHGGFLSLYTSSNASSKYNKLSARDQASGSMSMTQFLPSLLLRRNHRFFEVLEEVRRLME  241

Query  800   LYKNEEVSITVCGHSLGAALATLNAIDIAKNGTNTTSAG--------------------K  681
             LYK+EE SI+V GHSLGA+LATLNA+D+  NG N   A                      
Sbjct  242   LYKDEETSISVTGHSLGASLATLNAVDMVANGVNAPGAATATGTSGGSSSSPAQPQPQRA  301

Query  680   SFPVTGFVYASPRTGDHNFKNAYDATPNLHLMRIRNVPDIVPQVPPATPLIGYTDVGVEL  501
               PVT  V+ASPR G   FK A+ +  +L  + +RN  D+VP  PP    +GY DV V L
Sbjct  302   GCPVTAIVFASPRVGGPFFKAAFASFADLRALHVRNKGDVVPLYPP----LGYVDVAVPL  357

Query  500   TIDVTKSGYVKPPGDLASWHLLEPYLHGIAGTKGAGLLDGFELVVDRDISLVNKLLDYLK  321
              I   +S +++ PG   + H LE YLHG+AG +GA    GF L V RD++LVNK  D L+
Sbjct  358   PIHTARSPWLRRPGTPQTLHNLECYLHGVAGEQGAA--GGFRLEVGRDVALVNKGADALR  415

Query  320   EEYCIPGNWWIEKNKGMVQQDDGSWKLLDNEE  225
             +EY +P  W +  NKGMV+  DG W L D E 
Sbjct  416   DEYPVPARWRVALNKGMVRGADGRWALKDFEH  447



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2580415413488